4ZQYA

Ringhalexin from hemachatus haemachatus: a novel inhibitor of extrinsic tenase complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
RLCLSDYSIFSETIEICPEGHNYCFKKFPKGITRLPWVIRGCAATCPKPEAQVYVDCCARDKCNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ringhalexin from Hemachatus haemachatus: A novel inhibitor of extrinsic tenase complex.
pubmed doi rcsb
molecule tags Toxin
molecule keywords Ringhalexin
total genus 11
structure length 65
sequence length 65
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4zqyA00
2QJAC 2I9BE 1NYUA 1FSCA 2CTXA 2MJ4A 1S4YA 1COEA 2LCRA 1LJZA 2QC1A 1HC9B 1MR6A 1IQ9A 1F94A 4LFTA 1CDRA 1NTNA 4RUDA 4UY2C 1LSIA 2UX2A 2QJBC 1ONJA 1TFSA 2HLQA 1H0JA 3NH7A 1LXHA 1CHVS 2ERAA 1RGJA 1RL5A 3U74U 1KL8A 1KS6A 1CDTA 4AEAA 1TGXA 1CTXA 1LXGA 2MFAA 4FAOE 4BDTB 5DU1A 3KFDE 3NEQA 1M9ZA 1KU6B 1IK8A 2H7ZA 2J8BA 1FRAA 2H62D 1HAJA 1CREA 1CDQA 3QB4B 4FAOC 5DZ5A 1KFHA 6EBXA 4BIKB 1ABTA 1QM7A 1FFJA 1CDSA 1JGKA 1MAHF 1TXAA 4DO8A 1JE9A 1NORA 1FF4A 2PJYC 1QKEA 1KTZB 3EBXA 1W6BA 1KBSA 1NXBA 1NYSA 1L4WA 2MUOA 2BHIA 2GOOB 2FD6U 1V6PA 1I02A 4EY8B 1CVOA 2MJYA 4P7UA 5IMTD 1KBTA 1IDIA 2QJ9C 3NDSA 2CCXA 1CCQA 1UG4A 3VTSA 2N99A 2VLWA 4ZQYA 2H5FA 2CRTA 2JVEA 1VB0A 2PJYB 2K3GA 1B41B 2OFSA 1BTEA 1CXOA 1HC9A 1CODA 2H62C 2MUPA 2LA1A 4OM5A 1G6MA 1IDGA 5EBXA 1LX5B 1CB9A 3EVSC 2H7ZB 1IDHA 2H64B 1TXBA 1KC4A 1IDLA 1REWC 2L5SA 1FSSB 5DO6A 1CXNA 3U73U 3KFDI 2BTXA 1ERGA 2X8BB 2GOOC 2MJ0A 4OM4A 1FASA 1QKDA 3PLCA 2L03A 1KBAA 1NTXA 1F8UB 1XT3A 1IKCA 3ERAA 1ES7B 1IJCA 1HOYA 2JQPA 2ABXA 2CRSA 1KXIA 2NBTA 2H8UA 4QTIU 1YWHA 1ERAA 3FEVA 1JBDA 5IMYC 3BT1U 1DRSA 3HH7A 2MHYA 1NEAA 3LAQU 4IYEA 1BXPA 2UWRA 2CDXA 2H64C 1HAAA 1PLOA 1ZADA 4XJJA 1CRFA 4HQPF 3BT2U 2HLRA
chains in the Genus database with same CATH superfamily
2QJAC 2I9BE 1NYUA 1FSCA 2CTXA 2MJ4A 1S4YA 1COEA 2LCRA 1LJZA 2QC1A 1HC9B 1MR6A 1IQ9A 1F94A 4LFTA 1CDRA 1NTNA 4RUDA 4UY2C 1LSIA 2UX2A 2QJBC 1ONJA 1TFSA 2HLQA 1H0JA 3NH7A 1LXHA 1CHVS 2ERAA 1RGJA 1RL5A 3U74U 1KL8A 1KS6A 1CDTA 4AEAA 1TGXA 1CTXA 1LXGA 2MFAA 4FAOE 4BDTB 5DU1A 3KFDE 3NEQA 1M9ZA 1KU6B 1IK8A 2H7ZA 2J8BA 1FRAA 2H62D 1HAJA 1CREA 1CDQA 3QB4B 4FAOC 5DZ5A 1KFHA 6EBXA 4BIKB 1ABTA 1QM7A 1FFJA 1CDSA 1JGKA 1MAHF 1TXAA 4DO8A 1JE9A 1NORA 1FF4A 2PJYC 1QKEA 1KTZB 3EBXA 1W6BA 1KBSA 1NXBA 1NYSA 1L4WA 2MUOA 2BHIA 2GOOB 2FD6U 1V6PA 1I02A 4EY8B 1CVOA 2MJYA 4P7UA 5IMTD 1KBTA 1IDIA 2QJ9C 3NDSA 2CCXA 1CCQA 1UG4A 3VTSA 2N99A 2VLWA 4ZQYA 2H5FA 2CRTA 2JVEA 1VB0A 2PJYB 2K3GA 1B41B 2OFSA 1BTEA 1CXOA 1HC9A 1CODA 2H62C 2MUPA 2LA1A 4OM5A 1G6MA 1IDGA 5EBXA 1LX5B 1CB9A 3EVSC 2H7ZB 1IDHA 2H64B 1TXBA 1KC4A 1IDLA 1REWC 2L5SA 1FSSB 5DO6A 1CXNA 3U73U 3KFDI 2BTXA 1ERGA 2X8BB 2GOOC 2MJ0A 4OM4A 1FASA 1QKDA 3PLCA 2L03A 1KBAA 1NTXA 1F8UB 1XT3A 1IKCA 3ERAA 1ES7B 1IJCA 1HOYA 2JQPA 2ABXA 2CRSA 1KXIA 4KSNA 2NBTA 2H8UA 4QTIU 1YWHA 1ERAA 3FEVA 1JBDA 5IMYC 3BT1U 1DRSA 3HH7A 2MHYA 1NEAA 3LAQU 4IYEA 1BXPA 2UWRA 2CDXA 2H64C 1HAAA 1PLOA 1ZADA 4XJJA 1CRFA 4HQPF 3BT2U 2HLRA
chains in the Genus database with same CATH topology
2QJAC 2I9BE 1NYUA 1FSCA 2CTXA 2MJ4A 1S4YA 1COEA 2LCRA 1LJZA 2QC1A 1HC9B 1MR6A 1IQ9A 1F94A 4LFTA 1CDRA 1NTNA 4RUDA 4UY2C 1LSIA 2UX2A 2QJBC 1ONJA 1TFSA 2HLQA 1H0JA 3NH7A 1LXHA 1CHVS 2ERAA 1RGJA 1RL5A 3U74U 1KL8A 1KS6A 1CDTA 4AEAA 1TGXA 1CTXA 1LXGA 2MFAA 4FAOE 4BDTB 5DU1A 3KFDE 3NEQA 1M9ZA 1KU6B 1IK8A 2H7ZA 2J8BA 1FRAA 2H62D 1HAJA 1CREA 1CDQA 3QB4B 4FAOC 5DZ5A 1KFHA 6EBXA 4BIKB 1ABTA 1QM7A 1FFJA 1CDSA 1JGKA 1MAHF 1TXAA 4DO8A 1JE9A 1NORA 1FF4A 2PJYC 1QKEA 1KTZB 3EBXA 1W6BA 1KBSA 1NXBA 1NYSA 1L4WA 2MUOA 2BHIA 2GOOB 2FD6U 1V6PA 1I02A 4EY8B 1CVOA 2MJYA 4P7UA 5IMTD 1KBTA 1IDIA 2QJ9C 3NDSA 2CCXA 1CCQA 1UG4A 3VTSA 2N99A 2VLWA 4ZQYA 2H5FA 2CRTA 2JVEA 1VB0A 2PJYB 2K3GA 1B41B 2OFSA 1BTEA 1CXOA 1HC9A 1CODA 2H62C 2MUPA 2LA1A 4OM5A 1G6MA 1IDGA 5EBXA 1LX5B 1CB9A 3EVSC 2H7ZB 1IDHA 2H64B 1TXBA 1KC4A 1IDLA 1REWC 2L5SA 1FSSB 5DO6A 1CXNA 3U73U 3KFDI 2BTXA 1ERGA 2X8BB 2GOOC 2MJ0A 4OM4A 1FASA 1QKDA 3PLCA 2L03A 1KBAA 1NTXA 1F8UB 1XT3A 1IKCA 3ERAA 1ES7B 1IJCA 1HOYA 2JQPA 2ABXA 2CRSA 1KXIA 4KSNA 2NBTA 2H8UA 4QTIU 1YWHA 1ERAA 3FEVA 1JBDA 5IMYC 3BT1U 1DRSA 3HH7A 2MHYA 1NEAA 3LAQU 4IYEA 1BXPA 2UWRA 2CDXA 2H64C 1HAAA 1PLOA 1ZADA 4XJJA 1CRFA 4HQPF 3BT2U 2HLRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJA C;  2I9B E;  1NYU A;  1FSC A;  2CTX A;  2MJ4 A;  1S4Y A;  1COE A;  2LCR A;  1LJZ A;  2QC1 A;  1HC9 B;  1MR6 A;  1IQ9 A;  1F94 A;  4LFT A;  1CDR A;  1NTN A;  4RUD A;  4UY2 C;  1LSI A;  2UX2 A;  2QJB C;  1ONJ A;  1TFS A;  2HLQ A;  1H0J A;  3NH7 A;  1LXH A;  1CHV S;  2ERA A;  1RGJ A;  1RL5 A;  3U74 U;  1KL8 A;  1KS6 A;  1CDT A;  4AEA A;  1TGX A;  1CTX A;  1LXG A;  2MFA A;  4FAO E;  4BDT B;  5DU1 A;  3KFD E;  3NEQ A;  1M9Z A;  1KU6 B;  1IK8 A;  2H7Z A;  2J8B A;  1FRA A;  2H62 D;  1HAJ A;  1CRE A;  1CDQ A;  3QB4 B;  4FAO C;  5DZ5 A;  1KFH A;  6EBX A;  4BIK B;  1ABT A;  1QM7 A;  1FFJ A;  1CDS A;  1JGK A;  1MAH F;  1TXA A;  4DO8 A;  1JE9 A;  1NOR A;  1FF4 A;  2PJY C;  1QKE A;  1KTZ B;  3EBX A;  1W6B A;  1KBS A;  1NXB A;  1NYS A;  1L4W A;  2MUO A;  2BHI A;  2GOO B;  2FD6 U;  1V6P A;  1I02 A;  4EY8 B;  1CVO A;  2MJY A;  4P7U A;  5IMT D;  1KBT A;  1IDI A;  2QJ9 C;  3NDS A;  2CCX A;  1CCQ A;  1UG4 A;  3VTS A;  2N99 A;  2VLW A;  4ZQY A;  2H5F A;  2CRT A;  2JVE A;  1VB0 A;  2PJY B;  2K3G A;  1B41 B;  2OFS A;  1BTE A;  1CXO A;  1HC9 A;  1COD A;  2H62 C;  2MUP A;  2LA1 A;  4OM5 A;  1G6M A;  1IDG A;  5EBX A;  1LX5 B;  1CB9 A;  3EVS C;  2H7Z B;  1IDH A;  2H64 B;  1TXB A;  1KC4 A;  1IDL A;  1REW C;  2L5S A;  1FSS B;  5DO6 A;  1CXN A;  3U73 U;  3KFD I;  2BTX A;  1ERG A;  2X8B B;  2GOO C;  2MJ0 A;  4OM4 A;  1FAS A;  1QKD A;  3PLC A;  2L03 A;  1KBA A;  1NTX A;  1F8U B;  1XT3 A;  1IKC A;  3ERA A;  1ES7 B;  1IJC A;  1HOY A;  2JQP A;  2ABX A;  2CRS A;  1KXI A;  2NBT A;  2H8U A;  4QTI U;  1YWH A;  1ERA A;  3FEV A;  1JBD A;  5IMY C;  3BT1 U;  1DRS A;  3HH7 A;  2MHY A;  1NEA A;  3LAQ U;  4IYE A;  1BXP A;  2UWR A;  2CDX A;  2H64 C;  1HAA A;  1PLO A;  1ZAD A;  4XJJ A;  1CRF A;  4HQP F;  3BT2 U;  2HLR A; 
#chains in the Genus database with same CATH topology
 2QJA C;  2I9B E;  1NYU A;  1FSC A;  2CTX A;  2MJ4 A;  1S4Y A;  1COE A;  2LCR A;  1LJZ A;  2QC1 A;  1HC9 B;  1MR6 A;  1IQ9 A;  1F94 A;  4LFT A;  1CDR A;  1NTN A;  4RUD A;  4UY2 C;  1LSI A;  2UX2 A;  2QJB C;  1ONJ A;  1TFS A;  2HLQ A;  1H0J A;  3NH7 A;  1LXH A;  1CHV S;  2ERA A;  1RGJ A;  1RL5 A;  3U74 U;  1KL8 A;  1KS6 A;  1CDT A;  4AEA A;  1TGX A;  1CTX A;  1LXG A;  2MFA A;  4FAO E;  4BDT B;  5DU1 A;  3KFD E;  3NEQ A;  1M9Z A;  1KU6 B;  1IK8 A;  2H7Z A;  2J8B A;  1FRA A;  2H62 D;  1HAJ A;  1CRE A;  1CDQ A;  3QB4 B;  4FAO C;  5DZ5 A;  1KFH A;  6EBX A;  4BIK B;  1ABT A;  1QM7 A;  1FFJ A;  1CDS A;  1JGK A;  1MAH F;  1TXA A;  4DO8 A;  1JE9 A;  1NOR A;  1FF4 A;  2PJY C;  1QKE A;  1KTZ B;  3EBX A;  1W6B A;  1KBS A;  1NXB A;  1NYS A;  1L4W A;  2MUO A;  2BHI A;  2GOO B;  2FD6 U;  1V6P A;  1I02 A;  4EY8 B;  1CVO A;  2MJY A;  4P7U A;  5IMT D;  1KBT A;  1IDI A;  2QJ9 C;  3NDS A;  2CCX A;  1CCQ A;  1UG4 A;  3VTS A;  2N99 A;  2VLW A;  4ZQY A;  2H5F A;  2CRT A;  2JVE A;  1VB0 A;  2PJY B;  2K3G A;  1B41 B;  2OFS A;  1BTE A;  1CXO A;  1HC9 A;  1COD A;  2H62 C;  2MUP A;  2LA1 A;  4OM5 A;  1G6M A;  1IDG A;  5EBX A;  1LX5 B;  1CB9 A;  3EVS C;  2H7Z B;  1IDH A;  2H64 B;  1TXB A;  1KC4 A;  1IDL A;  1REW C;  2L5S A;  1FSS B;  5DO6 A;  1CXN A;  3U73 U;  3KFD I;  2BTX A;  1ERG A;  2X8B B;  2GOO C;  2MJ0 A;  4OM4 A;  1FAS A;  1QKD A;  3PLC A;  2L03 A;  1KBA A;  1NTX A;  1F8U B;  1XT3 A;  1IKC A;  3ERA A;  1ES7 B;  1IJC A;  1HOY A;  2JQP A;  2ABX A;  2CRS A;  1KXI A;  4KSN A;  2NBT A;  2H8U A;  4QTI U;  1YWH A;  1ERA A;  3FEV A;  1JBD A;  5IMY C;  3BT1 U;  1DRS A;  3HH7 A;  2MHY A;  1NEA A;  3LAQ U;  4IYE A;  1BXP A;  2UWR A;  2CDX A;  2H64 C;  1HAA A;  1PLO A;  1ZAD A;  4XJJ A;  1CRF A;  4HQP F;  3BT2 U;  2HLR A; 
#chains in the Genus database with same CATH homology
 2QJA C;  2I9B E;  1NYU A;  1FSC A;  2CTX A;  2MJ4 A;  1S4Y A;  1COE A;  2LCR A;  1LJZ A;  2QC1 A;  1HC9 B;  1MR6 A;  1IQ9 A;  1F94 A;  4LFT A;  1CDR A;  1NTN A;  4RUD A;  4UY2 C;  1LSI A;  2UX2 A;  2QJB C;  1ONJ A;  1TFS A;  2HLQ A;  1H0J A;  3NH7 A;  1LXH A;  1CHV S;  2ERA A;  1RGJ A;  1RL5 A;  3U74 U;  1KL8 A;  1KS6 A;  1CDT A;  4AEA A;  1TGX A;  1CTX A;  1LXG A;  2MFA A;  4FAO E;  4BDT B;  5DU1 A;  3KFD E;  3NEQ A;  1M9Z A;  1KU6 B;  1IK8 A;  2H7Z A;  2J8B A;  1FRA A;  2H62 D;  1HAJ A;  1CRE A;  1CDQ A;  3QB4 B;  4FAO C;  5DZ5 A;  1KFH A;  6EBX A;  4BIK B;  1ABT A;  1QM7 A;  1FFJ A;  1CDS A;  1JGK A;  1MAH F;  1TXA A;  4DO8 A;  1JE9 A;  1NOR A;  1FF4 A;  2PJY C;  1QKE A;  1KTZ B;  3EBX A;  1W6B A;  1KBS A;  1NXB A;  1NYS A;  1L4W A;  2MUO A;  2BHI A;  2GOO B;  2FD6 U;  1V6P A;  1I02 A;  4EY8 B;  1CVO A;  2MJY A;  4P7U A;  5IMT D;  1KBT A;  1IDI A;  2QJ9 C;  3NDS A;  2CCX A;  1CCQ A;  1UG4 A;  3VTS A;  2N99 A;  2VLW A;  4ZQY A;  2H5F A;  2CRT A;  2JVE A;  1VB0 A;  2PJY B;  2K3G A;  1B41 B;  2OFS A;  1BTE A;  1CXO A;  1HC9 A;  1COD A;  2H62 C;  2MUP A;  2LA1 A;  4OM5 A;  1G6M A;  1IDG A;  5EBX A;  1LX5 B;  1CB9 A;  3EVS C;  2H7Z B;  1IDH A;  2H64 B;  1TXB A;  1KC4 A;  1IDL A;  1REW C;  2L5S A;  1FSS B;  5DO6 A;  1CXN A;  3U73 U;  3KFD I;  2BTX A;  1ERG A;  2X8B B;  2GOO C;  2MJ0 A;  4OM4 A;  1FAS A;  1QKD A;  3PLC A;  2L03 A;  1KBA A;  1NTX A;  1F8U B;  1XT3 A;  1IKC A;  3ERA A;  1ES7 B;  1IJC A;  1HOY A;  2JQP A;  2ABX A;  2CRS A;  1KXI A;  4KSN A;  2NBT A;  2H8U A;  4QTI U;  1YWH A;  1ERA A;  3FEV A;  1JBD A;  5IMY C;  3BT1 U;  1DRS A;  3HH7 A;  2MHY A;  1NEA A;  3LAQ U;  4IYE A;  1BXP A;  2UWR A;  2CDX A;  2H64 C;  1HAA A;  1PLO A;  1ZAD A;  4XJJ A;  1CRF A;  4HQP F;  3BT2 U;  2HLR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...