5A0TA

Catalysis and 5' end sensing by ribonuclease rnase j of the metallo- beta-lactamase family
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
454
structure length
454
Chain Sequence
b'SHPHPELGRPPALPKGGLRVTPLGGLGEIGRNMTVFEYGGRLLIVDCGVLFPEEEQPGIDLILPDFTSIRDRLDDIEGIVLTHGHEDHIGGVPFLLREKPDIPLIGSKLTLALIEAKLQEHRIRPYTLEVAEGHRERVGPFDCEFVAVNHSIPDALAVAIRTPAGMVVHTGDFKMDQLPLDGRLTDLHAFARLSEEGIDLLLADSTNAEVPGFVPPERDISNVLRQVFANARKRIIVASFASHVHRIQQILDAAHEYGRRVAFVGRSMVRNMGIARDLGYLKVPPGLVVDVKTLDDLPDSEVVLVCTGSQGEPMAALSRMANRDHQIRIVNGDTVILASSLIPGNENAVYRVINGLTRWGANVVHKGNAKVHVSGHASAGELLYFYNICRPKNLMPVHGEWRHLRANAELGALTGVPHDRIVIAEDGVVVDLVEGKAKITGKVQAGYVYVDGLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE J
publication title Linkage of Catalysis and 5' End Recognition in Ribonuclease Rnase J
pubmed doi rcsb
source organism Streptomyces coelicolor a3(2)
molecule tags Hydrolase/rna
total genus 146
structure length 454
sequence length 454
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 5a0tA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5a0tA01
4C1FA 5FQAA 3VQZA 5ACRA 5HH6A 2BG6A 2ZO4A 3H3EA 1ZNBA 1SMLA 5LE1A 1M2XA 2OHJA 4DIKA 2OHIA 3A4YA 3FCZA 1K07A 2YNVB 2CBNA 5KIKA 2GFKA 5LCAA 2BR6A 4BP0A 1KO3A 2Q0IA 4UA4A 4HL2A 3S0ZA 2BMIA 3L6NA 3BK1A 2QJSA 1WRAA 2P4ZA 5AHOA 1KR3A 2ZNBA 4O98A 5EW0A 5LLDA 4TYFA 4ZO2A 2BTNA 4C1DA 3QH8A 3ZNBA 4RAWA 5ACUA 4EXYA 5EVDA 5EWAA 4UAMA 5AEBA 4AX1B 3IOGA 3I14A 3PY6A 1WUOA 2BGAA 2FHXA 4KEPA 2GFJA 2WRSA 5LSCA 2P18A 4AWYB 2NXAA 2WYLA 5A87A 2BFLA 4KEQA 5ACQA 3VPEA 3DHBA 2I7TA 2FM6A 2BIBA 5FQCA 5AYAA 4EYLA 3IOFA 2BG8A 1A8TA 2NZFA 4Z60A 5ACVA 3IE0A 5EVBA 3AF6A 3ADRA 5LCHA 2NZEA 2BC2A 1ZTCA 2FU6A 4TYTA 4ZNBA 3P2UA 3RPCA 3BC2A 2P97A 5AHRA 2QDTA 5KILA 2YNTB 1VJNA 4J5FA 4Z5YA 3X30A 4BZ3A 4ZEJA 2DOOA 4AX0B 1VGNA 4AWZA 1YCHA 2AIOA 3I0VA 3SW3A 5K4MA 2FHXB 3X2ZA 3T9MA 2GCUA 2GKLA 1E5DA 3X2YA 5EHTA 2Q0JA 4D1WA 4XWWA 5B3RA 1XM8A 4F6HA 2Q42A 2ZWRA 2WYMA 1X8IA 4UWOB 2QDSA 3IE2A 4Z5ZA 2R2DA 4F6ZA 3R2UA 2WYMC 1X8HA 5EVKA 2FK6A 4C1HA 2AZ4A 2FU7A 4D02A 2BFZA 3PY5A 2GMNA 4DILA 4V0HA 2FU9A 5ACTA 2BFKA 5AXRA 3JXPA 5HH4A 4EYFA 4C1EA 1DD6A 3IDZA 3I15A 1QH5A 2I7VA 2Y8BA 1X8GA 4TZ9A 4P62A 1XTOA 4XWTA 2YNWA 4AD9A 3ESHA 5HIQA 3AJ3A 1L9YA 5ACXA 2M5DA 2YCBA 4NQ4A 2UYXA 3KNSA 3RKKA 1A7TA 2YNVA 4U4LA 4UWSB 5HISA 4EFZA 3X2XA 4PVTA 2BG7A 4YSLA 3WXCA 3DHCA 3RKJA 4D1VA 4LE6A 1BVTA 4YSBA 2NYPA 2XR1A 5ACSA 5EV8A 3SD9A 3SRXA 2M5CA 3IEKA 4Z67A 5B15A 3Q6VA 5IQKA 1MQOA 2QEDA 4JO0A 1HLKA 3KNRA 1YCFA 3I11A 3SPUA 5HH5A 1P9EA 1VMEA 3TP9A 2E7YA 2H6AA 4RM5A 5LMCA 4UWRB 2XF4A 4GYUA 4EXSA 4C1CA 5A5ZA 4TZEA 2VW8A 2I7XA 4Z7RA 4NQ5A 4Z6XA 4FR7A 4EY2A 4XUKA 3ZR9A 1DXKA 3SBLA 1JJTA 2Y8AA 1YCGA 3IEMA 4TZFA 5HIOA 5EV6A 4RL0A 1JT1A 2BG8B 5LS3A 2YZ3A 4CHLA 4GYQA 4YSKA 4HL1A 4RL2A 3BK2A 3PG4A 4D1UA 1DDKA 4NQ6A 3MD7A 5LCFA 4J5HA 4WD6A 2P1EA 5HIPA 1JJEA 4H0DA 3T3OA 2HB9A 4D1TA 3BV6A 2YNUA 5A0VA 5FQBA 2YNTA 4RAMA 5K4NA 4FEKA 3IE1A 3KL7A 1BC2A 3G1PA 3I13A 1WW1A 4B87A 5K0WA 4UBQA 1ZKPA 5B1UA 5DPXA 3FAIA 3T3NA 2WHGA 2DKFA 5LM6A 1QH3A 4GCWA 4ZO3A 3F9OA 5A0TA 3DH8A 5ACWA 4EYBA 2BG2A 3AF5A 4PVOA 3ZWFA 4C1GA 4HKYA 3LVZA 4C09A 2A7MA 2Q9UA 5ACPA 3SFPA 4TZBA 1WUPA 1KO2A 4FSBA 4UWPB 3IELA 2ZZIA 2FU8A 1BMCA 5K4KA 5EH9A 1Y44A 4RBSA 2BFZB 5AXOA 2Y87A 3ZQ4A 2QINA 3DHAA 4NQ2A 2OHHA
chains in the Genus database with same CATH superfamily
1JDVA 1ZMRA 1DOHA 1I4WA 4EPTA 5I7HA 4UXIA 2PUCA 1TT5A 2PUEA 2KE5A 3H75A 1Q7GA 1SCQA 4IX1A 3TW0A 1QFXA 3GWGA 2B5VA 3KUKA 4ZREA 4FT2A 3A6GA 1KARA 3OA0A 5CLIA 4JS0A 4FQ5A 2DT8A 3JQ9A 3W2EA 2BLLA 1SMLA 4JOBA 4FW8A 3W8DA 1YMQA 2ODPA 1XL1A 2FQYA 1VLVA 2PH3A 3I04A 1GXSB 1A97A 1ZKMA 2CVZA 4EMTA 4JJAA 2OFFA 1LBSA 3HH8A 4EKEA 2H4ZA 1THTA 2AL7A 3PGXA 4MVJA 2I22A 4V0LA 1MRZA 1QGAA 1VYHA 2Y77A 3BRQA 4KQKA 1COWA 3GVXA 1TAUA 2HO5A 4WK2B 3DWFA 3P2OA 3NT4A 3QG5A 2CHFA 1YGPA 3BIXA 3P20A 2HK8A 3I53A 1XVTA 4HRXA 4LHXA 4PYRA 3DAGA 1R16A 1NSFA 2BGMA 1VLMA 1SC6A 1T2UA 2CDNA 3HKBA 4HD8A 1J1UA 3OWXA 3ZXSA 1OH6A 3AOEC 1DS6A 1ECLA 1P3DA 4GUDA 4RMGA 3IOBA 5FLEX 2VUHB 4U0KA 3MBOA 3VX3A 4P3XA 3LZCA 2NUTA 4IQ4A 4DV3B 1QHHB 3QOWA 5ESXA 2XKKA 4NDAA 3H9BA 3LBFA 5C46F 1CP3A 1IK4A 2EX4A 3EFOA 1YR9A 2C2HA 1IEQA 2EFCB 1P33A 2VK8A 3OKAA 4GW3A 3O9VA 3KSRA 4Y6GB 3IHKA 4JGGA 1P1CA 1UEIA 4EZEA 4JBIA 2PBRA 2I4OA 4J1NA 3K5IA 1HQDA 3ZYZA 4CR6A 5SV2A 5HX7A 2IZZA 2RBGA 4RKRA 1UK7A 5LQDA 3BOSA 1JE1A 2BP7A 5BPFA 2EZTA 2Q21A 3BC1A 3VYRB 1JQLB 2D5CA 2YZKA 1M34E 2J6BA 1ZK0A 5F5LA 4E4RA 5LQRA 2FPXA 4KH0A 4HLNA 4PHFA 5BW6B 3WJ2A 4M1EA 5EESA 3ZNOA 3ZZ1A 3F6EX 4R1SA 1N34B 2BTNA 4ZV7A 1UANA 3X2SA 2F9LA 1IHYA 1Z17A 2OZPA 3KCQA 1ISSA 4MYTA 5DCLA 4D3XA 4HWKA 4J16A 3I37X 1E59A 3THYA 3WGOA 2VOJA 4HYYA 4CG3A 2COKA 2COUA 1ZW1A 4LCBA 5A0FA 5JCPA 3LWBA 3EMKA 1UDWA 5B3JA 1HNZB 4WLVA 2SCUB 5HWSA 2P77A 4C1NA 5GZ3A 3H9GA 2YZ2A 1ZGAA 2HRZA 3KO8A 9ABPA 3I4FA 3JATB 5D6NA 5TMDA 2AC2A 3KAKA 3R6WA 2XH8A 5FL7A 2HQSA 1TL7C 3EVNA 4FZVA 4YY3B 2Q3LA 2R4UA 2YQ5A 4GSKA 3TLAA 3X1WA 4JLAA 1A9SA 1P77A 2QTGA 1N75A 2JKVA 4NCIA 4Q4HB 1WW2A 1ZD2P 3RU9A 1OXSC 3II6X 4KDEA 3AHEA 2BH9A 4OP2A 3W6PA 2OZLB 2FUKA 3EQ9A 4JSYA 3W7BA 1PS8A 1GN9A 3HYNA 1SXIA 3ODGA 5AKKA 2NZYA 2ZCVA 2R00A 4OGLA 3E27A 3PE4A 2YYZA 3KZKA 4GQIA 4A82A 1X1AA 4EYQA 2H85A 4I50F 4LXGA 5A7HA 1Z5GA 3U48A 1U8ZA 1LKZA 4QOSA 3TLXA 4Q1AA 2V1UA 3S28A 1SXPA 3HLKA 1VLJA 5D5PA 3OFSA 2IEAA 4LHEA 4Q1BA 1KEZA 3UB3A 4BEBA 2NSYA 4A8TA 4CN8A 3KWJA 2QSYA 4RPJA 4PDXA 3PR2B 1UBTS 4JNKA 1X19A 3AJ9A 3PUKA 4RPIA 4UQOA 4X3PA 3G5MA 2HDOA 1DO8A 2QP3A 2Z9CA 3EGWA 4FI3C 1J20A 1AKVA 4FMDB 4QU5A 1DINA 5F9FA 1VIAA 5AW0A 5J58A 4ISBA 5KJEA 2BTOA 4XX0A 4JJ4A 5D7NA 3WC4A 3AY7A 1DX6A 4IVNA 1ZTCA 1W73A 1WOYA 3OFVA 1JN0A 1K7FB 2HDHA 1WF3A 2ZSHA 1ADBA 1K92A 1M34B 3RVKA 3CLTC 4U00A 5AM1A 1ECPA 1MB3A 4PZUA 4ZEWA 3ROGA 3O2SB 3U1TA 1E61A 1W36C 1I01A 3ED1A 2Y1GA 1R0CA 5AHRA 4AKHA 1GTRA 2H4WA 1YS4A 3LPAA 4ZRDA 3NAZA 4B46A 1DKUA 1EBBA 2FJPA 4S0XA 3F9IA 2P9EA 1QSGA 3C98A 1I1OA 1U80A 3CLRC 2V7GA 4LHWA 2A0WA 5KVAA 3O6VA 2J4DA 1Z6ZA 1DKQA 1ABFA 4QO7A 1W34A 5JNRA 4IDNA 3E9ZA 4HN9A 4ZO4A 4G8DA 4UJ3A 4X0EA 4JI5B 4EGQA 5AQ1A 4UQLA 1GKIA 4F2HA 5LD2C 1E3IA 3VU8A 5JZ9A 4Z7NB 2JHCA 3RGGA 1VJ0A 2Z2JA 2P6NA 2WVHA 3DEAA 1YNOA 4EHLA 3LHDA 1XTTA 2DPXA 2J7PD 2ORED 3NUZA 3HS3A 1E98A 2XWQA 1AVTA 1XYYA 2HMTA 3PWSA 4W9MC 2UXDB 1EZ1A 2YBEA 3QV1A 1HUQA 5AICA 4FKZA 4J0DA 5FKJA 4IIUA 1H93A 4CMHA 1T9GR 5CDYA 1GFWA 4ZCQA 3ABIA 1UWVA 3UAXA 4LEIA 3L7KA 4XEUA 4HJRA 3PNVA 5EQJB 3OE7D 3ZE1B 5LR6A 3OOYA 2W4QA 4EKDA 4JY7A 3NYQA 1XI2A 2ZBQA 4PS1A 5EGNA 2HPAA 2GUWA 1GHTA 4XEHA 5LKRA 4KH1A 1FU4A 4QGFA 4FI3F 3IB6A 4NI5A 3CBQA 4TL9A 5H9VA 1YB5A 4HUTA 1AV7A 1H4VB 4CMEA 4BJ6A 1NP3A 4F3TA 1RWVA 4UHFA 2JGDA 1ICEA 4DYHA 1B41A 4W82A 5EE5B 1QFYA 1RLUA 3IAM6 3NP9A 3ROPA 1MO5A 3F4BA 2ZWMA 3KAJA 4K9PA 3ZLJA 2NZ2A 1VDMA 4MYHA 1BQ4A 5EVKA 3LMKA 3VSCA 2I67A 1ETHA 1ST3A 2C96A 3OTWA 3UIEA 2DBYA 2CHQA 3K20A 4HNAB 3QFRA 1CEYA 1LWNA 1LDBA 5ALUA 5AHXA 1AF7A 1CR4A 4FDAA 2FYTA 5IYZF 3WBKA 3PY5A 3M9XA 1T2DA 2J6CA 3GOHA 1QRDA 4D26A 3IBCA 4HDMB 2FK7A 3DOOA 1URPA 2XYHA 1U0JA 3COPA 2EHDA 1MD9A 4BB0A 3PC4A 2QT0A 4MRAA 2VP5A 2XT0A 3QUAA 5IMSA 4G67A 2PJDA 2H48A 4REMA 1J5PA 3A25A 3ZCQA 2W6NA 4QYTA 1YIDA 2TMDA 4XTCS 4YP9A 3KTAA 5JAQA 3R77A 3FYSA 2YZMA 2GJ9A 4TQ9A 3OLCX 2BKLA 2E9SA 4AL4A 1XTOA 4NBVA 1JJIA 4NCAA 3CX3A 3E3NA 3IQDB 2BUCA 1OHHA 1JKXA 1KH1A 2RIPA 4L9SA 1ZCJA 8ADHA 3CWQA 5I9IA 2GFQA 3VTFA 2PLRA 4J1TA 2R6DA 5ITVA 4UTPA 3KYDB 3M5DA 4EVQA 3GEHA 1L9YA 1HM5A 1X0XA 4HEHA 1FPQA 1XN4A 5ACXA 1EDZA 2GSWA 4UM5A 5C1IA 3SM9A 4DARA 3E9MA 3F4KA 3A9CA 3IAFA 4H7KA 5EJMA 2W6JD 4I4LA 1VTKA 2NYRA 3IC5A 2YRXA 3C6XA 3WGLA 3C5EA 3HCAA 2BG7A 2Q07A 4US0R 2V7WA 2YH2A 3UEOA 1SOUA 2N42A 3LECA 4MH0R 1QM5A 4NV0A 1PT8A 4CDNA 2A1UA 3SVZA 3RKSA 5FOUA 4D1VA 2G71A 1RKUA 5EZ5A 1RVDA 3EMDA 3PC8A 3PL5A 2I6UA 1CEXA 1PGNA 1YGYA 3QXXA 4LSGA 4PHHA 2P2YA 1PFGA 4QA9A 3WA6A 5K9ZA 5KIAA 2A30A 1SUDA 4GIBA 1TIKA 4EPRA 1EI9A 3TOZA 5C35A 1SVNA 1D1QA 1EIZA 4ND6A 1H6AA 4X1KB 1HNXB 3E2IA 3NVAA 4PLGA 4Z8YA 2VPZA 3H6GA 1ODCA 2ARKA 4RHFA 4XWKA 5KNCH 4H1VA 1N78A 5M5BA 1P17A 3FJYA 1TTHA 3DULA 2CXRA 3MUOA 5JBQA 2PEYA 1OYVA 2EIXA 4LPKA 4KOAA 3TL6A 2YWJA 3AJDA 4G01B 2WB2A 4PAOA 1VG0B 1PL0A 1VMEA 4Q9HA 5JSHA 1VQ1A 5EP3A 2GYVA 2EEPA 4JN6B 2QN8A 4AP6A 4BU1A 1J8MF 1GGJA 1LUAA 2R5FA 2IT1A 2WW8A 2XDWA 3D31A 3NHMA 3UWMA 3W8FA 3U2QA 4E5UA 4CMBA 1DO0A 3ZOZA 1DKLA 2KYRA 2NX2A 1YQGA 2QEQA 2VDMB 5I7VA 1DEHA 4MWCA 1NN0A 2C99A 1DIAA 1FFXB 2QX6A 5J5CA 4HGQA 4AF8A 4FILA 4XYEA 5DXFA 3D7NA 3T1NA 1Q92A 1TM3E 2UUPA 2VF8A 3AGPA 4LJ5A 3UMBA 3SPXA 2JGMA 2OE2A 1X7YA 1DQRA 3P96A 1AUVA 4B3IA 4KQ6A 1RYDA 4PAGA 5IEBA 1N7GA 3RUHA 5CYGA 2C00A 4BFLA 1N0UA 1C9KA 2CFRA 2RBKA 3UHOA 2SKDA 4PNPA 5IJ0B 1DXKA 2ZSUA 4NYIR 1QVWA 1H9AA 4XIGS 5E7MA 4AW9A 1JJTA 4BHTA 4RZUA 1W5EA 2WIGA 3DCJA 1VPLA 3SHVA 4KDFA 5F51A 1UOOA 3GFOA 3X43A 3N3BC 4AF6A 3LDGA 3MN1A 5I3ZA 1JLMA 2FE4A 3ESDA 2PMBA 4CNQA 1LDNA 2EW1A 4BB9A 5BN1A 5ICGA 2FP3A 4M1OA 4ZU1X 5EZ6B 4KI0A 3IT3A 2I54A 5AOVA 5EIEA 4M38A 2XB2A 4NV1A 1EXMA 3GP3A 1I7LA 4PGFA 2FK8A 3WBFA 3K71B 3WFJA 2GK6A 1Z2EA 3NDJA 2ODEA 4C20A 4FFLA 1N1DA 1UF9A 3LXUX 3UT0A 3ZEAA 3A2LA 3CIOA 4R01A 5DGDA 1OXUA 1W87A 1EXVA 1F5NA 4PZYA 4BE7B 1WMFA 5EPOA 1PGOA 2Z2XA 5AH0A 5U9CA 3N87A 5IDQA 3EZ7A 2MWMA 1XZMA 4QVKA 2GXQA 3EPKA 3ZGOA 4O4LF 5JSKA 2PHZA 2V9CA 3KWFA 3P9QA 1ZGGA 3HN2A 1DDKA 1UMBA 1CKEA 1QYXA 4YBZA 1ODLA 1E5LA 3ANLA 1TMYA 3COSA 3K0SA 5DYGA 4XJVA 5AW2A 2CV2A 1O03A 2DPYA 3PNQA 4AF7A 1UFKA 2BKUA 1L7VC 4BWYA 4FFSA 2AHRA 1KKLA 1LLDA 5TE9A 4TYQA 5KI6A 2IXDA 3ZIUA 3UB4A 4EMUA 1XWWA 1X7DA 1ZFNA 1NJ8A 1GLGA 2BGUA 3GA0A 4DMKA 5CVDA 4NP6A 3HADA 3T0GA 1BE8A 1OAAA 5CRIA 5LXTA 4KE7A 3HXTA 4ZOAA 1G6Q1 4AI6A 3LPNA 1U0TA 1NRXA 1Y42X 3BIWA 3K70C 1DPFA 3TQHA 4FMPA 3VU9B 2NNLD 1MVLA 1TNDA 3MWDB 1KK3A 2JANA 3Q5DA 4QTYA 5KWVA 2DHQA 4UBNA 5AKGA 5LZ7A 3L40A 1EX6A 2XCUA 3M2TA 1O6CA 1BMDA 3EEBA 3OIGA 4JUIA 4UOZA 5SY9A 5JEEA 1WSAA 5HE8A 1NJ1A 5JZSA 3A04A 1JA0A 4UZSA 1OLUA 2FP4A 4XQ0A 2Z9DA 1DADA 4I8DA 3B1FA 1JT2A 1TQ2A 1WDMA 5DPXA 1U0BB 1DAOA 1NBIA 1PG5A 3IJEB 1MENA 4DLNA 5JWRA 2HUPA 2P9BA 3VYTB 3UKJA 4UEQA 1T3SA 3BILA 4EUHA 2Q3EA 1U9IA 3GIDA 3RT1A 1RI2A 3ENVA 1MV8A 4FSHA 4F8EA 5HUJA 1Y6QA 1HFWA 2O8FB 1EUQA 3MJEA 2J1LA 4IILA 3V8QA 3AFHA 3KETA 3DMHA 4OXNA 3NBXX 4XFJA 3HNRA 4PG8A 4TV9F 1DJLA 1IWBB 2FY8A 3NGMA 1ILEA 1XKXA 4R2JA 2GCGA 2ZR7A 4M9ZA 3BPSA 2YBDA 4YRGA 3I5XA 4B35A 1F1BA 4HUJA 2JLWA 3MILA 5A4JA 3LKVA 1YZGA 3CVJA 2BGWA 2OYRA 1MOQA 5CK5A 4EW3A 4A36A 2WFAA 3K0CA 3GVCA 1JAYA 3ENQA 3V4LA 2NU9B 2WMNB 1M2HA 1Y3BE 2EBHX 3FCUB 1XEWX 5ALTA 2X0NA 4J0KA 3WRYA 3KB8A 3OT4A 2AE1A 1VLLA 3EAQA 3K8YA 3DLBA 1E2DA 2QZ9A 1JKJB 5ANRB 2PUFA 3DBLA 5EUQB 1Q95A 3RTCA 5JMWA 2NWQA 5EHQA 4G0UA 2IELA 5HGXA 3B13B 5LA6B 3ITNA 5ENVA 2Q8PA 3HU5A 4RWZA 4KACA 4WPGA 4DC1A 4EF5A 4TPKA 3V5NA 4DV0B 5A5DA 4GL4A 1ZSYA 3D7MA 3GXOA 3Q10A 1C4XA 1SHZA 4JLSA 4OM8A 4TROA 5A9TA 4INOA 4BV3A 2FPIA 3COYA 4BB6A 4CIVA 1KH2A 2OZVA 4ZYUA 4RYLA 1QU3A 1EWQA 3G7SA 4C0WA 1MNQA 2DOKA 4F56A 4XB2A 3W8NA 1PZGA 3B3FA 5JADA 3EPHA 4H17A 3S81A 2LCFA 2GBIA 1P6QA 2DHRA 3TGWA 3U3DA 3F7NA 1UM9B 2WWIA 1WZUA 2R4TA 3DM5A 3L6OO 4P6VF 1QIDA 2A4KA 3WG9A 3FNBA 4DZRA 3THWA 3Q8LA 3KJEA 1CWUA 3DXYA 1TU3A 1ZCZA 2DE0X 2WWTA 3V6MA 1N6NA 5A3RA 3ANYB 4JX9A 2IYAA 2XECA 4TRMA 4BV8A 3AV3A 3FNQA 3LXRA 3WNZA 1KMMA 5C53B 1Z34A 4CG2A 3FGPA 3MTQA 3RC2A 3C6ZA 2GEVA 3V8PA 4ECAA 3CCBA 1WLYA 1XX6A 4MQEB 5BV8A 5JYEA 1XP8A 1CY6A 3DFMA 4WCFB 3WXMA 1GO2A 3TZCA 4DJTA 4MQBA 2A86A 2FWMX 1NVBA 3JAKB 4NR0A 3THRA 2WPDD 5ALKA 1N6RA 5GIPE 4OB6A 4Z4QA 3NTOA 3GVHA 3NM4A 4JJEA 4B3CA 3IVRA 1ESMA 3WLFA 4BS9A 2C58A 1J06A 3OVMA 4F5WA 5LWQA 3T3GA 4RTRA 3MK31 3V4RA 1KORA 3ZWFA 3C16C 3L7BA 4LV6A 4YDSA 1WUKS 3GW8A 5AM5A 2CXTA 4D9KA 4M0UA 3CWCA 4EUSA 5I47A 1CUVA 4DUGD 3BM5A 3OZAA 1E3JA 2RHCA 1N9ZA 4R3WA 1MQ9A 3N70A 4RHUA 3FROA 5JCJA 2X1HA 5FD8A 3W3AD 2FZKA 1DOAA 2ZBPA 5ALPA 1KETA 4JROA 1KY3A 1HPLA 1SHJA 1YKSA 2W8BB 2NXWA 1I13A 3DNMA 4S1TA 1M2GA 1QP7A 4C3ZA 2BCGY 5DPMA 1OV4A 3REQB 5BMVF 3I9NA 4ZMSA 1DUSA 1EP9A 1KR3A 4QYMA 2BFEA 3Q9SA 4L5CA 5DKFA 4DUPA 4FHEA 1G4AE 3HP1A 3PG5A 4K9OA 4P34A 1VKOA 1HX7A 5F7XA 4C1DA 2YWXA 4KWCA 1TZJA 2WT4A 4KGDA 1QGUB 2B8EA 1JR6A 1CC1S 4LJKA 1O95D 3I9MA 4MWZA 3T7CA 4O5AA 5EJ7A 3ZNBA 5BQPA 5L3RA 3NC4A 2QE7A 4FKMA 4I5GA 4AY3A 1SHKA 1P4HA 3O84A 5G02A 2UZ1B 1VLQA 3AG5A 1QGDA 2E48A 3N6VA 2A1IA 1DIHA 1IPEA 4IZ6A 2FFBA 2PX5A 4C0QC 5KHLB 1YS2X 3NWJA 3R3VA 4V0MA 5EMNA 3ZX4A 2DXIA 4J16C 4JLDA 4QGAA 3RFUA 2QRKA 3DDZX 3ICOA 3KP1A 5DBIA 3ZU6A 3TINA 5IS2A 3BE8A 1Z5NA 1W4AA 2I65A 1SZPA 5I7WA 4I6EA 3LVRE 2AN1A 1JILA 3HKCB 5B3JC 5JARA 1WD5A 2X40A 4QGBA 3B6KA 3TEJA 3HM9A 4MHTA 1PR5A 3N2KB 1M2JA 5K5EA 4MVJF 2IU0A 1MOPA 1IC6A 4UOQA 4MUKA 1BDHA 3RIYA 2WWRA 2WRSA 3WIDA 4QFMA 4BO8A 3PA6A 1T9ZA 1KE1A 1H0SA 1LC3A 1IZ8A 3OF3A 4AXXA 4CEHB 2BSXA 3ZHTA 4YAGA 1RKQA 1XP5A 3D7SA 3E0QA 5JHGB 1SBIA 4ZRNA 5G4LA 2Q5QA 8AT1A 5HFNA 2CV1A 2DFPA 1FDOA 4CMJA 2BMEA 5DLQC 1N3LA 1GQRA 3AF3A 4MRSA 3R1IA 2XNDD 4OF4A 1SUPA 3KR0A 2W2OA 1V37A 1G63A 4X7PA 1DRKA 1KK0A 5K4GA 2R00C 4NNJA 1BEZA 5FQCA 2OR3A 2G7MC 3K31A 3P71T 5BV7A 3UOAB 4IO1A 3CPJB 2QP9X 3DH0A 1E58A 4PYIA 1PJAA 3DMYA 2O1SA 3KJGA 1WP4A 2JFQA 1J49A 3EF1A 3QI7A 4GYYA 4RCVA 3X44A 5CAEB 5FBVB 3VO8A 2C7PA 2HCJB 1D2MA 3EXEB 1RJDA 2X0DA 1O9GA 2BEUB 3I04M 5IC4A 3VHQA 2AC7A 3KZVA 2O2HA 4ZHQB 3ADRA 1C7QA 1JBEA 2FW8A 2GJ4A 4L8LA 4MVJM 1S3FA 4V0RA 1AKTA 4YT2A 3WGVA 2APJA 2QTBA 3SBEA 4JFRA 3SQLA 3RQIA 4ZOBA 4DYDA 2VH5R 5TF4A 3R7WA 4OTZA 5I4KA 2P9FA 3SEZA 4KFCA 3D59A 3ZIDA 1XCBA 1KYTA 2JKYA 5G3ZA 3TW6A 2YWRA 1XQ1A 2D2FA 3GB9A 2FWRA 4QXQA 1SUWA 7ABPA 5K8UA 1CUGA 5EE9A 4ZAYA 3OKFA 4GP7A 2C4WA 4Q9AA 1XMOB 3ZS8A 5DNCA 4QE3A 3I8SA 2GCOB 3R7LA 4M83A 4EYEA 3FFTA 4YRDA 16PKA 3KPYA 3E5NA 3ZBPA 1QHGA 3BGSA 1BRTA 4BFWA 4DCJA 1VJNA 3TLGB 1IY8A 1DKPA 3PE6A 3H1PA 4JVLA 4QFCA 1U6KA 1KZHA 3BGOS 2DQKA 3RFCA 5JNWA 2IUSA 3FKJA 4D4IA 5AJYA 2RGUA 2XIJA 1MJFA 2NO4A 1ND5A 3LBAA 3V42A 2VWGA 1HBJA 4RC9A 1ZM4A 3STTA 3K5HA 4EHFA 1O2DA 2IPLA 1RMYA 2XNSA 3DLCA 3JVIA 1PJBA 2LIVA 2ZIXB 3Q72A 4AJNA 2FPWA 2Z30A 4NCKA 1MLDA 4LVUA 4ND5A 3VR4D 3VNVA 3MAJA 4N7BA 4TV8B 1G1AA 4FYJA 4V1CB 1B23P 1VRVA 3K9LA 1DJNA 3LJKA 5AXBA 2RHRA 1BYIA 5KNLA 3FTPA 4IDQA 4RPCA 4PY2A 4C5AA 1QNFA 3IT0A 2Z5GA 5LSAA 2CYCA 5DNDA 4ZC8A 1F0KA 1VGVA 2ZRCA 3N2IA 5CJPA 1XPOA 5FTMA 1MJGA 3MUEA 3BVPA 2BBSA 3IESA 2ERYA 1UP6A 2DBZA 3LHSA 1L4NA 3B1YA 4G5OA 1IN8A 5J1TB 2VT3A 2GEKA 3USES 3PWTA 3WZ2A 4ZCRA 5J1SB 2VQSA 3M4NA 5A1JA 4BRUA 2V97A 3UXMA 2D1TA 3R2UA 4MYUA 1GQFA 3GHYA 3N6RA 1M74A 4U7FA 4R71A 2V4MA 2VF5X 4M9CA 3THXB 2EWWA 5EZYB 3OHPA 3PICA 3CPHA 3GX1A 4TLEA 4DG8A 1NVMB 1CJCA 2O48X 2YHUA 4ABYA 5H4HA 4F5ZA 1U0EA 5IT0A 4ZN6A 3LUFA 3A6KA 4NY1A 4QC2A 3WMGA 3KQTA 2PL3A 4X71A 1OPXA 2KX7A 3HPQA 4U3JA 3BTOA 4LMRA 1TVKB 4Q24A 3MWEA 1V5FA 1XVAA 2EF0A 4WNAB 3VVLA 1E6WA 1VHTA 2PCLA 3VDQA 1FP1D 2C9OA 1E0DA 3PX3A 2JJ2A 3UK7A 1I33A 4IV0A 4HVAA 3NWOA 1XTUA 5B57C 2H06A 4RY8A 4Y2VA 2RD2A 3EDRA 5LNK1 4H18A 3TJRA 3O4FA 1Z7GA 3QFTA 3TIIA 5AW1A 2GLTA 1EM8B 3RGWS 5HRCA 2IZ7A 3D4BA 4BVBA 4E70A 3ZLTA 1QBKC 2WU1A 3ZU4A 2QRNA 2Q2WA 3LBYA 3FPCA 1P7ZA 2VF4X 2PLFA 4OA8A 1QKKA 1KMNA 4IH4A 4CV2A 1E4VA 5JDIA 4DIDA 4UVDA 3GLGB 1GU7A 3SQNA 4O4HB 1PNOA 1Z06A 1G55A 5DTJA 1U9JA 3OZUA 4N0PA 4BNJA 4BB5A 1NBMD 2JC3A 2YCBA 3JZIA 3TNYA 3JSAA 4NL4H 1ULZA 4LRXA 3ECAA 1DLJA 1XZNA 1N6PA 2V5UA 3FR8A 4JX8A 1NF2A 5COQA 2NO7A 3NEAA 4J1TC 2EZ9A 1KDYA 4A0GA 3PIRA 1KNQA 4I1UA 2ZATA 3H9UA 3WKAA 3ZD8A 5AM2A 4K7JA 5F77A 2R62A 1CRQA 4JEHA 3ZTYA 2A7XA 4HBGA 4X66B 2WFLA 4Z9AA 1UEJA 1X77A 2VCYA 3KU1A 3VC2A 1E63A 3WGYA 4KR0A 1DRWA 2XOXA 4JITA 1UH5A 1EFRD 1E1DA 1FOEB 5B37A 3S29A 1OIWA 1ULSA 4DDVA 4PZZA 4PCUA 4K46A 4OLJA 1TGVA 3TK1A 1L5OA 3FRIA 1TUBB 1PV4A 1U7XA 4WA7A 1H2EA 4QVIA 3WAKA 2EP7A 4B4VA 2GM5A 1T4CA 4G9BA 3RG8A 1GITA 1SZCA 5GONB 3RIXA 3DAHA 3SYRA 1W5TA 5EWLA 4HQ0A 4U5QA 5C34B 2JLYA 1XTVA 5FBHA 4KXLA 3R7BA 2GASA 3PC8C 4KFTA 4LGCA 1C1DA 2H51A 3BEDA 2NSHA 3FCXA 5DI3B 2XJ4A 3WWDA 4I99A 3ZWNA 1PV2A 4NFYA 5IQKA 4KN6A 2AIRA 3CH4B 1K2VN 4ZU6X 4J0EA 3HWSA 3T3DA 1CLUA 5KWEA 1B00A 1HLFA 4WKOA 2F8TA 2ZS9A 3OZ7A 2ZRHA 1NNSA 2ORVA 4RVDA 5EMJA 2G1PA 3NONA 1I3LA 1J2UA 1G7SA 1YK0A 3RC3A 2RH4A 3IMCA 2OAGA 4RF2A 3W1VA 2IU4A 5JNSA 4QECA 1YJ5A 3NIDB 2IK8A 3KHSA 2EQ5A 2G0AA 2V4UA 2ZSAA 3UJCA 5BUZA 2WJGA 5F35A 2G0TA 2WU8A 1OXVA 2R7LA 2WTEA 4GR9A 5CA1B 3UK6A 4PSVA 4C87A 4N0MA 3TX6A 1X1SA 5B6JA 2XUAA 3N8GA 4PFQA 2MSKA 4AMZA 4HT3B 4YBRA 5H3LA 3JAMA 5EUMA 1JDSA 2A0FA 2VCHA 3ELBA 4WASA 4D9HA 3LCVB 4GI5A 4H1HA 4CM1A 4YR7A 5JR3A 4FR7A 2AXEA 1YI0A 3OCYA 1UBLS 1P2UA 4TTPA 2A8YA 1LVGA 1HRDA 3MSCA 1NQTA 6CHYA 2JFFA 2HK9A 2OEPA 3LPLA 1YZTA 2JVIA 4JU8A 2DWUA 3HACA 4UQPA 4WI1A 5EYPA 3EYAA 3U7QA 5JAIA 5DN6D 3L8GA 1KJIA 3DO6A 5FCDA 4RIIA 3A3KA 5G40A 4E2YA 1L8XA 2JJ1D 1U5CA 1R4MA 2JBWA 1YCGA 3LQKA 4L8FA 4P58A 4R84A 1CY4A 2DHEA 3JX9A 3UANA 4HS9A 4M7PA 1Z4NA 4AYXA 2ST1A 2NVUB 1KK2A 1XZDA 4IDDA 4OKSA 1BFDA 2CCGA 3W5BA 3DE0X 1WDTA 1QRAA 1LWOA 3E1KA 4U6SA 1Z4LA 3WGQA 4AG6A 5FPTA 1DOZA 1Q1BA 4ZZ3A 4OHMA 1UOQA 2RDMA 4JP3A 3SI7A 5JROA 3GMDA 1NUQA 4U2GA 2C7OA 3IQXA 4HKTA 2E4YA 5HM6A 3FHLA 1P19A 1Z62A 1R0LA 1IL0A 3KV3O 4IV5A 2ZK7A 3D2BA 1P0FA 3OOHA 4LRUA 4JB2A 4CLOA 4J0CA 1E2JA 4P92A 1N1EA 1OMOA 3JV7A 4H9GA 3T0FA 1S2LA 4LNAA 1J0DA 4CHGA 3SKXA 9GPBA 4NZOA 4RD6A 3MD7A 1N2EA 4IJQA 2LGJA 1KU0A 2P1EA 5J4VA 1IVNA 4CUJA 1QTQA 4FOTA 5AHWA 2W71A 5E9AA 3RC8A 3G5UA 4PXYA 1YAHA 4MP6A 1MNAA 1CG6A 4XJXA 4KRXA 4BLOA 4DCTA 4R8SA 1F6DA 1HDXA 1SVSA 1WCXA 2J5QA 3MLEA 4YEDA 3RSFA 2X7JA 1SVLA 4TMYA 5BN4B 4DHWA 3KE9A 1OQAA 2YNUA 1T9KA 2CYBA 1WEKA 3QXSA 2I8AA 4L02A 4DLBA 3J7AC 2IW3A 4BECA 3PQ5A 1F9AA 3DL0A 1E92A 5C9ZA 3UOWA 1A96A 5KWJA 1NQ5A 1BX3A 1TT7A 1GUBA 1AIPA 3K0FB 4BMSA 3GP5A 1D9ZA 3QW2A 1KK1A 4BKRA 4CWAA 5T57A 5HJ2A 1M8PA 1QLHA 2BM0A 3B2QA 4BAZA 4WLUA 1JEYB 2F48A 3GLIA 5EPEA 4JI4B 4UZFA 3U7EB 3QVVA 1NNUA 3FNIA 1Y7LA 1E62A 1P8AA 4RA6A 3F9CA 2HL6A 5IDWA 4LTDA 5I8ZA 4QGSA 1R9MA 4IDPA 4BNHA 1I6MA 3X1ZA 1CETA 1QYRA 1ODTC 1UBEA 1V39A 3GDWA 3L9WA 3D6VA 2WG0A 1T3GA 2IHKA 4IH9A 2L2QA 4JH0A 3G0OA 3Q7SA 1TC1A 4YCDA 4DRZA 1FQWA 1LDEA 1HF3A 2BFDB 2Z3WA 3DTNA 1SBQA 4P5PA 3ST7A 2NUAB 3A6LA 2CBGA 2X23A 1Z82A 4KXQA 2B98A 3M34A 1FW6A 3RPEA 4LBWA 3ZHVA 2AJDA 1UT6A 2C4MA 10MHA 4KQWA 1LS1A 1D6MA 3ADCA 1H1LB 2IE8A 3AFOA 5CB4A 3DH8A 5ACWA 4Z6KA 1Y63A 1JJAA 2DFVA 2VVTA 2YS6A 3G1WA 3AYXB 1PT9A 1U9IC 3DEFA 4DIOA 2EKQA 4DKXA 2IXAA 2FUG1 2OXEA 2P65A 3MWFA 3EUWA 3UW1A 5EJIA 3RYCA 1GL9B 1NPTO 1BW9B 1R10A 3Q2OA 4U8GA 4RJTA 5B1DA 3RM3A 4RGQA 4UASA 1Z7BA 3BMQB 1JV2B 2DMRA 1BAPA 2ZRAA 3DAPA 2CVPA 3KKQA 4JLPA 2R5NA 1HDCA 4A5SA 1LSOA 2PUWA 4LS3A 2KM1A 1BMCA 3SQMA 4NLLA 1CR2A 3NHJA 1ODIA 4XWGA 1Y44A 5A7FA 3JAWA 1Y6JA 1WY5A 2GH1A 2BIFA 2QRZA 2PU7A 3HI6A 3K0CC 3M1LA 4FYHA 3HV0A 1JFFB 1JLLB 1QE3A 2J9XB 5D3KA 1CUHA 1GUFA 1Q7CA 2YDXA 2BUBA 3HFRA 4A6PA 1R3DA 3UKDA 3WRYC 3ZJ5A 2P35A 3PD0A 3UJ7A 1GTVA 1NU6A 1PW7A 3FTQA 3LY5A 3Q3VA 4G4SO 3CZMA 2X0RA 3KZXA 2RG7A 1DDIA 5DBGA 4G1EB 4F45A 3G9XA 1UDRA 1WMSA 1BA3A 2J9YB 1ZOPA 3MOSA 2HF9A 2ZSDA 3L43A 1FFGA 4H3SA 1PN3A 4QDKA 3N1UA 4D45A 5LXTF 3TCNA 4F4DA 5LC1A 4EG6A 2JB9A 2W43A 5BXYA 4BPBA 3H2HA 3FFWA 2LVBA 4OMDA 2EL7A 4OLBA 1AHNA 4MI1A 2MU1A 3HL4A 1AZWA 2C07A 5CCXA 2QVYX 4JBXA 4CKCA 2HK7A 3MJ4A 4BEJA 1N57A 4B2LA 1U65A 2EF1A 3NHRA 4HZUB 2WFMA 1OU0A 1S5PA 1V11B 4D46A 1K07A 2IWRA 3D3NA 5K6AA 1C81A 5IH3A 4OQXA 2C1EA 4DRXB 2O07A 3NHZA 4MSUA 1KEUA 1NAIA 1HV8A 4PPGA 5J4KA 3U7HB 2HHHB 4MWEA 5F1YA 5AK5A 2X5JO 2FFRA 2D00A 3G8AA 2B6HA 1CD5A 2C83A 4KXFB 2ANCA 5BOSA 4ZXPA 3MS7A 3E5MA 1ULTA 1UP4A 1MR3F 3IBYA 4MA0A 1JDJA 2IEBA 4UVIA 1NONA 2L42A 1F2DA 3INYA 4E6EA 5BN5A 1SZDA 2V7QD 1IZ9A 3EZYA 4L4UA 5HKLA 5TPZA 3EASA 4MS3A 3ZKWA 4F12A 3TF5A 5KTKA 4H4EA 1TX4B 2OENG 4EW1A 4NCXA 3V48A 1AD2A 3CKMA 4RQTA 5J5VA 4HL2A 5L53A 4HS4A 5EMLA 3B6EA 5COBA 5KYNA 1HXHA 1SZJG 2NSDA 2AZTA 4G8JA 3ZH2A 3AW9A 4P3YA 2EX0A 3WB1A 3D1LA 3LM8A 3KM0A 4W4TA 3UT5A 1V5EA 2H00A 3WGMA 1MB0A 1NLZA 4LY3A 1CJVC 2IH2A 5D2CA 3IMFA 3M6XA 4MMXB 2BBTA 4JENA 4L0CA 4MV0A 1GCUA 2B6NA 2LE0A 2IOHA 2YIDA 1NQVA 3WY9A 5DM60 2A9FA 3P9PA 4OQYA 3QH8A 4DV6B 2ZUFA 5JFGA 1PT5A 3BXOA 3MCZA 1K5GA 4H3HB 2R6AA 2GR9A 4RMJA 3TLKA 1GZ4A 2J8ZA 5KC9A 1XHFA 1QHXA 1GILA 2X3UA 4QJ4A 2ILTA 2V0NA 3BBLA 1TI7A 4DLTA 4EJFA 3IODA 4NURA 1C2YA 1MX1A 1AHIA 1CJUC 5CPBA 1V5WA 1XJ0A 2XVYA 4B8ZA 1SUIA 2ZE8A 2ZTUA 4FYVA 4KZKA 4D97A 3JQPA 4DCNA 3FAZA 3FPGA 1G3UA 4BQIA 3H5RA 3D02A 4CL2A 2JD0A 4Z0NA 1BN6A 3RS3A 1XJQA 3G8DA 5AJUA 4BNLA 2XNCA 1YDFA 3GJRA 4JCCA 1I14A 2G83A 1H3NA 2NAPA 4KFRA 4RKQA 4TWIA 2ESRA 1DELA 1RI3A 3KDPA 4ZOQI 4KEPA 4DM7A 4QJBA 2TS1A 4GZ3A 3AKEA 5FBZA 4A8JA 2Q4RA 1UPFA 3UJ8A 5JBNA 3F7MA 1NF9A 5JLJA 1DEOA 2QSUA 1ISGA 1ZR2A 1HSZA 2ZXFA 1Q1ZA 2O7NA 2ZSKA 1Z5WA 1JIKA 3LOPA 4ZK2A 1AQIA 2VTBA 5A3QA 4EI7A 5FADA 4A8PA 2TECE 3AVWA 5A87A 3P9ZA 1HDEA 4FLMA 1FIUA 1PFVA 3FI9A 1EP2B 2L69A 4Q3DA 3U3XA 1ZHOA 5JAZA 1T13A 1HZJA 1LY1A 1YOVA 3FMFA 2QRHA 3N3AC 4US1R 3WGJA 4M6WB 3VNQA 2F1OA 2NUPA 2XUGA 4LA4A 2FG6C 1AKMA 1STOA 3PENA 4U7HA 1K7CA 4DCGA 1KWGA 3FR7A 4B6PA 2P6OA 1MQSA 1FJGB 2BG8A 3E3OA 1XTBA 2LWIA 2NQ8A 5B1YA 1N5KA 3NORA 3ZUPA 3WNDA 2ZTVA 1BGXT 2EJWA 5H59A 2HGSA 1VB5A 1P0IA 3G23A 3IULA 2PK3A 3V46A 2EP8A 1XNGA 4N18A 4CV1A 5THQA 4A16A 3U4MA 3PXAA 2BE7A 2I1VB 4G23A 1ZVVA 2C0CA 2QRVB 5MHTA 2I99A 1UC5B 3E9NA 4RK6A 4EBBA 1GAXA 2QR2A 2EFYA 3PTLA 2BEJA 4ARSA 4LDAA 1SCUA 1XALA 2NT4A 5FWYA 4HDRA 2QJFA 4REQB 1NQWA 2FFHA 3WDKA 1IMJA 2HXSA 2O5EA 1IHUA 1TTPB 1UFRA 3D8BA 2BFOA 2R84A 2I4RA 3FUUA 3C1UA 4MYRA 2QL7A 5FLKA 4W5HA 2ZRKA 3DAYA 3LBNA 1EXWA 2YXNA 4PO1A 1V16B 4NZ9A 3VR2D 1KMHA 2ZRBA 3WYCA 1FP4B 2VJDA 4UM8B 4UHHA 5D1NA 4WZBE 2P9CA 3EY4A 4BX0A 1KO8A 1D2NA 5F73A 3DUFA 1QGZA 2C2ZA 4HUQA 1XQYA 4FGUA 4UE2A 4A26A 4XWAA 1L5LA 4FBLA 4IKPA 1KI6B 5JVDB 4ND7A 4NJOA 1ORTA 4I81A 1G0OA 1DV1A 1L5FA 2QRUA 3A32A 5LZ8A 3RFVA 3N0WA 2MYUA 2FH5B 1NVXQ 1EP1B 2QN6A 3QH4A 4HWRA 5KYYB 3VU1A 1K08A 4QBTA 5HNKA 4RESA 5H3CA 3WZLA 1Y9AA 3ZKAA 1EBFA 5GINE 2GZ2A 1PZEA 3P97A 2ET6A 1TZMA 2OMEA 5JC1A 5I45A 2ZWIA 3O2NA 5HCNA 3CZRA 2M6KA 1JPNA 3I4CA 4ER0A 4RSRA 3Q9UA 4B6FA 4LF6B 2Q0JA 2X4IA 3G9QA 1B8PA 3N7AA 4MUEA 1RHQA 3O94A 5LP6B 4JQYA 1PG2A 2QX7A 1N2CB 1XRPA 3FBTA 4C5BA 3ZI0A 4YPOA 4O29A 3IUJA 4LCJA 3DGEC 1KAMA 1YVRA 1FSFA 2DPLA 3EZ6A 3OP4A 2HNAA 1J6UA 4ZYTA 2DRIA 2J9RA 2R3SA 1T8UA 4BLUA 2Z5FA 4TUYA 3PJEA 4TYWA 2X5XA 3DDOA 4J0FA 4E5MA 4WZAE 2X14A 4QX6A 3PEYA 3EA4A 3TTVA 4QDJA 5IN4A 3K9FC 1DIBA 3UH1A 2F9MA 2H1OA 2G9UA 4QG3A 3GK3A 4OAPA 5IDYA 2QVZX 1GCOA 4IYRA 3C87A 1PKEA 1TF7A 4QXOA 1Z7WA 3THSA 3LZDA 4ALLA 3FFAA 2DJIA 4WXMA 5F98A 4EJ2A 1YFLA 1EFPA 2A0UA 4MV1A 2E7ZA 3R4VA 4RGVA 2DBRA 1V4VA 2ENUA 3DZGA 4PX2A 3HCRA 2NUBA 5AW5A 3SHOA 4CVNA 1ECCA 2HJWA 3AR7A 2P27A 2RHLA 4J0HA 4M0PA 4C5CA 4BWGA 2FN9A 1KH3A 1QV6A 5DYYA 3BE4A 2GN0A 2JKZA 4WIAA 2QT9A 1N92A 3TFWA 2RGNC 1X38A 1A8QA 4UTNA 4PRZA 5KBYA 3H2GA 3NIFB 3R5TA 4PTLA 3IP1A 1HQYE 3AVQA 2PXAA 2KQUA 4RAQA 3ADDA 1TJ3A 4L57A 3I8XA 4CKXA 1P5RA 1GGEA 4JWKA 2G5CA 2JVJA 3A9SA 3OJWA 1NY5A 3PDIA 4Y67A 1BCRA 1SBHA 1BVYF 1NMYA 3GELA 4LY0A 4B81A 4X20B 5FH9A 2XWBF 1WBBA 1KQOA 3CG4A 1TD9A 3LVBA 3EVGA 5KYVA 5IASA 1P0CA 2M9MA 3SYTA 3WBJA 4PPFA 1FUKA 3B78A 4XR4A 4JYMA 2GPYA 4Z1MA 3SS9X 1GR1A 1CNFA 3VTAA 3FZYA 4ENRA 2JLRA 4P4SB 3ZG6A 1M2NA 2C20A 1Q20A 1G66A 2Y8EA 4GGOA 3LWZA 4KSBA 1ZDMA 4LJSA 1Z2CA 1V1RB 5JAMA 3TCXB 4NQ4A 3NOQA 2GYUA 4QKQA 2X6RA 1XZAA 5BV2P 1R8JA 3S8EA 1WCV1 1PLLA 1U81A 3QXGA 4ENVA 3JRNA 4IDBA 5JDIC 3MAGA 2VHUA 3EQZA 2F4NA 4B48A 2RHGB 1NJ2A 5BV0A 5KNBA 1ZJ5A 3RJTA 3NALA 3KKNA 3VUEA 5EP1A 2REOA 2GF0A 1S3GA 3VZSA 3DHCA 2GPSA 1ES9A 4Q15A 2UUCB 1P4SA 2JI7A 1KDVA 5EHNA 2I2BA 2W2TA 3TSWA 2JFNA 5GP1A 3LUCA 4OHRA 1SIUA 4EJSB 5E1DA 2QRMA 4COKA 4NESA 3L46A 4PFJA 5HFJA 3SX0A 3W34A 1YJCA 4WZAB 3WRXA 3NIWA 2OO3A 2XB6A 1RJ9B 1V9CA 3GLKA 4BO3A 4DV2B 1WZ2A 1J9ZA 1MJNA 2VNIA 2YJTD 2Q7DA 3N8DA 2XYRA 3VH4A 3KKLA 4DLXA 4DC0A 2D2XA 3R5SA 1FC0A 2ID9A 5JMTA 4ZPXA 2Z6UA 3H9QA 2C9ZA 4X65B 4MVJH 1BROA 1V4BA 4RZIA 3CXUA 1N2JA 4U4AA 4MPDA 5T4HA 1MAUA 2AF3C 4MKFA 7REQB 2VLIA 5ACPA 3H4MA 1MJGM 2QAIA 3KKZA 3FUCA 2XA9A 1Y3HA 3V55A 4TRRA 1MCZA 2QORA 5KNCD 5JCOC 1J0EA 1CF4A 4OREX 1AS2A 1NURA 2O2GA 5HKBA 4IXDA 2DQ4A 2Q9BA 1Y5IA 3R76A 3JD2A 1GPUA 1WKBA 4HB0A 4EJ0A 3I76A 1Z5OA 2YINC 5BVGB 2I7XA 1RIIA 3T52A 1ECBA 3EXHA 3LXMA 3G17A 2YW2A 2N46A 1AK9A 1ENOA 1UR5A 2CJYA 2ZBFA 3QK7A 1WB4A 3H19A 4LUCA 3W90A 3VA7A 3P94A 3C41J 2XCTB 4HQRA 4DANA 1YFJA 5B1EA 1Y8ZA 2JFOA 2WE8A 3P52A 1AKWA 3FCZA 4E0BA 5G0VA 3STWA 5DLYA 1M2OB 2H1WA 1T26A 3ACDA 3MHPA 3Q3CA 4N0QA 5IVPA 2JRCA 4UULA 1EJ6A 4IUDS 4E51A 4YIKA 3DM9B 5JXIA 1CY2A 1F4VA 1JLRA 1BWPA 4HDKA 4IFIA 3ZHOA 4U0JA 2A67A 3UBTA 1U3VA 5T67A 2C7GA 3BTSA 4MR7B 2E1RA 2G4LA 2VATA 1AS0A 3BXZA 1JDBB 3I0MA 3AK4A 2WNHA 1ZA2A 2PNFA 3NWEA 4NOMA 3RTAA 1IXSB 4C0AC 4RD3A 4TZKA 1UMCB 4M9UA 4CFSA 4L5BA 1I8TA 1ZL2A 2IGTA 3W7VA 3GEPA 3SXUB 1ORIA 1S02A 2PQMA 5JD4A 4D42A 3DT6A 4QDOA 4BBZA 2G1AA 2V55B 3CRNA 3FJ1A 5J59A 2JHPA 3TIXB 4B43A 2FRXA 4CZ2A 1XUOA 1QS0A 1ZNYA 2EJCA 4ASUD 2IU3A 1FNCA 4RNDB 2Y93A 4D8XA 1K4YA 4CM8B 1E3SA 4QDUA 2FPGB 1ZUHA 5HF8A 2V6BA 1NW6A 3SK0A 4LF4B 1KY4A 3OTHA 1QIEA 5LP1A 1I4TD 3RVJA 1P1HA 4DV7B 4UFOA 2NIPA 1XEAA 2BH2A 2A35A 5I9SA 1AZTA 1GA1A 3JD0A 5ILQA 3I2FA 3WX0A 1H1TA 3KTDA 4QFDA 4ZQCB 3S3TA 4A0QA 2M6RA 4DNFA 421PA 1XRMA 3M4XA 4NBWA 3C3YA 1N3BA 1RWXA 2JBAB 3G5AA 4CLXA 2XDQA 3ZHBA 4BLTA 1W85A 1KVQA 2CLKB 2F1RA 1Y89A 2HC9A 4H6VA 4KE6A 4C2TA 1YHYA 3K8OE 3PQ8A 4HGRA 3WLSA 3SZ3A 2XNHA 1EQAA 3NTVA 4CM6A 2PANA 4R1OA 1G59A 4PLZA 3SBDA 4FWTA 3IBTA 3RYFB 3OWHA 5TQVA 2HWYA 2K5UA 3RVRA 5BQFA 3AEQB 1JZSA 3UFXB 1GXSA 4BZZA 3T7KA 4MLPA 5SICE 4F3YA 1JQAA 3QVKA 4F5YA 2ZB2A 4G1BA 3DDCA 2G9RA 4GEKA 4M7OA 4XVRA 4DPKA 2H2AA 3GPDG 4PIMA 4Y2XA 4D3DA 4YSKA 1M2WA 1QGYA 1X39A 2ZZNA 2CY0A 4DWJA 4AU1A 3O3OB 4XIYA 1J39A 1XZPA 3OI7A 2PSHA 3F49S 1XF1A 5F5XA 4DCUA 3VBEA 1VG8A 4S1NA 4ZD6A 2ZT7A 3O0TA 3S70A 5ALMA 2Q0QA 3GD7A 4PG6A 4GCWA 2UAGA 3ADBA 3ERCA 5A0TA 3AW8A 2PD3A 1DJMA 1J8QA 4TWAA 1A8UA 1BS2A 1EA5A 1U04A 4NONA 2Q28A 3FCEA 3GEMA 1QHHA 3VZCA 3LQ4A 2BKXA 1BE6A 3AESB 3PLAE 4I4TB 1BCSB 1CQJA 1KDOA 1R4NA 3OEED 3QEOA 4R2HA 3PUZA 5DNAA 4D3SA 4FYWA 5B12A 1ZL0A 2D1QA 2AHOA 2G0NA 3GEDA 1A9XB 3ORHA 1ZVJA 1QOZA 5AKZA 1V7ZA 3DTVA 3NGXA 1T8WA 2P30A 2QL9A 4RKYA 3TNLA 3AETB 4F21A 1P0QA 4PZPA 3K7EA 3RRZA 2XSZD 1WXFA 4C4AA 1TYEB 2PL1A 3LHKA 2K6GA 5JMOA 3Q9LA 4UHDA 1GD1O 5DHRA 4TXLA 3PTAA 4M0EA 3IOCA 4CCWA 2WFZA 2ZM5A 3RG2A 3TPZA 4O5OA 2XYVA 3I2KA 3T15A 3L01A 4HNGA 4R8VA 4YJ2A 1E9DA 2BFFB 2MSEB 3GBVA 4LHYA 4IDGA 1QKIA 1LBTA 4IUCS 5IAJA 3N39C 5K3DA 3TR6A 3SLRA 2PUHA 5TS2A 4MUGA 2EZ8A 1PQPA 4AYTA 4FHGA 3QELB 1VIVA 4CGZA 2WM2A 3Q3IA 4Q02A 3LUHA 4C1FA 1JEQA 1BDIA 3AFMA 3LIPA 3QBEA 1JYEA 3OU6A 2CBZA 3JATA 3LTEA 5T4EA 2E4UA 3K1JA 1C8BA 1RAFA 4RCZA 3WL8A 4TSFD 1IXYA 1RYZA 4KC0A 3M7IA 3CUKA 4Q1CA 4S1OA 4BO4A 4PAWA 4E2WA 3VR0A 4F3CA 1M2XA 5CYOA 1T15A 2DTDA 4WNYA 4MQMA 5K3EA 4WH0A 1V5GA 3ELYA 4PZ0A 1BEEA 3E9QA 1LSJA 3LQQA 3BWXA 3PU6A 3B1XA 4AKEA 2CLCX 1X9GA 1G8FA 1GADO 2GPNA 3FYCA 1QG6A 4JB0A 3PV0A 4BQEA 1DNPA 3VJRA 1W8DA 3GEGA 1OY1A 3QKIA 4GMDA 1U0LA 4IDOA 5CFLA 1JHZA 2EJTA 1D4ZA 3B1ZA 3OZWA 3BQMB 3JVUA 4MIEA 5AVVA 4EQ6A 4L8YA 4RY0A 4F60A 1O89A 1APBA 2C5HA 4IGKA 1LW7A 3WK9A 1KO1A 1J0BA 1CJKC 1P1JA 3L7IA 3O03A 3QNMA 4O1MA 4NG5A 4WFJA 3TIVA 5A4AA 3PSHA 4QIHA 3A4VA 3VHRA 5A5VA 2FCRA 4PAMA 1CZLA 2VHJA 3F97A 4YRJA 4DWVA 1CB7A 1VPWA 1PU2A 4ZGBA 1N6LA 5K6AC 5CB4F 1K2WA 4DADA 1EEXB 1Z0UA 4WBNB 3ZW7A 2J67A 3GJZA 2HREA 2RK3A 4DXHA 1IBLB 1QZTA 1DMSA 1TJ4A 1XFDA 3IFSA 1AO3A 2MT9A 2V3VA 2VWPA 4IWXA 1TEVA 2C9MA 3LCMA 3T4PA 4MS1B 3UPTA 1HNWB 3VYVA 1BOOA 1Q1NA 5K8JB 1WL8A 2C3YA 1F14A 1YB6A 2FPPB 4TS3A 1DMRA 4JBGA 3ROKA 2GK4A 3AFNA 1G8JA 3RCBA 2FW0A 5EHIA 2PA0A 1WUJS 3FGNA 3IBFA 3ZYCA 4C7MA 5CFZA 2O4CA 2GAAA 4GLOA 1NI3A 3DG9A 1XTZA 2H08A 4GBGA 4TKVB 1M34A 2WF9A 5FOQA 2EIHA 1RRMA 5AUQA 2ZNBA 1Z5PA 2QNRA 1T2AA 1GCIA 1A7KA 2AE2A 3LGSA 2R85A 3TN7A 1WF6A 2DKNA 4FOSA 2Q5EA 1MMFB 3EIHA 1GTL1 2J0UB 4KB5A 1RQ7A 3GHHA 1R6VA 2IEGA 3OJEA 3NEYA 4KO8A 4R7TA 5H81A 3URKA 2BONA 5CTAA 4FOPA 5JWHA 4MQFB 1JXAA 3EAFA 4BJ5A 1NA5A 1VHJA 1II8A 3RVNA 4BC1A 1SG6A 4IGEA 4B3DA 4XM1A 4LOIA 2H2DA 4HQLA 1HY3A 1W44A 2J6HA 3CMCO 2VIIA 5E7IA 3LUJA 4B3XA 1QXSA 1NXVA 2AR9A 1JE0A 2G76A 2BDTA 4WOCA 1YZHA 1C29B 2YV2A 1SQFA 2WJHA 3JQAD 4FMBB 4C05A 4AJ1A 4HVCA 2YHAA 2OFXA 3F3YA 1O77A 5EHGA 1M1ZA 3ZXUB 2QD4A 5IM4A 3ZGZA 2ZRLA 1J0XO 4JP8A 2EJBA 1K8RA 4IVQA 3RRMA 2MR5A 4B6EA 2RGRA 4Z4IA 5LMNB 4KVFA 1X13A 4MVJG 2XQVA 5ALYA 2GFJA 4BVKA 2C3MA 3FPSA 4L4RA 5JAOA 1PJ2A 2NVBA 2GFHA 4A1FA 2DYKA 3R74A 4OG2A 1KVTA 1R5BA 1WB6A 4RYDA 2A5FA 1G64A 2GZAA 3G7UA 3LYAA 3IX7A 4G89A 4IJMA 4N6OA 5ELLA 3TYXA 3U4CA 1NBME 4OJQA 4EHNA 3B7PA 2NW6A 4IOJA 4A8JC 1W30A 3CJTA 2FFJA 1FQKA 4IH1A 1KTIA 2AKAB 3K0KA 4N3CA 2GUGA 2YXBA 1P75A 3FWKA 3NBMA 2RKWA 1Y5LA 3IOFA 2G09A 4EATA 1KPIA 2V7VA 5B6IA 1NIPA 3ZDXB 5EVBA 3HJNA 4U2CA 2PZEA 3PJGA 5FOTA 1OYWA 2Q45A 1QIHA 2WYVA 1QZUA 1D1PA 1Z12A 4NTZA 3RBAA 1KGDA 2OORA 3OQHA 121PA 4YCJA 5ECYA 3LD9A 2FZLA 3LRPA 4L95C 2ZRMA 4DSNA 3NFYA 4MTCA 4AC9A 4CEJB 2PFSA 1A9OA 2L82A 1SCKA 1YS7A 7YASA 2P2NA 4CXMA 4F1KA 2RGYA 3MQ2A 4YLGA 4MV8A 1NC1A 4GYJA 3IAEA 3SF8B 1NOKA 3T6KA 3W6ZA 2XT6A 2JJMA 3COWA 3ADOA 4HDMA 3A14A 2P97A 3DUWA 3LOQA 3R24A 2NZUG 4PFKA 3G2HA 1RCTE 4YAUA 1GL3A 4JLOA 1Z7YA 4C2AA 3B6JA 3ZVNA 2GD2A 3PJFA 5KILA 3MGKA 4RH1A 4BP8A 2HADA 2GN8A 2EATA 2WWFA 4BU0A 1ZH2A 4P1ZA 1ZHHA 3X30A 1KYZA 5FPHA 3B7GA 4J90A 1Z6QA 5JJCA 2Q3MA 1L0BA 3S6JA 3TDKA 2YJ6A 2ZB4A 3AUFA 4F2PA 3M89A 3UPUA 2I4NA 4Q3EA 2JDID 2ZI9A 1NG1A 2XV1A 5GQSA 2BGGA 3EEYA 5KYXB 2BHNA 4ZOLB 3KYDA 1RTKA 2W93A 4KV9A 1HT1E 4EBFA 3FMOB 5EFOA 1PNRA 4WJLA 2R25B 2QZSA 2R8ZA 1CR0A 3G1UA 1FRNA 1SOMA 2WG1A 2G1KA 4MUBA 5EHTA 2FSGA 3AUSA 1WPXA 3AHDA 1KI4A 4K3UA 1B42A 4O59O 1I2ZA 4R05A 4XCQA 5BSTA 3WB9A 3ZDRA 4A15A 1AGYA 1H2ZA 2NO9A 2ON6A 2EBUA 5TRTA 2EG9A 4UATA 1Q77A 2Q2QA 4CCAA 3LL7A 5IJZA 1GTJ1 4PO8A 1L5HA 4H2DA 1JTEA 3AYZB 5KZMB 3DDWA 3ZV5A 1YMUA 3LW8A 1DHRA 2HTEA 2YWCA 1N2GA 3AVTA 1TPYA 2QVXX 3D0KA 4QUHA 1M6VA 1K7SN 3GDFA 4TL8A 5TQJA 1GQQA 2O0MA 4X1KA 1HQKA 4P4NA 2JI9A 5BWBA 3ETEA 1ZIPA 3E8MA 3PHBE 1YB1A 2KBFA 3CR8A 3ICQB 1DC3A 2ZCJA 5LLSA 1LF0A 4OJKA 1XK7A 2JFVA 4AMVA 2FU7A 2MSCB 2OD2A 2Y05A 4J8PA 3CVOA 1QTRA 1M67A 1B6GA 2BJVA 1JR3D 3PC3A 4L8VA 4B5LA 1QHIA 4M76B 4BFCA 1YXMA 1SA0B 4C1HA 3AFGA 1LFAA 4HDCA 1PFQA 5ACTA 1QP8A 2H5IA 2J3QA 3L4SO 4O6VA 2GEFA 1YE8A 5JWOA 1LDYA 4L4SA 4LXHA 5IAGA 5LQSA 1CZNA 2AMYA 3C7KA 4X5OA 1K3UB 2P62A 3NHKA 3HPRA 1FFXA 3IP9A 4LRWA 4N76A 2YY5A 3W7AA 2VPXA 2QK4A 1FP7A 1GNPA 1CVIA 3MLBA 2P78A 5ALVA 2EVWX 1T5LA 1FRFS 2ZBUA 2C3UA 5E6RA 2O3QA 5DBHX 3SLGA 3P0HA 5E9QA 2NXNA 4LW8A 5HRUA 2OGUA 2FMXA 1VFNA 1ZG3A 5FBLB 5IC5A 3RK4A 1GGKA 1N5MA 3HRIA 3TFOA 3IL2A 3HJUA 4D41A 4JK3A 1TECE 3IO5A 2C7RA 1YTUA 3OESA 3MRXA 1PJSA 6Q21A 5BUCA 1OKKA 1MF7A 3WIUA 4HB2A 5ALRA 5HTOA 2WWVD 1KR2A 3U37A 4BJ3A 3G7NA 1Z29A 2ZI3A 2CL5A 1FDRA 5IDXA 3TQCA 3DTTA 3ELWA 1E2MA 3PR1A 4X1YA 5JQWA 1E0SA 5JRDS 3CGGA 4YLYA 5BXQC 2RHMA 2D62A 4PTZA 4BBPA 3F5DA 1JMKC 3DZ8A 4O3FA 4ZVLA 4PN3A 2QW0X 1Z4KA 2OLEA 2AC4A 2X2PA 3KKEA 5IAKA 4BVFA 2RE8A 4BGEA 2D7JA 3EZGA 2OHXA 4X93A 3CKYA 1BMFD 1OWNA 3OQIB 3JASB 1UKEA 1YC5A 3MRTA 4TUYF 4EAAA 3SKYA 1IBSA 3BQNB 3VM6A 8MHTA 1DAIA 1HDYA 2JGIA 4TMFA 1SOVA 3I8OA 4XRRA 2M5CA 1EWYA 2NACA 3D0QA 3IEKA 3VZQA 3ET5A 1KA9H 2J08A 1NYLA 1I2AA 1AUXA 1QRSA 1BIFA 3KS9A 3QU5A 3WK5A 1MQOA 3IPCA 3S5JA 3MCAA 3O95A 1E1QD 3SX2A 1QU2A 3WRXC 3ZE6A 5IWAB 2QROA 3OD5A 3QX9A 1ACJA 1NPYA 2HDWA 2C0PA 3PQ2A 5TMBA 1II9A 2LRHA 1ZRSA 2FSVA 4G85A 4GX1A 3WMFA 5FTLA 5IUNC 1KJNA 1GWNA 1O3YA 4IJKA 2FZEA 4MAFA 3W2TA 4NMMA 2QWXA 3FMIA 1FTGA 2WVAA 4MWTA 1JSZA 4GYUA 3CJRA 3DV0B 4HGNA 1Q57A 4N3NA 4MWGA 1ZD3A 3C70A 1CQIA 3KLOA 2FJ0A 3GC6A 3G2PA 3HB1A 4DDMA 4EG8A 1SBYA 1G6HA 1J1IA 4R5MA 3ILXA 3BIOA 5AMXA 4CG0A 2FEPA 4GKJB 1F48A 4GOJA 1Y82A 3VDXA 4FDTA 2XRYA 1QJ4A 1CP2A 1TO1E 1WW3A 4ESOA 4NJEB 5E8JA 3EXFB 5ALJA 2YMMA 3ZY4A 1S1MA 2BKAA 3B38A 2CGEA 2QJOA 4YP0A 2O8FA 4YGXB 3ESXA 4Q6BA 5AHKA 3OQOA 1GIAA 4Y1RB 1QZXA 4PG4A 4RXMA 5K0NA 3E22A 4B6OA 1S01A 3BL8A 1WXIA 2ZYUX 2XMBA 4RTNA 3JYNA 2BD0A 2BN4A 2H1CA 2ZRFA 1H2YA 1WP9A 3LHIA 4KFUA 4N7MA 3NWBA 3N0RA 4RZSA 1QX3A 3GJTA 4TWRA 4CR7A 1X8XA 5CVJA 2V3CC 2WMDA 4YDRA 1E5VA 4WINA 2JZNA 4HWOA 2WT8A 2P5UA 2ATCA 3JZMA 1ZNWA 4RIHA 3V80A 3LY9A 4XSVA 1GZ5A 5M3BA 3FSRA 2JH9A 4ZI5A 4EO7A 5K4HA 5EGSA 1KRWA 4DJEC 4C3VA 5KKNB 4ZWNA 2EGGA 1A95A 1BU8A 1EKXA 4GI3A 5DLPA 2NU9A 3U80A 1JVNA 3S55A 3G8CA 1JECA 1L2TA 3AUUA 4KVGA 4D80A 4YJ3B 4DA7A 1NXQA 1CUZA 1SU6A 4QVGA 2XMDA 3T34A 5J2TB 1IEXA 1R8SA 4NKRA 1JKJA 2IYQA 3JW8A 1ZD8A 3GGPA 5ILOA 1ESCA 2AX3A 3PRHA 4CMCA 5JNVA 1T8TA 1Y3FE 3MTEA 1MQAA 5LA6A 1Q3TA 3LF1A 5I7RA 4Y30A 1U94A 4PCAA 3MCTA 1JZQA 1RKXA 1Y0BA 3I28A 4B4DA 4NICA 4CN9A 3BSWA 1O0SA 1JJEA 2IBMA 3VBCA 4EFMA 4ZYVA 4DM3A 2X41A 4AKGA 3AX6A 3PEWA 1B73A 1MA0A 4B31A 5ERGB 3QHAA 2F43B 4A23A 3PQFA 3R3JA 3PNKA 4RDXA 1PR9A 1NOIA 1LBEA 1M76A 2O2EA 4EFLA 2HFKA 3UN1A 4B33A 5DFAA 2GLUA 1M2VB 3WWPA 1T36B 3RS0A 1P39A 2UXBB 2OV3A 1UM9A 4QICA 3U1VA 5JPIA 1LPNA 4FDLA 1PQ4A 1V96A 3UQZA 3IE1A 2CHEA 1YS6A 1RHUA 2UU9B 2OSBA 4RL4A 3VHLB 1R6UA 1GT6A 1WW1A 2ZWVA 1O96B 3VTZA 1UJNA 5BW8A 2O1XA 4H6XA 4KSYA 4UU0A 4EVIA 2KI5A 4C08A 1G8SA 1V6SA 3RYIA 4X9XA 4MQEA 4ER6A 1UAYA 2YJGA 1GZ3A 3FAIA 1TAHA 2LZ0A 1WRBA 3KUUA 3PXCX 2I2WA 1YWGO 2PGOA 3H17A 4JAVC 1UMDB 2Y0EA 5IVDA 1EX7A 4QUBA 4ARIA 4DL9A 5DX8A 3LC0A 1O6BA 4X6LA 1P91A 1NNI1 2FAXA 1PBTA 2WDPA 3I52A 3QTTA 4QBKA 4UXJA 5K0JA 4A2QA 1NKSA 3PEEA 5HF9A 1FFBA 5BRAA 4JOSA 3CLTD 1VJTA 4M98A 3JYHA 1E8NA 2PCJA 4ZV9A 3E05A 1W36D 4GOLD 1LA2A 1UC9A 2Q9CA 2VYFA 3H5NA 1N4AA 5K0LA 1UPCA 2SKCA 2ID4A 3OQNA 2FPOA 4YA6A 2DY0A 4L2IB 1PYOA 4AT1A 4HWTA 2R6ZA 3CLRD 3GRAA 1HEIA 2VH1A 5EIFA 1KR5A 2W8BA 4L07A 4KRGA 4ENUA 5C7LO 2XCIA 4EQZA 4DLLA 5K6TA 4B82A 4HC4A 3HTXA 4N54A 1QFJA 1DCMA 1V48A 1YQUA 3QKRB 1CF9A 1YRWA 5B2FA 5A1TA 1P60A 4F8YA 1SXQA 2F90A 4YP5A 3H99A 4CKBA 1QGUA 1Z8HA 2IHNA 1LJ8A 1Y33E 4CLEA 2QD1A 1UT5A 4D98A 3TGLA 2GNAA 3CN9A 5HMLA 2IHJA 3RH0A 1BHJA 2DKOA 1FA9A 1NF8A 3EK2A 3O93A 3W5VA 4FINA 4L78A 3K8ZA 2FB9A 1V3UA 3AV0B 1WPQA 4GGMX 1G60A 1R4AA 2WIBA 3HZOA 4RV5A 1OXKB 2FJUA 1V1JA 2JLVA 3QVGB 3GUHA 1ONOA 1IVYA 3OF2A 4ND4A 3MPOA 1EFVA 1GQYA 1P0MA 2BZSA 2J0EA 4K6MA 1WNFA 3ZCPA 3ZPXA 2AFIB 1N6IA 1SM4A 2DX7A 2C2MA 3HKCA 3OZDA 2G08A 2CVQA 3DXXA 4FLFA 4O0MA 4IQFA 4B6GA 1J00A 3W6NA 4AYWA 4YIHA 3ANMA 4F71A 2R2AA 1GYQA 3PUVA 1IPHA 1H5NA 3MRSA 5SY6A 3VR6D 5IUJC 4NK4A 1Q16A 4EGCB 2BEKA 4ZAVA 4J9VA 3U4IA 1QV9A 2CKDA 3F2IA 3O1LA 1VJGA 2IEYA 4G4JA 5FUYA 5THXA 2GVDC 1GP2A 3IPYA 4UHEA 3WK8A 5ELMA 4CEHA 1K97A 3H7IA 1VBKA 2YVUA 3Q8KA 2NZ8A 3NDIA 4RXUA 1OVMA 3MCUA 4G9GA 4W7HA 4Y2RA 1KO7A 1O6FA 1Z6AA 3PCXA 4URWR 1P2BA 1RACA 4Z8XA 3W79A 3BRWD 3I83A 2W37A 4KX3A 2G6BA 3QF4B 4NWIA 4ES6A 2QZZA 3HDVA 3LFUA 4GR5A 2XW6A 4RPKA 3VPDA 1ZM3A 2G63A 1TEZA 1U8UA 5JNLA 3NAMA 4OAOA 1GLVA 2YY7A 5CH8A 3D6AA 3GNLA 3N28A 4B45A 2FXVA 4TL7A 4EL5A 7GPBA 3R5HA 1SCNE 3ISJA 5CVEA 3CRRA 4UEJA 2XF8A 4GSLA 1FFEA 3L7MA 4I14A 3ZNNA 3ASYA 4ZHQA 1YBAA 3B7WA 4O4JB 3FRJA 5T4FA 5LLTA 4O4IB 2QTCA 1L7MA 1E3DA 2HK6A 2QM0A 3ADKA 3M6MD 1T2VA 4ETWA 1SHUX 2J31A 3V9PA 3O8BA 4HNRA 2AW5A 2ZSEA 1MG0A 1IY1A 1NULA 1Y9EA 2H1IA 3DR3A 1ATZA 3L8ZA 4GMFA 3GP8A 1OFIA 1QDEA 2NTEA 1BJKA 3WWOA 4W5JA 4MDFA 1DXYA 3FX2A 1EINA 1TJYA 4IXTA 2R97A 1KFJB 5EKDA 5A4FS 5CLJA 1OR8A 4YJ2F 5DV9A 3SOZA 2GCOA 1ISFA 2QI9C 2RCYA 2FEWB 2VZ8A 2CZQA 3K92A 4B4KA 4NDNE 4YJHB 4S12A 1DI0A 2EWVA 4IJWA 1QLWA 3TLGA 2IV2X 3T7EA 1NRIA 3K1TA 1OC4A 2BCEA 2CWWA 2XI4A 3A6HA 4OUKX 2FE1A 3ZLBA 4AP5A 4OHYA 3G2JA 3HVRA 1WUYA 3GA7A 5E95A 4KHPB 1YV9A 2CDRA 4QRDA 2VZLA 5J47A 2SICE 3ZE9A 3HJAA 2D6FA 2C0QA 1RNLA 2ZIXA 1OXTA 5H3HA 4RADA 3DMTA 1W0JA 4QRHA 2FPKA 1MGOA 2IC5A 3F47A 2C3OA 1XAGA 3GCWA 1TXGA 2R87A 3GLHE 4Q05A 4C76A 1LBQA 5TS3A 4G37A 2WK1A 3LT4A 3VZBA 1CUYA 3F7OA 2QD3A 3MAAC 2A9PA 3F46A 4QQFA 2PKQP 5KOHB 4W5TA 1PJCA 2H0AA 2GDZA 5EE0A 4G8BA 2HGZA 2IEIA 3ETCA 2GSDA 2JCBA 3R5JA 1T3TA 4GMHA 4RVNA 3P9XA 4D0LB 3OZEA 1E3WB 1BHSA 3B51X 3IV7A 4QNMA 5DTIA 2PRZA 2FXIA 2Q9AA 3L7JA 2C5BA 2EOAA 4N03A 4MQLA 1IZZA 4UD6A 4MITA 4P4GA 2XCQA 4EHIA 4MDEA 1TUGA 5CH5A 5DTEA 2HEIA 4J2HA 1JYFA 3BSSA 3WHLA 4R3NA 4BVLA 4EYLA 2FSPA 2QYOA 4HATA 3RK1A 4EB0A 2Y1DA 1KWKA 2W2KB 4W7SA 5ADWA 3QBTA 4Z99A 5IXSA 2C7QA 3AF6A 1V95A 1ELOA 1H8ED 3L8MA 4JP2A 1M54A 5EZYA 3TRHA 1ZZGA 3FNHA 3RAFC 3COJA 3M6UA 4URZR 1E0JA 3DR5A 4JT4A 1WMEA 3NM5A 2G9VA 2I62A 2A5JA 3OQ6A 5KQMA 1C3OB 2I3DA 3MZ0A 4UCQA 1DAPA 4TTIA 3DBIA 4BMDA 1BDBA 5ARBA 1SKBA 1OGIA 1YUMA 4F3RA 2CMGA 2QI9F 3EARA 1E5QA 3N8NA 2KS6A 2V7BA 4YWHA 3KPJA 4CKEB 3WAJA 2UUOA 2PX6A 4DBVO 5JBIA 4BMZA 1WW8A 2OORC 1QVRA 2C1XA 2PMKA 3JSXA 1XJ5A 4MZXA 4FFRA 1NZJA 5IKEA 1S89A 3S2UA 1JIJA 3LQFA 3KJFA 1ISPA 1WJGA 3C7AA 1M8JA 1EWKA 2FX3A 1YJQA 5AJTA 1X2BA 4GF5A 3BWCA 4D7AA 5FWNA 2YNTB 4GKAA 2XX3A 4YRAA 4J5FA 3RFFA 2DH5A 1NMXA 2GPJA 1EM8A 3BCRA 2PM8A 4ZANA 3V7UA 2JCGA 3X1JA 3MMXA 4B7CA 3ONVA 2Y1WA 4F4CA 5IJ9B 1PSWA 4HQFA 1Y9DA 2B1IA 3BJIC 4KVZA 5GY7A 2RHTA 1PT6A 1U1IA 4OI1A 1E3EA 3FSJX 3T5CA 4EUNA 6PFKA 5HQ3B 2W6CX 4BAUA 4GOND 2V5AA 1RLJA 2WP0A 5KJ6A 4CETA 3K2QA 5IM4F 2AIOA 4AWZA 2MYTA 4XFDA 3P9IA 2NOAA 1GFZA 4Y6LA 1XVLA 3VHXB 1SK8A 3EVTA 4KQ1A 3ZW8A 1SEVA 2C4HA 4OXXA 4INPA 2NO5A 4TXHA 1JSLA 3NAGA 5AW7A 2H59A 4LPSA 2VAMA 4ANFA 1T1GA 4KWEA 1OX4B 3BZUA 3S2GA 1JU3A 3D54D 3K0AB 4IQGA 3C97A 1VCIA 4RD0A 4GXRA 4L7QA 1EA7A 3Q3HA 1L7XA 3VNRA 2ZAIA 1GRVA 3O8QB 4XSGA 3JQBA 5FTKA 2FUEA 1XM8A 1GPLA 3H6HA 3QHPA 1O87A 1K0FA 1NVDA 2GJSA 1SKMA 3TB6A 3ZIAA 5EQTA 2B3TA 1T0HB 1AQLA 2PSEA 3WJ7A 3FHJA 4QTXA 4OMFG 4PLVA 1ZMOA 1B3RA 3IYLW 3T3MB 4M8LA 3KQWA 2R2DA 5BNWA 5CCBA 3FW1A 3F8TA 3TVDA 1KJWA 3NX4A 5I7SA 1DARA 1PE0A 2VNHA 4EB3A 3X1MA 5DI3A 3FKSA 1KY5A 1XO1A 5JXJA 3KHUA 4PICA 3KELA 4G26A 3L92A 5KO2A 4U5XA 2DFLA 1BHO1 1D2EA 1SELA 3GI1A 3QKSA 4GVLA 4IRXA 2BFBA 1BC5A 4JGBA 4JQZA 4MYDA 1POWA 2VQ3A 4ITRC 4P4UA 4R2XA 4TTJA 4ZVOA 1YASA 3BSYA 1EVYA 3KXPA 4M9XA 3AB8A 1RC8A 1ZIOA 5BN3B 1AX9A 1JNYA 1QF9A 2QYTA 3CW9A 5K0CA 3OY2A 3I9FA 4MXDA 2F55A 1SUCA 2HOQA 5GGXA 1Y4DE 2BFKA 4MR9B 5IBQA 4D57A 1DC4A 3ND5A 3ASUA 5AXRA 2P4EA 1RIFA 2PVPA 3D5TA 3AF4A 3EH1A 3TCKA 4LZNA 4EYFA 4BASA 4PZEA 5LVAA 4G5QA 2B35A 2PZGA 2W4MA 3TOXA 3U40A 4AMBA 1T8YA 2GZRA 5KMGB 2IYUA 3ZDCA 4KR2A 1A76A 1RM3A 3BXFA 3QPWA 2DT5A 2OM2A 2PLWA 3BERA 4D9CA 4MV7A 2HBRA 3WSWA 5GOTA 1QP0A 2QUJA 1JMVA 2ZU6A 3B89A 3D8RA 1RZRA 2YJ5A 2VJMA 4CCYB 2WEKA 3KE8A 4D8TA 2QZPA 4RHXA 2YNWA 1QOPB 3CH7A 3E15A 2RMKA 2Q3HA 1QIKA 4KUEA 4MRPA 3VOTA 3QVTA 3QXJA 2P9TA 4TMTA 4YDQA 2C8KA 3H4IA 1JSXA 1LPBB 3CW2A 4FBGA 1V25A 1OBFO 4J03A 5IARA 2ACKA 4LJ4A 3U09A 3MVEA 3E5HA 2W2VA 2UYXA 3PC6A 4F4UA 1JEEA 4LSWA 4XGQA 3BMXA 2F8SA 3NAQA 5BSVA 2QUHA 4ZT5A 1SQGA 2NVUA 4DSOA 3ZHCA 2I0FA 4MPJA 5HISA 2GXSA 3PUXA 1VI6A 3ZWPA 5E6UB 2A9RA 2Z1MA 4CEIB 4GHWA 2VJAA 1KQPA 1YDHA 3EF0A 1F2UA 1XU9A 3IR5A 3OIWA 3OM0A 5J2UB 4JOCA 5JSYA 4RDIA 1JTFA 4BLVA 1RLMA 1C7FA 3T4XA 4D1YA 2ZAOA 4CKWB 4NBSA 3ZH9B 4BMCA 6YASA 3L8DA 5JO0A 4D9FA 4E5PA 4PZDA 3TRIA 1BVTA 1WUHS 1VMAA 1JB9A 1O94A 4RNCA 4KQJA 4P31A 3BORA 1R5OA 1RAEA 3GEEA 4ON9A 1Q1AA 4C4TA 4C29A 5IXJA 2ZSIA 4RIFA 4ZVKA 3WP0A 1YZKA 3HWRA 5KU7A 1MA3A 3NT5A 4DCVA 5KHOC 2F17A 3A1NA 3OQMA 1G0NA 3H11B 3N2ZB 1DBVO 5KSZA 4C7OB 4W1SA 1HOXA 1NI4B 1K75A 2ADMA 3K09A 4LYEA 4X45A 5ALZA 1OLXA 1ISMA 2O2SA 2WM9B 5GV8A 4DMCA 3F78A 2MMGA 4MV6A 1N5JA 4DS3A 5BN4A 3HZZA 2IEZA 4KNVA 1W7AA 1U98A 4P22A 3I11A 4RVFA 3VR3A 1V8OA 3BRCA 2Z4SA 3SPUA 4UNQA 2IX3A 1KDPA 1ZGZA 1KJ9A 1TE2A 1T4BA 2WIKA 4LDRA 3CSSA 3L9XA 1TLTA 4ZV4A 1CHDA 3FD8A 4MVJD 4KPYA 5C8YB 4Q21A 3R5XA 2C29D 5M7EA 1COWD 3HFGA 4KZPA 3RBZA 3EPRA 2QTFA 2FSVC 3IH5A 4CIYA 2F3SA 2X22A 5A9SB 2O0KA 1EK1A 2JD1A 1XRQA 4KTTE 4GL2A 2X2OA 5ULLA 4HO1X 3CNLA 1Y3DE 4YQEA 3FBGA 2NXJA 2Q0HA 1W0KD 1G7TA 2GTIA 1RJGA 1LD3A 4N47A 1AA9A 4L74A 3OCXA 4ACBA 2BFDA 3UGKA 2QTWB 2HMWA 1NXSA 2DERA 2RKBA 3QX8A 3C5VA 4HH1A 3T9CA 4OQEA 3VZPA 1VIDA 5ARDA 4I3GA 1U6IA 1Z0FA 1WZCA 1LDMA 2QVGA 2B8TA 1BKYA 5IC6A 5EP4A 4MJXA 1XL0A 3O4HA 3QBJA 4GM1A 4WECA 4YAWA 3KKPA 4C4XA 3QE9Y 1ZYUA 2YL2A 5IH7A 4P98A 2BFPA 2FTKE 3GJYA 3AR5A 4ACAA 1SPBS 2NU6B 3HDTA 1E2HA 4WXPA 2O50A 1SB8A 1OTYA 3MJFA 3U44B 1PDWA 5C8DA 3TVTA 4MINA 2UKDA 4GYQA 2A7QA 2YNMA 3D6JA 2YC4C 3M81A 3QXHA 2VYVD 3QE0A 3SSNA 4QT4A 3O8RA 4UNSA 4YI5A 3BICA 2CFTA 4BNWA 4DEXA 3RABA 3BK2A 3G6KA 4D1UA 1ZAKA 3JTEA 5COAA 1QAMA 1EX9A 1FSZA 5AW9A 4C4RA 4C6RA 4EJMA 1JW9B 4V2UA 3VJKA 1N33B 2PH1A 4IIHA 2VRBA 3P9NA 3B5EA 3IA7A 2VDKB 1I51A 3A1TA 2QY6A 2C2WA 4CTKA 1V43A 4WD6A 3EVAA 3T0IA 3U4HA 2JGEA 1JEDA 4IHJA 3WV5A 4Y9SA 1QV7A 2HB9A 2IS4A 3ZE7A 4HVLA 2R6GA 3FZGA 5FUVA 1OWPA 2J45A 5FL7D 1PYDA 3CT6A 4K9LA 2O8VA 3IKJA 5ALSA 1ITZA 1KMIY 2XUOA 3BB3A 3CKLA 3R40A 4KXYA 3TSCA 3R9WA 3ZV6A 3GV0A 1GGHA 1JHUA 1XKLA 4EUEA 4H77A 3KQQA 4LC1A 5K4NA 1NJSA 2IXTA 2AOTB 4EHDA 1OCEA 4BNDB 1MEJA 4V0NA 2HRDA 1KTVA 3LI2A 5FI1B 4MQ4A 2ZJZA 3FETA 2EBWA 3PPIA 3TBHA 3M1IA 4BN4A 1KI7A 3ORRA 5B64A 1T35A 2CSXA