5A0TA

Catalysis and 5' end sensing by ribonuclease rnase j of the metallo- beta-lactamase family
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
454
structure length
454
Chain Sequence
SHPHPELGRPPALPKGGLRVTPLGGLGEIGRNMTVFEYGGRLLIVDCGVLFPEEEQPGIDLILPDFTSIRDRLDDIEGIVLTHGHEDHIGGVPFLLREKPDIPLIGSKLTLALIEAKLQEHRIRPYTLEVAEGHRERVGPFDCEFVAVNHSIPDALAVAIRTPAGMVVHTGDFKMDQLPLDGRLTDLHAFARLSEEGIDLLLADSTNAEVPGFVPPERDISNVLRQVFANARKRIIVASFASHVHRIQQILDAAHEYGRRVAFVGRSMVRNMGIARDLGYLKVPPGLVVDVKTLDDLPDSEVVLVCTGSQGEPMAALSRMANRDHQIRIVNGDTVILASSLIPGNENAVYRVINGLTRWGANVVHKGNAKVHVSGHASAGELLYFYNICRPKNLMPVHGEWRHLRANAELGALTGVPHDRIVIAEDGVVVDLVEGKAKITGKVQAGYVYVDGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Linkage of Catalysis and 5' End Recognition in Ribonuclease Rnase J
pubmed doi rcsb
source organism Streptomyces coelicolor a3(2)
molecule tags Hydrolase/rna
molecule keywords RIBONUCLEASE J
total genus 146
structure length 454
sequence length 454
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 5a0tA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5a0tA01
4TYTA 4NQ2A 4XUKA 1WRAA 3AF5A 4RM5A 5HISA 1YCGA 5LE1A 4H0DA 5LS3A 5EW0A 2OHJA 1QH5A 3SD9A 4Z60A 3IOGA 5K4NA 4FSBA 4AX1B 2XR1A 3BK1A 2P1EA 1ZKPA 5A5ZA 1VJNA 4TZFA 2AZ4A 3R2UA 1K07A 2Q0JA 4YSLA 4EXSA 2GMNA 3ZNBA 5HH5A 4BP0A 2BG7A 3PG4A 3IEMA 4HL1A 4J5FA 3I14A 5ACVA 5B1UA 3I13A 4ZO2A 2GFJA 4PVOA 4RL2A 5HIQA 4C1GA 1BMCA 5IQKA 3IE0A 2NZEA 2Q0IA 1ZNBA 4KEPA 4O98A 5ACWA 4Z7RA 4C1HA 3VPEA 3KNRA 4AX0B 4Z5ZA 5LCAA 3X30A 1YCFA 5K0WA 4TZEA 5B3RA 4D1VA 5ACUA 5AYAA 3X2YA 1X8HA 2XF4A 2NZFA 2BG8A 4D1UA 2OHIA 1VGNA 3PY6A 4C1EA 2GCUA 5A87A 4UWRB 4RAWA 4YSBA 2BTNA 1YCHA 5HH4A 2CBNA 5AHOA 2AIOA 3JXPA 3DHAA 3I11A 5LM6A 5K4KA 2QDSA 2HB9A 4JO0A 3X2XA 1ZTCA 2R2DA 4LE6A 3L6NA 5A0TA 1DXKA 2ZO4A 3ZQ4A 2I7XA 2BC2A 2WRSA 3T9MA 4GCWA 2Y8BA 4WD6A 2YNTA 2BGAA 2BG2A 3FAIA 4D1TA 4F6HA 1X8IA 3X2ZA 4UWPB 5ACSA 2BR6A 4AWYB 1KR3A 3WXCA 5FQBA 2E7YA 2I7VA 3G1PA 3PY5A 2QINA 4DIKA 5AHRA 3ADRA 4BZ3A 4HL2A 5EHTA 5HIOA 2VW8A 5HH6A 2NXAA 3T3NA 2FU6A 2FU8A 3DH8A 4DILA 3DHBA 5ACQA 5EV6A 3I0VA 3IE1A 5EV8A 4AWZA 3RKJA 3IELA 1WUPA 4D02A 2Y8AA 2FHXB 4FR7A 2BG6A 2WYLA 3SBLA 3BK2A 5EVDA 4V0HA 1A8TA 1WW1A 4XWWA 2WHGA 3DHCA 2FK6A 2BMIA 2ZWRA 1DDKA 5K4MA 2QDTA 4EYFA 4FEKA 4UBQA 1BVTA 2YNWA 3Q6VA 4NQ4A 5LCFA 5KILA 4RBSA 5LMCA 3SFPA 4ZO3A 4ZNBA 3BV6A 3SPUA 3A4YA 3TP9A 1M2XA 4GYQA 5ACTA 2Q42A 1L9YA 3SW3A 4EY2A 5EVKA 5LSCA 2FM6A 1JJTA 2M5CA 3S0ZA 2P97A 1X8GA 4XWTA 2Q9UA 1DD6A 2I7TA 4P62A 1SMLA 4C1FA 4EFZA 4F6ZA 1KO2A 2YZ3A 2YNUA 5ACXA 4ZEJA 5AXRA 1BC2A 1E5DA 3QH8A 5HIPA 2WYMC 2H6AA 5LCHA 1XTOA 5AXOA 5FQCA 2M5DA 5B15A 1MQOA 5EH9A 2P4ZA 5ACRA 2FU7A 2GKLA 2UYXA 3AJ3A 2ZNBA 1VMEA 4AD9A 3H3EA 2FU9A 2QEDA 4Z5YA 1JT1A 2GFKA 4UA4A 5A0VA 3ESHA 3MD7A 4GYUA 2Y87A 4RL0A 2BFZB 2QJSA 2YNTB 3ZR9A 2NYPA 5ACPA 3BC2A 4B87A 3RKKA 5FQAA 4UWSB 4EXYA 2YCBA 4D1WA 1Y44A 2YNVB 3IOFA 5AEBA 3ZWFA 4NQ6A 4Z67A 3IDZA 3VQZA 5EWAA 1WUOA 1KO3A 3P2UA 1XM8A 2A7MA 2FHXA 4U4LA 5LLDA 4TYFA 3SRXA 4CHLA 4C09A 1P9EA 3IEKA 2BFLA 4KEQA 3I15A 2YNVA 4EYLA 4EYBA 2BFKA 4UWOB 4PVTA 2BG8B 3KL7A 2BFZA 1HLKA 3F9OA 3AF6A 1QH3A 2BIBA 4C1CA 4UAMA 4C1DA 4RAMA 2ZZIA 4YSKA 4Z6XA 2DOOA 3RPCA 2P18A 3LVZA 4J5HA 4TZ9A 3FCZA 3KNSA 1A7TA 2WYMA 5KIKA 5DPXA 4HKYA 3IE2A 1JJEA 2DKFA 4NQ5A 4TZBA 2OHHA 3T3OA 5EVBA
chains in the Genus database with same CATH superfamily
1NKVA 5JY1A 1YTUA 2AZXA 1OIXA 3RFCA 3UMRA 1R3UA 4KN9S 3HUTA 1YKGA 4GH5A 2GAAA 2WU0A 4H35A 1E9FA 2HK7A 3DLIA 1ORVA 3RRMA 3RRNA 4DAOA 3I2IA 4LJ4A 4LYYA 5I8ZA 1UXOA 1IM8A 3L02A 4ID3A 4GC9A 4J7UA 1KH3A 1ZI6A 2XE7A 1Y1RA 4DABA 2REXB 4IVQA 4OQXA 3I2HA 1G38A 2C20A 4X1KB 2W2LA 3FZYA 3L7MA 4JL6A 4MRPA 4RCVA 4TTAA 3V8MA 4HWTA 5KTPA 1QU3A 4GX5A 4X63A 2OLKA 2VBCA 1GUDA 5LS3A 2Q2OA 2ZRFA 1XO1A 2ZLBA 4O1HA 3H6HA 4LKRA 1YFZA 2DWUA 2V5UA 4NL4H 5JAZA 3M2PA 1CPYA 4CYMA 4ZOCA 4E31A 2JLVA 2GPJA 3LXMA 4DG5A 5G0UA 1LY1A 2DRIA 3IDSA 1BE6A 4ZV4A 1EUDA 3F5QA 3FMIA 3P2OA 4FSBA 3M2TA 4B3TB 4QUEA 4EUKA 1VP9A 4GPZA 4EJ2A 3IOMA 3DG9A 4L8FA 3RS3A 2VXYA 5ALQA 2I3GA 2MYUA 3QNMA 1Z5PA 2PXXA 2A9VA 2PKWA 2QROA 1T5LA 3H7IA 4WSOA 1RXEA 2QN8A 3GCDA 3WWCA 5SZJA 4BKQA 1EFUA 2GNOA 3LCCA 4OL0A 2Q0JA 4PYLA 4N3CA 4GW3A 1DIHA 1MV8A 4KW7A 3AZOA 4MK4A 1JXAA 1GQ2A 2WF8A 3S28A 1HFJA 2L17A 1EDOA 1FP1D 1I3KA 2IU4A 5HDQA 4XXHA 3CLTD 1G1AA 1T8PA 2NV0A 4EXSA 5HP4A 1G3MA 3HFRA 4G8CA 4R5MA 1EG7A 4UDOA 1YBHA 3HTXA 4YGXB 1LJLA 3GLFB 2AV6A 3ZE9A 3ZUGA 1HOXA 2BDEA 1G8KA 3DL7A 1XA3A 2GPWA 3LQQA 5BQ5A 1IATA 2VQEB 1Z33A 5JS7A 1EA5A 1ENZA 1EB8A 4NARA 4J0DA 3HDYA 4MQFB 1NLZA 1T2AA 3FWNA 1SRRA 3U9TA 3Q9UA 3PYXA 4BQQA 2CB9A 4FXOA 1CLEA 2AR0A 3ROZA 1UFOA 1M6HA 1YT5A 1AGXA 2RI0A 4HI0E 5EG5A 4X1IB 3VZPA 4RHFA 4C43A 4WBNB 1L3CA 5IM4A 3ILVA 3PK0A 1WHTA 4ALJA 5EJ7A 1XVVA 2OV1A 3CT6A 4QUIA 3QQ5A 2V03A 1TCCA 1DQYA 1AHHA 5IQKA 2ZJ3A 5CD9A 1CDEA 2BFEB 4X64B 1M9NA 1U8XX 2HWKA 2HIMA 3H86A 4QU0A 1V41E 2F1RA 2PGLA 1XQXA 4HX9A 4L4RA 3QJYA 3E61A 3ZDEA 2J87A 3U4CA 5EY5B 1NHGA 2IELA 3I4FA 5DISB 4BGIA 3HXLA 4DNFA 3H8WA 4MDFA 1A1VA 5K0WA 4CM3A 3T9AA 2XUQA 1Z5OA 3TEJA 2O1SA 4B17A 4B7XA 5AP9A 2CXXA 5FV7A 2AZDA 2OTCA 2AOUA 3HKDB 1MT0A 3N5KA 3KKLA 4M9SA 1E3EA 1WPGA 2DTEA 3KT8A 4KRXA 4TS1A 5I9IA 1RLJA 4G0QA 4CN8A 4UEQA 3AC0A 4A92A 1M6VB 2NN3C 2YJ6A 1C3LA 4F7WA 4G1FA 2PTHA 3I34X 4QXPA 3U7JA 3NYQA 1E3IA 1Z17A 2JK1A 3D8UA 1CQWA 3THOA 3HB0A 1NLFA 2WYHA 3KTOA 2I0FA 1EB9A 5TDHA 4Q4DA 4HUTA 4BWYA 2FRVA 2WY2D 4IJKA 2IUFA 4KQGA 4J07A 4N6NA 4WV3A 1EE1A 2NYAA 2VJDA 5CYOA 5GONF 3T3HA 4ZCTA 4BGUA 4MKGA 4ZAGA 3HBMA 3QP9A 4ZZ2A 2AXPA 3ROGA 4R71A 3IX7A 2ACWA 4FP9A 3TAXA 2VAVA 5LM6A 2JFUA 4Z9AA 1G8HA 4RDXA 1SBZA 2BFWA 4FMCF 5L45A 1IY1A 1P60A 2IYLD 5IF9A 4U7TB 4IUBS 4MIYA 4Z7JA 3A1TA 5KYTA 4UU7A 5BQ3A 5KVVA 4GLLA 2R8ZA 3AI7A 3DOHA 5BOSB 1LV8A 4FWTA 2R6FA 1OHHD 2PA3A 3GYBA 3PQEA 1JFFB 5CM9C 1E63A 3N28A 2OWEA 1P39A 1H05A 4NDNE 2GS9A 2JRLA 1K8XB 5JSKA 2O57A 3BIFA 3MMZA 3W5AA 3OH8A 1YI8A 1RRMA 3DCIA 3BH7A 1ZGBA 4GNKA 4QASA 4Q34A 3RYFA 3GNQA 1JPUA 4MI9A 2IF2A 1RM4A 4PF1A 1QIJA 2LWIA 3A3NA 3QGMA 1BS2A 4FNAA 1EI9A 3UMSA 1UBRS 3V1MA 3WQHA 3AKEA 1D0IA 5B3KA 2PZBA 2DQ4A 1GQQA 2PT6A 5JFTA 4DSUA 1YS2X 1EK2A 4ARVA 5KC8A 1YI0A 5EQFA 4MYDA 1BMDA 4KNVA 3HLKA 1L4UA 4GPEA 2E1PA 1PR6A 5A05A 1ORTA 2CXNA 2ZJ4A 1U0NA 1CF9A 1ONNA 2B0JA 1H2AS 3RTDA 4Q9DA 5I4IA 4IG9A 3KQSA 2YXBA 5KYXB 2FLKA 5JNVA 1E5VA 3ADRA 3O8QB 4BZ3A 1LQUA 4GBMA 4IIDA 4UMVA 3VKFA 4BEJA 1ENYA 2NWQA 1GZ6A 1JB1A 2GTPA 4ZVLA 4PU0A 3WBJA 1B41A 3FWZA 3DVQX 1BRMA 3KYDB 3O5AA 5AJVB 3TVTA 5I3ZA 1EWTA 1JGTA 4ZEWA 1Z38A 4J16A 2W8BB 4DBLC 3PP8A 4Q1BA 3DWGA 4DLAA 4P31A 3SQNA 5CFQA 3SSMA 3S8MA 3DXZA 2XVMA 4A1OA 3DH8A 1FUUA 4KQWA 3C3EA 5EYPB 2AEEA 3F46A 3RRXA 3S1AB 3HRHA 5BWNA 2OVFA 5AM0A 5EHZA 1DX6A 1HDGO 4XX0B 5BN4B 1EXNA 1UDAA 2SNIE 3UJ8A 4ALKA 4CW7A 2WM9B 5CDFA 2XEXA 4BN0A 1ZUD1 4TN5A 3ZWNA 5KYYB 5FO0A 1RQPA 2VJCA 4NC9A 5FWYA 2JIPA 3WMGA 3FVTA 1VA5A 1G42A 2ZT7A 3M6AA 1G6KA 3F8TA 1JPVA 4EA7A 5L3SA 2Z8XA 2PKCA 1QVRA 1GTRA 1PBTA 4KXUA 5K2OA 4XA8A 2JJQA 3UJPA 4BV9A 3L7NA 4I46A 3F3KA 2M6RA 5SY6A 1RHRA 5J58A 3I2KA 2CC2A 3L6CA 5JG7A 5SZHB 1P5RA 1EFVB 1VC2A 3MXOA 2I29A 3PWZA 4PYJA 1QIEA 4M0DA 5HGXA 4ZT7A 3RRYA 3W05A 4JLAA 2NO5A 1RVV1 4J0QA 4UPEA 2V9CA 4RXTA 1JHYA 1Z2NX 3MCWA 5TR9A 2Z4SA 3ZDCA 3W3AH 3QV1A 4BX8A 1UKVY 2WWGA 2XUZA 1CUGA 1CQJB 5D1NA 3U49A 2XHEA 4B35A 3P0JA 1MPTA 2JL1A 2ZJYA 3GLGA 5H3CA 4KKVA 2Q41A 4JS0A 3RQSA 5D01A 4BNXA 1LC0A 1YZVA 5C53B 4E2WA 2EGUA 2XZDA 1L5YA 1R8XA 2BEWA 1YFJA 5DMHA 1U0BB 5CDTA 1ZI9A 2F1HA 4MYHA 1E96A 9GPBA 5DBHX 1FYVA 4Q6BA 4I4CA 3H13A 3SPUA 1P81A 3ZLJA 1Z06A 4MLDA 2FPGB 3I1IA 1X19A 4CLEA 3NDBB 3D6HA 4C20A 2X5XA 5D6OA 1B8OA 5DEIA 5M5BA 2BGRA 4REQB 1RQRA 2FPRA 3F3SA 3BCHA 3VPHA 3JQGB 4XI9A 2PMDA 1U3TA 3WYGA 3EUAA 1S02A 4A0RA 4QG3A 3MM4A 2O0MA 4DQXA 1EUDB 3RVKA 1L9YA 1J20A 3ZWOA 3SQMA 3CUWA 3OE4A 3RV3A 1V4VA 4GZMA 4HLUA 1Y48E 4XQEA 3PQFA 3WGMA 4M86A 3E5HA 2ZRKA 2FXVA 4Q19A 2V6BA 4CBVA 4E7PA 1JE0A 1PV1A 3BT7A 1OH6A 4KR6A 3D3WB 4LYEA 1TF5A 4WXPA 4BDSA 3LY7A 4MXDA 4GYJA 3B8HA 4JT4A 4CTKA 4EHJA 5JAPA 4JR1A 5T8KC 3ZWQA 1W7AA 4C5CA 5IT4A 2WM3A 3AVOA 3EGDA 1NRIA 4EELA 4I4TF 1FLAA 1UMKA 2ZAOA 2ZANA 3WY9A 1I10A 4ZYLA 5K0JA 3I04A 1H4VB 2AYYA 2JJ1A 2HBYA 3PHIA 3PPWA 2A0FA 4H18A 4LV8B 4OOEA 3GAMA 5IBQA 2O8FB 4AG5A 1THGA 3RFUA 4PV7A 3NEJA 5IH3A 2ZT8A 3NVDA 1KEKA 4XVHA 2FPLA 2CHVA 3KEOA 4BS9A 4JJ8A 4YRBA 4V0SA 2JI8A 1R18A 1BFDA 1G7SA 4R51A 3M34A 4BTEA 3PL1A 2FN9A 2RFLA 1A5AB 1UXKA 4XVRA 2J3QA 2W6MA 3EEYA 4GPAA 4WH0A 2DF8A 3HCEA 3QWAA 3FPFA 2QI9F 4XUDA 4IEEA 4MLZA 3KD2A 4CZ2A 2C88A 2GR9A 5LP6F 1HSOA 1OV6A 1K5GA 1N3IA 5CYFA 1UINA 3KVVA 5K0ZA 1PR4A 1GTMA 1R5OA 1ZGHA 4LGMA 3VI4B 2GYUA 1O5TA 3NYRA 4HAOA 1A5ZA 1IN8A 2HEGA 4GKJB 3UKOA 4GOKA 2C7BA 1DO2A 1KAMA 4B3MB 2QZZA 4RD0A 4UTXA 1JVNA 3WL3A 2P9JA 5IYZB 3H2BA 4LDRA 4GBED 5CCXA 3BIJA 1NLYA 1SM4A 1TZJA 2HRQA 3IXMA 4KRGA 1K9VF 1R8SA 3RUCA 1US8A 1L8AA 2OAGA 1H2BA 1XAHA 3C4VA 5EFZA 3EC7A 3ZVRA 4AZTA 4ZK2A 4PX5A 1GA6A 1CZRA 2UYGA 3QKRA 3X1WA 2KW5A 3A6LA 4FK8A 1XPUA 2VG8A 4HVAA 3OU2A 4NCNA 1Y7IA 4MWZA 5KYYA 3Q4GA 2QXUA 3MHPA 4RKYA 1QFXA 4M1SA 1XCJA 1Z4OA 2WSMA 5FWXA 1Q2XA 4L8WB 4EYGA 1UP4A 1HY3A 4FGLA 2CHFA 4CQLB 3IA2A 4W8OA 1ZNWA 5DLEA 3G7UA 3LYAA 5FUBA 2EDCA 3FY4A 1DEHA 1VKNA 4EGFA 1JQDA 1H8EA 2CDAA 1J8YF 3CV3A 3FCEA 4KLZA 1JXQA 1N2OA 4QBGB 2HW8A 4NXMB 1EX9A 2GFQA 3EVBA 4KAAA 1NVWQ 2PX4A 3G89A 1F8FA 2IT1A 1YRLA 2VDMB 4FZ3A 3JS5A 1PVVA 3PVZA 2VPXA 4N4AA 2C1ZA 2PZAA 3NC1C 5IMBA 3STVA 1C9MA 4KO3S 1G98A 1U9IC 2FFRA 3MWJA 1ES9A 3R9XB 4M1QA 3V1YA 4CQLA 3IVGA 1BJRE 1M73E 5AIAA 4XM0A 2O07A 3BWXA 4L0QA 2VHVA 3KKPA 1L1FA 5JS6A 4W5TA 2PUVA 3KKKA 5HJ7A 3IMKA 4FINA 1BCSB 4J7XA 4KFTA 1X7HA 4IP0A 5HBRA 1GLVA 4A0QA 1FVHA 1O58A 4DMMA 4Y7CA 3TOVA 1VPDA 4F46A 2JAOA 4MAMA 5HF5A 4BFYA 2QN3A 4P3XA 1KZ4A 1KAEA 4EHAA 3I9LA 3KOMA 2DWPA 3LP8A 4KSYA 1N6NA 4DM4A 1IZ7A 3EEOA 1FMJA 1XG5A 2A2ZA 4BMXA 4A7PA 1W0KD 5IBRA 1SVLA 5JQGF 2J46A 3SF8A 3NDRA 3TR5A 1G19A 2BFLA 4OGWA 4R9RA 5I01A 4Z8XA 1YBFA 4I50B 2OYCA 3SOZA 1IZZA 4CEIB 2XYGA 1KEWA 1J9ZA 3CNHA 3TDMA 2J6HA 3TJZA 1C1XA 3LHKA 1NN3A 3IUJA 2B34A 4XGQA 4P4UA 4JUBA 1FSGA 3GGPA 4P4LA 3C97A 4EDHA 2I62A 1NJFA 2GLUA 2DR2A 3T8YA 1OLUA 2W8ZA 1IPFA 1U31A 1P80A 2GQ0A 2H48A 3DVSX 4L5IA 5AW1A 1VLMA 2GCPA 2FOIA 4M1MA 2K7FA 4UAMA 4BNMA 1EVKA 1SIUA 4QULA 2ZBRA 3VYVA 2OA0A 3NMUF 4JUAA 3VOAA 2KPOA 2H2DA 1JIKA 1XMPA 3L8DA 5E1DA 1ECCA 1H6CA 1IXYA 3OICA 2Q3DA 4I1PA 1J90A 4U2GA 1GUYA 1C30A 3IXQA 5AFSA 2OWDA 4OP1A 1KHHA 3Q7EA 3SMQA 4YK7A 3UPTA 3C87A 1XZBA 2RHHA 3M6FA 5DXFA 3EJWA 2WE7A 5IEBA 4C4YA 3QFFA 4UQLA 1FU4A 3UATA 2SHKA 3BRCA 3V8QA 3CFYA 4YRFA 2OV3A 1KDRA 1VKRA 4Z3OA 1WMFA 1RBQA 5FL3A 3BG5A 4D9HA 3FNFA 5EEHA 1T3SA 4HKYA 2CWDA 3PEVA 1FX0A 1HURA 3GQVA 5BORA 5LZ4A 1XSEA 3H87A 3L40A 2YWRA 1M72A 2G63A 4Y6OA 1S6YA 3ZQKA 1QAOA 1R8JA 2A1TR 3ASYA 4DRXA 4R1NA 1CWUA 1E77A 1KZ1A 5KC9A 2AOXA 2UKDA 4TYTA 2GNAA 2PKEA 5TGZA 4PGFA 4RADA 4ZVPA 2Q9CA 5AK4A 4TLBA 1E2LA 3H9GA 3QH4A 2NZWA 4RTOA 4U39A 3B78A 1OGYA 3HV0A 1JZSA 1QQ6A 1SCKA 3L92A 4GICA 1II0A 4YJKA 1P9RA 5H4HA 3V9AA 2FX2A 4AXXA 4W1RA 3OKCA 2HHHB 3RK1A 2RC6A 3ST7A 1RHMA 3CWQA 4DA6A 5JCPA 4HFNA 3L4SO 4B4UA 1PGPA 1XX6A 1D7AA 1QH8B 2AD5A 2QRNA 3GEEA 3PQ6A 4L57A 5HOQA 2J9XB 3QUSA 2WKQA 1SUBA 2GF9A 5KNCD 2OHJA 5IBCA 4YP0A 4FDLA 5CNIA 4Y9RA 3WHKA 3BSSA 9ABPA 1Q57A 4E5VA 3DTVD 3FBTA 3PFKA 2G72A 4FQ7A 1AS2A 1Z7GA 3DBLB 5T4BA 4ENQA 4WXEA 3NETA 1BDJA 2BFCB 3IHLA 3H8SA 1G21B 4HFRA 4TTRA 5E6UA 1DT5A 5D3QA 4DVJA 4A26A 1N2BA 1U4NA 4EJSC 4JBXA 1VJNA 3F4LA 3PNYA 3P9PA 3D7NA 2H52A 3G1WA 3QTLA 4K8RB 5EE9A 1DCMA 2OZLB 2HN9A 3OZUA 1B1CA 3NTXA 1U6IA 2VNKA 5L4LA 4GZ6A 5DHQA 2ZPTX 4UEWA 2OD7A 1G6HA 4OQNA 4X6LA 3MEQA 4D26A 4RYLA 4H6VA 4NYIR 2HH9A 2PX0A 4HXEB 4MR8A 5JYEA 2ZGVA 3BSWA 1L5ZA 4M1KA 2XE8A 4Y67A 3QKRB 4F2WA 4CIWA 3CIFA 2WUEA 1NMEA 4JJKA 4E88A 1I2BA 3AHDA 1R9JA 3KQPA 5EVCA 3VSBA 2WJHA 3ZWYA 4CI9A 1Z6ZA 3ZS8A 4B2YA 2HLHA 1SHJA 4IEIA 1B1AA 4HV4A 2IP2A 4A8PA 1NPYA 3FPHA 2PZGA 3GRYA 5IJ0B 1QORA 4ZO9A 5JJBA 2YJZA 3QWHA 2NSYA 2Z30A 1VIAA 1FS6A 3VH2A 3Q12A 1OTXA 1ZA2A 2XGOA 5HZHA 4LWQA 3DXYA 4PS0A 5SYAA 5DCYA 4W9NA 3KYDA 3BXFA 4LIPD 2XMBA 4INZA 4QGFA 4MWDA 3NHYA 2BW0A 1XF1A 3P4YA 5B37A 1FUIA 3H9QA 5T3YA 2DFTA 1ZEMA 4Y6LA 2ZPUA 3SKYA 4BLPA 2VFAA 3LQYA 5E8RA 2Q0IA 1QE3A 1XZAA 4QA9A 1PTJA 2FJ0A 3GA7A 4E4RA 6NULA 1BROA 1HORA 3FHOA 3C8UA 5EC8A 1FFAA 2EZ4A 2OXCA 3MWYW 2NG1A 2PR2A 5A9SB 1PG2A 1XTKA 4LF4B 1IJKA 3LCUA 1D8TA 4GC5A 4TZEA 2QN9A 3BAZA 2V4ZA 3UWMA 1SHZA 4NULA 1GV1A 3GLTA 1M2WA 5GONA 2AGVA 2ZJOA 2UUPA 3H97A 2EXXA 5E6RA 2WDZA 4IKOA 2AF4C 5E2BA 2X8LA 1S0UA 2Z98A 3BMOA 4U02A 4EQZA 5AKLA 4PG6A 2XF2A 4BMPB 1GTVA 2GK3A 1YS1X 3LQFA 2XNHA 3PLRA 4G6ZA 4BJ6A 2OECA 3D6VA 621PA 3ICVA 2MSEB 3D5QA 1D07A 1MG0A 1D2MA 2AK3A 1DAMA 3S2ZA 1Y5NA 2HHLA 4GR4A 3A3OA 5EIOA 5DCUA 4BNNA 2OUIA 3GFRA 3RASA 4G8BA 4TLMB 1U0FA 3SXUB 5BSHA 1L5FA 5MN5A 4D1UA 1NJ5A 3EF0A 4MQEA 3HI4A 5K4KA 4P5PA 1MV5A 1S3GA 4Y98A 5ENZA 1CY2A 4DF3A 4N03A 5DHPA 3WNDA 5K3FB 4Z4GA 1VMDA 2UV8A 1VIDA 5JROA 1TU4A 4QJ5A 3B48A 3QZUA 2PA0A 4KMRA 4C2UA 4FFBA 1DXKA 1C8VB 5B1IA 5AVQA 1Q21A 2QS9A 2V7XA 4N5HX 5EJ8A 3GMIA 3GFOA 4MYSA 5EMHA 3LXRA 2OV8A 2FMKA 3A58B 1H66A 3GJXC 1QCDA 5JBNA 5D7NA 1TM4E 1X74A 3DUFB 4IINA 1JR3E 4EATA 2GTIA 3COJA 1XCMA 2VTVA 2OMEA 3KZ1E 4MVJI 1VKOA 4D9FA 5ADVA 1JDSA 2G6BA 3O8BA 1RHKA 4OHKA 1YV9A 3VPAA 4GPIB 4UFPA 4HDSA 2Q2WA 2Y77A 1RJDA 1U2TA 3GFFA 3GA5A 1UBNA 1UXGA 2BKVA 1PJLA 3LVBA 3JQGA 4TSKA 3VMFA 1JKJB 3A14A 1BQ4A 3CEJA 1VMKA 1ZM3A 4E03A 1F4VA 4I36A 2REBA 2WJGA 4I9HA 1LI4A 4PGMA 3LS2A 5DOZA 2NTYC 3OX4A 4LGCA 2R0QC 2J3HA 4C2TA 3N0VA 1G5FA 1PUJA 3BMCA 3F2VA 3IERA 1NVVQ 3JARB 5AJHA 3ZV4A 1JAXA 4AUNA 1RYBA 3E7FA 3W5UA 2WILA 5FA6A 1OCEA 3WFJA 2WD8A 1OVGA 1RYZA 2I1QA 3R20A 5B6JA 1T4CB 4U1RA 4V1CB 4EO9A 1HQCA 4ZAYA 2AN9A 3DMTA 3DZCA 2OXFA 3WGQA 2FGKA 3QU9A 2QLMA 3Q85A 1YMVA 1ANKA 4PQGA 4ZRNA 1AGRA 1AQLA 4W5RA 4YP5A 5CM2Z 4BFLA 1CUWA 1KYWA 5EE5B 3WMXA 2P6OA 3QXSA 1JEOA 3PB3A 3ZHCA 3CJTA 3MD0A 4PCLA 1M6VA 3ECSA 4LOIA 5EV6A 4ZCSA 2QL5A 1NBHA 1TZKA 1RC1A 2XMSA 3WI7A 3KZOA 1XXLA 3H19A 2IYOA 4WD3A 1LX6A 3HXKA 1Y5LA 4C0SA 3S81A 4L1KA 4DHWA 1N78A 2ADMA 2FW7A 1U7PA 1YIAA 1YOBA 4W9MC 2FHXB 1BD3A 1OXSC 1MJGM 1XB2A 3T9CA 3R41A 5L53A 1WPRA 1CRQA 4RIHA 4UUOA 2B83A 1CETA 2Y0CA 1E6WA 2H7VA 3K1AB 3KYJB 2VH1A 3ZE8A 1SCDA 2I66A 3Q7SA 2AQKA 4ER7A 2CF5A 5I51A 3BSFA 5EMJA 1H0HA 2GUGA 1JG4A 1PRYA 4XFJA 1IHYA 1B15A 3WLNA 3CO0S 1XQ1A 3X2EA 1BAPA 1JHZA 2R9VA 2HQOA 4LZZA 2DFDA 4PY2A 1L4MA 2VHQA 2WC1A 5FPKA 2C9BA 2A5FA 1RPZA 3AFMA 2QDTA 4B6GA 4Y2TA 5BWMA 2ZZNA 4RYDA 5ITVA 4C2BA 1GZUA 4O4IF 4PQYA 1XTSA 2DAPA 2ZR0A 1EFHA 2PGNA 3OETA 3R0QA 2VR1A 3VHXA 3DW3X 1NWCA 1RQ7A 4PFJA 4YROA 1SU8A 3FZNA 3LBHA 2WJWA 5B7PA 1CNFA 1QHFA 1DQSA 2PEYA 4MKZA 2WSBA 4OHCA 5EMMA 1QQAA 1AN9A 3AV0B 3AETA 3HSSA 4ZHQB 1CUJA 2YNMC 4NICA 3DZIA 5J2UF 4GS5A 3UJ7A 3WLRA 1ZH0A 1F48A 4DBLE 4E5DA 2XNCA 3T9BA 3QKWA 5AI5A 4YAOA 2GM5A 1AM4D 2P9CA 3N7TA 2AMVA 4RLSA 3FNHA 2EW8A 1IZ8A 2ZVDA 5I47A 4W5QA 3MHTA 1N2ZA 1USWA 3WGJA 3DAHA 4G4SP 5AH0A 1B7GO 3S5UA 4C4PA 3NIBA 5CW2A 5DB4A 5ER9A 221PA 2Y87A 1B0PA 3A9SA 2XCLA 1BYUA 3IAM1 1TKRA 1BQ3A 1VL1A 3FDZB 3R76A 4IDGA 3O82A 2GO7A 1DWQA 5KNDH 5DXAA 5I5EA 4PR3A 5BUCA 4Q4HA 3HVIA 2NNWB 3UC9A 1JJTA 4D9MA 4F2PA 1HYEA 1UZAA 1QB7A 3IT2A 1WKBA 2YC4C 5GONB 2HV9A 5IHXA 4DEYA 3UPUA 1N7JA 1Q0SA 1EM8A 3HN7A 5LC1A 4UHCA 1UEXC 4WE3A 3MMXA 5TPWB 4RMIA 3O9VA 1SKYB 5MN4A 3RE1A 4P62A 1QIFA 1YVEI 2CKMA 4NYIQ 5FV4A 2F3QA 1GNPA 1OBCA 2I3DA 5FBQB 5IZCC 1MD9A 4NPCA 3RLFA 4J0IA 4P5DA 1C3OA 1Z4QA 3CB4A 2QTWB 3E9CA 3VJRA 2ZUUA 1XZQA 4AICA 4HJXA 1I13A 3QU4A 5C4MA 5AXRA 3GH1A 3KUUA 3MJ4A 3PRKE 1NHWA 1RLTA 3ES9A 2BVNA 4XVQA 4D9BA 3C14C 1AURA 1V39A 1GNLA 3Q9NA 3L7JA 3UEOA 3CE9A 2Z83A 1OPRA 3N87A 1CUDA 1VMIA 4ZOAA 4JH0A 4PR0A 1RQLA 2VHWA 2R1UA 5E2AA 1D4ZA 3H9JA 3DB2A 2JGLA 3OZAA 4P2GA 2EF0A 5EWJA 5GOTA 1ZD5A 2PZEA 3GCWA 3WYFA 3Q3HA 4EW2A 1HE3A 2HGSA 1K68A 1MN6A 3CG0A 5CVVA 4D79A 2EIHA 3PQ8A 2PH1A 1E66A 3LECA 1VYTA 4ZANA 4IZOA 2Q9BA 5GZ6A 3NWJA 4LF7B 2HRBA 2QEDA 2J5XA 3NNNA 1A7AA 4RFLA 4KL8S 2CJPA 4CR7A 3WL7A 4WN9B 4D4HA 4PQEA 1CUFA 3EZFA 3VU1A 2YZ2A 4B33A 4EY4A 2ZSBA 2IGBA 3CPJB 2JGRA 3TGPA 2Q3MA 2PANA 1BG6A 1EINA 2EFYA 5F51A 2OG1A 4X44A 2AFVA 2FW9A 1VJ5A 2ZRMA 3RUHA 3EUWA 5I9LA 2GCOA 4NFSA 2QUHA 4AD8A 3BBLA 4EG1A 3IMFA 2WMYA 1SUIA 2QRJA 3R77A 1YQQA 2WEKA 4ZJZA 2GX6A 1ZY2A 3QVGA 2Z6VA 5DOVA 4C6SA 1NBMA 5KWIA 2ZYUX 1ID8A 1H42A 3C5CA 4B46A 4ZI3A 3JQFA 1Q1ZA 4CKBA 2C4TA 1HM5A 4JI5B 4ARSA 1DXHA 4IDOA 5IN4A 1PL8A 3S7TA 1CUBA 3C45A 4KLAA 1UDCA 8LDHA 4M7OA 1FNNA 1OH8A 4R1QA 3AVWA 4L3OA 2GFIA 5CB0A 2ZAYA 4LHXA 1N6PA 3P96A 1OH7A 5EP1A 5DSXA 4OQDA 4X1KA 3TI9A 3ZZTA 2BKXA 1SUPA 2I2AA 3P26A 4HQ0A 1ZITA 2ILVA 4KLRA 4V0NA 3TO5A 4TKLA 4BNVA 4X00A 4B2IA 1GTL1 1X8KA 4ZEVA 2P1RA 2OCBA 1Q6YA 2PRZA 1KO3A 1Z4NA 3DKKA 5BXQC 2DUUA 4Q39A 1A8IA 3QKUA 2B8NA 3EUFA 4YIHA 3HJNA 3NAQA 3SBOA 3CUYA 1UF9A 2GSWA 2RAVA 2E6UX 2QB5A 2BMWA 2NNLD 3SQDA 4DPLA 1QHNA 4LXQA 5DNDA 1XLTA 4JENA 4QDTA 1YIOA 4GG1A 4R1LA 4BU1A 1ILEA 1EXDA 1KS2A 3B1WA 4ITRC 3PZBA 2GAOA 1AJEA 3OCJA 4ZEMA 2QD5A 2VLBA 2GEKA 1YR3A 3WDKA 3FOWA 4PYQA 4DG8A 2DH6A 5J40A 4B84A 4JBIA 4M36A 3QLJA 1Q1EA 3VR2A 3SC4A 1IY2A 4R69A 4IDFA 3I58A 5A03A 3EW7A 1W73A 2O8BB 3BWCA 3H1PA 3UNXA 1Y89A 1ORHA 4FLFA 1MIOA 4XIIA 4ZXPA 1F9AA 3P9IA 4BWFB 2XLBA 1PDWA 3R3UA 1V4NA 3B6KA 4IMPA 3MILA 5EZYA 4K0KB 3DFUA 4QUGA 2PUEA 2G88A 4WZBB 4CMJA 1OD6A 1W4LA 5DYWA 5IW8A 3UFBA 1T8WA 4F4CA 1E7QA 5E1OA 4U7JA 5COBA 5AD1A 5G3ZA 1PS8A 1RI4A 1BVHA 3T3MB 1TQ6A 5LJIA 3NFRA 5K3FA 5BY2A 3TQSA 1YOVB 3C70A 4DRZA 5CT6A 4AURA 2E49A 3CW8X 2JJYA 3ROTA 3ZOKA 1JEJA 1WZEA 2A0KA 1IULA 2BONA 3ADKA 5DVZA 3AHHA 5AI6A 1ZO8A 4FW8A 5E2IA 4FYPA 4HB0A 3W8NA 2V45A 1XALA 3LDGA 5F78A 1FW6A 3MGCA 4BOYA 4LZLA 4LS3A 5IUNC 1H9BA 4E12A 2ODPA 1XZDA 3H04A 1UBTS 2AS0A 1AH2A 5K6AC 4LDZA 4NG4A 3ZDQA 1ZM9A 3A1CA 1F0NA 4CFSA 8ADHA 3TSWA 1DHTA 5LP6C 1JVSA 2PO7A 4L0CA 4Y9UA 4MYTA 5B36A 2OM6A 5JT1A 2YHSA 4DIKA 3UKJA 1X8LA 4YRPA 1PWZA 2X6RA 4ZI7F 3P2MA 2PJZA 3WA7A 1RCTE 1T0PA 1WUTA 4PRLA 2OD9A 1F60A 3WGHA 2BR5A 5EVBA 5JANA 5CLFA 3GZNA 3QJ5A 4XGRA 2KM1A 2Y67A 3UANA 1N34B 2G9VA 5D86A 2FAXA 4B80A 2GB4A 4G1EB 3U40A 1WF3A 2HB6A 1ONBA 1ZGAA 1BKYA 2ID7A 1RMTA 4LC0A 4YB8A 2VYQA 2CMKA 3AF5A 4UVIA 5BQXA 3UT0A 5FD8A 2J6IA 1CB0A 3K0AA 3TUZC 2NOAA 3AIOA 4OKSA 5EXDA 3RF6A 3VU3A 4C7MA 4AJIA 5KREA 4MV4A 1ZG3A 4MHTA 1WHSB 1NVTA 4Z2YA 2CT8A 1MEJA 2O8CB 1F8GA 1MVNA 2ZBEA 3LCMA 1ETUA 2O20A 2WFAA 2CFOA 1DAHA 1UPUA 1V0JA 3RD5A 3LUBA 1NR7A 4TKVB 3ICQB 5JNSA 1RBMA 2RBEA 2ZRPA 3AU9A 3BDIA 3D0OA 3QFHA 1U80A 4FLMA 4B34A 3IOGA 3COZA 2PAAA 3GQBA 1PJTA 3SEFA 5TS2A 2B30A 1L8XA 2QAJA 4MS1A 4Z7QB 5IASA 3I8SA 5ICMA 5M7EA 2QD1A 3BEDA 3HS3A 4HQNA 2VH5R 2QM7A 1B00A 1O08A 3N2GB 4B4WA 1SCBA 3FFBA 4KAFA 3OCWA 4PAOA 5A4AA 1EFKA 3VTFA 3CX6A 4MIEA 1WHSA 4N5IX 3EA0A 1ONOA 1W25A 1OX4B 1UK6A 1KU6A 1VYHA 4IRUB 2ZSUA 3SP1A 1JQJC 1MAVA 2DKNA 4LNAA 2XT6A 4OXXA 1PL7A 4NU0A 2PBFA 4MEAA 2A5YB 3T7SA 1PGJA 1JLKA 4LTDA 2QRHA 4FMCB 4TROA 3AXTA 4MI3A 4NE9A 4UUNA 5HPYB 3QUCA 4GOXA 3ETGA 3LRXA 2J85A 4ZVVA 2H2IA 1XRSB 5F2NA 3F7MA 3KZXA 4G5XA 2ZB7A 4DLRA 1QX3A 5K0TA 1PJQA 4CTNA 1AKWA 4WKBA 4P54A 3PENA 4LFBB 1SHLA 1SEVA 2GM3A 1V25A 2Y0BA 3SYMA 5CJPA 3X44A 1YKFA 1TD9A 2O3QA 3GEPA 1RAEA 2DETA 4AW9A 1NP7A 2PZMA 1IBRA 2G1UA 3DMYA 4IGIA 2F1KA 2FRXA 5BSVA 4DCCA 2J3MA 5IANA 2MSDB 3PXCX 1PNRA 1T8RA 3UAXA 2FE4A 1HDOA 5AKEA 4D42A 2X42A 3IV6A 4PO3X 4URFA 1FXSA 4F4JA 1DAPA 4B8WA 2BD0A 3DGFC 5GV7A 4IS3A 2VNSA 1HGXA 3K20A 5LJLA 2WPNA 4R1OA 3BRSA 4FDVA 1V1MB 4C9BA 1UZMA 2WT4A 3OT1A 4EF4A 2C5AA 3U26A 4IGFA 1KS9A 3L6RA 1QH9A 1QO0D 4MYUA 3LTNC 2GRJA 5LCAA 3CO5A 4WKNA 2IS4A 1AX9A 2QTTA 1EEXB 1SQFA 1AD2A 2WDPA 4CM1A 4NAHA 4ARCA 1DRWA 3C6XA 3DDCA 1IUPA 2LGJA 3ZY4A 4WMLA 3QRWA 4BL5A 1EZ4A 3OE7D 2Y1CA 4D1VA 3U9SA 4IV0A 1GAWA 4M99A 1VB3A 1GU0A 3RNLA 4D43A 8GPBA 5I7UA 1I3NA 1O0BA 5H4GA 1NR1A 4DIUA 4EUNA 5A3JA 1IUOA 1QHHA 2Y93A 3FSJX 3SXPA 2Q5IA 1ZRHA 2ATIA 2JZOA 3D6TB 1HRKA 2WTNA 3CNOA 4GMFA 5IFKA 2Y1LA 2OFWA 5FXMA 1YUMA 5YASA 3SHVA 3DFZA 4OI1A 2IP4A 1GG2A 1GQYA 1MOZA 1MENA 3TQHA 4I1OA 4QWMA 1JUDA 3IVAA 1JIXA 5ULLA 1K3UB 3OQHA 1ECPA 4K05A 4KREA 2YZ7A 5BT8A 1MP0A 3D81A 3FYSA 2DM6A 3PITA 4ESVA 1V8ZA 1GXSA 2WT8A 2NX2A 2OPHA 2JNWA 3VPSA 1SCJA 2OHGA 1D2CA 5KQPA 1FVFA 2CK3A 5T41A 3JW8A 4QBFA 4TX1A 5FOTA 4JJAA 3VI3B 4YO8A 3N2NA 4RS3A 3ORFA 1JLSA 4NCBA 4JO0A 4M55A 5JQWA 3SSAA 1MQSA 4BNHA 3D0QA 1TUEA 3EGWA 2X9QA 3I1YA 3PFBA 4BMCA 3ZE0B 1UODA 1MHTA 2QMOA 2YDYA 3NC0C 5KIAA 5M2QA 2GBCA 4GAEA 3PRHA 4OOFA 5A0FA 3T9MA 1JAHA 1Y6GA 3HUFA 1WBBA 4GCWA 3HQ4O 4S1PA 4JC4A 3DDZX 3TLGB 5KTNA 2ZI6A 2ZTSA 4WECA 1KMHB 1RKXA 4F5WA 1X92A 4IL5A 1GRVA 2PRYA 4NY1A 4DYHA 1NW8A 2I1WA 1XLWA 5E9WA 5HTKA 1EP2B 3DA8A 3DE1X 4XWWA 1TYEB 2FEMA 5F1OA 2KLBA 1GEGA 2ODTX 4ND8A 4ZALA 5K0BA 3I6IA 4N0PA 4TSFA 4MJ7A 3NS7A 3ADPA 3QM1A 4RSHA 1T34A 6REQA 2QLBA 1FRVA 1QVZA 3P27A 4BUCA 1ADFA 3HE3A 4Q66C 4RMHA 1HKUA 2Z3ZA 2DHDA 3RJ5A 4AY4A 2O8EB 1K0UA 2VYND 1VL6A 3OLZA 1N7IA 1ZGJA 3IJ5A 1DCTA 1B93A 2X7XA 1KZYC 4LHZA 5NLLA 3GLIE 4AO7A 5ALIA 3R7NA 3PUJA 1O6CA 1EM8B 4EF6A 3EMKA 5K9ZA 4B7AA 4IXTA 5DIFA 4ND8B 3W8DA 4LHEA 1S7GA 3JWPA 3SVTA 3OCVA 2CLKB 3EH1A 4H08A 4L72A 3H3XA 3WZLA 3INYA 1KQNA 1UZLA 3F3YA 2ZYAA 3QKTA 4FC6A 3UK2A 1HTWA 1TZCA 1Z6AA 3P9RA 1TCBA 4Q02A 1DAEA 4RD6A 4W63A 1QOQB 4PSVA 2I9KA 1DTWA 3DJFA 5AKYA 4A10A 1ESNA 3HXQA 1GU1A 2Y05A 2GBLC 3CZQA 4RQTA 1RJEA 1XEAA 4RSMA 4K1XA 4UNNA 4UOEA 4MI6A 2P91A 3E4CA 4RVCA 1KVTA 2FSSA 5LP6A 4DSNA 3BEOA 1CUUA 1R0YA 2R8OA 4O1IA 3H42B 1W9MA 2YASA 3ZK9A 3R2UA 1P2GA 5BURA 1GQOA 3ZGLA 1I14A 3C6YA 3QXJA 1FE8A 1UPFA 2QRLA 2FR0A 3OQIA 2WU4A 3D7SA 4U7GA 2V6GA 3V7YA 1UPTA 1X1RA 2AOTB 3Q40A 5AQEA 2R751 1WG8A 1AKNA 1Z2AA 2IQIA 4Q24A 5EJ6A 1OUMA 1P73A 2AH5A 2H2WA 3ER6A 3R9IA 1DBVO 3DKIA 2BKLA 4YRDA 3UAGA 2BMIA 2FK6A 2A7QA 4Q05A 2XBMA 1YVDA 3WK6A 1ZC3A 3LPAA 3UT5A 4OLFA 1NF9A 4BFUA 3K8YA 4RPLA 1MQ9A 3RJ9A 2AOVA 2W6ID 5BYBA 1YRWA 1O9GA 4OQYA 4IQFA 4K9DA 4NQ4A 1SJ9A 3JTEA 2A86A 3NZEA 2ONCA 4CE6A 4DLPA 5LCFA 2B8JA 4NATA 1N5IA 4HQFA 3WGYA 2AN3A 4ZV7A 3HJFA 4DSAA 1Q0PA 1HYBA 1WD5A 3BGWA 2O7VA 3UB2A 3WNVA 2PSSA 3A2LA 1E1QA 1U1EA 4TMKA 1U28C 4UHKA 4JELA 3IL2A 1W4AA 2XMPA 2ODNA 2KYRA 3QVOA 3ICEA 2AX4A 1A71A 1DCFA 3LGXA 5BN5A 3C6ZA 3Q6IA 2QRMA 2WWRA 1JTFA 4PC6A 1R9GA 2LIVA 4Y6SA 5HW0A 2NU9B 1OFGA 3IT1A 3JQ9C 2YICA 1PNOA 3G02A 3MUFA 5EUMA 4BCCA 3OTQA 1JDVA 2YJ4A 4UAUA 3VBEA 4EHNA 1GZ7A 1SXJC 1P75A 1GRRA 1D6NA 1R6BX 1TU3A 2VDLB 2XGSA 4KIUA 4Q3CA 2A9QA 4L22A 4R9SA 3FRJA 4HAVA 4YTEA 2UZ0A 1EAYA 1CCWA 2P0YA 1JFRA 1GL9B 2RI1A 3GAAA 3I1FA 1SBQA 3KM0A 3NNSA 4B7CA 1AUQA 1INLA 1DU4A 1U1IA 1REQB 3D6UA 3W79A 3X1XA 3RM3A 1NQ5A 3GUHA 3OIUA 1GV0A 4HGZA 5CB4A 1YL7A 2P3QA 5LSCA 5ICFA 2Q5JA 1XXHA 3STHA 1J6UA 4BVKA 2DB3A 3HNPA 3NWBA 1H4SA 5B3LA 4S1NA 4JT9A 2QZ9A 3WQRA 4YMVA 4URHA 1PD0A 3N7UA 5IKPA 3UGKA 4QVKA 3MBOA 2DP4E 4TYNA 1XRJA 1QDLB 2WVJA 2X5NA 5DI3B 3D2LA 3WWEA 4MJXA 2XNDA 1KPIA 3ABZA 3N07A 3EH2A 3QX7A 2DMRA 4F6ZA 1E98A 2JC3A 2W00A 2YHIA 4YJFA 4ZMSA 5BPFA 4YT5A 1QNFA 3CQ9A 3GVHA 2EJUA 1PZHA 2W4MA 4FIDA 4R5HA 1M0EA 4NP6A 3NVKI 2A57A 1KZ6A 4KKXB 3PGJA 5DK4A 1ZK3A 3ETLA 3HMKA 5J2TB 2C61A 2EATA 3GOQA 5C9ZA 1U1DA 1YR6A 4MO9A 3R0IA 3SVZA 1R6VA 2ZYSA 5I7RA 1UKAA 4FFMA 3IIMA 2V1XA 2IYZA 1EJ0A 4IHJA 4TQ9A 3SC6A 1HWYA 3FDIA 3AF4A 1CR0A 3BTVA 3IQGX 1TTQB 3D54D 2H29A 3JZAA 3UK0A 4B0OA 4C6TA 1H8HD 2ZQYA 1NVKA 1QZTA 2Z3WA 4Q93A 3TD6A 3X1JA 2FH5B 2J3KA 2WA2A 3QE0A 1Q1NA 4MB2A 4V39A 4I7EA 3ASVA 3OFND 4IJQA 4QPZA 2Q0XA 4DZRA 1UKZA 4NI5A 4BN5A 4C4XA 2Z57A 3ZEIA 4RD1A 3GLFA 4FOLA 2WF7A 3BX1A 4PICA 5CCDA 3GWGA 3SJ7A 3T1TA 3ID6C 2IZZA 4NFLA 4CHTA 1CXZA 3B3QA 1E1NA 3LV8A 4N54A 4QJIA 3S55A 4BFZA 1ECGA 3D7MA 4RU1A 1XCGB 5LDHA 3NOOA 4JZKA 4MRSA 1E3MA 1WXDA 2BWJA 1K86A 5LZ8A 4EX6A 3RUAA 4R2JA 3JASB 2HMSA 3SYNA 3DEFA 1SG0A 4RA9A 4CEJB 5F12A 2YL2A 3TRKA 5JRJA 4GYUA 2ZWAA 4HXGA 3D4LA 4KV9A 5ALPA 2VZ0A 3CIOA 1ZL2A 3DO8A 3ELUA 3MWGA 3HO8A 1T5DX 2XE6A 5E0KB 4CKEB 1N4DA 4I6EA 1I2MA 5KCZA 3GEGA 5LDDC 1A76A 4AB1A 3T5AA 4ZT4A 2I6UA 4MV1A 5B2EA 2ETXA 2Q8NA 3BWBA 3EVZA 1RADA 4YRJA 4EYOA 4DLBA 5GINE 1LH0A 1S4QA 2GJAA 2CXUA 3KOYA 3LDFA 3QE3A 1GUFA 3DD1A 5FUXA 1VSUA 3KB8A 3N1UA 3RFVA 1S3IA 2YCBA 1KI6A 1NF2A 1XD2A 1CU1A 2R8BA 3KQHA 1Y44A 3EZ2A 2HLDD 2ZFUA 4U3JB 3ZWFA 4IQ8A 3PQ7A 4AJ2A 5IDXA 3L8FA 3AY6A 3UENA 3UOAB 1PLLA 2IZ5A 1G8GA 1C5KA 3EJ6A 3Q11A 1UP7A 4GUAA 5C1BA 2FPGA 5EKXA 1WUOA 1OR8A 2WHPA 4ETIA 2EP7A 1XTBA 4KQ6A 5FTNA 4XM2A 3G0GA 3S2FA 3QV2A 4JLPA 1O1YA 1MC1A 3I9MA 1Y1PA 3D8SA 4AYTA 4HEA1 5L3RA 2EFHB 5EIHA 2O2CA 1ZAYA 2P5TB 4PLYA 2VBGA 3E2IA 1M0TA 2VYVD 3PC3A 1QVVA 3O94A 5AXAA 1KY3A 1JU9A 3EPKA 1U0LA 3ZWKA 2BGGA 1YC5A 3LBYA 3QVXA 1Z12A 2GZAA 2JBWA 1RAAA 2Q1UA 2ZATA 2A9JA 3CMCO 1W88A 3DS8A 1RQ2A 3FPSA 2CL6X 4KUEA 1NQXA 3VOBA 4FHCA 2OCYC 3W4JA 2F62A 3UHFA 3OZWA 4PN7A 3K5WA 2NT3A 4QPJC 4IJVA 4CKBB 4JOQA 7MHTA 2Q2QA 1SQSA 1NBAA 5ITSA 1XEWY 2W11A 3F1LA 4FHEA 3BZBA 5ALGA 3PX3A 3IR5A 5C8YB 5CA1A 1ZUWA 1HEUA 2PV0A 4A4DA 3FWYA 3A10A 2FYTA 3IXLA 4W5WA 5A9TA 3E22A 3UMBA 3EFEA 5KPJA 3DM5A 2JFZA 2XYPA 4C1DA 1AGPA 1G291 2IUSA 4HSGA 4MSUA 4RANA 1F4LA 3DEHA 4PZAA 5KYUA 3S2SA 2A35A 1DG3A 1YGPA 5A7HA 1MT3A 3Q5DA 3TG8A 4YCAA 1N8TA 2HA0A 1Z28A 4LDJA 4ZOQI 1K7EB 1SC3A 3D6FA 3AX6A 1J2YA 2J5KA 5CA0A 1L0BA 1X7XB 4OAQA 4XWGA 1FTSA 3E9ZA 1K06A 1U0TA 3ONFA 1OC2A 5JV5A 1CUAA 4OTZA 3V6MA 4QOHA 3V8VA 3VOTA 4HDOB 3HYLA 3TQTA 1JG2A 4GR5A 3KSRA 1WCIB 4FT4A 3ABOB 3SS9X 1Z2PX 1JB9A 1GN8A 2Y1WA 1V4BA 3BQMB 1V9LA 4BPRA 4DQ0A 4B83A 5EP4A 3PPYA 3LC2O 1W5SA 3R7SA 1V8DA 1SIOA 1ZESA 1ZJ5A 1F0KA 2VJLA 3ITEA 1REQA 1TAQA 2H08A 2Q5OA 4QDOA 2LVBA 3E48A 3C3MA 4BQFA 4WW0A 1V6SA 1ENPA 3MCVA 4TQUS 1RQXA 4M8NE 2W48A 5JZ9A 3H5WA 4B79A 4I9FA 3BZUA 3A4IA 3RRJA 3ZU2A 4G5FA 4FS3A 1ARZA 1AQNA 3RVOA 4COKA 4GDFA 2JIRA 1Z4PX 4H7KA 5BW4A 5M29A 1QX4A 1U63A 3ESDA 1FRQA 1B0ZA 1M8GA 3CRZA 4TWRA 2QYOA 3KJHA 4NCHA 4OREX 5JHHB 5JOQA 1KZGB 1JAIA 5IBPA 2PLFA 3ZWWA 4WJLA 3ZPXA 4JL8A 1ZW1A 2B8WA 4NBRA 2C5GA 4CLOA 2CCJA 1J0BA 4LXGA 4YNBA 3T4XA 1RYYA 4DCSA 5JUWA 1XRQA 1G2OA 1BHJA 2BFBA 2JVIA 2GVDC 2H2AA 3IA7A 1R74A 1ZW6A 3AVXA 1ZK0A 4O2BF 1P5JA 2W43A 3JAKB 4J03A 4ZRDA 1DOZA 4JI0B 1KAGA 4KE9A 1VQ1A 3HO6A 4UATA 4Z60A 1RWWA 2FQQA 1QF9A 2B61A 3LKVA 2EX1A 4JLDA 4LOLA 4UBNA 3W3ZB 5ICEA 3GL9A 1C1DB 5DYYA 5EEGA 4ER3A 2Q46A 3PFFA 3EOZA 1O6BA 2P0EA 3H0CA 1FMTA 4OHMA 5L7YA 3VNSA 4JWTA 3U3XA 3LWNA 1PK8A 2H4YA 3SX4A 5K20A 4CDRA 3TQRA 4N48A 1KE1A 3TD2A 3NC4A 2WJIA 3FTCA 2H51A 4BB0A 3NKFA 2B6HA 2W90A 2TECE 4RQBA 3CZRA 4MQBA 1T1EA 4G01B 5EKTA 4F5ZA 3VA7A 1Z0DA 2AXQA 4JLBA 3QX8A 3K0CC 3LHIA 4ZC1A 4EUSA 1AS0A 5DGCA 2BSQA 4I1UA 2Z2JA 1GG9A 3OQPA 2I03A 4LV6A 1UK8A 3HUUA 3V48A 5JXIA 1I7DA 4HG2A 1SD1A 2D4HA 3PG4A 4DC0A 3Q5GA 4HYYA 5IYZF 2QLNA 1PTJC 3L7CA 4XUCA 4LMAA 3IIIA 5J2UA 4M1OA 4ZAWA 4C4SA 4E15A 1I36A 2CW5A 4PPGA 3SHOA 5KTSA 1NG1A 2P35A 3N6RA 3O47A 1MIHA 1U2QA 1ZH8A 1ATIA 3QYPA 1C29B 1H94A 4R3WA 4WNAB 4TQGA 5KWSA 1DBPA 1LLQA 2PPLA 3IOYA 1LA2A 1W5BA 3SZUA 4F60A 4FJ0A 2I4TA 3VKUA 4HQKA 3B6EA 3I6ZA 1HE5A 5TQ0B 2CL0X 2JB9A 5KQMA 3AU8A 3OZGA 2R79A 5IM5A 1EWQA 1ZC4A 1ISFA 1KOJA 4Q12A 1LPMA 4JJIA 2C54A 2NU6B 2P27A 1GYRA 1S2LA 2GA9A 4RGYA 5CYPA 3ND7A 1KRXA 5DLQC 5C1IA 3RCBA 3RRZA 5BNIA 5KTYA 1RRKA 3PF9A 3VPEA 3AVQA 4WY2A 2D4AA 3I64A 2XB2A 2YFQA 1T4GA 4ND3A 5TY0A 2IIPA 2CJWA 2IZ6A 1BEUB 4DR3B 4UHEA 4RNDB 5JMPA 1OXBB 3MRXA 1N6RA 5JC1A 4MVXA 1NPTO 2KHZA 2D7JA 3A1NA 2L19A 4EG5A 5HKBA 2ZOSA 4X62B 2Z08A 3QVKA 5FPQA 1F1JA 3I05A 4ND5A 1OFHA 2CZCA 4WBNA 1YS7A 1RWNA 3CLVA 2PMEA 1FDOA 5E3IA 4WAUA 3RSZA 1CQJA 1P2SA 2OHIA 4FFPA 4C0JA 1P7VA 3SHFA 3MLEA 4ZYZA 2X2EA 2FZGA 3WKBA 4A6EA 4I5GA 2LR0A 5GAJA 2GCUA 4R7GA 2N42A 1WMBA 4BMVA 1Z08A 5AKZA 3HCCA 5FHQA 3UMYA 3TTWA 1P7CA 3CJRA 4OI4A 1LPAB 4M0KA 1YB4A 1SQGA 1YCHA 4A8TA 4D80A 2QENA 2G17A 2O2EA 2PWYA 3E9NA 4EPWA 2E21A 1EUQA 3JARA 4X66B 5LA6F 3L6DA 1KI2A 3AM4A 4OMDA 2ISSD 9LDBA 5JI3E 1OXMA 4HLUC 3ZNPA 2OP0A 1G9SA 4AYWA 3G88A 1OYYA 3P71T 5EJGA 4Q1EA 3PNQA 3HB4X 4O8ZA 3Q7RA 4HPWA 3WK7A 1M7BA 2TS1A 2GLXA 3L8ZA 4H7HA 3P9XA 1IAVA 1KZ7B 1WUYA 1XTIA 3LQ2A 4H3HB 4CPDA 4LE6A 4ZOLA 5BSTA 4M9XA 3DB1A 2V7UA 4ZMBA 3M6WA 2ZO4A 3MWFA 4IILA 2B7CA 2JLBA 4GLFA 4JP3A 3VXKA 1X42A 3H2YA 3E9RA 5K0CA 5K5EA 3SDSA 2CVHA 2AHRA 1OJLA 1P77A 1XBTA 2ZRDA 3AF0A 3CF6R 5CW1A 5C18A 2JGAA 4JQYA 1IJFA 3SICE 2CN1A 1ZYUA 1Z83A 3V42A 3X1MA 2PH7A 1XDGA 3EY9A 2Q28A 1H6BA 2WD7B 2QEQA 4CLRB 1PZNA 3E6AA 4Z9XA 3WLMA 4X8MA 5G02A 3HB5X 2C2BA 3F67A 2W6JA 2YMMA 4IJ5A 4X85A 5JWRA 3BXXA 3JAWB 1KQ3A 2DT5A 5CA0F 2BFZB 5F21A 4TYMA 1N2SA 4ZVTA 5ALFA 3IUNA 3LQRA 5CHEA 1SN7A 2VUSA 3LA8A 2GPSA 1N2XA 3N2YA 3R0XA 2X15A 3NP9A 2C5FA 4AMBA 2R8YA 2WZQA 2JGMA 1NT4A 1LLDA 3DT6A 4OUDA 3RR2A 2C84A 2BR6A 2X4IA 2PO5A 4AWYB 1YDFA 1TXGA 1I2AA 2CJXA 3TUIC 1I6KA 1DV1A 1P7YA 2J31A 3D8TA 1U3VA 3QELB 1USGA 3IUSA 3G1PA 1Z6PA 4FFVA 1YJQA 2PPVA 1NVGA 3NDIA 4RHYA 2PU7A 1C9EA 2ATVA 4PX9A 3ZGYA 5HS6A 2YH2A 1OBFO 3BVPA 4LHWA 5GY7A 3RBVA 4ARBA 5D85A 3SZOA 1W94A 2JD1A 2EW2A 3ADOA 4AROA 4CLXA 3K6KA 1GUAA 3O4GA 2JIBA 1M67A 3CPEA 3HCRA 3LMKA 3I6YA 2QX8A 3TIIA 2NTVA 2QTVB 3P9YA 5DHRA 5MDHA 3OEEA 3GJ0A 4G3XA 4P7FA 3I0VA 3U3MA 3NHJA 5FRDA 4IGKA 1RAFA 1BIFA 2VJPA 1KRWA 1VL0A 1CFJA 3JVDA 3JV7A 3PU6A 3IELA 3R5XA 4CTJA 3AM1A 1UBOS 2ZAGA 2JAXA 1CRZA 2B25A 3CNBA 1VI2A 1W29A 2AYZA 4WN3A 1NKTA 3B38A 1I0ZA 2W2TA 2NADA 2B3DA 2N1BA 3JYOA 4HO1X 1W5FA 1E9EA 4F85A 3K9BA 1DHRA 2FWJA 3BWDD 3HC7A 5AVZA 1T2FA 2HQSA 1V35A 3QUTA 4MR7A 5GV8A 3EDMA 1CRLA 3IC5A 3RU9A 2WIJA 4QU5A 5CVDA 3UWPA 5M04A 1SOMA 1WSDA 2B0CA 2PS9A 3AHJA 4HK4A 1OWNA 1OZHA 2ZSFA 2Q1WA 4GIBA 4Q0MA 1WR8A 1YZKA 1HFEL 4V2IA 4F91B 2A1UA 3WGZA 2QDKA 3JQAD 5MGBA 2XB8A 3O6VA 3NBMA 1DXQA 1UXIA 2E5FA 2MJLA 2AFHE 2WU8A 4RFSA 4TL8A 4X24A 4ZXFA 1J39A 4C04A 2FY8A 2VPYA 2JJ2D 1HDEA 2FPIB 4D56A 2G4CA 4BMYA 1K4YA 2VS1A 3DZHA 3C6MA 1TA0A 3HDJA 3KEGA 3DUWA 4GFDA 2IPLA 2G71A 2UYOA 4U2BA 4UM8B 3RV4A 4EP1A 1XTJA 2HK6A 1Q14A 1L5VA 5LMCA 1J8MF 2AE1A 1J2RA 3KYCA 3QHQA 4RPHA 5DM0A 4A6XA 1YAHA 4DC1A 1X70A 3BE8A 2B78A 4K46A 3TIGA 3ZHSA 2Z95A 4EMUA 3RSFA 3MJFA 3PL5A 1ZCAA 4G1UC 3HUEA 4IGEA 2YOFA 4CQMD 1PR3A 5DHUA 5LZ5A 2VT7A 2IRWA 4MA4A 4MRMB 2R2AA 4JZYA 2NYUA 4HD8A 2I8AA 1H2WA 3T1VA 5DBOA 4EDFA 2P90A 3L7AA 4Z8YA 1ZIPA 2IA5A 2ZJ8A 2IEGA 4KVZA 4AIIA 3I3OA 5CPBA 2WLSA 4O2AB 1AIPA 4DV3B 3CVOA 2RMKA 1L8QA 2BM8A 2H2FA 2NXJA 4BRWA 2Q4EA 4WASA 1W2HA 2HXGA 2CNNA 3VO1A 1MW8X 2YNMD 2C77A 3L0CA 2RBKA 3GD7A 1GTZA 2NUBA 3TDNA 3WVNA 3EBOA 2I7TA 1OTYA 2F3RA 3I12A 3OQ6A 1Z82A 2NO1A 2XY4A 2VF8A 5MGNA 3LIPA 1W8DA 4C7BA 3HCAA 1Z4MA 3STUA 2X2FA 4PXSA 1DIAA 2WYOA 4MW4A 1NRXA 3ONVA 1E9BA 3KJIA 5BYKA 3OPYI 4GOLD 1JBKA 4WESB 1FRZA 1NAIA 2QL6A 2RIRA 4RV4A 2BFMA 4AUKA 2Q45A 1T5HX 4B09A 2R00C 2Z2KA 4X7PA 2IXBA 3L4JA 2FN7A 1L4NA 2Q5FA 3K9LA 4LHSA 4IYRA 3Q2OA 1PEDA 3R9KA 1RNLA 2F1OA 4MULA 1T9AA 4Q3DA 3WHIA 4DMGA 4F6CA 1NSTA 1Y6ZA 5E7JA 3QH8A 1ZD8A 1K98A 1WVMA 3JD0A 2JD0A 3MJRA 2FZVA 5E7QA 1H1TA 1KMQA 3N0RA 3F96A 4Q4JB 3RABA 4GPD1 4JBHA 1PW7A 4F9GA 4U7DA 2H6AA 2X5JO 2B8TA 2YCLA 2VRNA 2W5UA 4N82A 5DTRA 2PZLA 3RTGA 2OGWA 2OG2A 4DR1B 1RJFA 4KWTA 5KYNA 5B15A 4ZJUA 2GM4A 5EIFA 4DB2A 4KB5A 2ZP1A 1LKZA 2FEKA 5ACRA 1ZQ9A 2UYXA 1Q7GA 2J3EA 4JLNA 1D2AA 1RBYA 2LP4Y 4LCJA 1TMYA 4OCZA 4DNOA 4DDTA 3V1KA 4RAMA 1F0YA 4FXPA 1L3IA 4CTOA 4NDAA 4HNTA 4BNGA 2C4HA 1CUZA 1YCDA 5DV9A 4CUJA 1IQRA 2ZQ5A 3BPSA 3MTIA 1WNTA 3MOIA 2NPIA 3BDAA 3MXTA 5FI3A 2GARA 1GSOA 2JFQA 4LOKA 4N0DA 1VGQA 4D9NA 1GRQA 2QMZA 1XZJA 3JD2A 4PYIA 1AXGA 1YZTA 1G0NA 1V3QE 1DBRA 3G68A 2NU8B 5KNBH 2J08A 3VU9B 3GJ3A 4CIVA 3AK4A 3Q41A 2GN2A 3AJEA 3LRPA 3OFJA 2GGSA 1B8VA 1FP4B 3PUXA 4RJLA 1T24A 1DARA 4KE6A 1WPQA 1E1DA 4K6FA 4KQMA 1MRZA 3ENKA 3OQBA 3BE4A 1DC3A 4IVNA 4OBWA 3GR6A 2Q9AA 5LB2A 2EIXA 4X5OA 1MLDA 5JQGA 3U31A 2I6GA 3L41A 2JDIA 1TI7A 1POXA 2YBEA 4ECEA 1ZL0A 4U2FA 4BX0A 5SZKB 1Y9EA 2OY0A 4C3OB 2UVDA 1PJCA 5TX7A 4YXWD 1CDOA 4JB0A 3L1IA 3HBJA 1IOVA 3IP7A 4LZJA 3CPHA 1TU0A 4I50A 4Y0AA 5SY9A 3V8NA 4ZYXA 3U80A 1E2UA 3ESBA 3WO1A 1M2JA 5A9RA 3E84A 3U19A 1N8KA 2HJSA 2HK9A 1P2TA 3B9QA 4N18A 3TZKA 3W7BA 4I8IA 5IXYA 3SQXA 1E2DA 4PZUA 2BHTA 5EI5A 3G0CA 2X0EA 4B82A 4EM6A 1CDZA 1V6CA 1WY5A 3E23A 5ALEA 1RWBA 2GF0A 3NCTA 5LVAA 3T1YB 3GRPA 2HFKA 3I23A 3DYVA 1WX1A 1MFZA 4M8KA 4IUCS 3VC1A 2JAQA 4AULA 1FMFA 2C98A 3P9ZA 1KGDA 2J0EA 5TIIA 2X6QA 3AI3A 1WNFA 3B6IA 3BORA 4MGZR 1X1SA 5AHWA 2X9VA 4DSTA 2CUZA 1BCSA 2DFKB 2RGRA 4PINA 3RWMB 3WDLA 4LXXA 5JI2E 2XUOA 3T12A 4D4JA 4GOND 4TRMA 3ETDA 5DYGA 5A4FS 3VNUA 1L4EA 3IIKA 3WTBA 1KMHA 2VRCD 2ZI3A 1ZH6A 1G8SA 2VDQB 3JVVA 3PUVA 2EFDB 2ZWPA 3BFVA 4WVFA 1UADA 1XTRA 5JAMA 3A1EA 1G8MA 2K5UA 2X23A 4RLFA 5L7TA 4DLUA 4O2AA 1IM2A 1T6NA 4MA0A 3U1BA 4JB3A 1ZLYA 3CS3A 4IHJB 1A8PA 3PBKA 4PYNA 3FM9A 1L5SA 3NUZA 2AI1A 5EKDA 3PGXA 3VR6H 5KOHB 1AXEA 4CFYA 2BG8B 3OAAD 2VBFA 4NE7A 4CMCA 1X13A 3KJQA 5IAGA 2CLCX 3C7KA 2IDKA 3BSYA 4MVCA 4BTVA 3MD9A 5A6SA 5JH7A 1C3OB 1BOOA 4ZVOA 2M6SA 2AFIA 1FXWF 4IIJF 1EX6A 3LDUA 3IULA 1XFAA 4L8GA 1N9GA 1P1JA 5LQSA 3FYUA 3HN6A 2P2NA 3E53A 3VR4H 3I62A 2W6NA 4TXHA 2VNIA 4YCDA 5THKA 2QZJA 5DK6A 3LFTA 1E4EA 1UAYA 3LVRE 3ADCA 1V8OA 2FWMX 2P2LA 4O4IB 1CZHA 3PIRA 3VNRA 1HT1E 5P8WA 1VHLA 3OEYA 4LWPA 1SVKA 4R81A 3VJLA 1BWPA 2E37A 5F5LA 4C03A 5EN4A 3C74A 5JSUA 3MVEA 3WICA 2IC5A 3A6HA 1DV2A 2QN7A 4WADA 3TSAA 1ADJA 3ZJUA 1JFVA 4HRXA 1SY7A 2GETA 4HDRA 2Z56A 3HPQA 2FJUA 2I34A 2H4XA 2DULA 2C8KA 3C3DA 4R1UA 3WNZA 4A3SA 5BVHB 4A15A 2MMCA 1MVOA 3OJXA 4YRTA 3LLUA 4IX9A 5T64A 1DG9A 3RADC 1Y6JA 1OLSB 5AW9A 5GIPE 3ZGZA 3K15A 2J59A 4CQJA 1QHGA 1L5HA 1BX1A 3N8HA 1GGVA 2WJZB 3GFVA 5IC4A 5HQ3B 2K7ZA 2PHZA 5ITZA 5LNK6 1Y9ZA 1IPHA 3PDCA 3QVVA 4MJ3A 3W5CA 3V7FA 2C5SA 1FFXB 2BH9A 3ITNA 2DHQA 4PSDA 4XQGA 3BD8A 4IHKA 1NVDA 4R1SA 4R2IA 3V4ZA 1EJBA 2X1VA 3WRVA 5LU9A 1E6CA 1CJCA 3LSYA 4KJZA 4ENUA 2QUKA 3ESCA 1Z5NA 4EI7A 1WTCA 4KQ9A 2Z09A 4YYEA 5F3WB 3AF2A 5LIRA 4I1IA 1QJ4A 3AONB 4Q9HA 1L6IA 3PRYA 2Q50A 2RGYA 4DDWA 4DS3A 1LPBB 3TECE 5FPTA 2HMVA 1E69A 2IYAA 4EEZA 2JLUA 1KBOA 3NHSA 5MHTA 4M1EA 4RTMA 1TCVA 2WVHA 1KEEB 5K4NA 1DWOA 2IXEA 4EA9A 4Z0TA 3UT5B 3ZHYA 1NRJB 1F20A 2PMKA 4Q48A 1SCQA 1I4OA 3QBJA 2NZ2A 2G80A 2ZBUA 5PGMA 5JPIA 2P1EA 5ACSA 2XQIA 3HKBA 1PJSA 3UKDA 3IQZA 4QRDA 1IB6A 3H84A 3NV7A 5DWQA 4BKRA 2H1RA 4UM9B 3A28A 1A3CA 3DAOA 5TGDA 2F4VB 3KQNA 4CM4A 3NLLA 1TQ4A 2GJ8A 2X9NA 3QX9A 1MMFB 1ZVJA 4QHYA 3RUPA 3T6KA 3UAVA 4F1KA 5KSZA 3K3PA 2V97A 3BBPA 5FUQA 4QGSA 1AA9A 1JBEA 2YIDA 2V4MA 4G5RA 1T0UA 2WAXA 3HDTA 4AJNA 4Y2XA 1Z88A 3ZNBA 1DC7A 2VI5A 1ORWA 1T8TA 1P0IA 3JAWA 3LL4A 4J5FA 2Q4BA 1FIUA 1AF4A 5D7BA 4AJHA 3RRFA 4DJFC 3Q72A 1VOTA 5JRZA 4HRVA 4TM7A 1RWPA 2PTGA 5B57C 1VKJA 2II6A 3THRA 3VKGA 4PSCA 5EL0A 1YS6A 1APBA 4ED9A 3MPUA 5ENVA 1H2HA 5AVKA 2XA9A 3VZRA 1GFIA 4KHZA 1SXJE 2G5TA 2C3YA 4K2HA 4TT3A 4YRCA 3KZMA 4CHGA 1WV1A 2HPHA 3A6FA 4XIFA 2UYQA 1XK6A 5PNTA 2YY6A 3B3FA 3B9PA 3NTQA 1TT5B 4LRYA 4RK6A 4YAFA 5DEOA 4XIYA 4C76A 5B30A 5HIQA 3N05A 3QY0A 3NOXA 4HYQA 5BNFA 2CBGA 1Y1KE 5K3OA 1JHPA 1E89A 5IX8A 1KIAA 3CHYA 4EO4A 2P75A 1UMCB 3LY5A 3QA3E 4PNPA 3T0GA 1ZNBA 4WK2B 3A7DA 3NAGA 3SF0A 2XUPA 3NVMB 4EG8A 1PDVA 1XR3A 2I55A 4AKGA 3ITDA 5FB3A 1U11A 2XV1A 3AZQA 3ZV3A 3WRWA 2FP4B 2FSFA 1FQJA 2F59A 1H1DA 4HGYA 1Y3IA 1IBKB 3I9JA 1CZKA 1DI0A 3ZK8A 1MHPA 4YA6A 1R88A 3UOGA 4B1FA 4F12A 5K6AA 1GGKA 1ML4A 1NNLA 5KZMB 1P29A 2R47A 2ZVPX 2OYRA 5B55A 4LZPA 1EZZA 1Z4KA 3IV9A 3H8JA 3DKVA 1QF7A 2I65A 4N5MA 2H5EA 4R9NA 3TR0A 4ENWA 1W76A 4WGGA 5C2JB 1GZVA 1JXMA 1LXCA 5KAMA 4DUGD 3KTDA 2NUTB 3P9CA 1UAGA 3A6DA 4I55F 4IYJA 4AF8A 4Q9NA 1K7XB 2LCQA 4DJAA 3RT9A 2NP7A 1U8EA 2I5PO 1K88A 3L0PA 4NJMB 4XSVA 4RM3A 5KJEA 3W34A 1PJAA 2CBNA 1JWLA 2GD6A 2ZRGA 1IN5A 5AR1A 2WSSA 5ICCA 1PKXA 1F2VA 2CXTA 2ZQZA 5EXPA 4F9TA 1B23P 4PC1A 3P32A 5I9TA 5LYYA 1DEXA 3VU9A 3UXEA 3RS2A 4MW6A 3B85A 4BVBA 3RUFA 3H2KA 1PQUA 1K7SN 1PR2A 3KSDO 4Y6QA 2D2FA 5BOVA 3MSCA 3HKEB 2BGUA 2RGUA 4NJOA 3V2HA 1DELA 1JIQA 3MGBA 4I5DA 5I7SA 4NJMA 2R8PA 4IKEA 5A4KA 4FFNA 5IDQA 5G4KB 2GZSA 5BSEA 5TB5A 2Z8YM 4OLAA 1IK4A 2XF8A 4G2NA 1Z5WA 3VPDA 3V32A 4F6LA 2IS1A 1WXXA 3W06A 3OUZA 1UT5A 1WUKS 1E9AA 1P2FA 1NJSA 1VIVA 2FSGA 3HY3A 3NTUA 2BC2A 2RGDA 3KOZA 4EB0A 4EG6A 5DX0A 3Q3JB 3ZI0A 4RJ2A 2HA6A 4E1VA 3PNVA 1WDWB 5DM70 1XV5A 3B7WA 4K28A 1KPHA 3BQNB 4MWEA 2ANBA 3RAGA 3O84A 3PJEA 4A2QA 1HRDA 2J48A 5DLDA 5J9FA 2A58A 1XMOB 3LUHA 5HE8A 1TF2A 4G63A 1OROA 2GJ9A 2Y76A 3EIEA 4P1ZA 4EG4A 3IIEA 1JALA 1OW3B 1L1RA 2WWTA 2E9SA 4HNAB 4URZR 5JR3A 1EVYA 3X2ZA 1EA7A 1C4WA 2G36A 3I8XA 2R11A 2B37A 3OKAA 4QJBA 2NXNA 2H65A 5IJWA 5CXUA 1SZCA 3U39A 1IHUA 3JQRA 1NQVA 2X4GA 4CKCA 3EGOA 2VLIA 2XXAB 3DM9B 1XI2A 3H75A 4OFZA 2CXOA 2Q6TA 3OMWA 3X1KA 2Z5VA 1GPMA 1L7MA 1OXUA 2XNKA 4AM8A 4D9CA 3QVJA 5ESXA 3FYTA 3AJ3A 3KNRA 2Q7XA 5EHTA 5HIOA 5IJAA 2V4UA 5EWJB 1UBJS 5A4MS 4HEHA 1DQPA 2GEBA 5H81A 4DA9A 4PRYA 4BEWA 4JUCA 2JCYA 4GKVA 2XKJE 4TN1A 5CU7A 2AKEA 4EVIA 1E2HA 5AKHA 4ARAA 1F2TB 1TL7C 3CRNA 1CEYA 1RJ9B 3EBPA 4E5SA 3OE1A 2XMGA 1Z2OX 3K0FA 5DN6D 4KBGA 2OE2A 1V11A 2BM0A 4ZFNA 1AV7A 5A1TA 3PJRA 2B5VA 2VPTA 1NONA 3WLEA 3UH0A 4BJ1A 2Z8YA 2GCEA 4U4AA 2ATXA 3QLTA 3J7TA 5EV8A 4J3FA 2IYXA 3TLBA 4QDUA 1FLNA 5K3AA 1FYFA 4J0GA 1XRRA 2C8VA 2GCOB 2WFLB 5G0WA 5J2TA 2GK6A 5EHQA 1U5AA 2G6TA 3L5KA 2A5LA 3SXJA 2RG7A 1NN0A 1Y1SA 2CLSA 1LWOA 1JPNA 2P4QA 2ZI9A 1YBAA 2CF6A 4H7IA 4O1MA 4BO4A 2RHCA 4RJTA 4WCFC 2IHVA 4G2TA 5CYGA 3IYLW 2EBFX 2NW6A 2NU7A 4TZ6A 2NXCA 1OYOA 1GZHB 1L5RA 1RCUA 3HEMA 4OJYA 1RC8A 3J81A 4JP8A 3EXHC 2OOKA 2P77A 1RRGA 3F74A 1P3DA 3FE2A 4FI3C 4NG5A 4PGAA 1XZFA 1Q6ZA 2AW5A 4NK5A 4QRHA 4DAEA 3M9LA 3TCXB 1N32B 3P0RA 2OZLA 5HXAA 1Y8RA 2LD4A 3Q8LA 4RSRA 1L5GB 5LQMA 3DLHA 2WZDA 3RJMA 3GFSA 2DLDA 5TT1A 2VC2B 3DOIA 1YQTA 5FFFA 1VGNA 3HSKA 2FN4A 2BFFB 1QBGA 5DM4A 4KQ2A 5K2MA 4MR9B 3DMFA 4LYHA 4Z9YA 4KZKA 5CB4B 5JNTA 3KUDA 1NM5A 3OU7A 3OEHD 1FU8A 3LCVB 4FU0A 1W93A 3FRIA 4TWBA 4W1SA 1BVTA 2DPHA 5B2FA 1XZLA 3DKRA 4A5OA 3AG6A 5HIKA 1WVIA 3DBIA 1IBMB 4G1MB 1Y3AA 2ACKA 1EUCB 2QIOA 3PGVA 3FZGA 1PAUA 1VSBA 4IW3B 1ZK4A 4OG2A 4R8MA 5DX1A 4JA0A 4MGKR 3EDYA 3TAUA 4MKIA 3WBFA 1FXUA 3IMGA 3A9WA 2CHQA 2Q3FA 1PV4A 1JQKA 3IUPA 2JK0A 1Z6TA 4CIAA 4D0RA 2VF2A 3IP1A 4EHHA 3BV6A 1HMYA 3D3QA 4UMDA 2W98A 3RS7A 2XH8A 3VQTA 1M5UA 2ZRAA 4KO2S 3VAYA 4MPPA 1QO7A 3U16A 1NJ6A 4UXHA 4V0OA 2E2WA 3OPYA 3V97A 2QTAA 3HGQA 3A9VA 4Z51A 1V7PC 3AT1A 5J47A 3Q9SA 3DYIA 1QG0A 1UMCA 3JALA 1JYSA 3PUZA 3BL5A 4QDXA 4TZTA 4E09A 5ACTA 1HL7A 2QJFA 1C4OA 4RFVA 2BDUA 5EHGA 1KR5A 3LVFO 3REFA 4BTLA 3NTVA 2XBLA 1WAMA 1E9CA 1ZBDA 2BJHA 4KODA 4OXYA 4M9ZA 4WTOA 4ZQBA 3U4QB 2RHMA 3GRRA 2DWOA 1YI1A 4TXJA 3ESZA 3STYA 2LCFA 5A62A 2B1RA 1LSSA 1U2PA 3S7ZA 5AVSA 1P74A 3L0IB 3JYHA 3HM9A 2Q6KA 2ZIAA 3CMMA 2OCAA 3LQKA 3D64A 3R6LA 3UBMA 3ZJTA 1I3MA 5E9AA 1U81A 1NNEA 4HJRA 1I0IA 3QWBA 3PNMA 4G5YA 3PQ4A 1A9PA 2MSNA 1P1HA 1Q0RA 3EFHA 1THMA 2ZRBA 3GJQA 4Z4EA 3BHMA 3HJGA 1LLUA 1DX9A 1TEXA 1N9GB 1Z39A 3HFJA 1O54A 3O38A 4CNQA 2Z9CA 5CXQA 5HVNA 1N33B 4C1FA 4LZNA 3NR2A 3TQFA 2EZ8A 3ML1A 4D44A 1E1RA 1LS1A 4OHVA 3W1WA 4L3VA 1QUEA 2QP4A 4PBTA 4UCXA 3K71B 1TK3A 4LFCB 4G1CA 3U6KA 3EXIB 3ZVMA 2VHJA 1M34A 2UZ1B 1HF3A 1R8QA 3DNPA 3SHTA 5ESRA 3C7AA 3OA0A 4BMNA 3KWLA 1XD2B 4BBJA 1AUPA 2K2WA 3R23A 4HLDA 2H4WA 3JYQA 1SHTX 1U4OA 5CT8A 3VNQA 1XTOA 1OI4A 1TADA 3P7MA 1XJ0A 4URYR 1HG0A 2YY5A 4PN3A 5FKJA 4UNIA 3RHSA 3X1ZA 3L18A 1H93A 3CBQA 3BFXA 4KJXA 4XWAA 3UHAA 2AKYA 3AOEC 2EZTA 3HYTA 1BE1A 4OXQA 3N58A 4IV5A 3WJ2A 1EK6A 3MERA 5IVPA 5BMVF 2WIDA 4CKYA 1H4QA 1J22A 2IVFA 1E1CA 4TVKA 4XVCA 3H7AA 4EI2A 1QVWA 3U3OA 5F52A 2OCDA 1FOEB 1JMYA 1NP6A 2GBGA 1Z0IA 3PFGA 2FP4A 1KVUA 3VR4A 1B2LA 1FTYA 3MF4A 2ZYDA 3P94A 4IXDA 4X6UA 1LBSA 2IXTA 2Z5FA 3LOQA 3JQBC 3VM6A 1GTSA 4AP6A 1LVHA 2IVZA 3BJIC 4CJXA 3MT7A 5CCEA 5JTUA 1UJBA 2P2YA 2YJGA 5T6MA 1I5RA 5BRNA 4D3ZA 4HDSB 4ESOA 4YMTA 1OBHA 3CURA 4LWOA 4B3FX 3PQ2A 2XSZD 5DX8A 1ZD4A 5AO9A 3H5RA 4PEVA 3HBNA 3GXOA 1M1ZA 4JFRA 1B26A 2IEBA 4IVPA 5ACPA 2GASA 2A0WA 2I4OA 2XUJA 2ZI5A 5LB4A 2AR9A 2H0QA 4F72A 4PNEA 5JO0A 4FSXA 1M7HA 5JW6A 5KPDA 4M9CA 4QPCA 3TBHA 2NM0A 3FRHA 2HAEA 1N6LA 1ZOPA 3KKEA 1LFAA 3LCRA 1NGSA 4RSGA 4FHZA 5ALLA 5JCZA 4BVAA 2BBWA 5JVDF 3ND6A 2Z9BA 4R31A 1L6RA 1E3WB 2V8BA 2VWGA 2RGAA 2Y1GA 3CUKA 2FUG1 2OESA 3ZU6A 2H3EA 2Y9MB 1FFHA 5GMOA 1XM8A 4JK3A 1ZJWA 2GAIA 2M2IA 2O14A 4QYXA 1Y1QA 4OIFA 1QGYA 2ZE7A 4NZMA 1KOLA 3SYKA 1LWNA 2JLYA 2R87A 4DRXB 3C15C 2VK8A 5B58C 2CFRA 2UYYA 5ED4A 4WLNA 1PJ8A 1AB5A 3DNMA 4YS6A 1L5MA 2GKGA 5BP7A 3I15A 3PHGA 2YNVA 4BU0A 1NQAO 2V6IA 4IO1A 4EYBA 3ND9A 5JDCA 3W3AA 3QPBA 5ADHA 3FIUA 3BFJA 3TOXA 5ALHA 5JD5A 3PUWA 4KDCA 3AYXB 1U0SY 3B52X 4R01A 2XIQA 3VFDA 2FPKA 3EK2A 4QXRA 3W9SA 4LXHA 1IONA 1FNDA 1M66A 3BM5A 5JD6A 2D0IA 2YTZA 1ATZA 5EVJA 4ME6A 3EVDA 5IKOA 1PBNA 4D3FA 1MJFA 5GPBA 1RXSA 5HGJA 2J6CA 1A9SA 4AECA 4RJIA 5MFPA 3L0ZA 2VP4A 2XXAA 3OIDA 3RJZA 4ZKDA 2QX4A 4AUEA 1TB4A 3DHYA 3N2KB 3UGTA 1KO4A 2OBYA 4IWNA 3BKXA 4BQNA 4YVFA 2RHWA 3C41J 3TGWA 3MAGA 1QK5A 4OGFA 5CJ2A 3ANLA 2O7RA 3OO1A 1II8A 4OQPA 2QXYA 3FPKA 4URUR 4CXMA 4X60A 1SOVA 2VRBA 2WG0A 4OLJA 3VVLA 2ADOA 1U65A 4F8YA 2EKLA 2I2WA 2FMHA 3GARA 3P0HA 1KKUA 4P4GA 4OQ4A 4PS1A 2A9PA 1TKBA 4R84A 4E22A 3FMOB 3U0BA 1SURA