5A0TA

Catalysis and 5' end sensing by ribonuclease rnase j of the metallo- beta-lactamase family
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
454
structure length
454
Chain Sequence
SHPHPELGRPPALPKGGLRVTPLGGLGEIGRNMTVFEYGGRLLIVDCGVLFPEEEQPGIDLILPDFTSIRDRLDDIEGIVLTHGHEDHIGGVPFLLREKPDIPLIGSKLTLALIEAKLQEHRIRPYTLEVAEGHRERVGPFDCEFVAVNHSIPDALAVAIRTPAGMVVHTGDFKMDQLPLDGRLTDLHAFARLSEEGIDLLLADSTNAEVPGFVPPERDISNVLRQVFANARKRIIVASFASHVHRIQQILDAAHEYGRRVAFVGRSMVRNMGIARDLGYLKVPPGLVVDVKTLDDLPDSEVVLVCTGSQGEPMAALSRMANRDHQIRIVNGDTVILASSLIPGNENAVYRVINGLTRWGANVVHKGNAKVHVSGHASAGELLYFYNICRPKNLMPVHGEWRHLRANAELGALTGVPHDRIVIAEDGVVVDLVEGKAKITGKVQAGYVYVDGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE J
publication title Linkage of Catalysis and 5' End Recognition in Ribonuclease Rnase J
pubmed doi rcsb
source organism Streptomyces coelicolor a3(2)
molecule tags Hydrolase/rna
total genus 146
structure length 454
sequence length 454
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 5a0tA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5a0tA01
2WHGA 1JJTA 3DHCA 5EWAA 2CBNA 5ACSA 4Z67A 5HH4A 1KO2A 1WUPA 3G1PA 4AD9A 3PY6A 2P97A 2BFZA 2M5CA 4ZO3A 2I7TA 2UYXA 3L6NA 4AWYB 3IE2A 2NZEA 5HH5A 2BFKA 2A7MA 3IDZA 3IELA 5LM6A 2R2DA 3ZNBA 2Q0IA 2Y8BA 3KL7A 2WYMC 4HKYA 5A5ZA 2YZ3A 4NQ4A 4D02A 3ADRA 3T3NA 3ZR9A 4AWZA 5B1UA 3TP9A 4UWSB 4F6ZA 2QJSA 4U4LA 2YNVA 2BFLA 2DOOA 3IOGA 5EVDA 4AX0B 2FHXB 2GFJA 2BG7A 5K4KA 5EV8A 4UWRB 2BR6A 5A0VA 3A4YA 3SBLA 3KNSA 3S0ZA 4Z5ZA 5AHOA 5ACPA 1DXKA 2I7XA 2YNUA 3SRXA 5EW0A 4H0DA 4D1UA 4J5FA 1ZNBA 4RAMA 5ACVA 1SMLA 4C1HA 4BZ3A 5K4MA 1L9YA 2Y8AA 3LVZA 1ZKPA 3DHAA 1YCGA 2XF4A 4BP0A 2GKLA 3RKJA 2ZWRA 5EHTA 4EYFA 5FQCA 3I13A 5HISA 5FQAA 3X2ZA 4HL2A 2BG8B 2P18A 3ZWFA 4GCWA 1JT1A 4D1VA 2FU8A 4RM5A 3BC2A 4AX1B 5EH9A 1E5DA 4C1EA 3AF6A 2QINA 1WRAA 3AF5A 5A87A 2YNVB 5EVKA 2HB9A 3MD7A 1VMEA 3BK1A 4D1TA 2GCUA 4PVOA 4C1GA 4ZNBA 5AXOA 3X2XA 1Y44A 2YNTB 4C1DA 4UA4A 5HIPA 3IE1A 2NYPA 1HLKA 3BV6A 2M5DA 5HIOA 2Q9UA 2BIBA 4KEQA 4EXYA 2AIOA 3P2UA 4LE6A 4RAWA 2NZFA 2FU9A 2BG8A 1MQOA 1A7TA 5A0TA 5K0WA 2WYMA 2WYLA 2ZNBA 3SPUA 4UAMA 4CHLA 4FEKA 4V0HA 1VJNA 4FR7A 5EVBA 4B87A 2FU6A 3RKKA 4HL1A 4UBQA 4PVTA 3RPCA 5ACQA 4UWPB 5FQBA 5LE1A 1YCHA 3FCZA 3WXCA 5B15A 5EV6A 2YCBA 4Z60A 1JJEA 2GMNA 4Z7RA 3SFPA 4TYFA 2YNTA 5LCFA 3ESHA 3IOFA 1XM8A 4GYUA 1WUOA 3DHBA 4P62A 1KR3A 1M2XA 2QDTA 2BMIA 3I14A 3H3EA 1BC2A 5LCHA 2BG2A 1VGNA 3I15A 5AYAA 3F9OA 3PY5A 1X8IA 4XWTA 5DPXA 1QH5A 2GFKA 3BK2A 3PG4A 4GYQA 2ZZIA 3IEKA 2Y87A 4YSLA 4TZFA 4Z5YA 5LCAA 3R2UA 2AZ4A 5AHRA 2OHHA 1DD6A 3I0VA 5ACTA 2BGAA 3SW3A 3FAIA 4EFZA 5KIKA 1X8GA 4ZO2A 2YNWA 4NQ6A 4NQ5A 4J5HA 3SD9A 1XTOA 4Z6XA 1P9EA 2P4ZA 3X30A 2Q0JA 2FK6A 2FM6A 4XUKA 5HIQA 4TYTA 2H6AA 1K07A 4KEPA 2XR1A 4FSBA 2OHIA 4RL0A 5HH6A 4DILA 4EYLA 2FU7A 1QH3A 1A8TA 3I11A 5ACRA 4UWOB 3QH8A 4DIKA 3IEMA 2VW8A 4YSBA 2BG6A 5AXRA 4TZBA 4ZEJA 4TZEA 4XWWA 5LMCA 2BC2A 5ACUA 2Q42A 4YSKA 2QEDA 3X2YA 3ZQ4A 2WRSA 3T3OA 5B3RA 2BTNA 1BVTA 4WD6A 5LSCA 4EXSA 5KILA 4C1CA 5LS3A 4O98A 1KO3A 5K4NA 5ACXA 4C09A 5IQKA 4F6HA 2I7VA 4RL2A 5ACWA 3AJ3A 3T9MA 3VQZA 2BFZB 2ZO4A 1BMCA 3IE0A 1ZTCA 3DH8A 4RBSA 3KNRA 1YCFA 3JXPA 4EY2A 4C1FA 4D1WA 4EYBA 4NQ2A 4JO0A 2OHJA 2P1EA 2FHXA 1WW1A 2DKFA 5AEBA 3Q6VA 3VPEA 5LLDA 2E7YA 1X8HA 2NXAA 4TZ9A 1DDKA 2QDSA
chains in the Genus database with same CATH superfamily
3FPKA 4DWOA 4JR2A 2OORA 3BTUA 3QOXA 4BNTA 3TM4A 2PU5A 1KY2A 4LYHA 1QJCA 4MKIA 3PRYA 1GEEA 3PUZA 4O0MA 5HGJA 3EAQA 1UBEA 3VPFA 5FTLA 1N7GA 1Z6ZA 1QWOA 2GCOB 5I51A 3OKPA 3CH5A 3VOTA 1AX9A 1T9HA 2O1SA 4OA8A 4ZO9A 1V1RA 2QS9A 4ALKA 4HX2A 4GMFA 2XQJA 2A2ZA 2RMKA 1D9ZA 3FWKA 5DMXA 4JNKA 2Q7DA 1NVFA 2DJIA 2QN6A 2R5WA 4E2YA 5REQB 5C2JB 5IHPA 4KFTA 2WU8A 3M4ZA 3RYHA 1RW4A 3BXHA 4PYMA 1UBJS 4ZGBA 4KMOA 5EIWA 5F3DA 4IIYA 1YVRA 2ZKIA 3L4KA 3I9JA 3KDPA 1JQDA 4QQNA 5H80A 1U6JA 1F14A 1WDMA 4Q1FA 2DFTA 1DMSA 1ZBQA 2A78A 3CWCA 4F2PA 3LCUA 1OB2A 1XKXA 1OBHA 3SZ3A 3EH2A 4NEGA 1ABEA 5EMLA 2IQ5A 3NNDA 1V7QA 1PSZA 4Q3NA 5A5DA 1OFIA 4OGFA 3NHYA 2VG8A 4FD2A 3PQ4A 4P80A 5DGIA 3HEAA 3AHIA 4CKEA 2QG4A 4JLKA 2PGOA 4MZXA 2JGIA 3PHLA 3AI2A 3GZJA 2R5NA 1KZHA 2Q5LA 4RD3A 4BQOA 2PL1A 5CEFA 1RAIA 2OBFA 5B4UA 5I01A 4GLLA 2ROQA 3X1KA 1Z3IX 5JBQA 3T3NA 1RR6A 2G04A 4GOKA 4JEHA 1PE0A 3H05A 1I4LD 1VPLA 3KWMA 3GP3A 1PJQA 5ALFA 4ZVOA 1N9ZA 2QJSA 2V6JA 1RYHA 2JFHA 4OJKA 1RKQA 5C5IA 4MS4A 1G98A 3T1TA 3G5LA 3KB6A 5JXHA 1II0A 3ITDA 3VI3B 1OV6A 3ZZUA 5EI5A 2XT9A 3LPNA 5TPZA 2VAXA 4FE7A 1NDHA 1Z82A 2DU8A 4ZAYA 1S8NA 3UICA 1LQUA 2X5NA 3R0XA 3X1WA 1VL1A 3O2SB 1BOFA 3NHPA 4OXQA 3WWZA 1KRWA 2MSDB 3I4FA 4E70A 1KK3A 2XNCA 3TBFA 1PV4A 3HUTA 1WPXA 1A98A 2ONKA 3NEYA 4FCWA 4DKJA 2XECA 5E3IA 3RVKA 5A4MS 2IT1A 2O4CA 3FCEA 3IO5A 1SKQA 4XB6B 3LRXA 4BXOA 4ZJZA 1EXDA 2H4ZA 4Y18A 2NP7A 2VUIB 2AFHB 4F3NA 1DXQA 3GQBB 5CB4B 4J5FA 1W29A 2I8CA 1W9HA 4MOWA 1ZNBA 2PX3A 2HMTA 3VH4A 3VVBA 3LL4A 1N4DA 1WQ3A 3V7UA 4U6NA 4R5MA 4KU4A 2DMRA 1G1MA 1VTKA 5EL0A 1LBEA 2IV3A 4B2PA 1SUAA 1NXXA 2ZYGA 2WFLA 1G2QA 4WJZA 4RKYA 5K8LA 1SB8A 4BMVA 1TEVA 3IP5A 2R4QA 1KDYA 4RTPA 3HVJA 4KLZA 1TE2A 2IU0A 5CDGA 3KXIA 5IH7A 1DO8A 3GY0A 4A73A 4FFSA 3QEMA 1L5YA 2QN8A 3EF1A 4CNQA 1WZNA 3V7FA 2R8RA 4BUZA 1N0HA 1H2AS 3ODGA 1DWQA 3LHSA 1CVLA 3PVCA 4ZYVA 3A2KA 4C3ZA 4TZ6A 4R8RA 2H08A 2VHYA 4AJ4A 3MCVA 1XFDA 4IJ5A 1E1CA 2ZR9A 4QL3A 3VGJA 3RSLA 3ZDCA 1A72A 2J0SA 4WADA 1U1EA 1ZM3A 5AP9A 4KR7A 5AW7A 1XMPA 3VHXA 4NYJR 5CB6A 3OPYB 4PDXA 4PSCA 4KWHA 4AX1B 1X9IA 3KLPX 2CVPA 3RSFA 5JFTA 2CL7X 2JAXA 2B7CA 3RVRA 4B71A 2WV7A 2VXCA 2C5EA 3QVTA 4AKHA 1E5DA 1OXXK 2ORIA 1EP3B 2K6GA 2FWNA 3IT1A 3TLXA 3WLFA 2IY9A 4L3WA 4F7WA 4HDNB 4CKZA 4NOLA 1TIKA 2AF4C 3A06A 1MJNA 4KGDA 2ODPA 2ILVA 3MXOA 4J0GA 3IP6A 4YO8A 1V5FA 2REQB 3HXQA 3FI0A 1OFVA 4PZAA 2C4VA 4FJ1A 4LF5B 5I9TA 2P6OA 2Q6IA 3KEQA 3WBKA 1BVTA 4ENQA 2BOVA 2PIDA 3DMPA 3OEED 1PD0A 1EDDA 2J87A 3L7IA 4N3CA 4DFDA 4QPCA 1B00A 1R5NA 5IC5A 5JALA 4INAA 4D6PA 1FOEB 1T8RA 2X3FA 3C5EA 3C7DB 3H4MA 2JHCA 2AOUA 2ECKA 2DUJA 2YNTB 4KWTA 1IK6A 1D5WA 1NGSA 2ETXA 2Y99A 5E4TA 2WWVD 2AVDA 4A92A 5ARBA 1J21A 2ZCVA 5T41A 1L1FA 5HM8A 3K9FC 5JS7A 1QUFA 1FF9A 2J0UB 3BD9A 3OQ6A 5EQTA 1PS8A 3WMGA 2EKBA 4UKDA 2V5UA 4LI0A 4BKUA 4BGDA 1T8WA 4LOKA 1VE6A 2AI1A 4G5SA 5ILQA 5EE3A 1QG4A 5H82A 5I8ZA 1ZIYA 1U2GA 5G02A 3WO0A 1GPMA 4Z1MD 4JIMA 2KS6A 1E77A 3TTXA 3I0ZA 4DRXB 4ZYTA 3FOEC 2YY5A 2OFWA 1HKUA 5J5CA 3PEWA 4GD3Q 3RS0A 4FHCA 3CVYA 3SHFA 2ZRGA 4GR4A 5AXCA 1SCKA 5LP1A 4QYXA 5FV7A 3ZGOA 1KBZA 2VPZA 3URKA 2P1RA 2PSDA 3G2JA 1RC1A 2R7MA 2ZVQX 3THYB 4YJ3A 5F98A 1ZJ5A 3CSSA 4WLUA 4HL1A 2XZOA 2YYZA 3UMMA 3T12A 1VMAA 3ND9A 4TROA 4CL3A 3WGVA 3L7OA 4UWPB 3RIMA 3T94A 3CZAA 3HKEB 1EVIA 1XVTA 1SHTX 2Q46A 1YCHA 2ZANA 3AIMA 4ILEA 3AKZA 4B3GA 2XCLA 1RQLA 1ICEA 3BHIA 5GJBA 5F9MA 4ASUD 2HCBA 1Q92A 3WNQA 5A2QA 5KTNA 2PM8A 4CG3A 4KQKA 4FEEA 4RMHA 3GEMA 3ZPXA 4I08A 4RQTA 2GMNA 2QW1A 4HBZA 1JPNA 3L0DA 3PSHA 3U37A 4FGZA 4EG5A 4CJXA 1PZHA 1VC2A 2NTYC 1E2JA 3BE4A 1P80A 2FXVA 3CNEA 4E0BA 3U9TA 5IUKC 3EIXA 1F2TA 4X00A 1XYGA 4HAXA 4DYHA 2AEEA 4IIVA 3OZIA 2W2KA 3DT6A 4REOA 3CR8A 4MEBA 3SEZA 1G5IA 3EQ9A 5F12A 5KQRA 5LMUB 1YVPA 5YASA 3WLTA 3IOFA 1KI7A 2Q3JA 1NQTA 3DXZA 7YASA 1J23A 2Y1FA 3EOZA 3LWNA 2IOQA 2NUBA 2CBXA 2Q2QA 4ES6A 2BL4A 2QVLA 5LYJA 5KPDA 2AT1A 2FH5B 2AGVA 3X1YA 1GNSA 1U8TA 5JO0A 1CEQA 4CLOA 1PI3A 1SRRA 3EC7A 1YR2A 1Q1ZA 3DVQX 2R60A 1THMA 2P3SA 3I9NA 3R0IA 4KFUA 4N3GA 4YDSA 5AKEA 1G21B 2I9PA 1Y37A 2H3HA 3FOCA 4CR8A 3N0RA 3M6IA 3QFFA 5J40A 4J0HA 2ZR8A 4P5EA 3HG7A 3DDCA 4HF7A 2AC7A 2EJTA 1E3SA 4EJFA 4BBZA 3PPXA 1FFXA 3ZWNA 4P33A 4TYNA 5GVRA 4Y7DA 1T4MA 1TQ2A 2IPNA 2OG2A 1POWA 1EWKA 1W5AA 2HO5A 2H8KA 2JD2A 3GBPA 1LV8A 3E8XA 2CNBA 3I15A 3VR4A 1M6HA 3DJFA 4M83A 1GPDG 1IB6A 3ABOB 1IY1A 5ALGA 5FA6A 5HJEA 1N2CA 1QTIA 2DTEA 2JIRA 4HQFA 4F9TA 5L51A 2DQ4A 2H9AA 1LPBB 1BU5A 2Y0EA 5FLYA 3QLJA 5L7WA 4CPDA 2BHLA 4O4IB 1QM5A 3MS2A 1J70A 1MVOA 2QNBA 4OD0A 3UIEA 5LOVA 3GLTA 1U31A 1LCIA 4XX0A 4ZCTA 1CXZA 4QEZA 3OFSA 3JWJA 2A9JA 4XARA 4ZOCA 5U9CA 2BAGA 1BD4A 1L4NA 2JF0A 2W6QA 5B37A 5LQUA 3HJFA 3SC3A 3T99A 4KMSA 5B64A 3USCS 2OXFA 3BN3A 1LF0A 3JZDA 2PBLA 2VWQA 4QEKA 2J3HA 1VJDA 4BO2A 2O7RA 2ZULA 4N0PA 3WL7A 5JHGB 1Q7CA 2CJXA 5D85A 3FNEA 1DP4A 2XE8A 4J1TA 4IY1A 1F12A 3C4QA 2YYSA 3L3BA 1ESZA 3BORA 4LTDA 3HEBA 4M8IA 1A5BB 3OEYA 1QPBA 3HKDA 2YZNA 3TQFA 4TYYA 2ZBEA 4P0PB 1ADYA 3K09C 3IODA 4E03A 1E5XA 4MP8A 2LKDA 4RD2A 4NU6A 3THXB 2AK2A 4RGVA 4D9BA 3N2KA 3KU4A 3KPYA 5BPHA 4REQA 1B15A 3VU9A 4HDQB 3VHQA 1V47A 2C7QA 4B47A 2HQSA 2AFHE 1KDRA 2GHRA 3LJKA 3OOYA 3SEFA 1GDDA 1KORA 2CE2X 4IHJB 5HKLA 2CXXA 3F9RA 4NQRA 4HB0A 5HBRA 1GAXA 2F3UA 4QHTA 4DA7A 2YHUA 1NXOA 2P4EA 3IBSA 1EFVA 3VO1A 1XSEA 4LJ4A 2PGIA 2A67A 3K0KA 4OU4A 1WPQA 1ZRMA 4JLPA 2G82A 4RLFA 4XUKA 4MAAA 4LFCB 4CU2A 4ZEVA 2D2FA 4YK7A 5CBPA 5JD5A 2H2IA 1FFCA 4E13A 8ATCA 2B4QA 2W2LA 1JYFA 3DR5A 1P3JA 3WISA 2RC6A 5I5EA 4R1TA 2HF7A 4IWYA 1TPZA 1CZKA 2D5CA 3I04M 5HDQA 1E98A 5BN4A 5LQJA 2V3CC 2BI7A 4MHSA 2IYNA 1IM2A 3FR8A 4M46A 1B8VA 3T8YA 4FHZA 4DQUA 2WA2A 2GZHA 2QW0X 3OOSA 4TYPA 3WGHA 1VG1A 4KEPA 2WUDA 3G0IA 3N6VA 2J9YB 4JBLA 3P9PA 3GFFA 1L5HB 1II8A 3D2LA 3R2JA 1E1YA 5E4YA 5SZIA 1V5GA 1W0KD 5CFMA 1YRLA 4X1IA 1H0RA 2A58A 3C6QA 3TBHA 4I8XA 3G88A 3QUAA 1J8MF 1ADGA 2V5AA 4ODIA 4Q5IA 4ZVVA 4B4KA 3OZDA 3HDQA 3CF2A 1L7OA 1OI7A 1ZGCA 2WU0A 3WB9A 3CUWA 2YRFA 4MPRA 3OPYI 1A95A 3V48A 1RP7A 2HHJA 3OF3A 1RLTA 1SCAA 4P35A 3TZBA 4G9BA 1M9NA 2ID7A 3AMVA 4RMGA 1KYTA 1YULA 2XDAA 3L6BA 4HEA1 4UHJA 3Q7PA 1SVOA 1FP1D 4HAIA 1TUBA 3N3AC 2PKEA 1ZO8A 2C4WA 1QGED 5L4LA 4KGVA 1GNQA 1X0VA 3RHFA 3SE0A 2IW3A 4RF5A 3ZGVA 5I3ZA 1EHYA 1KU6A 2YJ3A 4G89A 1Z2NX 1FE8A 2R8BA 1GDHA 4RUKA 3F90A 4QTUB 3UHJA 3JASA 2B5OA 2CNLA 4BFWA 4CIXA 3KYCA 1U6KA 1VHQA 2YBEA 2ZRMA 2HLNA 4W5RA 5EIBD 1BSVA 1G8SA 4PCUA 1SZDA 2I6SA 1OZHA 2WF8A 3PDUA 4UU8A 1I80A 1XQYA 3GRYA 3ZNNA 4AWAA 3IEUA 1VLZA 5DM2A 2WAMA 1R5BA 3LOPA 1WMFA 2R25B 5IDXA 4TL8A 3B3GA 3VC7A 2JEZA 2PLFA 5IM4F 1M2JA 1ZHHA 3SQDA 1JJ7A 1OXTA 2RHBA 3DQPA 1Y1PA 1SCIA 4HQ6A 3RVJA 4CKBA 3AEYA 3BX1A 5PNTA 4QFMA 1FQOA 2IYFA 5JC1A 4AKSA 1EJ0A 1GSHA 2YZGA 1WLSA 4QRHA 4KVGA 5TF0A 2BCJQ 2PMFA 1PK7A 4Q7QA 2WFAA 2DR3A 3IAUA 4GQBA 3VRHA 1DJLA 5DT9A 2AI2A 1JFLA 1Z0DA 3N86A 5TS2A 1HPLA 4BO4A 1UQUA 4ZKDA 2GZ3A 4DRYA 2OV4A 5EZSA 2H1OA 1K4MA 1YMQA 4BFLA 5LP6B 4BVLA 1L4FA 4UC0A 2B61A 1D4OA 2X15A 3N53A 5F2NA 4RZUA 1LLDA 1JJIA 1YCDA 3TS1A 2EYQA 5JTTA 2BGGA 3ZE8A 3PEUA 4NCHA 4EVQA 4AYTA 4NZPA 3W5CA 3R6LA 1IUKA 3OY7A 4C4SA 1HX7A 2HBQA 2G5CA 3SIPA 3UJHA 1P9LA 2ESRA 1CNMA 1ZVKA 2ZIWB 2W5UA 1PHRA 3TSZA 3ZWCA 1AKVA 4WJLA 1U7UA 4U2DA 3GLRA 4M1SA 4AL4A 3ZHQA 2V1XA 2Q3CA 1RP1A 3REOA 2CHVA 4ZOEA 1GGHA 4KRGA 4K9NA 5LKRA 4Q3BA 3COSA 1BJRE 2FSFA 2E37A 4HL6A 1P6XA 2WG0A 2I3GA 4N5NA 1ZNXA 3I2JA 4QTXA 3UAXA 1QRRA 8ADHA 1CR4A 2HV8A 1BCRA 2VLIA 1FU4A 4FZVA 4QOFA 4TMFA 2JFOA 4FTWA 4OMCA 3TL3A 5AVKA 4JVNA 4G0WA 4LN1A 1FU8A 2GVNA 3ZHVA 2HIHA 3E0XA 1LJLA 1E3TA 3CNNA 3I2HA 3Q0TA 1M54A 2NTJA 3PC3A 3WDSA 1LI5A 4NBLA 3A05A 3TEMA 3UT5B 4K1XA 1WZ2A 1V8ZA 4US0R 2QZZA 3BILA 1IG0A 5ECGC 3A3PA 2R1UA 4PG8A 3SQWA 2PAFA 1WXQA 3QEKA 4M98A 2C1ZA 2H4HA 3KKZA 3BDVA 4UCWA 4UREA 1G21E 2PUVA 1XI2A 1QDLB 4U2EA 4LBYA 2OZKA 2D59A 4WZAB 2VFAA 2AN9A 5KVSA 5JPCA 4JBYA 3PY6A 1VJ1A 1X38A 3F7OA 1A7JA 4FLEA 4P3PA 4DA0A 3H9BA 3H2GA 2W2QA 4ZRNA 3JVIA 3DLAA 4R1LA 4ZO3A 2I7TA 2QM0A 4CEIA 1GG9A 1LBTA 2P8JA 1EVQA 1KQPA 1NYLA 1SCJA 3BF7A 1FFSA 1C8LA 2JFUA 3KZCA 2XCUA 3RRMA 4EGJA 2F1RA 3GLFB 1VCMA 2FEXA 2PGAA 4OHFA 5JCOA 4CW7A 2FX3A 4QYTA 1QHGA 3FLBA 3LPDA 2A7MA 1KVQA 1YH3A 2NAPA 1PJTA 1JIQA 4HNHA 1B1AA 2GXQA 1G5HA 2HL6A 3HZZA 3K0AB 3MYRA 2MU1A 4RSMA 3BD6A 3KQPA 2PVPA 4TQAA 3UCXA 4DDKA 3S81A 7MDHA 3T1YB 3CIFA 2RGNA 7ADHA 1TJNA 2N1MA 2E89A 4UBNA 1KZGB 1S0UA 2QRGA 1DBSA 3JARA 4UDYX 4WXPA 1TUEA 4BV2A 1U5CA 4OB6A 3MIZA 1F8YA 1M2KA 1ZP6A 4QEDA 2ASEA 4WXMA 5FOUA 1IY0A 3FIJA 4TKZA 2XMGA 3H3FA 5ECWA 4B6QA 1ACLA 3EEFA 4EATA 4R0NA 4C76A 4NP6A 1JBQA 2YFKA 3BMQA 1BHSA 4GVLA 3DKRA 4RS4A 3GJ8A 4CMEC 3U44B 2NO9A 4AQ7A 4N6GA 1ZJYA 2I9KA 1YR9A 4EHNA 3G89A 5L3SB 1NVVQ 2PRJA 2Y1GA 2A5FA 1RI2A 4X7BA 3TP9A 3ZCUA 4YPVA 4GFDA 1P2GA 1QO9A 2IXBA 4MB0A 3ZU4A 2YOFA 1E1MA 1P5FA 3AKDA 4LJ6A 2QTVB 2CYAA 3RUEA 1KNQA 1A5TA 1DWUA 1VE9A 2GBLC 3AF3A 3DXYA 3MA0A 4QUAA 4C3UA 5CG1A 3G2QA 4D5EA 3IOGA 4MR9A 2BFCB 2O20A 3BSYA 4B2YA 2WC1A 5ARDA 3NWJA 3L1VA 1Z4MA 1JKMA 2JI6A 3HVKA 4GPEA 2C2BA 4O2AA 3SXPA 4OX9Y 4CMIB 3GFBA 4NH4A 1DLJA 3FAZA 3IMGA 2XNDD 3KT3A 1NZDA 3NJ4A 4KR3A 5DNDA 2GM3A 5JNTA 3V2IA 1W36D 1LV7A 1ZGZA 2WD7B 4M53A 2ID9A 1L5VA 5F33A 1R0XA 2GK3A 4R98A 1V3VA 3UJPA 2R1TA 3T15A 5KTRA 3P5SA 2XJ4A 1QTNA 1NYQA 2LVBA 1RJWA 1X80A 1UT8A 2G9UA 1F2DA 1MQSA 1A82A 4G4SO 3MJSA 4OQNA 4QE3A 3WSWA 3FPEA 1WZUA 2J4FA 3AUSA 3CX7A 3HI6A 2R8OA 3KL4A 3PLRA 4EW2A 5SYNA 2VC2B 2ZPTX 4MHTA 1TAUA 1H22A 1E4VA 4WHMA 4KQWA 3WOVA 3WIEA 4Q9IA 4C43A 1I14A 2P3QA 5FPYA 2W4MA 2O2EA 4PX2A 4X66B 4DXHA 2IOFA 1A9OA 1UMKA 2H54A 2PXHA 3IRVA 1N32B 1GAJA 1BE1A 1DFGA 2O48X 1T3GA 2D74A 2YS6A 3GO4A 1CVRA 1GYRA 4NPCA 3QLTA 5GIPE 2GKLA 1XO1A 2OAEA 2VA9A 1L4YA 1UJ4A 3M5WA 2N75A 2HPAA 4KQCA 2VQ3A 4P86A 4F21A 2CVFA 4Q48A 5FWXB 2R751 1J2TA 3KKLA 4LNUB 3X2ZA 1DKUA 4HL2A 1G20A 5DLYA 1SEVA 4NX2A 2BG8B 4MYTA 2FEWB 1N3IA 2AJDA 3DVRX 1E79A 5BN5B 3DLIA 3W78A 1CTQA 4PNPA 4DEYA 5KNDH 2HQ1A 1NZFA 1NV8A 2I3DA 1DC8A 2IUYA 2IHYA 4FDMA 2IXDA 4UCQA 2AJTA 3ISTA 4OQQA 1WEKA 5AESA 3ZVRA 1MX3A 3KX2A 1E9BA 1NQVA 3TOSA 3HHPA 1XRQA 3IQZA 3VYRB 5HJ5A 3WGIA 1R6AA 3RVQA 2NZJA 1R6XA 1NXQA 3RASA 1NSFA 1JPJA 1GEGA 1YE3A 2EGHA 2JVJA 1JLKA 3B3AA 3T0GA 1O94C 2F9LA 2AQHA 2H1IA 3QE3A 3KSDO 4RA6B 3G9ZA 4RHFA 3MD7A 4E30A 3NLLA 4EOGA 4FM9A 1TGVA 1QO0A 5FJIA 2OTCA 2J5BA 1ZZEA 2VEOA 4QU8A 3B1ZA 3V1KA 1WW2A 5AXDA 4QT4A 1RTKA 5IBQA 2AUTA 4POAA 4ZNBA 3EIUA 4DARA 2PVSA 1JP7A 3QYPA 4LX0A 2WWFA 1FFHA 5G0TA 1Y6FA 1XEAA 1XL0A 3D6VA 3LQ2A 4Z5XA 4FUTA 4OK3A 2H0QA 4J03A 3SX2A 3EIQA 1SO8A 4YECA 3ID6C 1B8NA 4QQKA 2QBYB 1W4AA 3F78A 4QFCA 3HEMA 5HIOA 4GOJA 1P74A 4LAFA 5I9BA 3EXHC 2H5IA 2VDUE 3G8BA 4JUFA 3IAHA 4OSOA 3WMFA 2NVUB 3TL6A 1HA3A 3DFMA 4UOQA 4WY5A 5EPEA 4FT4A 2VSOA 1JU4A 5DGHA 4YMSA 2ZM6B 2ZTSA 3IBTA 3LOQA 2D62A 2WABA 3WWYA 3TTUA 3T1OA 4Z2AA 4XCXA 5HNKA 2ATXA 2JIDA 1N8KA 1XCLA 2B4RO 5CGZA 1IUOA 3CZPA 4QWWA 2J3IA 4QYMA 4DXDA 4HWKA 3AERB 2FPSA 3I30X 4EL0A 4JIGA 2P3LA 3U39A 5B2FA 1AN9A 3N7AA 2ZNBA 4GX5A 5BRAA 3G1WA 4OBXA 5L40A 4E2FA 2O2XA 4DDUA 2DUNA 2DLNA 1Z47A 4PVTA 3CUUA 2WM3A 4GM0A 4EUEA 2P62A 3C3XA 1YQWA 3BXXA 3EEQA 3M9WA 2BI8A 4PO8A 4MUBA 1NWHA 3L43A 1QE5A 1YZTA 2W83A 3HJBA 3NBAA 4F2DA 3DHWC 4C3VA 1YQUA 3U4MA 1PHPA 1RYDA 4BFVA 2ZW9A 5ITWA 2RGWA 3A3NA 5B1EA 1PWXA 1STOA 3FTDA 3I73A 3MRSA 1Z16A 1IWOA 3QUQA 1CR2A 4ZEWA 1R4ZA 1EIZA 1RQ7A 1WXWA 5IDQA 2YL2A 3OIVA 1ISIA 4FMCF 1Y3FE 3I45A 3PITA 2QMOA 4JLBA 3PPIA 4U0JA 3L7MA 2H1LA 5E4JA 1C30A 4MUYA 4D3FA 4DVJA 4ZK6A 5EWMB 3ORSA 4BZXA 1DXOA 5BV1A 3D31A 1KC1A 1TZ2A 2BDTA 4KUGA 4MMYB 5C0OE 2JDIA 3W3AD 5HVNA 5F3RA 1TF5A 1PW7A 1E4OA 4LJLA 4EAAA 1ZU5A 1OJ7A 2CCJA 2WIFA 5LQDA 2ZYIA 4HB3A 3RD5A 4G1FA 1HM5A 1ZK0A 3GJYA 1L7NA 1OQAA 3DPIA 5F1OA 4PC3A 4BDSA 1S1CA 1UBMS 3AB8A 4MWTA 2GTIA 3FMVA 1CJSA 2Q3LA 3QOYA 3DULA 4MWGA 3WTBA 4NJEA 3HRHA 5CA1B 2WYHA 1GUDA 1T5HX 2GN1A 3NIDB 1QBGA 2PX8A 3GDHA 3HCDA 3KR2A 1DTSA 5ILGA 3A9WA 5AW5A 3F73A 3VKGA 1AA9A 1T0UA 4IIHA 3GLFE 4AC9A 4OEHA 3PDWA 5EUCA 2RIRA 3MB8A 5KNCH 2ZUDA 2AQKA 4NMMA 1NMEA 2HMUA 3IFSA 5FFNA 1LX6A 1B41A 3S7ZA 5ICMA 1E3IA 4OX9B 1GUBA 3GPCA 2PTGA 3KT6A 1T6YA 2J3KA 3PG5A 3QI2A 4XLZA 5FPKA 4HAZA 3ZVMA 3TTWA 1N7IA 4D1YA 5DP2A 3H3EA 1KFBB 2XKJE 3GD7A 1WBDA 2VPPA 4WA7A 5ITVA 4J0DA 1NVVR 2JJ1D 3CW9A 3B6IA 4ZO4A 1PDVA 3LXMA 3GFTA 1CYDA 5U4QA 2HHHB 5AVVA 4ALIA 2A9VA 3NDPA 3LK6A 1U98A 3SX0A 1F4LA 1ZPDA 3KZMA 1YZLA 1CFZA 2D0DA 5DX0A 1UBTS 3ZOZA 3E53A 3RFXA 4HAUA 2BFDB 4UM9D 4UOZA 2OWDA 2OGSA 3SVZA 4XWGA 3EUEA 1GGNA 2SHKA 5G2OA 1XTSA 1ENOA 2YDXA 3U48A 1RKBA 1Y8CA 3LBYA 1V39A 4GKBA 3OE5A 4N3BA 4GMDA 4LYJA 4ZCPA 1ZRNA 3WNCA 1D9XA 2R6DA 3O8QB 1YAHA 2VYND 1X1EA 3M82A 2NZWA 4Y9RA 2PLWA 2PGNA 4BVHA 1DD6A 1WB6A 1ZESA 1N6OA 2ZTHA 3A3OA 4KO4S 3CRNA 3EW7A 2PYIA 3A3YA 1TF2A 2WF9A 4PBSA 5CVEA 5AVTA 3IAXA 4RWEA 2H1RA 3D7MA 3NWBA 4NTZA 5EQDA 3IMEA 4GMHA 2JA2A 1QC5A 3QEBZ 1M75A 4TZTA 1Y5IA 4D3SA 4MRMB 3ZV3A 1CP2A 4A2CA 1RYEA 4EHIA 2RGBA 4X1YA 4OL0A 3WIUA 4E4TA 4BB5A 5ALHA 4EFZA 4OK6A 4IV0A 1XLUA 4EHBA 4BNFA 5HZKA 5JQGB 2JLXA 3GUVA 3C4JA 1UP4A 3GLSA 3ITKA 5ALIA 4AU1A 5I9IA 2NO4A 4ZO2A 3KPUA 5CVUA 4EITA 1WQ4A 2GASA 2ZG6A 3RV4A 1QHFA 1NT2A 4NZNA 3UQZA 1R10A 2IU6A 2HJGA 2VHZA 3RLIA 1EJBA 2UZ0A 1QMPA 5AMXA 4NCBA 4TYWA 1E0JA 4OHRA 1M83A 8OHMA 1C7ZA 4ZVUA 1JDPA 3AIOA 1FFAA 2IDMA 3R7WB 1NMYA 3SZUA 3EQ6A 4YY3B 5CX1A 5I7RA 3QKRB 2NZXA 5J2TA 3ABQB 3G5MA 3GVIA 1XTTA 1DI0A 1FXSA 1RHMA 1T2EA 2IYLD 5D3MA 3WTCA 5M7EA 1TTPB 5HIQA 2Q1XA 3HJHA 3HXLA 4GKVA 3BXZA 4J43A 3H87A 4KLCA 4DT1B 2CDAA 2QLMA 2VDKB 4ZT6A 1I7NA 4D9NA 3SS9X 1EXNA 1U0NA 3FETA 4ND3A 4TV9A 1BYUA 3BK7A 1NI5A 4GPBA 4UUBA 5DM0A 6REQB 1KDTA 2OHIA 3ESAA 3EZYA 3LUGA 3LWBA 4Y2GA 3R7FA 3A28A 3MVEA 4UZFA 3FH0A 1AURA 3MCZA 3D8SA 2LP4Y 1YDHA 4CMJA 1G3UA 3O6VA 4N5HX 1IRIA 2EX1A 2ECOA 2G0NA 3ND8A 2BEJA 4YDHB 3KD2A 4DJAA 3VPSA 3DS8A 4E6PA 2HJSA 2P9HA 3UH1A 2F43A 1USVA 1NPDA 3X2SA 3ZZ0A 2JKVA 1F6BA 3LLSA 3NWPA 3JATB 1Z68A 1KO5A 1U9CA 3NQ41 5INTA 1R8SA 1TM7E 2FJUA 2J3DA 1DIGA 2PRZA 5BUZA 4ID9A 4MV6A 2X22A 1SUEA 2A6PA 1EX7A 2AEMA 1Q0PA 2H5EA 4J0KA 4M1KA 2X7XA 3PYLA 4DCUA 1JIVA 2HA0A 3CZ5A 4J9UE 1QK5A 4M1TA 3T7DA 4A8HA 2X58A 3H9QA 4CMGA 4X61A 4MR8B 3T0FA 4DR6B 2PUDA 2VJLA 2C57A 2V5VA 3VKUA 1OGJA 2MCFA 2FEPA 5FKJA 1VHTA 4X90A 5KWVA 1DBVO 1X2BA 1XN1A 2RAVA 1OOEA 2P68A 3NC4A 2FQWA 4YBRA 3PD7A 5A3RA 3UMYA 3EDCA 3C6XA 2EWMA 4FNOA 4OL9A 1I2AA 2VTVA 3DOHA 4YSKA 4B83A 4M88A 1E8DA 4KWCA 4G56A 5TSDA 3WHLA 4QOIA 3OUZA 4CIBA 2MSLA 3EVZA 5AICA 4FHFA 1T1SA 2P78A 4HEA6 4QDXA 5A3QA 2UUCB 2HV9A 1VIVA 5JJCA 2PNFA 2Q49A 1CS0A 3AP1A 3PJDA 1X94A 4KO2S 2C5BA 4M7RA 4WD3A 5E2AA 3H6GA 3EIHA 4RVNA 3KNRA 1YC2A 1I51A 4YMVA 1MABB 4DBLC 2YINC 5WRFA 3VU3A 2JGEA 4JELA 1CUZA 2GBPA 2YN4A 3QM1A 2CMFA 1HEUA 3IBGA 2P27A 5L95A 3OIFA 1RLUA 1BMFD 1KEVA 1SZJG 3IUJA 3EEOA 1G6HA 3BTVA 2HMAA 3IEVA 3DJYA 5FADA 1RPTA 3GAMA 4FU0A 2WOOA 2Y1EA 3FF1A 1ZISA 3LOUA 3QBVA 4NESA 3VX3A 4KJXA 2VNIA 1HNNA 1L3BA 3NU1A 4RQAA 3S1LA 5KTMA 1O5OA 4TWJA 3PFNA 3GRVA 2GPTA 2HK6A 4QYWA 1XLTA 3PIIA 3Q5GA 2H2DA 2Q6TA 3F9IA 2Y77A 4JA0A 4RDXA 2J7PA 4KOEC 1U3FA 4Q05A 4L5IA 4GF5A 4UCXA 4FHEA 4UTZA 7MHTA 2XPCA 1T4GA 4I36A 4UHBA 1G3IA 3EWNA 4KV7A 3OX2A 4N4AA 4KR6A 1HSZA 1Z07A 1T9DA 3QA3E 4MUHA 1FJ2A 3MGAA 3FTPA 2L19A 1QVVA 4ENTA 1N75A 4KOAA 1Z6TA 2OT3B 2F1KA 2XD9A 3JWPA 3K53A 2Q45A 5LCXA 3TRJA 3W2TA 4XDYA 3WNZA 4X7RA 3TGWA 1CY7A 2AMLA 3O47A 3OCYA 4OSEA 1RXSA 3DUFA 5KYYB 4A91A 2JZOA 5ITSA 2ZUWA 1O97C 2WJAA 1L6RA 2YIJA 2ZJ7A 2AG1A 5SZJA 4CTOA 4GUDA 5IPFA 5B1SA 4Z4EA 4GZ3A 4I50B 3ADKA 4EPTA 2AC4A 3HNRA 2IYRA 2EF1A 1QSGA 4W5QA 5C32A 2OVFA 4Q4DA 5CTJA 5JCZA 5IT0A 2I91A 2PA3A 3D9QX 4MQ4A 4YMWA 3WGJA 3KQHA 3B48A 5J43A 1KQFA 2C4KA 3DHCA 2WMOB 1COWD 2OV6A 4Q7JB 1ONPA 2Y9MB 2XDWA 1ZJWA 1KEEB 1WUPA 2VT2A 3VTAA 4NZZA 2E49A 4ZU6X 1HC7A 2ATVA 4Z7OB 1JQ5A 5CVCA 5F1PA 1OGYA 3JALB 4RVHA 4ZAFA 3AR6A 4ENUA 5I7WA 2VXBA 3SZGA 3DH8A 1T43A 2DRIA 4X3CA 4ZVPA 2BFZA 4XDZA 1G3QA 3LV8A 4CCYB 1RPZA 1UJ2A 2OO7A 1JQBA 2G67A 3CSUA 1WLYA 1J9ZA 2Z1NA 3LUAA 2QX9A 4XVQA 5CM8B 3RPEA 1JEYA 1ZOIA 2GB4A 2XRFA 3JQQA 1ZAKA 4UAJA 2HREA 1G6OA 2BIFA 3ANSA 4JB0A 3VR6H 2ZIFA 1KSGA 4BNWA 2NZEA 4O4LB 4X1KA 1F38A 3AILA 1P6UA 5BURA 4BIIA 5CBKA 4ZV9A 3A4IA 3B85A 5CUQA 5HQ3A 6Q21A 1C29B 1O58A 4LRWA 2POQX 3IELA 4NCNA 3SZLA 2D5AA 2W48A 3MJCA 4M8LA 5HTOA 1P7WA 3CB2A 2UVDA 5EWJB 1RQNA 4XEUA 3UK1A 4FBGA 1KI9A 3KETA 2J1LA 2A8YA 4LDRA 5LQSA 3SE7A 1MENA 4GIBA 4TYMA 5CH5A 3NPMA 3TZ6A 2WKSA 4UPEA 2VTBA 2X1LA 4L95C 4BJ1A 3TLAA 2BGMA 1HE4A 2HYDA 1AN0A 1LH0A 3T4EA 3NANA 3EY4A 2QR2A 4IICA 1JRLA 2WRZA 3CRW1 2C3YA 3VR5D 4LDQA 4I1VA 4BKRA 1JKJB 2A5LA 2GXSA 3DHEA 3KQKA 3FOAA 2QTHA 4FZ3A 4AWZA 4YCMA 1FQJA 3CPEA 3VKVA 1FW6A 4KH0A 5IWAB 2FPWA 3RYIA 3G13A 3KJFA 2RK3A 4NL4H 2A59A 2CLLB 5BSTA 4CIVA 1UMCA 3CXRA 2YNVA 4WCFA 3DZHA 3EFOB 1Q1EA 3BOSA 3KLMX 4DSAA 4W6QA 1EKXA 1JDSA 2F6RA 2PMBA 3FAKA 2LWIA 3H16A 4UFOA 4YIKA 5EWLB 1GLGA 1HT2E 1NFRA 1UC8A 2CL0X 2NTNA 3EZ7A 3I6ZA 5ICFA 1BHJA 4BFSA 4FSHA 5K8TA 5GONB 5P21A 1UXGA 3LX4A 2I2AA 3QHAA 4R41A 4ER0A 3O8RA 1GA6A 2Q07A 4ZCRA 3GVPA 3UK0A 1KPIA 4HJRA 4HUJA 4JENA 4WLFA 3T9CA 3W4KA 1P9NA 4CF7A 3UANA 4BRSA 4EEZA 5DT2A 4BO9A 1NYRA 3CLSD 5A0VA 1XTKA 2E3JA 1X8LA 3F7MA 1KJ9A 1T9KA 2FG6C 2FWMX 1J06A 1XEXB 2ZROA 4G1EB 4J94A 5E6SA 4G4SP 3RU7A 3T5MA 3Q9SA 4MMZB 1PF7E 3CZRA 4MGKR 4D56A 4KR2A 4WFIA 1NQUA 2PUFA 5B53A 4QSMA 3ZE9A 4C4TA 3FKSA 3KYDB 4PU0A 2XCTB 1XYVA 2JCSA 4O4HB 3UHOA 1VDMA 4L8VA 1FRNA 2LKCA 2A88A 3PPVA 4FC7A 4EFLA 3RWOA 2C9OA 4TLEA 2DFKB 1DMRA 2JPDA 4X85A 3VKWA 2HMVA 4HDAA 2X14A 4XDHA 1Q77A 1YU6A 2EW8A 2RB5A 2G70A 1YI0A 1MRZA 2EHDA 3D0RA 5E9WA 3TNYA 1TD1A 4ZVTA 4D7AA 4EYEA 1L9YA 1AK1A 5K4MA 1WS6A 2MSWA 3JVUA 3LVZA 4H6WA 1NR1A 2FN7A 3INRA 3H17A 3AQIA 3NDJA 3QVVA 4DPLA 1SK9A 4FZJA 1XZKA 5JAZA 3E15A 4MS3A 5E1DA 5CDFA 4NZ9A 2VYVD 2JAWA 1F3LA 1BXKA 3COWA 2JAPA 3OIYA 3C39A 4D9CA 2Y6VA 2XBLA 3IAS1 3LPMA 3ROQA 2WJPA 2UU9B 2P90A 1R6DA 5F76A 5PGMA 4U02A 4QPNA 4AF7A 4II7A 1NLYA 3DWGA 5F1KA 2MYPA 5LU9A 3ROFA 2CFTA 3LS2A 3G9QA 1H2ZA 2OV1A 1PD1A 3QWBA 3URMA 5KAPA 1XWFA 4YCJA 3GP8A 4J2TA 3RVNA 2FOLA 1OLUB 2DBZA 4PPGA 4DIDA 2AMYA 1R0RE 4R71A 1YKFA 3R76A 1MAUA 2V45A 2ZSJA 4F5YA 1J9GA 5JPDA 3TVTA 1QFZA 5SZKB 2RAPA 3UJAA 4C9BA 1XLTC 2QMEA 3II6X 3SS8A 2GFQA 1BWSA 1RM4A 2R8YA 4QA9A 3MCTA 1N1DA 3RT1A 3WMRA 1I9CA 1UBRS 2GXAA 3NTLA 3ES9A 3PFIA 4MIOA 4N39A 5IP5A 4YP1A 4WT7A 1FSGA 2B5VA 2LIVA 2VNJA 2YOHA 2DPYA 1MX1A 4HLUC 4YGYA 3INTA 2Q7XA 1PK8A 1T3HA 1P7PA 1AGXA 2H57A 2HU7A 3B52X 4EGFA 4YRLA 4D1TA 5EIOA 2H1VA 1KFEB 1QIKA 4GM1A 4RV9A 1GTL1 1JTVA 3O93A 5AJYA 4QOJA 1WUTA 3TQCA 3ZW8A 3ZW7A 3WIVA 3OM1A 3A9TA 3EAGA 3WK7A 5HCIA 1ZN8A 4QJ4A 3I5UA 3D4LA 4Y3UA 3REFA 3G8YA 2W6ID 4ZODA 4AB1A 1YB5A 2P9CA 2PO5A 1JVBA 2WWTA 4IDFA 4QUHA 1KL7A 3MJ4A 4G65A 4HLCA 5DGXA 5D51S 3IULA 1FVXA 1KXJA 5J1TB 1HLKA 4PZZA 2VRBA 2X4IA 1G9SA 4PCVA 4ESOA 5C81A 3BD8A 1VL6A 4JP1A 1E6KA 2QTFA 3DV2A 3TQSA 1MXFA 4D3DA 3CUSA 3TIXB 4PR3A 2WM9B 4BLVA 5JAPA 3I8SA 3FUUA 1O0CA 1JJAA 2IDKA 2K2QB 2PZFA 2Q9BA 1J4AA 3OQJA 1BRMA 3RQSA 2AE1A 4DCTA 2RGCA 4KQFA 4EYKA 1Q7TA 3FYUB 4C03A 2HJRA 4QGGA 4PINA 2JIBA 5JAMA 1GUFA 2QRNA 3KJQA 4M8SA 2CNOA 2ASVA 1RDFA 1XCPA 3B38A 4O1MA 1WXDA 3NBYC 4RFLA 1B6SA 1GA1A 1MJGA 3LZ6A 1SIBE 4U9IS 4BOYA 1KVRA 1CDEA 1I3KA 2DQSA 4F2HA 5EVJA 2P4SA 3KQOA 4WK0B 3DLTA 3FPLA 3GIWA 1EK6A 5KSWB 1KYVA 1YRQA 1IPFA 2QV0A 1CPYA 2IITA 1OVGA 3RTAA 3WL8A 4GM4A 1NY6A 4Q9KA 1GZHB 1S4MA 3GGSA 1UCFA 2QE7D 3G7UA 1E18A 2VHUA 3MTQA 3RRNA 2VHWA 4RY2A 4MVXA 3QUBA 3ZUGA 4AD8A 4DMUB 1CZOA 3B51X 4EKNB 5THQA 5C51B 5LD2B 2HCRA 1NOKA 1RS0A 3WAKA 2WHPA 2CFSA 2Z5VA 2JGDB 3MELA 4K9PA 1NXVA 1DIBA 3CCFA 4CM8B 4GPAA 3BHMA 4X20A 2QHXA 5IF9A 5MDHA 1E60A 2BMAA 2ZRFA 3LA6A 4MKXA 1SC1A 5J58A 1U8CB 4QDKA 1CQIA 2IYAA 4TTTS 3WLQA 2C7GA 4WBNA 1FP2A 3UKJA 3H1PA 1C3EA 3LGAA 2YWFA 3ORHA 3PB3A 1M1YB 3SK0A 3SQNA 4Z49A 1FQKA 2AG8A 4JMPA 4KYVA 2A4KA 5BNTA 4NZYA 2E85A 4G9GA 1J1ZA 2JLRA 3IIKA 1XJCA 1RHJA 1QF7A 1W25A 2XWPA 4ND2A 4WCFC 4HPJB 2DUMA 1EQ2A 1THZA 4ZEOA 3SZOA 4BBAA 4EF5A 5K3EA 2QP3A 1ZTCA 1C8BA 1JJFA 3K4QA 4HN2A 5LA6A 4PFSA 2SKEA 3IB6A 3SAJA 5K2MA 5BN3B 3U1BA 1WCXA 3N5KA 1LLCA 2P67A 2QAGC 4OHOA 2C7BA 3IDOA 4ER7A 1VA4A 2OCLA 4IEIA 1X1BA 4N0QA 2ADMA 2WP0A 5ECDA 5CXQA 3DFFA 3NASA 1PP4A 5E4FA 3RI3A 2RHHA 1Q1AA 4RKQA 4ALLA 2VZEA 1Y5NA 3OQPA 1AU9A 5KX5A 1RABA 1DRUA 3PYXA 3LUBA 1C5KA 4PSDA 3TF5A 3AKEA 3LH5A 1ISPA 3PFWO 4OHXA 3B7PA 3UKDA 4HFMA 2E5LB 3BCUA 3ND5A 3V3KA 4HBGA 1CR1A 3RUPA 1OLSB 4L6IA 1QS0B 4Q3CA 3U2QA 4MROA 3DTNA 1T34A 3C6MA 5I9SA 2Q0QA 4N82A 1I9GA 2IDZA 2XF8A 1O87A 3HN2A 2P11A 5BYBA 1MB9A 3AEKB 3QU7A 3PG4A 1D1PA 5JC8A 5K3BA 2CLDX 3ZTWA 4Q1EA 3SM9A 5KCZA 1AKMA 2Z3VA 4W82A 3L8YA 2R87A 1Z0FA 5JH7A 1C0IA 3CZQA 4XOUA 4IM7A 2ZI3A 3NNNA 2Q6KA 5GZ3A 5C8XA 3LT0A 1ZUWA 5KS2A 4WSOA 2R85A 1PJ3A 1Q7GA 3EF0A 4IINA 4P2BA 5H4HA 1TK2A 5BW5A 4WA8A 3PENA 4QTTB 4KPGA 4CQMB 2HN9A 3UK7A 3F6CA 1OLXA 3D4NA 5EHQA 3FNFA 1GR0A 2PANA 3FGPA 5DTJA 5LDDC 3E9MA 3RYCA 3BWDD 4IDNA 3LUDA 1E4EB 3EZGA 2HIMA 4IYJA 3S68A 5E7QA 3AVUA 5C80A 2HA5A 3CRVA 5L6LB 5FTNA 2V7BA 1TZKA 3EIFA 4MRPA 3CLHA 3H65A 1BMFA 4OYYA 2G5TA 3ZIUA 4GE3A 2FV8A 2YV2A 3TRKA 1JR3D 5G3ZA 2ZWIA 1A9QA 2ORWA 3OOEA 5BW6B 1UFRA 1KMCA 2FPGB 1SCUB 2GARA 3BMOA 3F7TA 4KIJA 4U7GA 2B8JA 4D9IA 1MX5A 1A27A 1IZ0A 3LQYA 2J5QA 1UWVA 1HXHA 5FNZA 1S8FA 3L7CA 4A6DA 1WHSA 4B85A 3KJXA 5BW8A 5IAAA 3L06A 5TS3A 1JAYA 3DC2A 1VE3A 2QN7A 3HB5X 5H5JA 5TX7A 5KIAA 3SD9A 2KM1A 2R44A 1XTOA 5JJIA 1B14A 1BDJA 1EDBA 1NU6A 1P91A 2DYKA 3DBVO 3I52A 4GOOD 1QVWA 3I0NA 5EUBA 1P9EA 2W4QA 3NIWA 3RRBA 3EOBI 2AN5A 3ZZMA 5JS2A 2IEYA 2L0XA 1ZMTA 4GNKA 4DL9A 3Q8LA 3UGJA 1ARZA 4BE4A 4LC9A 3LRPA 3FB4A 4WY8A 1GPNA 4AXBA 1RAGA 2PZBA 4QKQA 4BLUA 1UZUA 4NBTA 2B83A 1KZ1A 1XMSA 2ZJ2A 3LKDA 3N05A 5FBQB 4EELA 4F4CA 4JR0A 3TRFA 4CFYA 4YJ2B 2FUKA 1JJEA 4GI3A 4Q18A 1ZMRA 2GLUA 2YWRA 2AZDA 1BCSA 1EA7A 1K89A 1Z39A 4LNAA 1E2EA 4PYRA 4XFJA 4CUZA 1BGXT 3C24A 4Y2JA 3CT6A 2CB0A 2RHOA 1Z6QA 4XIFA 2HWKA 1R66A 3VV3A 1J2YA 4YJGA 3UWKA 1GRCA 1W35A 2PDAA 2JI4A 2XT6A 3IOMA 2D1RA 2VUHB 3M6VA 1U7XA 1V41E 3SXUB 2C2WA 1H05A 4IIJB 4LV8B 4YMUA 3GDOA 3AI3A 4ZV4A 3CF6R 1EX6A 5LYYA 1QPGA 4LE0A 4NATA 1H9AA 1YB1A 2HSDA 3ABIA 1R4AA 5ESXA 2PS9A 4HUQB 4OF4A 1NASA 4RVOA 4KPUA 2D1FA 4M8NE 4RENA 5IKMA 1FNNA 5A6SB 2Q5JA 2EZ9A 4KXMA 2VDWB 1PEKE 4CVNA 1BC5A 2QZ4A 3DE1X 4MP6A 3HK2A 1KKLA 2XXAA 3BMNA 2JANA 3IQGX 4QO7A 2BE7A 5AW8A 3ZHUA 1TK9A 5EUMA 4O2RA 1GGMA 1Y82A 4IV5A 1IQRA 1NZJA 1K3UB 4LSMA 4M9CA 2C3UA 1O9GA 3FBWA 3WGKA 3J81k 1R0LA 3ZJTA 3TG2A 3QKIA 2WRSA 3HXPA 2E21A 5G0UA 1UPCA 3UZUA 4HYYA 3C6ZA 3H9GA 1QHEA 4RJKA 1FZTA 3IUMA 4QOHA 5JWOA 3X2EA 1M5RA 3M2PA 3OKAA 1Q1NA 2QRVB 3FPSA 2O19A 2PQ0A 5KTYA 1LF5A 3L0BA 4UDOA 3OTWA 4NAHA 5FYDA 4OREX 4MW0A 3DZCA 1B26A 2XB6A 4EEKA 5LQKA 3BDAA 1D2EA 1VYVA 3JU3A 1DKRA 3ZXIA 4U5QA 1GQFA 2EZUA 1HY3A 421PA 4MEJA 4I0WB 3HV0A 4ZVMA 5D7BA 4KLNA 5JNWA 1ABBA 4AJPA 1ZOLA 1IM5A 3PE4A 1YNSA 4RD0A 4ARAA 3L92A 2GJSA 1UOEA 2XJ9A 4EJSB 3SCZA 3ADCA 1EFAA 1ZD5A 4C07A 1O8CA 4B9AA 3NBUA 3OZUA 2CJWB 5CLHA 5IG2A 4I3HA 4CT5A 1GM5A 4OM7A 1JWBB 3VU1A 4MI9A 4DUPA 3JXPA 1N78A 3RFFA 2BUBA 3QFCA 4AFNA 2I6TA 2YIDA 3PX2A 1GTRA 5AVOA 4Z3DA 3ZOKA 5KUTA 1EJ2A 1TO6A 4ARCA 1Q0QA 4L4YA 4DEXA 3HI4A 2BIBA 2XE7A 3ZDXB 5KNDA 2JKZA 2O06A 4EYBA 1GU1A 1RPAA 1V4NA 1N5OX 3RJ9A 3U19A 3TMKA 2D7DA 4E51A 2F1OA 5FBWB 5FP0A 4GO1A 5FHQA 4H1VA 5CT5A 3FD8A 4ZXFA 1JKXA 4CQNA 4B45A 2ZB7A 5CVDA 3I1FA 4RSGA 1JDVA 1NA5A 4UZSA 3T3IA 2RB4A 1TMKA 2OL4A 3GGGA 4BQEA 1N2GA 1JZTA 2NM0A 4Q4AB 3SSOA 1KMHA 3PNKA 3NH9A 3N39C 3TO5A 3VTZA 4ZFNA 3T9DA 4AZ3B 3DWIA 1XLWA 4H0NA 1HG0A 4B7XA 1M1YE 3PEEA 5GJWC 3K73O 3IQFA 4GT1A 3RU9A 1LVUA 1JNYA 3R5XA 4I1SA 4IZHA 4TZ9A 4RE5A 1Y6ZA 5JAIA 4BNDA 5ES4B 3AJ8A 1BN7A 3B78A 3ICVA 3CZMA 3ONVA 4CLHA 4IFEA 3WJ1A 3C5WP 4E31A 2GWHA 4OIMA 4KFCA 3Q15C 4Z4FA 2DSTA 3B20A 2VYVA 3RTEA 2RI0A 2EKPA 1ZSNA 3FMFA 4YPFA 4DIBA 1KO2A 4CCWA 4C14A 4GYJA 4B32A 3V46A 3ASYA 4ITUA 2IGBA 5DGDA 2JGJA 3RC9A 3G1PA 5EHZA 4MA0A 1EZ1A 5F2KA 3F1KA 2VJNA 4XFDA 4EHLA 3U4AA 4LDZA 3TFOA 1EEXB 2NXWA 3PEVA 3Q7EA 4MZDA 4UMEA 2NYAA 4LE1A 2B9EA 3N2GA 4EMUA 4A0RA 4OH7A 1TZCA 3LC7O 2WSBA 1JZQA 1XCJA 1E5TA 3VYVA 2B8NA 2OK8A 5HH5A 1T5TA 1F2VA 4PVCA 1A9YA 1T0BA 1GRRA 2OLKA 2ZWOA 4NHEA 3RRJA 1Y3DE 4A9AA 2J3JA 2FHSA 4P82A 5JMOA 3ILSA 1P61B 3GWGA 3GLIE 1Z83A 1AQYA 3RUFA 1SK8A 4IMPA 4Y1RB 4UMDA 4Y2TA 3MWDA 1QFJA 2H6EA 1F0PA 1YS1X 2WP8J 1MXHA 4U8GA 3RS4A 2HFKA 3TKLA 3EFEA 1E6EA 4IQGA 4ZVRA 3H5NA 2HTFA 2BFPA 4ZOLB 2G9VA 2DETA 3BH7A 2PK3A 3HY4A 3X3HA 4BNNA 4D4KA 1PWEA 3QVJA 5F1YA 3W5HA 1XAHA 1MC8A 2X76A 4HX5A 4RH1A 2JC3A 4NEQA 1S2IA 1XT6A 2X6RA 4QGBA 2XBUA 2J9GA 5CDFE 1K6JA 3KAQA 5DNCA 4CM3A 2OBBA 3TIGA 5CH8A 1SUBA 3HR8A 1PV1A 3QF4B 1LFDB 1N8SA 1QMGA 2BFWA 4ND7A 3QU5A 4IIDA 4UWSB 1GU0A 2B6HA 2ZUVA 4FYYA 3BL6A 4PQEA 1Z13A 4REMA 4WEQA 1LPAB 4PX9A 3HBJA 1UM9B 3ENKA 3KTAA 4O4JF 1B3BA 3KTOA 3DVAA 4YMLA 4AN0A 4DQ0A 4CMBA 5AK6A 4AX0B 2EARA 5F77A 1FS4A 4EK9A 2COUA 1J49A 1UKZA 3DGFC 2WUFA 1Z12A 3LQQA 4J75A 3M3HA 4Q0MA 2C77A 4HDOB 1FDSA 3VJRA 2VDPB 2Y93A 3TDMA 1YSCA 2PMWB 3JRXA 4KO1S 1GCOA 3UUGA 2HF9A 2PMEA 3NIGB 4IQ0A 1H2BA 1WQ1R 3C98A 3H11A 4BQIA 4E5UA 2Q7OE 3EVEA 2BRUA 1NR5A 3FUVA 1PR9A 4KQJA 1XEWX 4NECA 1CUEA 4EB8A 4KP7A 2FW7A 5JJ5A 2B2XA 4Q02A 2QMHA 2QPOA 4MV7A 1IBRA 1FFWA 2PR2A 4YAIA 3DZ8A 4RAMA 1N7HA 5KNCA 1ORDA 3MRXA 1ZMOA 3HU5A 1SKAA 4J7UA 1QV6A 4C4RA 1MOPA 1YQQA 5A4DA 3D1LA 1YOVB 2EOAA 4ZHSA 5D86A 2XBMA 3QPCA 4O2BF 2DPGA 1QLWA 1T6NA 3ORFA 5DHQA 3W3AH 1JT2A 4IX9A 5CG2A 4NDAA 1PKXA 4GI5A 521PA 4Z4IA 2VBGA 1KSJA 4IH9A 5HZGA 1MRSA 2ZRKA 4WEOA 2YWDA 4ZICA 2VKTA 3GDWA 4JQSA 4F6RB 2Z2ZA 2WZDA 1R6VA 1X70A 2O3UA 1EVLA 1G63A 5GM2A 4G0MA 5AIAA 3HKEA 2V3VA 2WT4A 4E5DA 3EC1A 3DEAA 3V8PA 1EMDA 3LCVB 1YGPA 3Q0EA 1T2DA 1U0EA 3AY0A 1D2NA 2POCA 2P4UA 4JDPA 2VF4X 4L15A 4UEQA 5G1PA 1BVUA 3VGPA 2PRYA 5B4TA 1RXIA 3IAS6 4JUAA 4PRLA 5TPWA 3NT4A 4DJJA 1M76A 3MJHA 1RADA 4LCBA 3WI7A 1MCZA 1KJQA 3BHJA 3K35A 4D92A 2HHLA 2EV9A 1TVEA 2R8PA 3ZCSA 4R51A 2RAUA 4XPZA 2JH3A 4ARUA 2FSUA 1HKHA 2MR5A 3CUTA 4PQFA 1EUZA 1CR6A 1Q17A 1X1QA 4G4JA 4TKMA 1R8QA 3BBLA 4DMFA 4OBWA 3BCHA 1P33A 4YRAA 4JXXA 1XA4A 3TX2A 5HRUA 1RXUA 5JLAA 2WJ6A 3WGZA 4DNOA 3J7TA 1R7RA 3QOFA 3AG5A 4UE2A 5TB5A 1OILA 2F8SA 4CM9A 4X60A 3ZDFA 1H9CA 5HF8A 2QX7A 1UFKA 4JUIA 1M1NB 3ZQUA 1S6YA 2GM9A 1DC7A 2J85A 4M7PA 4R1UA 5CT6A 3WL6A 3ZXYA 4KNWA 1VHJA 4TM8A 1NP7A 2Z4SA 1AB6A 4GU5A 2HRRA 2Z1MA 3PIRA 5B58T 1JYSA 5CIWA 2JLUA 2VTBB 1UMBA 1XTPA 2ONJA 4ZKEA 5HIPA 3WK4A 1VKOA 3R20A 4CL2A 3L7KA 2CNDA 3RADC 1MVNA 1E0AA 3UFXB 4HMQA 4MB6A 4CLRA 4MGYR 2BZSA 1UK8A 2GPYA 5HK8A 2FJ0A 1R0BA 1PGOA 2WT9A 2CCGA 1U8UA 2FRDC 4B6SA 3PX7A 1NXWA 1Y33E 3RKSA 1REQB 2EQBA 3LYHA 4FSDA 5I9LA 5D84A 1IN6A 1QKKA 1VLJA 4MK4A 5CHEA 3DD1A 3MJEA 2QTNA 4DC9A 1Z17A 4OYLA 1GPKA 4BQNA 1AUOA 2B99A 3BJIC 1KFJB 3IIEA 1Q83A 4N0DA 4Z0NA 3WV5A 4CIAA 2WYMA 3EQ2A 4L7QA 1ZI9A 3ZY4A 3H1TA 4O4IA 4XAQA 5EHNA 3WBFA 1Q1GA 1ULZA 2AH5A 2NSLA 3O8OB 4RXTA 1KQOA 2AG6A 3HN6A 3NWEA 3PWSA 4E09A 3M6XA 1RRKA 3HFSA 4W5WA 4MS1B 4YLGA 1VG9B 1DNPA 3PZBA 4K6MA 1YUNA 3K4HA 2PUBA 2KWIA 1J8FA 1XCBA 1L1EA 1RYBA 2ZUSA 2IC5A 2VXOA 1KAHA 1T6XA 3DO8A 4XRRA 4BFZA 3RLFA 3HB0A 2IE8A 4QYIA 2NU8B 5JSZA 3FRHA 1QK4A 1QB7A 3EW9A 4K1LA 4TLLB 5CLFA 4PW0A 2VSNA 1NJSA 3GRRA 5CFQA 3V7YA 1A7UA 3N3BC 1CZHA 3JQBA 1AS3A 4NICA 2P4QA 2I4NA 2ZJ0A 3M0EA 1JAHA 1EE2A 3A6JA 2XRMA 3QELA 4I1YA 3EUAA 2VDNB 2XHZA 1IL0A 4XSHA 3K0EA 5CNIA 1LI7A 2WWIA 1VP9A 4MEAA 2FKAA 2B7LA 2GUGA 2HLDA 4YA6A 5KOYA 1GG8A 2J9FB 1WUKS 1XXHB 3D2CA 2WYVA 4H08A 3RHTA 4KSCA 1Z5GA 5LCFA 5JFOA 4ENWA 1CZRA 4F4JA 4P9NA 3KFLA 4EHKA 1MHTA 1MB2A 4QNNA 1E1RA 5F2EA 3U26A 3U3XA 3VZPA 5AYAA 2MIIA 4J4BA 1L5QA 3DFUA 5IVHA 3WK6A 1AKNA 1U1DA 2VR1A 2A0FA 1HOXA 2K5UA 2RHRA 4NFLA 1N2ZA 1E63A 1IDOA 1NR7A 2JZNA 1R4NB 3RREA 1EUDB 2XWQA 3SSAA 6AT1A 1V5WA 2IEZA 2PFGA 3MOGA 3WFZA 2ZAYA 1W9MA 2JIPA 1RWPA 1YE5A 3HGMA 1NP6A 3ZY6A 2FWIA 5IVPA 4QBHA 4YMGA 3TQTA 5HJ2A 1M2XA 1ABFA 3T7TA 3DAPA 3OLZA 5HW0A 1WD5A 4G0XA 4B9EA 5H16A 1X74A 2M98A 4NAUA 4QBTA 1N9KA 1TAQA 2GCPA 1P4GA 1WB5A 3V9AA 5HKKD 5JV5A 1UPUA 4OXRA 4DMRA 4PAMA 1PJBA 5IK2D 1GPWB 1R5OA 1C0LA 3J81A 4M1YA 1KI6A 2BG2A 3M6WA 3V8EA 1LD3A 3KEOA 4A1OA 4EG3A 1YB7A 5LQMA 1DINA 4P2GA 1MIHA 4HFRA 4Z1OA 3GWZA 1ZVMA 3O84A 4P81A 4JEIA 4EKYA 5JXJA 1RYMA 4N54A 1XHLA 5IEBA 1T36A 3TE7A 5F9FA 4AS1A 5AKZA 3MGCA 1BVYF 3HVUA 1X8IA 2QN2A 2AXQA 3LRTA 5BWCA 1EGAA 1U0OC 2BGUA 4RPHA 5AJVB 2XLBA 2CWDA 2FLKA 3K6KA 1H5QA 1XKTA 3QWAA 3H83A 3MS7A 3OE7D 4UQPA 4UTRA 2ZE5A 3ZHCA 4MVJF 1PQUA 4ABTA 2IY7A 4WOPA 1HT1E 1CJCA 3OP1A 5JDCA 4HPXB 1C2TA 2PL3A 5CK4A 3IT3A 5BQOA 2OC4A 3PCXA 1U2ZA 2I2WA 5HGXA 5DCLA 3OTGA 3VOSA 3Q0IA 4YI5A 4D45A 1I32A 1V48A 2JLSA 3CF4A 5EP2A 4DLKA 2E5WA 2G28A 3JD4A 3ZZ1A 5HTKA 3L2OB 4PLGA 4XIGS 2CHGA 4R8LA 2OD9A 3DZKA 4ZI7F 3QJYA 1JLLB 4C0BA 1EDOA 3B6ZA 1I1OA 3HYLA 1MOZA 5DWDA 3RFTA 4DYVA 4DM3A 2ET6A 5DLDA 5G0WA 3RAJA 2DPXA 4R8VA 5TMDA 3EA5A 4NEHB 2QTMA 4ERNA 1XMIA 2O3JA 3ABZA 5T64A 4AX4A 3SD7A 4C0AC 1VPWA 4QECA 3LKBA 1LBQA 5KIKA 4WACA 1XKQA 2HDOA 4H1UA 4RTSA 1ZWKA 4BFTA 5K99A 3SVLA 1HSOA 1QFYA 4WZ6A 3PEFA 1CNEA 1S3GA 3MWGA 1I2CA 3IESA 3JQ7B 2V7EA 4Q00A 4XPIB 5CVVA 4MA5A 4J5HA 4DUGD 4FEGA 1DBWA 5TRTA 1AK9A 3NBZC 3OIWA 3T4PA 1I7DA 1SCDA 2CZQA 5TR9A 3PCTA 1WXIA 4FX2A 1U80A 2NSJA 5H1YA 1FRVA 5A3SA 5A9SA 2FE1A 1C3JA 1YS4A 2O50A 4PBRA 3VR6A 2VZ9A 4QXRA 2E4UA 4RIGA 1CFJA 4O8CA 5SV2A 1F4VA 4O2LA 1FS6A 4QRIA 1KDZA 3V8NA 3FDJA 4EX7A 3KQVA 4LYYA 4I55B 1BW9B 3JYQA 1SQ6A 3K5WA 4RL0A 1E89A 5HH6A 1TRHA 2R4UA 5J2UA 1ECGA 2XMCA 3KBOA 3Q87B 1LPMA 5AK0A 5BO5A 3GA5A 2QXUA 4RJLA 4EUKA 1OZ0A 3B70A 1QH1B 2A57A 2ZOSA 3KXLA 4IHKA 3IQEA 4Q1CA 3QH8A 2QLLA 1H93A 3ZYZA 1KMIY 3I6YA 1BEUB 1JSCA 4DIKA 2GOYA 5J5AA 5B6JA 1KP3A 2CFCA 1Q6ZA 2X2OA 1Z0KA 2DFNA 5G53C 2RKOA 3LTNC 4I8IA 1A4XA 3IERA 3P2YA 4FWBA 1B93A 4R01A 1Z0UA 3HKBA 2A9RA 4MV3A 2WUGA 1UJMA 3K9LA 3OZVA 4BUJA 3VC3A 5HFNA 3THYA 2EW2A 3QTTA 1SUPA 2ZAGA 3JAWA 2XQVA 4F1JA 2OZPA 1VKRA 1JMYA 3P20A 2E55A 4FE3A 3W90A 3WYBA 3ECSA 1V43A 1MBZA 2GRJA 4CMAA 1CVIA 4ER5A 4LGYA 4DWJA 1DBIA 2O3TA 2WVAA 3N1UA 5IKOA 4R7ZA 2IOYA 5LUBA 1F3OA 1C7FA 4HRAA 2W00A 3HL4A 3NTUA 2XADA 4TXLA 1F8GA 2EFEB 1TA0A 2C5AA 2OQ2A 1DFIA 5GP1A 4TN1A 2BZGA 2E82A 2OHVA 2W6JA 4G86A 4N49A 4WZBA 4WZAA 2FPXA 4BJHB 3C70A 3T3OA 4G36A 1SXJB 3CWZA 1XTIA 1W76A 2E18A 3QGMA 3U62A 1SVUA 3SR3A 1DJNA 4OOFA 3G3EA 3AJDA 5KDOA 4O1HA 2PWAA 1KDPA 1Z7WA 5JVDA 3TPCA 1Y3IA 3H2BA 1KO3A 3IMCA 2YC4C 3EEYA 1XQ9A 1Q0UA 2RI1A 3ZI4A 5GTDA 1EK2A 1EUYA 3FTEA 1PJ2A 2ZUCA 3H0CA 4Y7CA 5HA5A 3WIBA 1KYIA 2P77A 4EAQA 1RBQA 1KNXA 1I1HA 1LPOA 1FNBA 2JJ8A 4RVSA 1SG0A 3KQSA 2CVOA 4PPYA 2JIZD 5DMHA 5IHXA 1P17A 3BULA 5TDHA 5KJ6A 4AP9A 2I80A 4LGCA 1P2TA 3SDZA 5J4HA 1X92A 3O8LA 4M2LA 4OP2A 3RYHB 4G63A 4P7KA 1ZBDA 3N7TA 1LBSA 4K6OA 4P08A 1OI4A 4TS4A 2MYTA 2JLAA 1UZAA 3DT9A 1Z33A 2HT6A 1HMYA 3PZRA 4EY3A 1YBAA 5IH3A 5K45A 1W5SA 4I5FA 1TU3A 2DFVA 1Z6AA 3HYRA 3KB2A 5CGQB 3SG0A 4YQFA 5GIOE 2BPOA 4QDJA 1H4TA 3ORYA 2MSKA 1NHWA 4RVUA 1DS6A 1QANA 1C8KA 2WVGA 4XGRA 3V1NA 4BTLA 1Q95A 2CMDA 4XB2A 3SR4A 4CDRA 2QTVA 5DW3A 4BEBA 3AM5A 2IBMA 3FTNA 2YRXA 4K26A 4PE5B 5CAEB 3LXUX 4CKEB 5MF6A 4OLAA 2W9XA 2QY6A 3ZH9B 1E8MA 5AH0A 2Y1WA 3KQQA 2JHFA 4IG4A 1ESNA 2B78A 3HGTA 4LPSA 2FVXA 4WOBA 3CISA 3QXCA 1EGQA 3UAGA 2RKWA 1C7RA 1RWOA 3DW3X 1YJ5A 1P39A 1JHAA 5H0IA 2AD5A 3DZGA 4HQOA 2P6MA 2DT8A 3X1DA 4JNCA 1DDKA 2QDSA 3HA7A 5IZCC 3FBTA 4D82A 2P8SA 3MBOA 2IYZA 4P84A 3C3DA 3D7NA 3E2PA 4I19A 4DLSA 2AIRA 4MS4B 4YC7A 2BGJA 3LDHA 4ZDJA 1GV1A 2ZYDA 3EDOA 1MJHA 3D2AA 3GEDA 1E1KA 3TNLA 1CBUA 4EA7A 3D6NB 5FNVF 4FGWA 2Z56A 1MO5A 1QGOA 1T6ZA 2I6GA 3TD2A 3MXTA 4YUAA 4WDQA 1AQNA 2QNRA 1PZNA 2M5CA 1OF1A 3HBAA 5EJ8A 3P9SA 1K3TA 2XWSA 4TKUA 1KKMA 1QHIA 2A3RA 2VO1A 2NUPA 2JVKA 3HA2A 1T9AA 4M1MA 1V2GA 3L6NA 5ENVA 4AVYA 3W4JA 4E07A 3N28A 1PR3A 2ZRJA 4GZ6A 1CJUC 4Z3KA 2HYIC 3PEYA 5AW9A 1A50B 5K4AA 3N8NA 3DMGA 3G6KA 5HIIA 3X0DA 3O3MB 4MCHA 3TZKA 3HWX1 5I5GA 2XGOA 5HKBA 5K05A 2H1HA 2V7QD 1QH8A 5FWXA 4CZ2A 3S5UA 5FUMA 4H3HB 3P2KA 3G2OA 1IEXA 2WZQA 3M6AA 2EEZA 3A1WA 2TRSB 2EQAA 4AZ0A 3IQDB 5EJ7A 1CP3A 3FNIA 2Q0IA 4I7EA 1G8GA 1EVYA 1QHYA 2YDYA 3ET4A 3LHDA 5EESA 4CF6A 4XW2A 3NHAA 4UBKA 3LYAA 4O02B 4L22A 1O89A 2O2GA 5GGXA 1ZUNA 4ZHQF 5BQXA 4RK7A 3I6IA 1IC6A 2ZDGA 3PHHA 4BZWA 3LQ4A 4WLEA 3KU1A 2X7HA 3SNKA 3JQCA 2EGUA 5FB3A 2W7TA 3ZU2A 5JNSA 4ZD6A 2IZ0A 4AKGA 2Q1TA 1JAIA 1CZUA 1ULHA 2FOXA 1U7DA 2CXRA 3MUOA 3Q6IA 3VR3A 4XVUA 3JV7A 1LPPA 2CLFB 2HK8A 3T5CA 1E9DA 1R12A 1JQJC 3VHXB 2UYQA 2QZSA 2ZIEA 1W59A 3O0TA 1N92A 2GAFA 4YP9A 2VYQA 5DYGA 3TAHA 4CEHA 4G97A 2RC5A 1PO7A 2IHUA 3JQ9A 4GL4A 4IIBA 2BI4A 1E3LA 2EBFX 3W5UA 5A4IS 5FO0A 4OQPA 5EN4A 1OIWA 3ROGA 4OYHA 4JKYA 4S1PA 4BO1A 4DIUA 1U81A 1C9JA 1HWYA 3P1JA 2C94A 5C3UA 3AUXA 1SEPA 3RUIA 5ACPA 2JCXA 1ODTC 4FZ5A 4ZT4A 2WBLC 3A4MA 1FYXA 4TLBA 1D2HA 4YRFA 4D1UA 1N5MA 2QM3A 4LIPD 2FQQA 1T8PA 4NSNA 1U0FA 5CHYA 4ZYXA 1DRJA 1QORA 4D0NA 4DDMA 2NTEA 4JBHA 1XEWY 3KUDA 1HE1C 2DJ5A 2CSUA 2AOUB 1NVTA 2XB9A 2BSXA 3P45A 4GE0A 4F9EA 3PRKE 2IV2X 1FRZA 4F60A 1SKYE 4ZTZB 3IA7A 1ZJJA 1L4EA 3VVLA 2LZ0A 3I83A 4EJMA 1PT5A 2JB9A 1YCGA 4X62B 3CQ9A 1LS6A 1P18A 2IPLA 4GDMA 5D87A 4RH3A 4TGLA 2N47A 4N3NA 3HYNA 3L0ZA 4OQXA 1DAMA 2AUNA 3ANYB 5HE8A 4G0OA 1DT5A 3BVPA 4KBYA 4GPZA 4QWMA 4C6HA 2P6RA 3VNVA 1RM5A 4RK1A 2ZVPX 4RX1A 1Z6YA 3OLXA 4IDOA 4HVAA 1KI4A 2B1QA 3MTGA 4PTZA 4BNXA 2P18A 4ZDWA 3W6NA 4ZCMA 3DXFA 4FMPA 1SOWA 3WY9A 2O07A 3BTSA 1SBTA 1E9RA 3NONA 1IZ9A 4OXKA 5LZ2A 1G4HA 5FUYA 3AHHA 3FZYA 1K7FB 4YJ3B 2PFSA 3E05A 4NCIA 4GBGA 3UGQA 1E1DA 4KYUA 3M3DA 4NCAA 4KREA 1MA3A 3PGKA 2H7YA 4R9NA 5B55A 1U4OA 2OHFA 3IL2A 2E6KA 3DKKA 3HADA 1ZXLA 3GHYA 4OUDB 5EWMA 4H4EA 4Y6LA 4TMYA 4AKTA 2SCUB 3FZGA 4B7AA 2LW7A 1YT5A 2VJOA 4FLMA 4KMMA 1NRWA 1GUAA 2V4ZA 1KYYA 2GERA 1CULC 2P9TA 2VJYA 1AKWA 1XD2A 3AINA 3FNQA 3HFJA 4FDLA 3TEJA 3TAXA 4UE3S 4X5OA 3TZCA 4NS1A 3I62A 4F46A 4D3YA 2RBKA 5H4GA 1SXJE 1Q50A 3D1VA 1AS0A 5FI1B 5HKKA 5ALNA 4C0KA 1L7QA 2ZQYA 3A31A 4M21A 5FLXA 3DEZA 3R3SA 2V6FA 4Q37A 4JFAA 3OC0A 1CWUA 2HF8A 3S2ZA 4YAOA 4DEVA 3EGDA 4Z4HA 5BSHA 1K08A 1SVLA 1N3LA 3JX9A 4G1CA 4MUFA 4MYSA 5BQ3A 1F2TB 3HWSA 4ZVSA 5IT9A 1UC9A 1U0HC 3EDRA 2X8LA 2WM2A 2XQKA 4MIKA 4OMDA 1YS6A 1OXVA 1YR6A 2PKXA 1IB0A 2W2KB 3HGQA 3LI2A 4X8OA 1N2JA 2O05A 2WZBA 3F3MA 5HWSA 1LRLA 3ROKA 2QROA 3GJ6A 4BVKA 5DTRA 3BGIA 5ESDA 4CDNA 3GCXA 4JMLA 1CG6A 2CHUA 3R6WA 4F9GA 121PA 3V32A 4OJMX 3U9SA 1F8UA 5LYJB 1XGKA 4G07A 2IYEA 1MD9A 4WIAA 1UBNA 3UN1A 1Z2EA 4MVJG 3VPAA 3UCEA 1AGRA 3VOAA 4CLOB 5BSVA 2AMFA 3SMVA 3FUWA 1Y9EA 1RWBA 2ZRQA 4JP5A 3RHSA 2YYYA 4TT3D 4JKIA 4D0RA 2UVPA 1K7EB 3BXOA 3DDZX 1OFHA 3E18A 3PJFA 5GWXA 4WL0A 3WB2A 1UINA 3WGYA 4C0HA 3SDSA 1DEAA 4EWLA 1OXBB 4YLYA 4P93A 3A4VA 2G1UA 2VSXA 4K40A 3SPUA 1FYEA 4YR7A 4KGZA 1FEZA 1FFXB 1ODFA 2AVNA 5TGTA 3RVOA 2EP7A 1T24A 2FR8A 2FU6A 2EL9A 3Q8MA 3GA7A 2G7MC 4JX8A 4LECA 4M0EA 2E87A 3EVFA 4RBNA 5JS8A 4H0FA 3HCPA 2YWXA 3ZBTA 4D26A 1KFKB 5F9HA 4JP2A 4FMBB 4MA4A 4GMKA 4PAWA 2G6TA 1P1IA 1Z6GA 4WUTA 2ZBPA 4O2AF 4QGFA 2ZPAA 3IQWA 3K7EA 2LRHA 3KNZA 3IH5A 3OCVA 2BBTA 3E5NA 2ZZNA 3FOBA 4UEOA 3RK4A 1L6IA 3VPBA 2GN2A 2CJPA 3OJEA 4GGMX 3UQYS 5F7XA 1VI5A 2VVTA 5EZYF 3TM5A 5DSZA 2COKA 3RWBA 1GJRA 1H8HA 1QRAA 2O1XA 1BQEA 3KZNA 4PNZA 5BSGA 2YNUA 5BV8A 3NAMA 4HGYA 1M7BA 4F0JA 2BR4A 3IXLA 3N2NA 2VAPA 3UGTA 4DNQA 3ZWAA 2JLYA 4KW7A 1YZYA 1V96A 2HIGA 4G1MB 4J7XA 1N5KA 3AEUB 3TLJA 2BMWA 2FSHA 4I46A 1EFKA 3K8ZA 1FX0A 2AFRA 5HIMA 3VSDA 2C7VA 1BE8A 5B12A 1U1CA 4JT4A 4JK3A 2G4VA 3KJEA 4UCFA 4XX1A 1I0LA 2J41A 3HKDB 4BMYA 3R7WA 4AROA 3C7TA 3AF0A 3AJ9A 3DOOA 1WZEA 1WB9A 2DKOA 2VBFA 1UXHA 3F4KA 4MQ5A 3RANA 3O1LA 2G06A 4O29A 3WJ2A 3JQFC 3WL3A 2SKCA 4JC4A 1NAHA 3N2KB 2R7NA 5ERYA 1H23A 5DN6D 2I6QA 4REQB 1WU7A 3E5RA 3COVA 3VU9B 3E7PA 4XQEA 1D2AA 2BM8A 3AC0A 4LGVA 3W9UA 1RZRA 1KERA 3NUGA 1MRNA 4R7GA 2BELA 5C1PA 6REQA 2GDZA 2F64A 2H48A 2R00A 3JVDA 5BN1A 2GBGA 5KYWA 4QATA 2VSFA 4X93A 4KZKA 5KQLA 1UKCA 3VUFA 3KOMA 2FR0A 1DT3A 1EFVB 1Q5PA 4RPCA 2KBFA 1GLVA 3L8MA 3ZCTA 1U11A 1WDKA 5C8YF 1R27A 4KLAA 4IL5A 4X54A 2C58A 2GNPA 4AW9A 3M2TA 3ZG6A 1Z2PX 3T54A 3CUVA 1KY4A 3EGOA 2M2IA 1UAGA 5DRYA 2VK4A 3OETA 3VSEA 4AT1A 5BUSA 2ZZIA 5B57C 2L82A 1WE2A 5BN4B 1GPYA 3ZTTA 4UEWA 3NKFA 2Y87A 4F2GA 2ODQA 3MTDA 1QGZA 1W4CA 1CRWG 2ISCA 2Y67A 1USIA 2ZSAA 3HKCA 3OEHD 4KTVE 4L8FA 5A7FA 4TL9A 4JBGA 2NNWB 4LHEA 5I7AA 2RJ3A 4ZI5A 3WWOA 1PWZA 3A0UA 1II8B 4A7PA 3IVXA 3R2UA 5JAOA 4Z5YA 2NPIA 1NBMA 5EIBC 1YDFA 1FLAA 1Q91A 2X0KA 4HVTA 4QODA 1IOZA 4DUZB 1CF9A 5DV9A 5FPHA 3PL1A 5L3QB 1JFFA 3Q85A 2JH8A 2HLHA 2HA7A 3ZEIA 4ZJPA 1X8KA 3RS2A 1SXQA 3B5IA 4TLDA 4WNIA 2ACEA 1E6CA 2WKWA 3KQMA 1R0ZA 4G4GA 3AVOA 1Y8QB 5EP3A 1PG2A 3C43A 4QJ5A 4CQMD 1W47A 5KQMA 4AJHA 1QZUA 2HM7A 2XUQA 3U0BA 4D8XA 2HWYA 2JIZA 5EG5A 1M34E 4KN9S 3SQMA 1PQYA 4WPGA 3OCJA 5DBOA 1A8PA 3T3PB 3VJMA 4A6PA 4Q03A 4BE9A 3L7DA 2BBSA 3ME5A 1IXKA 2TMYA 4QD3A 2QXTA 1B6TA 4UZEA 2GN0A 3OMWA 1UBOS 4IWXA 1T2AA 4LZJA 1ZCAA 4Q82A 1HL3A 3CW2A 3MM4A 4F3CA 3EPRA 3V2HA 2P5UA 1WUHS 2R7KA 5KVQA 3STWA 1PEAA 3FB1A 4PIMA 1YZUA 2YHIA 3HCNA 1C9KA 4L8YA 1GDTA 1K8RA 3DNMA 3JASB 3PFKA 2V0CA 1NI4A 1BKYA 4L2IA 3KYCB 1TYEB 2R3SA 2GCEA 3AUYA 3I3SR 4RZHA 4WVLA 4JYPA 1L0BA 4W9RA 4FYXA 5DCWA 4DMCA 4F8EA 4TYTA 1JDBB 3L7YA 3ZGXA 2HSZA 3K0CA 4ID3A 1TEHA 1GL7A 3NBMA 2OGUA 3KLBA 1IUPA 5TC4A 4L78A 1EFDN 1E7QA 1Z3CA 1ZRSA 3D3JA 4W5JA 1MNAA 3AI1A 4QQ8A 1HZZC 4DCNA 5ABPA 5IWCA 2VDMB 4UVDA 3QX7A 4BP1A 2YJTD 3CV3A 2JCGA 1DJOA 2YNMA 1NNLA 4LI3X 1SBHA 3TN7A 3TE6A 1KJIA 1XF9A 1ZD2P 5KNBD 4CKBB 2XCRB 1FSPA 4EMSA 3TLBA 2WTUA 5ACRA 4K6CA 5H83A 1JLMA 4LZWA 2RH8A 4KXFB 3RF7A 4N1AA 3FNHA 2VA8A 3DYVA 3PR1A 4RHCA 4PXAA 3PA8A 4G8JA 5ESWA 1FRQA 2FWBA 2WTAA 2ZJ5A 3ZLVA 2V4UA 3E48A 4EY6A 4EVRA 1NVEA 1SBYA 5F5XA 3U09A 2I2DA 1CEXA 4F4UA 1C3VA 3W5SA 4GYWA 2C2KA 3L1KA