5A0AE

Crystal structure of human neutrophil elastase in complex with a dihydropyrimidone inhibitor
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
218
structure length
216
Chain Sequence
IVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Freezing the Bioactive Conformation to Boost Potency: The Identification of BAY 85-8501, a Selective and Potent Inhibitor of Human Neutrophil Elastase for Pulmonary Diseases.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords NEUTROPHIL ELASTASE
total genus 42
structure length 216
sequence length 218
ec nomenclature ec 3.4.21.37: Leukocyte elastase.
pdb deposition date 2015-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5a0aE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5a0aE02
2ZU2A 2PUXB 1UK2A 2GT7A 5EGMA 3KGPA 3GY4A 1SSXA 1LDTT 3M35A 2BDBA 5LH8A 1WSSH 1O5CB 1O2JA 3SNDA 2SGEE 1EJMA 1O2IA 1HB0B 8KME2 4JK6A 1LHEH 1O5AB 3RXMA 2J4IA 5TCCA 3GDSA 5H4IB 3ZZAA 1KLIH 1D3QB 1G30B 3MTYA 2SNVA 1TBRH 2UUJB 1RFNA 1MTSA 3AASA 1PPZA 2UWPA 1RS0A 5CE1A 1GBMA 1HLTH 2C3SA 1G2MA 1TNGA 3VB7A 1BTPA 2Y5GA 3RXBA 2G4UA 2Y5HA 4ABEA 1O5BB 1J17T 5DP8A 2Y82A 2Z9LA 1NPMA 3RXVA 3A8BA 1ZOMA 4TYDA 3LH3A 1LO6A 3RXLA 1C1VH 1TGNA 2GCHF 2QIQA 2ZTXA 3BIUH 1O2YA 2BM2A 2R2WU 1C9PA 2XTTB 2XBXA 2G55A 1C5TA 4PROA 5C5NA 4FU7A 1P57B 3BTWE 6GCHF 2ZF0H 3EA9A 4X2VA 1TRNA 2GMTB 4BXWA 1MZDA 1O3OA 1ZHRA 1FV9A 4Y6DA 3RXSA 2F9VA 1O3BA 2PKSB 3O8BA 2P94A 2A5IA 7LPRA 5JBCS 1HIAA 3LDXH 2KAIA 3MI4A 2EI8A 1SB1H 3SI3H 1DUAA 1MBMA 1D6RA 2AGGX 3ZZ7A 3MNCA 1IQNA 2Z9IA 5EW2H 4D7GA 3P8NA 1HAZB 5TJXA 2ANMH 1V2ST 3AVZA 5JBAS 4D7FA 2A5AA 3ZZ4A 2GVFA 4WH6A 1MKXK 1C1QA 3BEIB 1QJ7B 2HOBA 2DUCA 4H6TA 1AGJA 3SGAE 4X6MA 2Y7XA 1C4Y2 2PW8H 1BMNH 1EP6A 2ZKSA 3PLPA 2Q6FA 1C2JA 1C2MA 2GX4A 4A92A 2F91A 3RXJA 4ZXXH 2XBVA 4NA7A 5E2OA 1HRTH 4Y0ZE 1P09A 4TY7A 1CHOF 1GMDG 8GCHF 1LVYA 4DCDA 2WINI 3SJ9A 1P2NA 3UOPA 3A7XA 2W7SA 3RXQA 4K5ZA 1OYTH 5HYOA 1ELFA 1A0LA 1L0ZA 1V6DA 4IS5A 1V2RT 3RXEA 1F5RA 1YPHC 1L4ZA 2VJ1A 3PWCA 2PKAA 2A7HA 1TA6A 3HPTB 1C5PA 3O8RA 3ATWA 1B5GH 3BTQE 2FPZA 1EOJA 4GPGA 4BAMB 3SV9A 4GCHF 4XBDA 3CP7A 3GICB 2BZ6H 2VNTA 1MAYA 2JKHA 3A81A 2Z3CA 2A45B 3TGKE 3SV7A 2BQ7B 2P59A 1VZQH 3F9FA 2FO9A 1DWBH 1O2OA 4X8VH 1Y3WA 3A8AA 4NWKA 3UQVA 2H5CA 3A89A 1G2LA 3SNEA 3SUGA 1O2LA 3LGIA 1JIRA 4NA9H 3F68H 2F9BH 1UTPA 1AHTH 1Z8RA 3D62A 4WJG2 1O5DH 1LQEA 5EODA 1KYNA 2FX6A 5FX6A 4ABBA 1OS8A 2BXUH 1ELBA 2FMJA 3GY5A 1NTPA 1ID5H 5SGAE 1E36B 1THRH 1GI8B 4GUXA 1O2WA 2QYIA 2ZU4A 2H5DA 5LPRA 2A4OA 1AWFH 1DPOA 2WUCA 3SZNA 1CT0E 3DA9B 1FNIA 8LPRA 4CR9A 2FP7B 4E7NA 1O39A 1G3BA 1BMAA 4AFUA 1V2MT 1V3XA 1WOFA 1OWKA 2BDCA 2J95A 1QL9A 1Z1IA 1EPTA 1MUEB 4Y71A 4CRBA 2JH5D 3BN9A 4K1SA 4CBNA 3T62A 1ANEA 3BEUA 4FUIA 1DX5M 1UTNA 3A87A 3BTHE 2XRCA 2HALA 3E91A 1KXAA 3FAOA 2CHAC 3UNSA 4BAHB 3P6ZB 1GHBF 4JYVH 3T27A 2I6SA 1C5LH 1O2VA 1LPKB 5JYIA 1HAXB 2BZAA 1O3LA 4MPVA 2CHAB 3VXEH 4MPXA 2STAE 4X2YA 1F7ZA 4H42U 3RP2A 1C2IA 2GDEH 5E0JA 4NIVA 2GT8A 3FFGA 1HBTH 4U2WA 4B73A 5I46H 2BTCE 1O3NA 4NIXA 3TITA 1HCGA 1ZPBA 2TRMA 2ZCHP 5HM2A 3D65E 1NRNH 2ZCKP 2XC4A 2AH4X 2VIDA 4BAOB 4E7RG 2Z9JA 1AQ7A 1O37A 3OSYA 2ZFSA 2A2QH 1LVBA 1W7XH 3LGYA 3QLPH 1O2HA 3GY8A 1V2TT 1V2PT 5C5OA 3MH5A 4DIHH 1P02A 3ZYDA 2O8MA 3A85A 4JYUH 1S82A 3M61U 4TPYA 1JRSA 1EJAA 2ZGXH 1GDQA 3TLOA 4Q7XA 3LGWA 2PKAB 1O32A 2STBE 1D6WA 2NU2E 2O8UA 4F49A 5DP6A 2R2MB 1SQOA 4BTTB 1JMOH 3RU4T 2OQ5A 2QGRA 3TK9A 3M37A 2Q1JA 1YLCA 1GHAF 1UTQA 2FOMB 4XFQA 3FVFB 1V2LT 1A3EH 1OXGA 1XVOA 1O2NA 4B2CA 7KMEH 3C27B 4FUCA 1SQTA 4ZXYH 1C2FA 1G9IE 4ZKRU 4NFEA 1O2RA 4NIWA 3S9BA 1B0FA 2ALVA 5E0HA 3TJVA 4I8JA 1C1SA 3Q76A 1TPPA 4RKOB 3E8LA 4AGJA 1RIWB 4NG9H 3URCA 2YNBA 1KXDA 2FI3E 1HXEH 2ZDMA 2J92A 3O8DA 2HPPH 1YPHE 2FI4E 2VIPA 2WV5A 3ATLA 4K1EA 2ZFTA 6LPRA 1XUKA 3GYLB 3S0NA 1TE0A 3SU5A 1SGNE 1L2EA 1A3BH 1GHVH 3RXGA 3SORA 4DY7B 3QK1A 2Q6DA 1AB9C 2ZNKH 3F6UH 3GCHC 1P01A 4Q80A 4WWYA 3U98H 1H8DH 1EAWA 2ZQ1A 1UK4A 1C2HA 1D3DB 1AWHB 4ISIH 3FP8E 4HZHA 1TPSA 4HGCA 4AOQA 2AIPA 1PJPA 2XWBI 2CN0H 4I8KA 5A0AE 1ZJDA 2ZFRH 3QWCH 4AN7A 4HI3A 4WF8A 1JRTA 1AVGH 3BTKE 5FPTA 4OS4A 1K1JA 3TVJB 3NZIA 4KTUA 3PTNA 4OS6A 5K7RA 2FLBH 2FEQH 2BDIA 1GJ7B 1SGDE 1S0RA 2JH6D 2SGQE 1GMHG 1UVUH 2YOLA 1SOZA 3RM2H 1J8AA 2BQ6B 2PTCE 4GHQA 3RM0H 2V3HH 2Y81A 1Q31A 4ZROA 5EPNA 4X8SH 1SFIA 2XWAA 1IQEA 3STJA 1T8NA 3BTEE 3L6PA 1P3EA 3TJNA 3SV6A 3SOSA 1UMAH 5B6OA 2FOCA 2GV6A 4TY6A 2AEIH 1Z7KA 2VWOA 3KL6A 2FM2A 4WH8A 1QURH 5C1XA 2FTMA 4CREA 1O5FH 2FOEA 4YOIA 3U1JB 1LHCH 3SJ8A 4H4FA 3TNTA 1UK3A 1GHXH 1N6XA 1P0SH 1EUFA 2QV1A 5A2MH 1YGCH 3TJUA 1K1PA 4FUGA 1GMHF 5JB8S 1UVOA 3KN2A 1ABJH 1W11U 2Z94A 2G00A 4CH8B 1SGEE 1ZYOA 1F2SE 2AMQA 1OKXA 1XXDA 2PV9B 4VGCC 1CU1A 1C5XB 1O34A 3M5NA 1OWIA 1QHRB 2C8ZB 2ZHDA 4CH2B 1J9CH 1CGHA 2OC8A 4YT7H 4MLFB 4UFEH 2ANKH 5DG6A 1HAYB 4B1TA 3VXFH 1ZPCA 1ZTKA 2XBWA 4IBLH 1Q3XA 4ISLA 5F6MA 3TK5A 5FPSA 1C1OA 4AYVB 2VIWA 3BTGE 1MCTA 2CJIA 1TGTA 3ZZCA 1DFPA 3LC5A 1GJBB 1EAUA 1CBWB 4O3TA 3RXIA 2BDGA 1HJ9A 4NWLA 2BD2A 3GY2A 1RD3B 3TK6A 2BD4A 1A61H 1UJ1A 1DITH 1FLEE 2QXIA 1TYNA 1NROH 1G3DA 1A4WH 2A4QA 1K1LA 2IJOB 3UNRA 1G3CA 3RXAA 1DSTA 2GCHG 4WXVA 1C4V2 1UVTH 2F83A 1P8VC 1SPJA 2OINA 3AW1A 3PM3A 1DT2A 3DT0H 1TMBH 2G4TA 1OP2A 2ZGJA 1JOUB 4XBBA 1UTOA 1X7AC 2FWWA 1AZZA 1CVWH 2BDYA 3QTOH 1P3CA 2GCTB 1SMFE 3UTUH 3ATIA 2O9QA 3LJJA 3TPIZ 1Z6JH 1ORFA 2ANWA 3BTTE 1H1BA 4DVAU 3EDXB 1TIOA 3ATMA 1GJ9B 2A32A 2FOAA 1OP8A 3NK8A 3ZVCA 5FCRA 5CMXH 1KTSB 2NU0E 1TALA 4UFFH 2XNIA 1FY4A 1XVMA 1YCPM 2BLWA 1O2GH 1P2JA 4BOHA 2ODPA 1O3AA 1AZ8A 5DPAA 1ZHMA 3PMBB 1HAPH 4E06H 1O36A 1QRZA 1PQ8A 1QJ6B 1BOQA 3RXFA 4WMFA 4GSOA 1E34B 1EKBB 3KQBA 4GHTA 1VCPA 2BY9X 1ELEE 3JZ2B 5EXMA 3RXCA 4B74A 1PPHE 2ESTE 4Y7AA 3L3TA 1LPGB 4MNVA 1AY6H 1SHHB 1O5EH 5FCKA 2OUAA 4RSPA 2ZWLH 5CHAC 2NU4E 3PO1C 1SVPA 1FY5A 1MKXH 1GGDC 1FMGA 5GWZA 1F0RA 4I31A 1HAGE 2OP9A 1GHYH 2PWXA 1BJVA 2FOFA 2BVSH 3ZV8A 4X1QU 1SGFG 1NRRH 1KY9A 1O3EA 4KTCA 4JZDH 2W5EA 1NFWA 4GLYA 5E8EH 1FONA 1S5SA 1H9HE 1WQVH 2GKVE 1ZRKA 1AVXA 3MH4A 3U9AH 2VH0A 3OTJE 2J94A 1BT7A 1XMNB 2CMYA 1KDQA 5EQSA 4Z0KA 1O3HA 3EAJA 3PLKA 2Y6TA 3AAVA 4CRDA 1Z1JA 2ODQA 1VR1H 1MTVA 3PWBA 1YPLH 3UIRA 1GI2A 4U30A 1V2VT 1HAVA 2VINA 1BRCE 3F9HA 2J34A 5L30H 1PFXC 1C5MD 4AG1A 1TBZH 1W12U 4FUDA 3PYHA 2NWNA 1O30A 1ELAA 3VB6A 3P8FA 1DLEA 4NFFA 1RTLA 3LOXA 2ASUB 1TX8A 4JZ1A 3TH2H 2QN5T 1DWCH 4ZHLU 4LZ1H 1LTOA 3KEEA 5JDUB 1O2UA 3P95A 1VJAU 1ZGVA 2EI7A 3BG8A 2Z3EA 4YT6H 1BB0B 3HGPA 3GY7A 3LIWA 3SU0A 1E35B 3A7WA 1TFXA 1BTHH 1GBFA 1GHAG 3EQ0H 1OWHA 3LONA 1W0ZU 4UE7H 1AFEH 2ALPA 1SGYE 3MYWA 2XW9A 1GCTC 1ZHPA 3EYDA 2XCNA 1Z8IB 2ZDKA 1UVPA 3ZZ5A 3V12A 3R0FA 1C5RA 1SBWA 2CGAA 2FDAA 3RMOH 2H9EH 1TRYA 1RIWC 4FUBA 1UHBB 4TWWA 2GMTC 4ABGA 1T7CA 2HVXA 1NFYA 4DJZB 1AE8H 1TNJA 1P2MA 2ZCLP 1MTWA 3RC5A 1TGCA 1BTZA 1VGCC 4MNYA 6CHAC 2M5TA 4INHA 4I7YH 1ZLRA 1PQ7A 4J2YB 3QUMP 3RC4A 1OWJA 8ESTE 2TIOA 1AN1E 5C1YA 1AI8H 1P9SA 1K9OE 2W3IA 4IW4E 1FAKH 5G4BA 3ZZBA 1DM4B 2EI6A 1DY9A 1K1OA 3QTVH 1HIAB 3CENA 4NZLA 5FX5A 1KLJH 1K22H 1TMUH 1H8IH 1C2DA 3UWJH 2SGDE 3VEQB 1C1PA 3W95A 4UFGH 1YKTA 1AKSA 3NKKA 4Y8ZA 5EOKA 1THPB 1DS2E 1DLKB 2F3CE 3UNQA 1YC0A 1TGBA 1QQUA 1FIZA 1MBQA 1Z6EA 1GJ8B 1HAIH 1PPCE 8GCHG 3LGUA 3U8TH 3FP6E 1C2LA 3M36A 1AIXH 1C1MA 3QN7A 2P8OC 1RRKA 1SGCA 2GGVB 3HATH 5ABWA 1GI6A 1SHYA 2BLVA 4I32A 1TX7A 1GBTA 1QB6A 4JZFH 5JBBS 1EZXC 3RU4E 1H9IE 5FBIA 5JB9S 4ZAEA 2HPQH 1CO7E 6ESTA 4YLQH 1HAOH 2AIQA 1EPTB 1TNKA 5F8ZA 1JBUH 5ESTE 1C1WH 3TH4H 1FDPA 3EGKH 2C8XB 3ZYEA 4F4OC 3IITA 5EXLA 4X0WU 2WV4A 3BF6H 1PQ5A 2BY8X 3S9CA 2OC7A 1QB1A 3KQDA 2ZEBA 2RG3A 3SNAA 1QA0A 4E05H 1LHFH 1HJ8A 5HGGA 3PLBA 1EP5A 4XDEA 3VB4A 1YPEH 1O35A 4RKJB 1A0HB 4JMYA 1TPOA 1TOCB 1T8OA 1GGDB 1NFXA 3BTFE 2Y80A 1ZMJA 2OC1A 1TA2A 1GHZA 1BRBE 1GL1A 5C20A 2BD7A 2Y7ZA 3UY9A 4UD9H 2ODYB 1QJ1B 3TIUA 1YPJH 2Q6GA 2Z9KA 4K8YA 1QY6A 1P05A 3R3GB 2BD8A 4OGXA 3P17H 5T3HA 4A1XA 1YBWA 5I25A 1UHBA 5C1UA 3BG4C 4GVUA 1QGFA 4FU9A 4Y79A 1QL7A 1EAIA 2ZQ2A 5EW1H 2ZDLA 2XYAA 2C4FH 4ABJA 1QTFA 1ELVA 2FESH 2W3KA 1LPZB 3GDVA 3L33A 5AF9H 2EEKA 1S85A 4X2WA 1DICA 1V2KT 2A2XH 1DSUA 3RMNH 3ZZ6A 2BD3A 4IGDA 2LNCA 2VVVA 3I29A 1H9LB 3GISB 2VWMA 3H7OA 2GZ8A 1GI3A 2WUBA 1C1NA 1P2IA 1HV7A 1OWDA 1YM0A 2AFQB 2TGPZ 2AERH 1C5ZB 4IN2A 1MU8B 1O2MA 1W7GH 4X1RU 2BD5A 2GV7A 1L1JA 1ZMLA 1TBQH 1GHWH 3MHWU 3SUFA 3UR9A 3SI4H 3E3TA 2VIOA 3I78A 1O5GH 2VWLA 1HAVB 1XXFA 2J38A 2R0LA 3SV2H 1W8BH 1MMJN 5DP4A 1YYY1 2PLXA 1FPHH 2PFEA 5FXLA 2GZ9A 1H4WA 4KTSA 2BDHA 1QL8A 3NUMA 1K2I1 1LKBA 2QCYA 5GJ4B 2GD4B 1GI5A 1XUFA 2IN2A 1J15A 2HLCA 3VGCB 4YESB 3LPRA 2J2UA 3QZQA 1TWXB 3A7VA 1NRQH 1SOTA 2TGTA 3K6ZA 1TRMA 1SR5C 1GG6B 4ABAA 1MD7A 5TCAA 1FAXA 3UFAA 3PMAB 4OS1A 1XKAC 1Q2WA 2FYQA 2ZZUH 1PPFE 3CS7A 3VB3A 1HGTH 1FN6A 2B9LA 3ZVGA 2OC0A 2WYJA 1TNHA 1VGCB 4X1SU 2KAIB 5GCHG 2OBQA 5C3NA 3VGCC 3M3SA 1AD8H 1DY8A 1ELDE 4KP0A 1QBNA 1O3DA 1PYTD 4MQAA 4A5TS 3P8OA 1P03A 2GZ7A 3UPEA 4DURA 4Y0YE 1E37B 1RTKA 1AVWA 2ZHQH 3SU1A 2OCVB 4KKDA 1K21H 1GMCG 1FPCH 3OYPA 3CS0A 2FX4A 4FVDA 3U8OH 1VITG 3RXOA 1B0EA 3AAUA 1BTYA 5DJ7A 3RXDA 2SGFE 1P11E 2G81E 3M3VA 2ZDNA 3RXRA 4A6LA 4CRAA 2AMPA 3MU4A 2ULLA 2XC0A 3MNSA 1C2KA 2WPHS 4X6PA 5DKMA 5HM9A 2OTVA 1ACBE 1W2KH 1UCYK 1UTJA 3NWUA 4O97A 4MNXA 1LMWB 1GCDA 1C5SA 3M5OA 3U1IB 1Z8JB 5AFYH 1O33A 4B75A 4ZHAA 1IHSH 1HDTH 3A8CA 3PMHB 3JZ1B 3A83A 3QO6A 1EXFA 1GJDB 3RMLH 4XE4A 4AFSA 4A1TA 1N8OB 1FY8E 4JCNA 4ZH8A 7GCHF 4FUEA 4D9RA 1O2TA 4H6SB 4K1TA 1C5VA 3LGVA 4BAQB 1WUNH 3ZV9A 1EZUC 3GY3A 1O38A 5HMAA 1ESAA 1BQYA 4AG2A 1IQJA 1IQMA 3MU5A 1AO5A 1E0FD 2NU3E 1A2CH 1Z8GA 3SJIA 1ESBA 4ABHA 1O3KA 4X8TH 4XOJA 3ZVBA 4AGKA 4THNH 2O8TA 5IDKA 1P06A 1QIXB 4R0IA 4J1YA 2R3UA 4CHAC 1TONA 3RU4D 4Y8XA 1NY22 4DT7B 4AZ2B 1FQ3A 1EX3A 1EAXA 1SGTA 4DW2U 1ZSKA 1BBRE 1IQFA 1GL0E 2ZGCA 1D9IA 1AKSB 1MU6B 1GWAA 1XUIA 2ZPSA 3KQCA 3U8RH 2ZIQH 1EZQA 1C2EA 5HXFA 4WXIA 1AUTC 3C1KA 2D8WA 2BD9A 5L2ZH 1C9TA 1A46H 1TB6H 3TNSA 2HWLB 1OWEA 1MCVA 3SQEE 1SGPE 1D3TB 3ENSB 1F0SA 4X1NU 2ZHFH 2QC2A 1BHXF 1MTNC 1SGRE 1ZSJA 2QXJA 4JZIA 1LHGH 3A84A 1BITA 4XSKU 9LPRA 4FXGH 3H7TA 1KXBA 9ESTA 2QAAA 3ODDA 4UDWH 7ESTE 5T6FA 3DD2H 2A5KA 2JETB 2H6MA 2ZHEH 1GBAA 1P2QA 4ZKSU 3Q3XA 1WU1A 4MPWA 1E38B 2G8TA 2G5VA 1LVOA 2R9PA 3T2NA 3RLYH 3S69A 1SQAA 3UQOA 4Y76A 1NZQH 3MWIU 1C5WB 1N6YA 1A1RA 3QDZB 1V2NT 2VGCB 1HFDA 2ZU5A 4INLA 1ABIH 1OP0A 5BPEA 1YLDA 1V2OT 1Y3VA 4QT8C 2ZTYA 2HGTH 2ZGHA 2A7JA 2C8WB 3V7TA 2WYGA 1C2GA 2B5TB 2BDAA 1K1MA 1HNEE 3M7TA 4IN1A 4LXBH 2V6NA 4D8NA 2O8WA 1BMMH 3A7TA 3OY6U 1GDUA 1K28D 2XCFA 3A7ZA 3HKIB 4B2AA 5L6NH 1D3PB 4ISOA 1C5QA 2AGIX 2OD3B 2ZGBH 1QBOA 2PGBB 4X2XA 1CA0C 3SGQE 1NT1A 1MD8A 1THSH 4YTAA 1DOJA 1A5GH 1UTKA 3VB5A 1CE5A 1KXEA 3E6PH 4O03A 1GJ6A 1F5KU 5LGOA 1Y8TA 1WAYB 1EQ9A 3UUZA 3QX5H 1TQ0B 4R8TB 1FN8A 2UUYA 1NS3A 1JIMA 1T31A 2BB4A 4Y10E 4D76A 2VU8E 3STIA 4YLUA 1CHOG 1GMDF 1FZZA 2HNTC 4MVNA 3K65B 1YF4A 3V0XA 1O31A 3SHAH 1VITF 2BHGA 3V3MA 1UCYE 1EB1H 1KDQB 2WPLS 1ZJKA 1AU8A 1P9UA 2HRVA 4JYTA 2G52A 1IHTH 3Q3YA 1KIGH 2XBYA 3GDUA 4I33A 1DWDH 1Y5BT 1RJXB 3B9FH 1WBGB 3AW0A 1IQLA 1P04A 3MO3A 2W7UA 3N7OA 2IPHA 1GBCA 3ODFA 3SGBE 4ABFA 1MKWK 2A31A 1Z71A 1TX6A 3RXTA 2B7DH 1NESE 4K3JA 3H5CB 1UO6A 5EXNA 4UONA 1ZR0A 1D4PB 1RXPA 3FANA 3PROA 2F9PA 4HFPB 1PQAA 3B8JA 4U32A 4Y7BA 1PPEE 3QGJA 5C2ZA 3T25A 2FZZA 2PSXA 1KLTA 1O3MA 3LT3A 2A7CA 4X6OA 3O8CA 1BRAA 3MO9A 1B7XB 1INCA 3LJOA 4I8HA 1DVAH 2BMGB 3LU9B 5J4SA 2Z9GA 1YCPH 1CGJE 2QF0A 4K60A 2V35A 3M7QA 5AFZH 2IOTA 3HKJB 1C1UH 2P3FH 2FS8A 3SJKA 1HPGA 2BLQA 3SUEA 4INKA 1F92A 1NN6A 1SLVB 2FOBA 3ZVAA 1FY1A 4CRFA 3Q00A 1ZMNA 2J9NA 3ESTA 1ZPZA 1SGQE 2VVCA 1UVSH 2Z3DA 5EPYA 3RXPA 1GBLA 1NM6A 3GCOA 5EQRA 3TGJE 1T4UH 4LZ4B 3VPKA 4YOGA 2AYWA 2BLOA 6GCHG 3LC3A 2ZFPH 3LH1A 1CA8B 2QXHA 2THFB 1T8LA 4NA8A 1Y3XA 2ILNA 1WYKA 1LKAA 1HJAC 2BY5X 2SFAA 3NXPA 2AMDA 1O3JA 4Z6AH 2LPRA 2RA3A 1CT2E 4WVPE 4KGAA 1QRWA 1TPAE 1YPKH 1S0QA 3BV9B 4Y11E 3SU3A 1Y3UA 2I6QA 1QNJA 2RA0A 4VGCB 4MTBA 1YCPK 2VH6A 1GJ5H 3UWIA 4Q7YA 2Z6BD 1TNIA 4ISNA 3BEFB 5K0HA 1XX9A 2QXGA 2BY7X 1GG6C 3GCTG 1GI1A 1XM1A 2UUKB 2H2ZA 1IQIA 3NCLA 1G3EA 3P8GA 1S84A 1O2QA 3PMJA 3SW2B 3TJOA 1FUJA 1PYTC 2BX3A 3EA7A 3NPSA 4B71A 3E1XB 3RMMH 1UCYH 3A86A 1ARCA 2BYAX 1GI7B 2Z7FE 1FXYA 1K1NA 1BTWA 4BNRA 2WPIS 1DANH 3S7HB 3WY8A 1BA8B 1XUGA 2C90B 3M5LA 1DUEA 2AGEX 1ANCA 2SGAA 2P95A 2A4RA 1AE5A 1CA0B 3BTDE 1G37A 5GXPA 2GDDA 5DK1A 2VGCC 4NSYA 1XUHA 2V3OH 1Y3YA 2BVRH 1BIOA 4JK5A 5E2PA 1GCTB 3GYMA 2EA3A 2ZO3H 5FHTA 1F5LA 1J14A 4AB9A 5DGJA 3RXHA 3W94A 3ATKA 4DG4A 3DFLA 5DP7A 2WPJS 3SO3A 3E0PB 1SLXB 2FOGA 4FVBA 1A5IA 1S81A 5F8XA 4M7GA 4Q2KA 3ZVEA 4DGJA 1DXPA 2TPIZ 4BAKB 4A7IB 1SL3A 1XKBC 3FZDA 3F9EA 1EZSC 3SUDA 1QR3E 1BZXE 3RDZA 1Y5AT 2FXRA 2VIQA 4IMZA 5GPIB 4OS7A 3TU7H 4AB8A 5A0BA 1FI8A 3BSQA 3E0NB 2ZG0H 3SN8A 1ELCA 1ARBA 1NC6A 5FBEA 1C1TA 4DIIH 1BUIA 2V0BA 4MG3A 4UFDH 1O0DH 3ZZ9A 3ZZ3A 1PPBH 2A4GA 3QGNB 3GCTF 2CV3A 3T29A 1QB9A 4NIYA 1LHDH 1G36A 4CHAB 1UTLM 4U01A 5BRRE 4YZUA 1AFQC 3SNBA 4OS5A 3MFJA 4SGBE 3ITIA 2ZPQA 1NU9A 1J16A 2ZI2H 4NGAH 4X6NA 4AFQA 3RXUA 1HUTH 1EPTC 4O3UA 1W3CA 3A82A 1LQDB 2RCEA 1ETTH 3SJOA 1CT4E 1SFQB 3GOVB 1BCUH 1BBRK 2ZDVH 2ZA5A 2W26A 1GHBG 2ZTZA 4IMQA 3OX7U 2CXVA 1LCYA 1MTNB 4FU8A 2PHBA 1TNLA 1M9UA 2PR3A 3LKWA 4BTUB 2PUQH 2VIVA 2VB0A 4NSVA 4OGYA 1ETRH 1QBVH 5GDSH 1P12E 1WV7H 1O2KA 4X1PU 4YM9A 6CHAB 1HXFH 1A5HA 1C1RA 2H1UA 2JETC 4SGAE 1TGSZ 1V2JT 4ASHA 1V2QT 4YOJA 2ZDAH 2FLRH 3MU1A 4AYYB 4O9VA 1F0TA 2P3TB 2VVUA 3KQEA 4IC6A 3B23B 1YP9A 1O3IA 1TAWA 2OXSA 5FPYA 1S83A 5T6GA 2P3UB 1P10A 2FIRH 5L2YH 1TABE 2QF3A 1CGIE 2P8OB 4JZEH 4ESTE 5DP9A 2C93B 2SGPE 3BG4B 1JXPA 2ZU3A 5A8YA 2QA9E 1LVMA 1ZSLA 2F9NA 2D2DA 3KIDU 1T32A 4I8LA 1ZTJA 1OYQA 2GCTC 3S7KB 3KHVA 2F9OA 5FAHA 2O8LA 2ZFFH 2ZHWH 1MH0A 1L4DA 3G01A 1IQKA 2OLGA 3VFEA 3PO1B 1WCZA 2HNTF 4CR5A 2ZC9H 4TPIZ 2ZECA 2FYRA 1BDAA 2F9UA 1FJSA 2TGAA 3DFJA 2BOHB 2GP9B 4GCHG 5AVDA 4WMEA 2DE9A 1BJUA 1GI4A 3D23A 3P92A 2A0QB 4LOYH 1EJNA 1QRXA 5GIBA 1O2ZA 4Q7ZA 3ZZ8A 2B8OH 4ABDA 1IQGA 3PTBA 1VCQA 2UWLA 3MOCA 1ESTA 1NRPH 3MH6A 2BQWB 2R3YA 3GCNA 1W13U 1MZAA 3RUOA 3EE0B 1T4VH 1BMLA 2ANYA 3D49H 1WTHD 4CRGA 1ZGIA 1CHGA 3RC6A 2B0FA 3ZVDA 4ZKNU 1W10U 2H9HA 3DUXH 4BXSA 1FY3A 1OX1A 3DHKH 2TGDA 5F8TA 5GCHF 2BY6X 1AFQB 1IQHA 1SLUB 1GBIA 3V13A 1GVZA 1NU7B 5JPMH 1SGFA 3KNXA 3MMGA 1DE7H 4HTCH 2ZU1A 1C5OH 1BHXB 1KSNA 1MAXA 1TMTH 1O2PA 1RGQA 1DXWA 1GBHA 5A8XA 2PGQB 3T26A 1YPGH 3MNXA 4CRCA 2GTBA 1PPGE 1ANBA 3E90B 1SI5H 1T8MA 3F1SB 3SBKA 2OQUA 2P16A 1BTXA 2UWOA 3K9XB 5C67A 1O3PB 2ZPRA 2VWNA 1AUJA 1WTGH 1N1LA 1OOKB 4Y8YA 1ELTA 1IOEA 2G5NA 1SC8U 1O3FA 1UTMA 2DE8A 3S9AA 1VJ9U 2NU1E 1CQQA 1JWTA 3MH7A 3K2UA 1ZTLA 4NZQA 5J4QA 1TQ7B 4RN6A 3IWMA 3MU8A 1CSOE 2PSYA 1HAHH 2FOHA 3SHCH 4AFZA 5E0GA 1GVKB 1BTUA 3I77A 3SU6A 5CHAB 4WMDA 7GCHG 1GVLA 1GJCB 3P70B 4WY3A 4ABIA 3PB1E 2AS9A 5EG4A 1KXCA 3RXKA 4B2BA 5DP5A 1AMHA 2D26C 1DWEH 1GDNA 1TLDA 5DP3A 1O2XA 3E16B 1QQ4A 3T5FH 3A88A 2UUFB 1QFKH 1Y59T 2K1QA 1VITH 3ELAH 1G32B 1BBRH 3RLWH 5EQQA 1YPMH 1BRUP 1NRSH 1RTFB 5LPFA 1ELGA 5PTPA 3T28A 3HK3B 3A7YA 3SV8A 3URDA 2D1JA 1N8OC 1OPHB 4ZKOU 3BTME 1EOLA 1IAUA 2FODA 1SG8B 2ZFQH 2CF8H 5T6DA 3IG6B 5A0CA 4D9QA 5A09A 2R0KA 2RDLA 2FTLE 1MKWH 3HK6B 1GBDA 2FS9A 1QCPA 1TOMH 2TBSA 1WQSA 3PV4A 1L1GA 5F03A 3A8DA 4K2YA 1GPZA 3Q77A 3MU0A 1GBKA 3M7UA 1ZZZA 5A8ZA 3BIVH 2Y5FA 2XXLA 1Y5UT 2BX4A 2BOKA 2OBOA 2PKSC 1S6HA 4K69A 2ZP0H 3UOUA 1EATA 2G51A 1MTUA 4KELA 2PTNA 1DDJA 3K6YA 1MQ5A 4FUFA 2WPMS 5EU8A 3UR6A 1ZRBA 4A1VA 3KCGH 5AHGH 3TGIE 4TWYA 1OSSA 3SNCA 1GI9B 4CBOA 1U6QA 1F0UA 3SU4A 2XC5A 1CBWC 1O2SA 2WPKS 3UREA 1AB9B 3GCHB 4AX9H 1ANDA 1GMCF 1MQ6A 1EB2A 1GI0A 1GJ4H 4YO9A 3U69H 2EC9H 2BVXH 4BTIB 4AORA 5JBTA 3MO6A 1EASA 1V2UT 4MPUA 3MNBA 4ZHMU 2HNTE 1C5NH 3KF2A 3SQHE 1W0YH 1W14U 4X8UH 3OY5U 1C4U2 2YNAA 4MDSA 1NO9H 1HYLA 1GBBA 1GJAB 2JH0D 1SLWB 2QY0B 4FUJA 2A1DB 3SU2A 1P2OA 4FUHA 4B76A 1A0JA 3HGNA 3OU0A 4ISHH 4K8BA 1C5UA 1O3GA 1S6FA 1A7SA 3F9GA 5LPEA 1NFUA 5DO4H 1GBEA 3LGTA 1XUJA 2P93A 4ZMAH 1L1NA 3GY6A 1VCWA 3ZZDA 4XBCA 1FIWA 3FP7E 1K1IA 3M3TA 1C5YB 2FI5E 4NCYA 3QZRA 4IC5A 1HJAB 1KTTB 4I8GA 4ZUHA 5IYTA 2SNWA 2H9TH 2BXTH 4OS2A 5ESBA 4BANB 1P2KA 1ETSH 3M5MA 3A80A 1V2WT 1GBJA 1SGIB 4UEHH 4MNWA 4GAWA 1KXFA 1O3CA 3Q3KA 1QA7A 2C8YB 3EA8A 5ETXA 2CF9H 3ZVFA 4LK4A 4DOQA 3FZZA 3TH3H
chains in the Genus database with same CATH superfamily
2ZU2A 2PUXB 1UK2A 2GT7A 5EGMA 3KGPA 2KCPA 3GY4A 1SSXA 1LDTT 3M35A 2BDBA 5LH8A 1WSSH 1O5CB 1O2JA 3SNDA 2SGEE 1EJMA 1O2IA 1HB0B 5F53A 8KME2 3KYGA 3OFND 4JK6A 1LHEH 1O5AB 3RXMA 5KGOA 2J4IA 5TCCA 3GDSA 5H4IB 3ZZAA 1KLIH 1D3QB 1G30B 3MTYA 2SNVA 1TBRH 2UUJB 1RFNA 1MTSA 2KFWA 3AASA 1PPZA 2UWPA 1RS0A 5CE1A 1GBMA 1HLTH 2C3SA 1G2MA 1TNGA 3VB7A 1BTPA 2Y5GA 3RXBA 2V7QD 2G4UA 2Y5HA 4ABEA 1O5BB 1J17T 5DP8A 2Y82A 2Z9LA 1NPMA 3RXVA 3A8BA 1ZOMA 4TYDA 3LH3A 1LO6A 3RXLA 1C1VH 1TGNA 2GCHF 2QIQA 2ZTXA 3BIUH 1O2YA 2BM2A 2R2WU 1C9PA 2XBXA 2XTTB 2G55A 1C5TA 4PROA 1H8ED 5C5NA 4FU7A 1P57B 3BTWE 6GCHF 2ZF0H 3EA9A 4X2VA 1TRNA 2GMTB 4BXWA 1MZDA 1O3OA 1ZHRA 1FV9A 4Y6DA 3RXSA 2WHXA 2YMSD 2F9VA 3DSOA 1O3BA 2PKSB 3O8BA 2P94A 2A5IA 2WV9A 7LPRA 5JBCS 1HIAA 3LDXH 2KAIA 3MI4A 2EI8A 1SB1H 3SI3H 1DUAA 1MBMA 1D6RA 2AGGX 3ZZ7A 3MNCA 1IQNA 2Z9IA 5HIYA 5EW2H 4D7GA 1VKYA 3P8NA 1HAZB 5TJXA 2ANMH 3DCLA 1V2ST 5EJLA 3AVZA 5JBAS 4D7FA 2A5AA 3ZZ4A 2GVFA 4WH6A 1MKXK 2WZQA 1C1QA 3BEIB 1QJ7B 2HOBA 2DUCA 4H6TA 1AGJA 4TSFD 4X6MA 3SGAE 2Y7XA 1C4Y2 2PW8H 1BMNH 1EP6A 2ZKSA 3PLPA 2Q6FA 1C2JA 1C2MA 2GX4A 4A92A 2F91A 3RXJA 4ZXXH 2XBVA 4NA7A 5E2OA 1HRTH 4Y0ZE 1P09A 4TY7A 1CHOF 1GMDG 8GCHF 1LVYA 4DCDA 2WINI 3SJ9A 1P2NA 3UOPA 3A7XA 2W7SA 3RXQA 4K5ZA 1OYTH 5HYOA 1ELFA 1A0LA 1L0ZA 1V6DA 4IS5A 1V2RT 3F2GA 3RXEA 1F5RA 1YPHC 1L4ZA 2VJ1A 3PWCA 2PKAA 2A7HA 1TA6A 3HPTB 1C5PA 3O8RA 3ATWA 1B5GH 3BTQE 2FPZA 1EOJA 4GPGA 4BAMB 3SV9A 4GCHF 4XBDA 3CP7A 3GICB 2BZ6H 1MAYA 2VNTA 2JKHA 3A81A 2Z3CA 1E1QD 2A45B 3TGKE 3SV7A 2BQ7B 2P59A 1VZQH 3F9FA 2FO9A 3SZEA 1DWBH 1O2OA 4X8VH 1Y3WA 3A8AA 4NWKA 3UQVA 2H5CA 3A89A 1G2LA 3SNEA 3SUGA 1O2LA 3LGIA 1JIRA 4NA9H 3F68H 2F9BH 1UTPA 1AHTH 1Z8RA 3D62A 4WJG2 1O5DH 4ZCNA 1LQEA 5EODA 1KYNA 2FX6A 5FX6A 4ABBA 1OS8A 2BXUH 1ELBA 2FMJA 3GY5A 1NTPA 1ID5H 5SGAE 1E36B 1THRH 1GI8B 4GUXA 1O2WA 1SQRA 2QYIA 2ZU4A 5EJZA 2H5DA 2RDEA 5LPRA 2A4OA 1AWFH 1DPOA 2WUCA 3SZNA 1CT0E 3DA9B 1FNIA 8LPRA 4CR9A 2FP7B 4E7NA 1O39A 1G3BA 1BMAA 4AFUA 1V2MT 1V3XA 1WOFA 1OWKA 2BDCA 2J95A 1QL9A 1Z1IA 1EPTA 1MUEB 4Y71A 4CRBA 2JH5D 3BN9A 4K1SA 4CBNA 3T62A 1ANEA 3BEUA 4FUIA 1DX5M 1UTNA 3A87A 3BTHE 2XRCA 2HALA 3E91A 2F43B 1KXAA 3FAOA 2CHAC 2XNDD 3UNSA 4BAHB 3P6ZB 1GHBF 4JYVH 3T27A 2I6SA 1C5LH 1O2VA 1LPKB 5JYIA 1HAXB 2BZAA 1O3LA 4MPVA 2CHAB 3VXEH 4MPXA 2STAE 4X2YA 1F7ZA 4H42U 3RP2A 1C2IA 2GDEH 2LP6A 5E0JA 4NIVA 2GT8A 3FFGA 1HBTH 4U2WA 4B73A 4F48B 5I46H 2BTCE 1O3NA 4NIXA 3TITA 1HCGA 1ZPBA 2TRMA 2ZCHP 5HM2A 3D65E 1NRNH 2ZCKP 2AH4X 2XC4A 2VIDA 4BAOB 4E7RG 2Z9JA 1AQ7A 1O37A 3OSYA 2ZFSA 2A2QH 1LVBA 1W7XH 3LGYA 3QLPH 1O2HA 3GY8A 1V2TT 3OAAD 1V2PT 5C5OA 3MH5A 3MQKC 4DIHH 2WPDD 1P02A 3ZYDA 2O8MA 3A85A 4JYUH 1S82A 3M61U 4TPYA 1JRSA 1EJAA 2ZGXH 1GDQA 3TLOA 4Q7XA 3LGWA 2PKAB 1O32A 2STBE 1D6WA 2NU2E 2O8UA 4F49A 5DP6A 2R2MB 1SQOA 4BTTB 1JMOH 3RU4T 2OQ5A 2M2AA 2QGRA 3TK9A 3M37A 2Q1JA 1YLCA 1GHAF 1UTQA 2FOMB 4XFQA 3FVFB 1V2LT 1A3EH 1OXGA 1XVOA 3OEED 1O2NA 4B2CA 7KMEH 3C27B 4FUCA 1SQTA 4ZXYH 1C2FA 1G9IE 4ZKRU 4NFEA 1O2RA 4NIWA 3S9BA 1B0FA 2ALVA 5E0HA 3TJVA 4I8JA 1C1SA 3Q76A 1TPPA 4RKOB 2YMSC 3E8LA 4AGJA 1RIWB 4NG9H 3URCA 2YNBA 1KXDA 2FI3E 1HXEH 2ZDMA 5CDFE 2J92A 3O8DA 2HPPH 2FI4E 1YPHE 2VIPA 2WV5A 3ATLA 4K1EA 2ZFTA 6LPRA 1XUKA 3GYLB 3S0NA 1TE0A 3SU5A 1SGNE 1L2EA 1A3BH 1GHVH 3RXGA 3SORA 4DY7B 3QK1A 2Q6DA 1AB9C 2ZNKH 3F6UH 3GCHC 1P01A 4Q80A 4WWYA 3U98H 1H8DH 1EAWA 2ZQ1A 1UW7A 1UK4A 1C2HA 1D3DB 1AWHB 4ISIH 3FP8E 4HZHA 1TPSA 4HGCA 4AOQA 2AIPA 1PJPA 2XWBI 2CN0H 4I8KA 5A0AE 1ZJDA 2ZFRH 3QWCH 4AN7A 4HI3A 4WF8A 3AK5A 1JRTA 1AVGH 3BTKE 5FPTA 4OS4A 1K1JA 3TVJB 3NZIA 4KTUA 3PTNA 4OS6A 5K7RA 2FLBH 2FEQH 2BDIA 1GJ7B 1SGDE 1S0RA 2JH6D 3OE7D 2W6ID 2SGQE 1GMHG 1UVUH 2YOLA 1SOZA 3RM2H 1J8AA 2BQ6B 2PTCE 4GHQA 3RM0H 2V3HH 2Y81A 1Q31A 4ZROA 5EPNA 1K0HA 2W6JD 1SFIA 4X8SH 2XWAA 1IQEA 3STJA 2L6OA 1T8NA 3BTEE 3L6PA 1P3EA 3TJNA 3SV6A 3SOSA 1UMAH 5B6OA 2FOCA 2GV6A 5C17A 4TY6A 2AEIH 1Z7KA 2VWOA 3KL6A 2FM2A 4WH8A 1QURH 5C1XA 2FTMA 4CREA 1O5FH 2FOEA 4YOIA 3U1JB 1LHCH 3SJ8A 4H4FA 3TNTA 1UK3A 1GHXH 1WDIA 1N6XA 1P0SH 1EUFA 2QV1A 5A2MH 1YGCH 3TJUA 1K1PA 4FUGA 1GMHF 5JB8S 2AHME 1UVOA 3KN2A 1ABJH 1W11U 2Z94A 2G00A 4CH8B 4Q4LA 1SGEE 1ZYOA 1F2SE 2AMQA 1OKXA 1XXDA 3PV2A 2PV9B 4VGCC 1CU1A 1C5XB 1O34A 3M5NA 1OWIA 1QHRB 2C8ZB 2ZHDA 3U28C 3VG8A 4CH2B 1J9CH 1CGHA 2OC8A 4YT7H 3UAIC 4MLFB 4UFEH 2ANKH 1W0JD 5DG6A 1HAYB 4B1TA 3VXFH 1ZPCA 1ZTKA 2XBWA 4IBLH 1Q3XA 4ISLA 5F6MA 3TK5A 5FPSA 5C0UA 1C1OA 4AYVB 2VIWA 3BTGE 1MCTA 2CJIA 1TGTA 3ZZCA 1DFPA 3LC5A 1GJBB 1EAUA 1CBWB 4O3TA 3RXIA 2BDGA 1HJ9A 4NWLA 2BD2A 3GY2A 1RD3B 3TK6A 5GNDA 2BD4A 5HKKD 1A61H 1UJ1A 1DITH 1FLEE 2QXIA 1TYNA 1NROH 1G3DA 1A4WH 2A4QA 1K1LA 2IJOB 3UNRA 1G3CA 3RXAA 1DSTA 2GCHG 4WXVA 1C4V2 1UVTH 2F83A 1P8VC 1SPJA 2OINA 3F3BA 3AW1A 3PM3A 1DT2A 3DT0H 1TMBH 2G4TA 1OP2A 2ZGJA 1JOUB 4XBBA 1UTOA 1X7AC 2FWWA 1AZZA 1CVWH 2BDYA 3QTOH 1P3CA 2GCTB 1SMFE 3UTUH 3ATIA 2O9QA 3LJJA 3TPIZ 1Z6JH 1ORFA 2ANWA 3BTTE 1H1BA 4DVAU 3EDXB 1TIOA 3ATMA 1GJ9B 2A32A 2FOAA 1OP8A 3NK8A 3ZVCA 5FCRA 2JIZD 5CMXH 1KTSB 2NU0E 1TALA 4UFFH 2XNIA 1FY4A 1XVMA 1YCPM 2BLWA 1O2GH 1P2JA 4BOHA 2ODPA 1O3AA 1AZ8A 5DPAA 1ZHMA 3F0PA 3PMBB 1HAPH 1S6LA 4E06H 1O36A 1QRZA 1PQ8A 1QJ6B 1BOQA 3RXFA 4WMFA 4GSOA 1E34B 1EKBB 3KQBA 3N7DA 1VCPA 4GHTA 2BY9X 1ELEE 3JZ2B 5EXMA 3RXCA 4B74A 1PPHE 2ESTE 4Y7AA 3L3TA 1LPGB 4MNVA 1AY6H 1SHHB 1O5EH 5FCKA 2OUAA 4RSPA 2ZWLH 5CHAC 2NU4E 3PO1C 1SVPA 1FY5A 1MKXH 1GGDC 1FMGA 5GWZA 1F0RA 4I31A 1HAGE 2OP9A 2JJ2D 1GHYH 2PWXA 1BJVA 2FOFA 2BVSH 2CK3D 3ZV8A 4X1QU 1YWUA 1COWD 1SGFG 1NRRH 1KY9A 1O3EA 2J97A 4KTCA 4JZDH 2W5EA 1NFWA 4GLYA 5E8EH 1FONA 1S5SA 3W1EA 1H9HE 1WQVH 2GKVE 1ZRKA 1AVXA 3MH4A 3U9AH 3FN8A 2VH0A 3OTJE 2J94A 1BT7A 1XMNB 2CMYA 1KDQA 4I86A 5EQSA 4Z0KA 1O3HA 3EAJA 3PLKA 2Y6TA 3AAVA 4CRDA 3F2HA 1Z1JA 2ODQA 1VR1H 1MTVA 3PWBA 1YPLH 3UIRA 1GI2A 4U30A 1V2VT 1HAVA 2VINA 1BRCE 3F9HA 2J34A 5L30H 1PFXC 1C5MD 4AG1A 1TBZH 1W12U 4FUDA 3PYHA 2NWNA 1O30A 1ELAA 3VB6A 3P8FA 1DLEA 4NFFA 1RTLA 3LOXA 2ASUB 1TX8A 4JZ1A 3TH2H 2QN5T 1DWCH 4ZHLU 1KMHB 4LZ1H 1LTOA 3KEEA 5JDUB 1O2UA 3FO8D 3P95A 4Z1MD 1VJAU 1ZGVA 2EI7A 3BG8A 2Z3EA 4YT6H 1BB0B 3HGPA 3GY7A 3LIWA 3SU0A 1E35B 3A7WA 1TFXA 1BTHH 1GBFA 1GHAG 3EQ0H 1OWHA 3LONA 1W0ZU 4UE7H 4B6FA 1AFEH 2ALPA 1SGYE 3MYWA 2XW9A 1GCTC 1ZHPA 3EYDA 2XCNA 1Z8IB 2ZDKA 1UVPA 3ZZ5A 3V12A 3R0FA 1C5RA 1SBWA 2CGAA 2FDAA 3RMOH 2H9EH 1TRYA 1RIWC 4FUBA 1UHBB 4TWWA 2GMTC 4ABGA 1T7CA 2HVXA 1NFYA 4DJZB 4F55A 1AE8H 1E79D 1TNJA 1P2MA 2ZCLP 1MTWA 3RC5A 1TGCA 1BTZA 1VGCC 4MNYA 6CHAC 2M5TA 4INHA 4I7YH 1ZLRA 1PQ7A 4J2YB 3QUMP 3RC4A 1OWJA 8ESTE 2TIOA 1AN1E 5C94A 5C1YA 5IK2D 1AI8H 1OHHD 1P9SA 1K9OE 2W3IA 4IW4E 1FAKH 5G4BA 3ZZBA 1DM4B 2EI6A 1DY9A 1K1OA 3QTVH 1HIAB 3CENA 4NZLA 5FX5A 1KLJH 1K22H 1TMUH 1H8IH 1C2DA 2PP6A 3UWJH 2EY4C 2SGDE 3VEQB 1C1PA 3W95A 2VBCA 4UFGH 5C0TA 1YKTA 1AKSA 3NKKA 4Y8ZA 5EOKA 1THPB 1DS2E 1DLKB 2F3CE 5KECA 3UNQA 1YC0A 1TGBA 1QQUA 1FIZA 1MBQA 1Z6EA 1GJ8B 1HAIH 1PPCE 8GCHG 3LGUA 3U8TH 3FP6E 1C2LA 3M36A 1AIXH 1C1MA 3QN7A 2P8OC 1RRKA 1SGCA 2GGVB 3HATH 5ABWA 1GI6A 1SHYA 2BLVA 4I32A 1TX7A 1GBTA 1QB6A 4JZFH 5JBBS 1EZXC 3RU4E 1H9IE 5FBIA 5JB9S 4ZAEA 2HPQH 1CO7E 6ESTA 4YLQH 1HAOH 2AIQA 1EPTB 1TNKA 5F8ZA 1JBUH 5ESTE 1C1WH 3TH4H 1FDPA 3EGKH 2C8XB 3ZYEA 4F4OC 3IITA 5EXLA 4X0WU 1WXRA 2WV4A 3BF6H 1PQ5A 2BY8X 3S9CA 2OC7A 1QB1A 3KQDA 2ZEBA 2RG3A 3SNAA 1QA0A 2QF4A 4E05H 1LHFH 1HJ8A 2YMSB 4YXWD 5HGGA 3PLBA 3PRBA 1EP5A 4XDEA 3VB4A 1YPEH 1O35A 4RKJB 1A0HB 4JMYA 1TPOA 1TOCB 1T8OA 1GGDB 1NFXA 3BTFE 2Y80A 1ZMJA 2OC1A 1TA2A 1GHZA 1BRBE 1GL1A 5C20A 2BD7A 2Y7ZA 3UY9A 4UD9H 2ODYB 1QJ1B 3TIUA 1YPJH 2Q6GA 2Z9KA 4K8YA 1QY6A 1P05A 3R3GB 2BD8A 4OGXA 3P17H 5T3HA 4A1XA 1YBWA 5I25A 1UHBA 5C1UA 3BG4C 4GVUA 1QGFA 4FU9A 4Y79A 1QL7A 1EAIA 2ZQ2A 5EW1H 2ZDLA 2XYAA 2C4FH 4ABJA 1QTFA 1ELVA 2FESH 2W3KA 1LPZB 3GDVA 3L33A 5AF9H 2EEKA 1S85A 4X2WA 1DICA 1V2KT 2A2XH 1DSUA 4DT4A 3RMNH 3ZZ6A 2BD3A 4IGDA 4P02A 2LNCA 2VVVA 4FETA 3I29A 1H9LB 3GISB 2VWMA 3H7OA 2GZ8A 1GI3A 2WUBA 1C1NA 1P2IA 1HV7A 1OWDA 1YM0A 2AFQB 2TGPZ 2AERH 1C5ZB 4IN2A 1MU8B 1O2MA 1W7GH 4X1RU 2BD5A 2GV7A 1L1JA 1ZMLA 1TBQH 1GHWH 3MHWU 3SUFA 3UR9A 3SI4H 3E3TA 2VIOA 3I78A 1O5GH 2VWLA 1HAVB 1XXFA 2J38A 2R0LA 3SV2H 1W8BH 1MMJN 5DP4A 1YYY1 2PLXA 1FPHH 2PFEA 5FXLA 2GZ9A 1H4WA 4KTSA 2BDHA 1QL8A 3NUMA 1K2I1 1LKBA 2QCYA 5GJ4B 2GD4B 1GI5A 1XUFA 2IN2A 1J15A 2HLCA 3VGCB 2IJD1 4M9FA 4YESB 3LPRA 2J2UA 3QZQA 1TWXB 3A7VA 1NRQH 1SOTA 2TGTA 3K6ZA 1TRMA 1SR5C 1GG6B 4ABAA 1MD7A 5TCAA 1FAXA 3UFAA 3PMAB 4OS1A 1XKAC 1Q2WA 2FYQA 2ZZUH 1PPFE 3CS7A 3VB3A 1HGTH 1FN6A 2B9LA 3ZVGA 2OC0A 2WYJA 1TNHA 1VGCB 4X1SU 2KAIB 5GCHG 2OBQA 5C3NA 3VGCC 3M3SA 1AD8H 1DY8A 1ELDE 4KP0A 1QBNA 1O3DA 1PYTD 4MQAA 4TT3D 4A5TS 3P8OA 1P03A 2GZ7A 3UPEA 4DURA 4Y0YE 1E37B 1RTKA 4Q63A 2HLDD 1AVWA 2ZHQH 3SU1A 2OCVB 4KKDA 2KR7A 1K21H 1GMCG 1FPCH 3OYPA 2KM0A 3CS0A 2FX4A 4FVDA 3U8OH 1VITG 3RXOA 1B0EA 3AAUA 1BTYA 2V3MA 5DJ7A 3RXDA 2SGFE 1P11E 2G81E 3M3VA 2ZDNA 3RXRA 3WW7A 4A6LA 4CRAA 2AMPA 3MU4A 2ULLA 2XC0A 3MNSA 1C2KA 2WPHS 4X6PA 5DKMA 5HM9A 2OTVA 1ACBE 1W2KH 1UCYK 1UTJA 3NWUA 4O97A 4MNXA 1LMWB 1GCDA 1C5SA 3M5OA 3U1IB 1Z8JB 5AFYH 1O33A 4B75A 4ZHAA 1IHSH 1HDTH 1NBMD 3A8CA 3PMHB 3JZ1B 3A83A 3QO6A 1EXFA 1GJDB 5HIZA 3RMLH 4XE4A 4AFSA 4A1TA 1N8OB 1FY8E 4JCNA 4ZH8A 7GCHF 4FUEA 1YY3A 4D9RA 1O2TA 4H6SB 4K1TA 1C5VA 3LGVA 3KQ5A 4BAQB 3WWFA 1WUNH 3ZV9A 1EZUC 3GY3A 1O38A 5HMAA 1ESAA 1BQYA 4AG2A 1IQJA 1IQMA 3MU5A 1AO5A 1E0FD 2NU3E 1A2CH 1Z8GA 3SJIA 1ESBA 4ABHA 1O3KA 4X8TH 4XOJA 3ZVBA 4AGKA 4THNH 2O8TA 5IDKA 1P06A 1QIXB 3DSPA 4R0IA 4J1YA 2R3UA 4CHAC 1TONA 3RU4D 4Y8XA 1NY22 4DT7B 4AZ2B 1FQ3A 1EX3A 1EAXA 1SGTA 4DW2U 1ZSKA 1BBRE 1IQFA 1GL0E 2ZGCA 1D9IA 1AKSB 1MU6B 1GWAA 1XUIA 2ZPSA 3KQCA 3U8RH 2ZIQH 1EZQA 1C2EA 5HXFA 4WXIA 1AUTC 3C1KA 2D8WA 2BD9A 5L2ZH 1C9TA 1A46H 1TB6H 3N7EA 3TNSA 2HWLB 1OWEA 1MCVA 5FL7D 3SQEE 1SGPE 1D3TB 3ENSB 1F0SA 4X1NU 2ZHFH 2QC2A 2KCAA 1BHXF 1MTNC 1SGRE 1ZSJA 2QXJA 4JZIA 1LHGH 3A84A 1BITA 4XSKU 9LPRA 4FXGH 3H7TA 1KXBA 9ESTA 2QAAA 3ODDA 4UDWH 7ESTE 5T6FA 3DD2H 2A5KA 2JETB 2H6MA 2ZHEH 1GBAA 1P2QA 4ZKSU 3Q3XA 1WU1A 4MPWA 1E38B 2G8TA 2G5VA 1LVOA 2KCYA 2R9PA 3T2NA 3RLYH 3S69A 1SQAA 3UQOA 4Y76A 1NZQH 3MWIU 1C5WB 1N6YA 5EJ1A 1A1RA 3QDZB 1V2NT 2VGCB 1HFDA 2ZU5A 4INLA 1ABIH 1OP0A 5BPEA 1YLDA 1V2OT 1Y3VA 4QT8C 2ZTYA 2HGTH 2ZGHA 2A7JA 2C8WB 3V7TA 2WYGA 1C2GA 2B5TB 2BDAA 1K1MA 1HNEE 3M7TA 4IN1A 4LXBH 2V6NA 2J98B 4D8NA 2O8WA 1BMMH 3A7TA 3OY6U 1GDUA 1K28D 2XCFA 3A7ZA 3HKIB 4ASUD 4B2AA 5L6NH 1D3PB 4ISOA 1C5QA 2AGIX 2OD3B 2RFKC 2ZGBH 1QBOA 2PGBB 4X2XA 1CA0C 3SGQE 1NT1A 1MD8A 1THSH 4YTAA 1DOJA 4OM9A 1A5GH 1UTKA 3VB5A 1CE5A 1KXEA 3E6PH 4O03A 3NRLA 1GJ6A 1F5KU 5LGOA 1Y8TA 3WWBA 1WAYB 1EQ9A 2QE7D 3UUZA 3QX5H 1TQ0B 4R8TB 1FN8A 2UUYA 1NS3A 1JIMA 1T31A 2BB4A 4Y10E 4D76A 2VU8E 3STIA 4YLUA 1CHOG 1GMDF 1FZZA 2HNTC 4MVNA 3K65B 1YF4A 3V0XA 1O31A 3SHAH 1VITF 2BHGA 3V3MA 1UCYE 1EB1H 1KDQB 2WPLS 1ZJKA 4XRNA 1AU8A 1P9UA 2HRVA 4JYTA 2G52A 1IHTH 3Q3YA 1KIGH 2XBYA 3GDUA 4I33A 1DWDH 1Y5BT 1RJXB 3B9FH 1WBGB 3AW0A 1IQLA 1H8HD 1P04A 3MO3A 2W7UA 3N7OA 2IPHA 1GBCA 3ODFA 3SGBE 4ABFA 1MKWK 2A31A 1Z71A 1TX6A 3RXTA 2B7DH 1NESE 4K3JA 3H5CB 1UO6A 4HG6A 5EXNA 4UONA 1ZR0A 1D4PB 1RXPA 3FANA 3PROA 2F9PA 4HFPB 1PQAA 3B8JA 4U32A 4Y7BA 1PPEE 3QGJA 5C2ZA 3T25A 2FZZA 2PSXA 1KLTA 1O3MA 3LT3A 2J5UA 2A7CA 4X6OA 3O8CA 1BRAA 3MO9A 1B7XB 1INCA 3LJOA 4I8HA 1DVAH 2BMGB 3LU9B 5J4SA 1QZ8A 2Z9GA 1YCPH 1CGJE 2QF0A 4K60A 2V35A 3M7QA 5AFZH 2IOTA 3HKJB 1C1UH 4B6EA 2P3FH 2FS8A 3SJKA 1HPGA 2BLQA 3SUEA 4INKA 1F92A 1NN6A 1SLVB 2FOBA 3ZVAA 1FX0B 5DN6D 1FY1A 4CRFA 3Q00A 1ZMNA 2J9NA 3ESTA 1ZPZA 1SGQE 2VVCA 1UVSH 2Z3DA 5EPYA 2XOKD 3RXPA 1GBLA 1NM6A 3GCOA 5EQRA 3TGJE 1T4UH 4LZ4B 3VPKA 4YOGA 2AYWA 2BLOA 6GCHG 3LC3A 2ZFPH 3LH1A 1CA8B 2QXHA 2THFB 1T8LA 4NA8A 1Y3XA 2ILNA 1WYKA 1LKAA 1HJAC 2BY5X 2SFAA 3NXPA 2AMDA 1O3JA 4Z6AH 2LPRA 2RA3A 1CT2E 4WVPE 4KGAA 1QRWA 1TPAE 1YPKH 1S0QA 3BV9B 4Y11E 3SU3A 1Y3UA 2I6QA 1QNJA 2RA0A 4VGCB 4MTBA 1YCPK 2VH6A 1GJ5H 2L74A 3UWIA 4Q7YA 2Z6BD 1TNIA 4ISNA 3BEFB 5K0HA 1XX9A 2QXGA 2BY7X 1GG6C 3GCTG 1GI1A 1XM1A 2UUKB 2H2ZA 1IQIA 3NCLA 1G3EA 3P8GA 1S84A 1O2QA 3PMJA 4AC9A 3CNRA 3SW2B 3TJOA 3ZIAD 1FUJA 1PYTC 2BX3A 3EA7A 3NPSA 4B71A 3E1XB 3RMMH 1UCYH 3A86A 1ARCA 2BYAX 1SKYE 3H09A 1GI7B 2Z7FE 1FXYA 1K1NA 2K0QA 1BTWA 4BNRA 2WPIS 1DANH 1E1RD 3S7HB 3WY8A 1BA8B 1XUGA 2C90B 3M5LA 1DUEA 2AGEX 1ANCA 2SGAA 2P95A 2A4RA 1AE5A 1CA0B 3BTDE 1G37A 5GXPA 2GDDA 5DK1A 2VGCC 3FKSD 4NSYA 1XUHA 5T1VA 2V3OH 1Y3YA 2BVRH 1BIOA 4JK5A 2KZ4A 5E2PA 5DSFA 1GCTB 3GYMA 2EA3A 2ZO3H 5FHTA 1F5LA 1J14A 4AB9A 5DGJA 3RXHA 3W94A 4RT0A 3ATKA 4DG4A 3DFLA 5DP7A 2WPJS 3SO3A 3E0PB 1SLXB 2FOGA 4FVBA 1A5IA 1S81A 5F8XA 4M7GA 4Q2KA 3ZVEA 4DGJA 1DXPA 2TPIZ 4BAKB 4A7IB 1SL3A 1XKBC 3FZDA 3F9EA 1EZSC 3SUDA 1QR3E 1BZXE 3RDZA 1Y5AT 2FXRA 2VIQA 4IMZA 5GPIB 4OS7A 3TU7H 4AB8A 5A0BA 4XD7D 1FI8A 2LELA 3BSQA 3E0NB 2ZG0H 3SN8A 1ELCA 1ARBA 1NC6A 5FBEA 1C1TA 4DIIH 1BUIA 2V0BA 4MG3A 4UFDH 1O0DH 3ZZ9A 3ZZ3A 1PPBH 2A4GA 3QGNB 3GCTF 2CV3A 3T29A 1QB9A 4NIYA 1LHDH 1G36A 4CHAB 5KEDA 1UTLM 4U01A 5BRRE 4YZUA 5EIYA 1AFQC 1YLNA 4OS5A 3SNBA 3PRDA 3MFJA 4SGBE 3ITIA 2ZPQA 1NU9A 1J16A 2KX4A 2ZI2H 4NGAH 4X6NA 4AFQA 3RXUA 1HUTH 1EPTC 4O3UA 5B6LA 1W3CA 3A82A 1LQDB 2RCEA 1ETTH 3SJOA 1CT4E 1SFQB 3GOVB 1BCUH 1BBRK 2ZDVH 2ZA5A 2W26A 1GHBG 2ZTZA 4IMQA 3OX7U 2CXVA 1LCYA 1MTNB 4FU8A 2PHBA 1TNLA 1M9UA 2PR3A 3LKWA 4BTUB 2PUQH 2VIVA 2VB0A 4NSVA 4OGYA 1ETRH 1QBVH 5GDSH 1P12E 1WV7H 1O2KA 4RT1A 4X1PU 4YM9A 6CHAB 1HXFH 1A5HA 1C1RA 2H1UA 2JETC 4SGAE 1TGSZ 1V2JT 1BMFD 4ASHA 1V2QT 4YOJA 2ZDAH 2FLRH 3MU1A 4AYYB 4O9VA 1F0TA 2P3TB 2VVUA 3KQEA 4IC6A 3B23B 1YP9A 1O3IA 1TAWA 2OXSA 5FPYA 3SYJA 1S83A 5T6GA 2P3UB 1P10A 2FIRH 5L2YH 1TABE 2QF3A 1CGIE 2P8OB 4JZEH 4ESTE 5DP9A 2C93B 2SGPE 3BG4B 1JXPA 2ZU3A 5A8YA 2QA9E 2IPQX 3OTPA 1LVMA 1ZSLA 2F9NA 2D2DA 3KIDU 1T32A 4I8LA 1ZTJA 1OYQA 2GCTC 2JJ1D 3S7KB 2F4LA 3KHVA 2F9OA 5FAHA 1NBME 2O8LA 2ZFFH 2ZHWH 1MH0A 1L4DA 2QF5A 3G01A 1IQKA 2OLGA 3VFEA 3PO1B 1WCZA 2HNTF 4CR5A 2ZC9H 4TPIZ 2ZECA 2FYRA 1BDAA 2F9UA 1FJSA 2TGAA 3DFJA 2BOHB 2GP9B 4GCHG 5AVDA 4WMEA 2DE9A 1BJUA 1GI4A 3D23A 3P92A 2A0QB 4LOYH 1EJNA 1QRXA 5GIBA 3UB0A 1O2ZA 4Q7ZA 3ZZ8A 2B8OH 4ABDA 5CHBA 1IQGA 3PTBA 1VCQA 2UWLA 3MOCA 1ESTA 1NRPH 3MH6A 2BQWB 2R3YA 3GCNA 1W13U 1MZAA 3PV5A 3RUOA 3EE0B 1T4VH 1BMLA 2ANYA 3D49H 1WTHD 4CRGA 1ZGIA 1CHGA 3RC6A 2B0FA 3ZVDA 4ZKNU 1W10U 1MABB 2H9HA 3DUXH 4BXSA 1FY3A 1OX1A 3DHKH 2TGDA 5F8TA 5GCHF 2BY6X 1AFQB 2EQNA 1IQHA 1SLUB 1GBIA 3V13A 1GVZA 1NU7B 5JPMH 1SGFA 3KNXA 3GS9A 3MMGA 1DE7H 4HTCH 2ZU1A 3N99A 1C5OH 1BHXB 1KSNA 1MAXA 1TMTH 1O2PA 1RGQA 1DXWA 1GBHA 5A8XA 2PGQB 3T26A 1YPGH 3MNXA 4CRCA 2GTBA 1PPGE 1ANBA 3E90B 1SI5H 1T8MA 3F1SB 3SBKA 2OQUA 2P16A 1BTXA 2UWOA 3K9XB 5C67A 1O3PB 2ZPRA 2VWNA 1AUJA 1WTGH 1N1LA 1OOKB 4Y8YA 1ELTA 1IOEA 2G5NA 1SC8U 1O3FA 1UTMA 2J98A 2DE8A 3S9AA 1VJ9U 2NU1E 1CQQA 1JWTA 3MH7A 3K2UA 1ZTLA 4NZQA 5J4QA 1TQ7B 4RN6A 3IWMA 3MU8A 1CSOE 2PSYA 1HAHH 2FOHA 3SHCH 4AFZA 5E0GA 1GVKB 1BTUA 3I77A 3SU6A 5CHAB 4WMDA 7GCHG 1GVLA 1GJCB 3P70B 1W0KD 2KCOA 4WY3A 4ABIA 3PB1E 2AS9A 5EG4A 1KXCA 3RXKA 4B2BA 5DP5A 1AMHA 2D26C 1DWEH 1GDNA 1TLDA 5DP3A 1O2XA 3E16B 2K8IA 1QQ4A 3T5FH 3A88A 3FOAA 2UUFB 1QFKH 1Y59T 2K1QA 1VITH 3ELAH 1G32B 1BBRH 3RLWH 5EQQA 1YPMH 1EFRD 1BRUP 1NRSH 1RTFB 5LPFA 1ELGA 5PTPA 3T28A 3HK3B 3A7YA 3SV8A 3URDA 2D1JA 1N8OC 1OPHB 4ZKOU 3BTME 1EOLA 1IAUA 2FODA 1SG8B 2ZFQH 2CF8H 3EE7A 4P00A 3IG6B 5T6DA 5A0CA 4D9QA 5A09A 2R0KA 2RDLA 3F0OA 2FTLE 1MKWH 3HK6B 1GBDA 2FS9A 4ACAA 1QCPA 1TOMH 2TBSA 1WQSA 3PV4A 1L1GA 5F03A 3A8DA 4K2YA 1GPZA 3Q77A 3MU0A 1GBKA 3M7UA 1ZZZA 5A8ZA 3BIVH 2Y5FA 2XXLA 1Y5UT 2BX4A 2BOKA 2WSSD 4ACBA 2OBOA 2PKSC 1S6HA 4K69A 2ZP0H 3UOUA 1EATA 4FOUC 2G51A 1MTUA 4KELA 2PTNA 1DDJA 3K6YA 1MQ5A 4FUFA 2WPMS 5EU8A 3UR6A 1ZRBA 4A1VA 3KCGH 5AHGH 3TGIE 4TWYA 1OSSA 3SNCA 1GI9B 3OEHD 1U6QA 4CBOA 1F0UA 3SU4A 2XC5A 1CBWC 1O2SA 2WPKS 3UREA 1AB9B 3GCHB 4AX9H 1ANDA 1GMCF 1MQ6A 1EB2A 1GI0A 1GJ4H 4YO9A 3U69H 2EC9H 2BVXH 4BTIB 4AORA 5JBTA 2JDID 3MO6A 1EASA 1V2UT 4MPUA 3MNBA 4ZHMU 2HNTE 4RI0A 1C5NH 3KF2A 3SQHE 1W0YH 1W14U 4X8UH 3OY5U 3DSGA 1C4U2 2YNAA 4MDSA 1NO9H 1HYLA 1GBBA 1GJAB 2JH0D 1SLWB 2QY0B 4FUJA 2A1DB 3SU2A 1P2OA 3F2FA 4FUHA 4B76A 2GJGA 1A0JA 3HGNA 3OU0A 4ISHH 4K8BA 1C5UA 1O3GA 1S6FA 1A7SA 3F9GA 5LPEA 1NFUA 5DO4H 1GBEA 3LGTA 1XUJA 2P93A 4ZMAH 2HVYB 1L1NA 3GY6A 1VCWA 3ZZDA 4XBCA 1FIWA 2OK5A 3FP7E 1K1IA 3M3TA 1C5YB 2FI5E 4NCYA 3QZRA 4IC5A 1HJAB 1KTTB 4I8GA 4ZUHA 5IYTA 2SNWA 2H9TH 2BXTH 4OS2A 5ESBA 4BANB 1P2KA 1ETSH 3KYFA 3M5MA 3A80A 1V2WT 1GBJA 1SGIB 4UEHH 4MNWA 4GAWA 1KXFA 1O3CA 3Q3KA 1QA7A 2C8YB 3EA8A 5ETXA 2CF9H 3ZVFA 4LK4A 4DOQA 3FZZA 3TH3H
chains in the Genus database with same CATH topology
2ZU2A 2PUXB 1UK2A 2GT7A 5EGMA 3KGPA 3GY4A 1SSXA 1LDTT 3M35A 2BDBA 5LH8A 1WSSH 1O5CB 1O2JA 3SNDA 2SGEE 1EJMA 1O2IA 1HB0B 8KME2 4JK6A 1LHEH 1O5AB 3RXMA 2J4IA 5TCCA 3GDSA 5H4IB 3ZZAA 1KLIH 1D3QB 1G30B 3MTYA 2SNVA 1TBRH 2UUJB 1RFNA 1MTSA 3AASA 1PPZA 2UWPA 1RS0A 5CE1A 1GBMA 1HLTH 2C3SA 1G2MA 1TNGA 3VB7A 1BTPA 2Y5GA 3RXBA 2G4UA 2Y5HA 4ABEA 1O5BB 1J17T 5DP8A 2Y82A 2Z9LA 1NPMA 3RXVA 3A8BA 1ZOMA 4TYDA 3LH3A 1LO6A 3RXLA 1C1VH 1TGNA 2GCHF 2QIQA 2ZTXA 3BIUH 1O2YA 2BM2A 2R2WU 1C9PA 2XTTB 2XBXA 2G55A 1C5TA 4PROA 5C5NA 4FU7A 1P57B 3BTWE 6GCHF 2ZF0H 3EA9A 4X2VA 1TRNA 2GMTB 4BXWA 1MZDA 1O3OA 1ZHRA 1FV9A 4Y6DA 3RXSA 2F9VA 1O3BA 2PKSB 3O8BA 2P94A 2A5IA 7LPRA 5JBCS 1HIAA 3LDXH 2KAIA 3MI4A 2EI8A 1SB1H 3SI3H 1DUAA 1MBMA 1D6RA 2AGGX 3ZZ7A 3MNCA 1IQNA 2Z9IA 5EW2H 4D7GA 3P8NA 1HAZB 5TJXA 2ANMH 1V2ST 3AVZA 5JBAS 4D7FA 2A5AA 3ZZ4A 2GVFA 4WH6A 1MKXK 1C1QA 3BEIB 1QJ7B 2HOBA 2DUCA 4H6TA 1AGJA 3SGAE 4X6MA 2Y7XA 1C4Y2 2PW8H 1BMNH 1EP6A 2ZKSA 3PLPA 2Q6FA 1C2JA 1C2MA 2GX4A 4A92A 2F91A 3RXJA 4ZXXH 2XBVA 4NA7A 5E2OA 1HRTH 4Y0ZE 1P09A 4TY7A 1CHOF 1GMDG 8GCHF 1LVYA 4DCDA 2WINI 3SJ9A 1P2NA 3UOPA 3A7XA 2W7SA 3RXQA 4K5ZA 1OYTH 5HYOA 1ELFA 1A0LA 1L0ZA 1V6DA 4IS5A 1V2RT 3RXEA 1F5RA 1YPHC 1L4ZA 2VJ1A 3PWCA 2PKAA 2A7HA 1TA6A 3HPTB 1C5PA 3O8RA 3ATWA 1B5GH 3BTQE 2FPZA 1EOJA 4GPGA 4BAMB 3SV9A 4GCHF 4XBDA 3CP7A 3GICB 2BZ6H 2VNTA 1MAYA 2JKHA 3A81A 2Z3CA 2A45B 3TGKE 3SV7A 2BQ7B 2P59A 1VZQH 3F9FA 2FO9A 1DWBH 1O2OA 4X8VH 1Y3WA 3A8AA 4NWKA 3UQVA 2H5CA 3A89A 1G2LA 3SNEA 3SUGA 1O2LA 3LGIA 1JIRA 4NA9H 3F68H 2F9BH 1UTPA 1AHTH 1Z8RA 3D62A 4WJG2 1O5DH 1LQEA 5EODA 1KYNA 2FX6A 5FX6A 4ABBA 1OS8A 2BXUH 1ELBA 2FMJA 3GY5A 1NTPA 1ID5H 5SGAE 1E36B 1THRH 1GI8B 4GUXA 1O2WA 2QYIA 2ZU4A 2H5DA 5LPRA 2A4OA 1AWFH 1DPOA 2WUCA 3SZNA 1CT0E 3DA9B 1FNIA 8LPRA 4CR9A 2FP7B 4E7NA 1O39A 1G3BA 1BMAA 4AFUA 1V2MT 1V3XA 1WOFA 1OWKA 2BDCA 2J95A 1QL9A 1Z1IA 1EPTA 1MUEB 4Y71A 4CRBA 2JH5D 3BN9A 4K1SA 4CBNA 3T62A 1ANEA 3BEUA 4FUIA 1DX5M 1UTNA 3A87A 3BTHE 2XRCA 2HALA 3E91A 1KXAA 3FAOA 2CHAC 3UNSA 4BAHB 3P6ZB 1GHBF 4JYVH 3T27A 2I6SA 1C5LH 1O2VA 1LPKB 5JYIA 1HAXB 2BZAA 1O3LA 4MPVA 2CHAB 3VXEH 4MPXA 2STAE 4X2YA 1F7ZA 4H42U 3RP2A 1C2IA 2GDEH 5E0JA 4NIVA 2GT8A 3FFGA 1HBTH 4U2WA 4B73A 5I46H 2BTCE 1O3NA 4NIXA 3TITA 1HCGA 1ZPBA 2TRMA 2ZCHP 5HM2A 3D65E 1NRNH 2ZCKP 2XC4A 2AH4X 2VIDA 4BAOB 4E7RG 2Z9JA 1AQ7A 1O37A 3OSYA 2ZFSA 2A2QH 1LVBA 1W7XH 3LGYA 3QLPH 1O2HA 3GY8A 1V2TT 1V2PT 5C5OA 3MH5A 4DIHH 1P02A 3ZYDA 2O8MA 3A85A 4JYUH 1S82A 3M61U 4TPYA 1JRSA 1EJAA 2ZGXH 1GDQA 3TLOA 4Q7XA 3LGWA 2PKAB 1O32A 2STBE 1D6WA 2NU2E 2O8UA 4F49A 5DP6A 2R2MB 1SQOA 4BTTB 1JMOH 3RU4T 2OQ5A 2QGRA 3TK9A 3M37A 2Q1JA 1YLCA 1GHAF 1UTQA 2FOMB 4XFQA 3FVFB 1V2LT 1A3EH 1OXGA 1XVOA 1O2NA 4B2CA 7KMEH 3C27B 4FUCA 1SQTA 4ZXYH 1C2FA 1G9IE 4ZKRU 4NFEA 1O2RA 4NIWA 3S9BA 1B0FA 2ALVA 5E0HA 3TJVA 4I8JA 1C1SA 3Q76A 1TPPA 4RKOB 3E8LA 4AGJA 1RIWB 4NG9H 3URCA 2YNBA 1KXDA 2FI3E 1HXEH 2ZDMA 2J92A 3O8DA 2HPPH 1YPHE 2FI4E 2VIPA 2WV5A 3ATLA 4K1EA 2ZFTA 6LPRA 1XUKA 3GYLB 3S0NA 1TE0A 3SU5A 1SGNE 1L2EA 1A3BH 1GHVH 3RXGA 3SORA 4DY7B 3QK1A 2Q6DA 1AB9C 2ZNKH 3F6UH 3GCHC 1P01A 4Q80A 4WWYA 3U98H 1H8DH 1EAWA 2ZQ1A 1UK4A 1C2HA 1D3DB 1AWHB 4ISIH 3FP8E 4HZHA 1TPSA 4HGCA 4AOQA 2AIPA 1PJPA 2XWBI 2CN0H 4I8KA 5A0AE 1ZJDA 2ZFRH 3QWCH 4AN7A 4HI3A 4WF8A 1JRTA 1AVGH 3BTKE 5FPTA 4OS4A 1K1JA 3TVJB 3NZIA 4KTUA 3PTNA 4OS6A 5K7RA 2FLBH 2FEQH 2BDIA 1GJ7B 1SGDE 1S0RA 2JH6D 2SGQE 1GMHG 1UVUH 2YOLA 1SOZA 3RM2H 1J8AA 2BQ6B 2PTCE 4GHQA 3RM0H 2V3HH 2Y81A 1Q31A 4ZROA 5EPNA 4X8SH 1SFIA 2XWAA 1IQEA 3STJA 1T8NA 3BTEE 3L6PA 1P3EA 3TJNA 3SV6A 3SOSA 1UMAH 5B6OA 2FOCA 2GV6A 4TY6A 2AEIH 1Z7KA 2VWOA 3KL6A 2FM2A 4WH8A 1QURH 5C1XA 2FTMA 4CREA 1O5FH 2FOEA 4YOIA 3U1JB 1LHCH 3SJ8A 4H4FA 3TNTA 1UK3A 1GHXH 1N6XA 1P0SH 1EUFA 2QV1A 5A2MH 1YGCH 3TJUA 1K1PA 4FUGA 1GMHF 5JB8S 1UVOA 3KN2A 1ABJH 1W11U 2Z94A 2G00A 4CH8B 1SGEE 1ZYOA 1F2SE 2AMQA 1OKXA 1XXDA 2PV9B 4VGCC 1CU1A 1C5XB 1O34A 3M5NA 1OWIA 1QHRB 2C8ZB 2ZHDA 4CH2B 1J9CH 1CGHA 2OC8A 4YT7H 4MLFB 4UFEH 2ANKH 5DG6A 1HAYB 4B1TA 3VXFH 1ZPCA 1ZTKA 2XBWA 4IBLH 1Q3XA 4ISLA 5F6MA 3TK5A 5FPSA 1C1OA 4AYVB 2VIWA 3BTGE 1MCTA 2CJIA 1TGTA 3ZZCA 1DFPA 3LC5A 1GJBB 1EAUA 1CBWB 4O3TA 3RXIA 2BDGA 1HJ9A 4NWLA 2BD2A 3GY2A 1RD3B 3TK6A 2BD4A 1A61H 1UJ1A 1DITH 1FLEE 2QXIA 1TYNA 1NROH 1G3DA 1A4WH 2A4QA 1K1LA 2IJOB 3UNRA 1G3CA 3RXAA 1DSTA 2GCHG 4WXVA 1C4V2 1UVTH 2F83A 1P8VC 1SPJA 2OINA 3AW1A 3PM3A 1DT2A 3DT0H 1TMBH 2G4TA 1OP2A 2ZGJA 1JOUB 4XBBA 1UTOA 1X7AC 2FWWA 1AZZA 1CVWH 2BDYA 3QTOH 1P3CA 2GCTB 1SMFE 3UTUH 3ATIA 2O9QA 3LJJA 3TPIZ 1Z6JH 1ORFA 2ANWA 3BTTE 1H1BA 4DVAU 3EDXB 1TIOA 3ATMA 1GJ9B 2A32A 2FOAA 1OP8A 3NK8A 3ZVCA 5FCRA 5CMXH 1KTSB 2NU0E 1TALA 4UFFH 2XNIA 1FY4A 1XVMA 1YCPM 2BLWA 1O2GH 1P2JA 4BOHA 2ODPA 1O3AA 1AZ8A 5DPAA 1ZHMA 3PMBB 1HAPH 4E06H 1O36A 1QRZA 1PQ8A 1QJ6B 1BOQA 3RXFA 4WMFA 4GSOA 1E34B 1EKBB 3KQBA 4GHTA 1VCPA 2BY9X 1ELEE 3JZ2B 5EXMA 3RXCA 4B74A 1PPHE 2ESTE 4Y7AA 3L3TA 1LPGB 4MNVA 1AY6H 1SHHB 1O5EH 5FCKA 2OUAA 4RSPA 2ZWLH 5CHAC 2NU4E 3PO1C 1SVPA 1FY5A 1MKXH 1GGDC 1FMGA 5GWZA 1F0RA 4I31A 1HAGE 2OP9A 1GHYH 2PWXA 1BJVA 2FOFA 2BVSH 3ZV8A 4X1QU 1SGFG 1NRRH 1KY9A 1O3EA 4KTCA 4JZDH 2W5EA 1NFWA 4GLYA 5E8EH 1FONA 1S5SA 1H9HE 1WQVH 2GKVE 1ZRKA 1AVXA 3MH4A 3U9AH 2VH0A 3OTJE 2J94A 1BT7A 1XMNB 2CMYA 1KDQA 5EQSA 4Z0KA 1O3HA 3EAJA 3PLKA 2Y6TA 3AAVA 4CRDA 1Z1JA 2ODQA 1VR1H 1MTVA 3PWBA 1YPLH 3UIRA 1GI2A 4U30A 1V2VT 1HAVA 2VINA 1BRCE 3F9HA 2J34A 5L30H 1PFXC 1C5MD 4AG1A 1TBZH 1W12U 4FUDA 3PYHA 2NWNA 1O30A 1ELAA 3VB6A 3P8FA 1DLEA 4NFFA 1RTLA 3LOXA 2ASUB 1TX8A 4JZ1A 3TH2H 2QN5T 1DWCH 4ZHLU 4LZ1H 1LTOA 3KEEA 5JDUB 1O2UA 3P95A 1VJAU 1ZGVA 2EI7A 3BG8A 2Z3EA 4YT6H 1BB0B 3HGPA 3GY7A 3LIWA 3SU0A 1E35B 3A7WA 1TFXA 1BTHH 1GBFA 1GHAG 3EQ0H 1OWHA 3LONA 1W0ZU 4UE7H 1AFEH 2ALPA 1SGYE 3MYWA 2XW9A 1GCTC 1ZHPA 3EYDA 2XCNA 1Z8IB 2ZDKA 1UVPA 3ZZ5A 3V12A 3R0FA 1C5RA 1SBWA 2CGAA 2FDAA 3RMOH 2H9EH 1TRYA 1RIWC 4FUBA 1UHBB 4TWWA 2GMTC 4ABGA 1T7CA 2HVXA 1NFYA 4DJZB 1AE8H 1TNJA 1P2MA 2ZCLP 1MTWA 3RC5A 1TGCA 1BTZA 1VGCC 4MNYA 6CHAC 2M5TA 4INHA 4I7YH 1ZLRA 1PQ7A 4J2YB 3QUMP 3RC4A 1OWJA 8ESTE 2TIOA 1AN1E 5C1YA 1AI8H 1P9SA 1K9OE 2W3IA 4IW4E 1FAKH 5G4BA 3ZZBA 1DM4B 2EI6A 1DY9A 1K1OA 3QTVH 1HIAB 3CENA 4NZLA 5FX5A 1KLJH 1K22H 1TMUH 1H8IH 1C2DA 3UWJH 2SGDE 3VEQB 1C1PA 3W95A 4UFGH 1YKTA 1AKSA 3NKKA 4Y8ZA 5EOKA 1THPB 1DS2E 1DLKB 2F3CE 3UNQA 1YC0A 1TGBA 1QQUA 1FIZA 1MBQA 1Z6EA 1GJ8B 1HAIH 1PPCE 8GCHG 3LGUA 3U8TH 3FP6E 1C2LA 3M36A 1AIXH 1C1MA 3QN7A 2P8OC 1RRKA 1SGCA 2GGVB 3HATH 5ABWA 1GI6A 1SHYA 2BLVA 4I32A 1TX7A 1GBTA 1QB6A 4JZFH 5JBBS 1EZXC 3RU4E 1H9IE 5FBIA 5JB9S 4ZAEA 2HPQH 1CO7E 6ESTA 4YLQH 1HAOH 2AIQA 1EPTB 1TNKA 5F8ZA 1JBUH 5ESTE 1C1WH 3TH4H 1FDPA 3EGKH 2C8XB 3ZYEA 4F4OC 3IITA 5EXLA 4X0WU 2WV4A 3BF6H 1PQ5A 2BY8X 3S9CA 2OC7A 1QB1A 3KQDA 2ZEBA 2RG3A 3SNAA 1QA0A 4E05H 1LHFH 1HJ8A 5HGGA 3PLBA 1EP5A 4XDEA 3VB4A 1YPEH 1O35A 4RKJB 1A0HB 4JMYA 1TPOA 1TOCB 1T8OA 1GGDB 1NFXA 3BTFE 2Y80A 1ZMJA 2OC1A 1TA2A 1GHZA 1BRBE 1GL1A 5C20A 2BD7A 2Y7ZA 3UY9A 4UD9H 2ODYB 1QJ1B 3TIUA 1YPJH 2Q6GA 2Z9KA 4K8YA 1QY6A 1P05A 3R3GB 2BD8A 4OGXA 3P17H 5T3HA 4A1XA 1YBWA 5I25A 1UHBA 5C1UA 3BG4C 4GVUA 1QGFA 4FU9A 4Y79A 1QL7A 1EAIA 2ZQ2A 5EW1H 2ZDLA 2XYAA 2C4FH 4ABJA 1QTFA 1ELVA 2FESH 2W3KA 1LPZB 3GDVA 3L33A 5AF9H 2EEKA 1S85A 4X2WA 1DICA 1V2KT 2A2XH 1DSUA 3RMNH 3ZZ6A 2BD3A 4IGDA 2LNCA 2VVVA 3I29A 1H9LB 3GISB 2VWMA 3H7OA 2GZ8A 1GI3A 2WUBA 1C1NA 1P2IA 1HV7A 1OWDA 1YM0A 2AFQB 2TGPZ 2AERH 1C5ZB 4IN2A 1MU8B 1O2MA 1W7GH 4X1RU 2BD5A 2GV7A 1L1JA 1ZMLA 1TBQH 1GHWH 3MHWU 3SUFA 3UR9A 3SI4H 3E3TA 2VIOA 3I78A 1O5GH 2VWLA 1HAVB 1XXFA 2J38A 2R0LA 3SV2H 1W8BH 1MMJN 5DP4A 1YYY1 2PLXA 1FPHH 2PFEA 5FXLA 2GZ9A 1H4WA 4KTSA 2BDHA 1QL8A 3NUMA 1K2I1 1LKBA 2QCYA 5GJ4B 2GD4B 1GI5A 1XUFA 2IN2A 1J15A 2HLCA 3VGCB 4YESB 3LPRA 2J2UA 3QZQA 1TWXB 3A7VA 1NRQH 1SOTA 2TGTA 3K6ZA 1TRMA 1SR5C 1GG6B 4ABAA 1MD7A 5TCAA 1FAXA 3UFAA 3PMAB 4OS1A 1XKAC 1Q2WA