5A16A

Crystal structure of fab4201 raised against human erythrocyte anion exchanger 1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
226
structure length
226
Chain Sequence
EVKLQESGPGKLQPSQTLSLTCSFSGFSLTTSGIGVGWIRQPSGKGLEWLAHIWWSASKYYNTALKSRLTISKDTSNNQVFLKIASVDTADTATYYCARAYYGNYGGYYFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB4201 HEAVY CHAIN
publication title Crystal Structure of the Anion Exchanger Domain of Human Erythrocyte Band 3
pubmed doi rcsb
molecule tags Immune system
total genus 41
structure length 226
sequence length 226
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2015-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5a16A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5a16A01
5GGVH 4NUGL 4GAFB 2XY2A 1NJ9A 3MMEA 2F8XC 4X0KA 4RIRA 2YPKB 2ICEA 1YJDC 4Y2OA 2G2RB 3OAYH 1IBGH 4IHOB 5HDQH 5IVZB 5L88L 1LP9F 2XXCB 3A0OA 3MLVL 2IGFH 2W0LA 4PS4H 1QBLL 4G9FD 1RZ7H 1JE6A 1KG0A 4E41A 1XF5B 2GJZA 1VEMA 2Z4QA 3UTOA 2ZPKH 4YBQD 1E27B 4GBXA 3LQAL 1FAKT 4K94L 3S36H 4CJ0A 3BDYL 5IVXF 4KY1L 1H3UA 5F7EL 1EPFA 1HQRA 3PNWA 4JPKL 3EAKA 4NUGH 2VNCA 4LLWB 1U8JA 4R3SA 1HYSD 4NQEE 2YUXA 1R5VB 3LRSA 1U8MB 1C16A 1TETL 4NC1C 5L88H 2BC4A 3H3PH 5CGTA 3MLVH 1HXMB 1DN2A 1QBLH 1KPVA 2LVEA 3G04B 4YXHL 3F7YA 3LQZB 3TA3D 5E4EB 3BEVA 5ESAB 3MCKA 4WUUB 3HG1B 4U6HA 2VTFA 3NPSB 4K94H 4FQPA 2P5ED 3VXSA 4Q97A 1W0VB 3UZVB 3QFJD 1A7RL 1L7IL 4KY1H 3PABB 1MFEL 1MY5A 5F7EH 3PHQA 2G5RA 3MJ9L 4JPKH 2C7UA 3ARED 2NW3B 3QO0A 5K9OA 1AD0B 3ARFC 4Y7MA 5DUBA 5ID0A 3FT3B 5JQ6H 4AL8L 1TETH 1A7BA 3P9LB 3MV9B 1DUZB 5A1AA 4YXHH 4PV9B 5TPWL 1QFWI 3AM8C 2FX9H 4QNPF 1DSFL 4KRPD 4HIHA 4HGMA 1A1MA 1FO0B 5JW4R 4UU9B 2KDGA 1OM3L 1YNTB 1MFEH 3EGSA 4MNHB 1ZHLB 3KDMB 3KYMA 3EFFB 5DK0A 2J5LB 3OG4B 5ALBL 4AL8H 4KK8C 4MCYB 2NY0D 3DROB 1FNLA 5HYSG 5GGVY 5KG9B 3VWKC 1A5FL 1EZVY 3FZUC 2NW2A 5J1AA 2Q6WA 5ADOL 1FP5A 1CFNA 1XGTB 2R15A 3CVHA 2OTWA 4XP1L 1DSFH 2DYPB 3KYAA 3MV7B 3TFKD 2E6PA 4Y19D 1MIEL 3TA3A 4EUPB 3CH1A 5H37H 5DRWB 3IDMB 5DMYA 3T3MF 4OFDA 5SWSE 3L3IA 4MCZB 3TPUA 2JKXA 4GXUM 3SDXB 3VW3H 5E2JA 5IJVB 3QDMB 4U1KA 3QFJA 2DQHL 3GEWB 5SX5K 4L8SC 5ALBH 4BSWA 2DMBA 3C9NA 3AREA 1JV5A 4RA0C 3QQ9C 3G5YB 4S1DC 5JO5A 4HPYH 2RIKA 4OFKA 4YZFE 3KPPB 1QYGL 3QCTL 4JFHD 3KYOB 5TE6L 1OVZA 4POYA 3BPNB 1DCLA 4Z77A 3K8MA 1VEOA 2X4PA 4KRMB 4YIQA 1MIEH 3MC0A 4LSVL 4LLVB 3T0AA 2FO1A 5KVDL 1FORH 1A6WL 2B4CC 2B5IB 4IMKC 4U1HA 3S97C 5CZKA 3IDUA 4UDUB 1XGUB 1MFDL 1T21B 2DQHH 3UTSB 2F74B 1I8KB 4RDQF 4YUEL 3E3QC 5EZJA 3T8XA 4F7PB 2I5YL 4MNGB 3QCUL 1QYGH 43C9A 4Y8DC 4XC3L 3QCTH 5TE6H 5DA0B 1RHFA 1OL0A 2EH8L 4J4PC 1HHIA 1K8IA 3BISA 2X4SB 5KVDH 3UO1H 4Z7WF 4CVZA 4Z7QF 1AP2A 3HE6B 5DQDL 1I1AC 3MRLB 2CDGB 4G6JL 5JNYA 3WHE1 4IOSD 3OXRB 3ARBD 1FFNB 2I5YH 4RAVA 3PV6A 3KS0H 2ARJQ 3QCUH 4GQPH 5D1QD 2W65A 2AW2A 4YHOL 3MUY1 4XC3H 5I71B 3SGEI 2HT4C 2CXKA 1PZ5B 2EH8H 3OGOE 5IQ9A 4JFEB 5GRVK 2DQGH 5D6CA 1FVCB 2AK4E 3O11A 5C7XL 2VJXA 2EE9A 2IPUG 5HVGB 4FG6D 4J1UB 4QTHB 4FHBD 1T3FA 4GRLA 5DQDH 1U91A 5I8CA 5CBEB 4G6JH 5DGRA 5CHNA 3FQTA 1NGYB 4YNYA 3C5SA 1KC5L 4GKNB 5EU3B 5DD5L 1ZS8A 3GFUA 2YXFA 1N59B 3B2VL 3UZQA 4EBQL 3VFPA 3W9EB 3BZ4A 1KLUA 4P2RE 1XR9A 5E8OB 1KIUA 5EUKA 4F2MA 1A4JA 3OTTA 3OKYA 3CK0H 3MJ9A 4YHOH 4UI2A 4PR5A 5IBUG 4JHWL 4HK3J 1I1YA 4LKCB 5JA8B 4PJDA 3VCLA 4PJEB 2L7JA 5C7XH 2PTTB 1OQOA 4PJBF 3UZEA 3TGXA 4MB3A 5D7SH 3AS3A 1IAKB 1MCSA 1JGEB 2D4FA 1A1NA 1AI1L 3FQXA 5DD5H 2FX7L 5T1MB 2CGRL 3ZKXB 3B2VH 1NEZG 3RDTC 1ZT4A 1HWGB 1ND0B 2DQFB 4ZNEE 4G8IA 3ARBA 1SJXA 3VD9A 2WP3O 1VFMA 4PJIB 3TN0D 5JW4N 4GW1A 1U3HC 1WZLA 4I3RH 2WM0A 5I1AA 3ILQC 4HWUA 1A4KA 4JHWH 5D1QA 1DBAL 4NOBA 2EDDA 3ARQA 4LRIC 2DQCL 4X8XA 4J6RL 5C2UB 2UZXB 2QQKL 1V8HA 2EE2A 3X3FL 3MODL 3H9ZA 1D5IL 3S8WA 4PJXE 1AI1H 3EYSL 4NKMB 4PJDF 2FX7H 3IDNA 3AY4C 2LFGA 1VPOL 2ADIB 4DUXA 1OGTA 5DS8B 3BMVA 1VFAB 3DETC 3FRUA 3IF1A 4PV8B 1VACA 3MRFB 3DMMB 3K1DA 1C5CH 2OR9L 2CDEB 2W0FA 1DBAH 3U82B 1C08A 3V6OE 3D39D 1U8QA 5HYEA 5I8KL 3BO8B 2DQCH 2Z8SA 4I77H 4J6RH 1NMCB 3PWPB 3RVVD 4CU7A 1FG2A 4LRNL 2QQKH 3LKSA 4CNIB 4Z76A 1N0LA 4GKSB 2BY3A 3MODH 3SJVD 4F15C 2G5BB 1D5IH 1SY6A 4Y5VC 4QHMB 3EYSH 4XCCH 4BELD 1VPOH 4L3CA 3V5HB 3KPLA 4WU7B 2AJVL 3MJGX 2FZ3A 1WAAE 4LLQB 4LPVA 4PGBB 4KI5D 3QDGE 3L7EB 2OR9H 2Q7YB 4ELMF 2ICES 3BP6B 3T0EE 3TH3T 1EEYA 2XZAL 3RVWD 4MXWL 3QUYD 4X83A 5ID1A 5C0BE 4RRPA 3HC0B 5KVGL 1LHZA 5D2LF 3L5JA 1VKXA 4F9PC 4EN3C 3G5XB 4PRNA 3UYOD 2F53B 1BFTA 2BHZA 5DEGB 3DTXB 5IMKA 4Y5XB 4HX1B 3VXTA 5IWLC 5E9DA 5CIPH 3N1QC 2D9CA 4JY4B 1A7NL 4PJCA 4PJ7B 3U7WL 1CL7L 2FB4L 4TUOA 3TIEB 4IOFC 4ZS6C 4M7JL 1I1CA 2PTVA 3MRQA 2OQJA 2XZAH 4MXWH 2WNGA 5IBLD 4IRJA 4LIQE 2O5YL 2ZUUA 1QFHA 5KVGH 1LDSA 1P4BL 4JFXB 3LPGA 4ZUWB 3D39A 3OJDA 2JIXD 3PXJA 5H2BB 1N3NA 3QI9C 2NZIA 3V5DA 4KKCC 2X41A 1HE7A 3OGCA 5GGRY 5KJRL 2LTQC 1P7KB 3SJVA 5D7KD 4G8GD 1N64H 1WBZA 3U0PA 4ELKA 4Z9KB 2YUWA 1AJ7L 2ARJB 3U7WH 2GKIA 2P45B 2FB4H 3GGWB 1CLOL 4M7JH 1FVDA 2MKWA 2X05A 5FYJD 3AB0B 3O3EB 1T6VN 2W92A 4OLZL 4HKJA 4LVNB 2O5YH 1XIWB 3MUZ1 4U1NA 1P4BH 1GOGA 4NO2B 1HK6A 1NAKL 3DVGA 3QUYA 5DJ0A 5C8JB 3VDBA 5HHQB 4ODBD 1KGCE 5CP3A 5CJ8A 1SBBA 5KJRH 3O3BA 5J3HD 1TQCB 3BPCB 1B0GB 3SE8H 1T03L 3NIFE 2BVYA 4GUPB 5DHYB 1AJ7H 4JDTL 3W5MA 4OQTA 4MAYB 2F19H 4WW2C 1CLOH 1PLGL 1QUNA 3MLUL 3QUMA 1V7ML 5HHVL 1CZ8L 4OI7A 3KPQB 4U7MA 4HZLA 4JQIL 4OLZH 5DYOB 3MBEB 1G1YA 2PETA 4JFFB 4UTAL 2CO7B 3GJFA 4JFDB 4Q6IC 4CMMA 3VFOB 2FJFB 4OV5B 3RZCB 1S7XB 3VXPA 2JIXA 4GG8B 3ORJA 5B4MD 1T03H 4NQCA 2CXGA 3EFDL 3TBSB 1FC1A 2HRPL 5MI0B 5CCKL 4JY6B 4KK5C 5DFWH 1V7MH 5HHVH 4E5XB 3P9WB 4OD1L 4JQIH 3LKRA 5E2VL 4I4WB 4UTAH 3PE9A 4X5LA 5DDHB 1EV2E 5K33A 1UKQA 2ESVA 4WGWB 1CGTA 1IEAB 5I2IA 1HKLL 2APBA 2GJJA 4GRMA 1EFXD 4HFUL 3HI1B 3C5JB 3S34H 5D1XB 5CD5C 5A2IH 4PY8I 5IB1A 1FLTX 3EFDH 3MV9E 3TO4C 4X4ME 2HRPH 1EHAA 3P4OB 1DBJL 4ZQKB 1T66C 5CCKH 1INEL 3MRMA 4N0YH 3TZVD 1UACL 1LNUB 2FDBP 3F7VA 3UTTE 5H35A 4G6KL 4MAUH 1CXKA 1T4KA 5E2VH 3EO9L 4P49A 4CL7A 1X6LA 3JWDL 1KCKA 2QJDA 1HKLH 4O51A 5FUOL 2EDEA 4I0PB 1OT2A 5DJZB 4HFUH 5IESL 5D7IF 3VXRB 1G9MC 3ARGD 4N1EA 2PYEA 1H5BB 4DVRL 3AXLB 3C6SB 4NKDA 5C2BL 4QTIH 4G8FB 1F3DH 3HCVB 1J0HA 2FJHA 5BRZD 1INEH 2H2PD 2RAMA 1NBZB 1UACH 3FCTB 4R8WL 1T83C 3U9PL 5LCVL 4G6KH 2NR6D 3ZDXE 3P73A 4YBLB 1QKZL 2XWBA 3JWDH 3NIDE 2X4TA 5GS0C 4EI5D 5FUOH 1YNKL 3T77B 1RJZA 5FB8A 5IESH 5F1SA 1CWVA 5E99L 2DD8H 3GKWL 2DRUA 4QOKE 3CCHB 1WFTA 4WI9A 4NNPL 3T08A 1QBBA 5C2BH 5E8EB 4J3TA 2DJSA 5FO9A 5T3ZL 4KJYB 5JW5A 3VGFA 4R8WH 1N2RA 1QEWB 1XGQB 3O4LE 5D71L 3U9PH 4P4KB 1H15B 5LCVH 5IG7B 5C9JA 4POZD 4P5TD 1QKZH 2BSSA 4PLOB 5EPMB 1CGYA 5F1NB 3C87A 1X5XA 2JB6B 1QO3B 1M7DA 1YNKH 4M43L 1V3KA 3MV8A 5E00B 5E99H 3GKWH 2PCPB 1FV1A 3P3YA 3B5TA 4MNGE 1V05A 4NNPH 3ULUL 3A6BL 1HXYA 5ACZB 3U4EB 4ZYKB 1F3DJ 1IGCL 2XG4A 1U3ZA 5D5MA 2UWEB 1RY7B 5BRZA 3MX0A 1JPTL 3VGAC 3GSXB 5BQ7A 2WANA 2AI0H 4LCCA 4WI2A 4XZUA 5E7BA 5A2FA 3H7BA 4PY7A 5GRXG 1FNSL 3C60B 4DUVA 5HHOB 4M43H 3FB7B 2W38A 5IM7A 4ODXA 3RJDA 3ZE1F 1FVEB 4C83A 1EUUA 3DO7B 2XPGB 1F6FB 2ZUVA 4AH2A 5DRZA 5HHME 4PBWD 5K9KA 3RWDA 3ULUH 3BZFA 2YD9A 5GRZA 1F3JB 2CIKB 2P47B 5JA9A 1MH5A 4RWHA 2OJZL 2Q87A 4QRRB 1IGCH 2NZ9C 4HXBL 4NRYA 1UQSA 1BX2B 3MRBA 2IANE 3QHFL 4EDWL 1JPTH 3DLQR 5L2KB 5F3HB 5FKAA 1NCUA 4DTGL 3A6OA 1I7RA 1NL0L 3BH8A 3K1KC 4XVUC 1FNSH 2BZDA 3D0LB 4P5TA 2FIRT 2BSRA 2GSGB 3BUTA 2QADD 1KJMA 2R0LH 3RL2B 2HN7A 2B2XL 2XNAA 1WTGT 3T1FA 2NY1C 1I9JH 1G6RA 1W0WA 3KWWA 3MRHA 5D96C 4F7TA 4NCC1 2OJZH 3PQYB 2Y25A 4R97C 4OCNC 4PJEE 5FCSH 4HWZB 2IPKB 3QHFH 2DI9A 5H94A 1KXTB 5CD3B 3B4NA 3WN5B 3Q5TA 1NL0H 4X9IA 5A40E 1FE8L 1U0QA 3VRJB 1UCTA 2B8OT 1LP9B 3ZDYE 3VRLF 3K3QA 4LVHB 3QG6A 4HS8L 4OZFA 4F33A 1MJUL 1QRND 4N9GA 2B2XH 1EBAA 3G08A 4X6EB 4N8VB 2DIAA 1PX4A 1RUML 1ZWIB 1P4LB 5I75C 1JF5A 1BM3L 1T5XA 1MCIA 4Z95H 1J5OL 4QT5B 3MGTB 1MLCB 1HHGB 1T0MA 4LBEA 1W72L 4FXKA 2VDMH 4NPYA 5IVXB 2X5PA 4APQD 4OD2A 4LPXA 1INQA 5A3ID 1AKJD 2W9DL 3DYOA 4NGHH 3O0RL 2OI9B 5IVNA 5CSGA 1FE8H 2P7TA 4PP1C 32C2B 4WFEE 1KNOB 4Z0BL 4OF8A 2G60L 1YECL 5DFVD 1D9KB 4HS8H 1ZMYA 1MJUH 2APVA 2K7PA 1CT8B 2DIJA 2DQEL 4OQ1A 1AO7B 1KCSL 3GSNL 1RUMH 4QRPB 3DX6A 1BM3H 3MRGB 3GO1L 4YDVA 3I6LD 3ALPA 1JPGB 5CAYB 4KROC 4KUCF 5CZVL 1J5OH 3HAEG 4P2YA 5IHZB 2HKFL 4CBPA 2UVEA 5T1KD 1W72H 2JE8A 4M6ML 4XI5D 4QYOB 2HTKC 4Y88A 4Y1AB 1KG0B 5IW1A 5DVNA 1ZGLA 3IETB 5E2TL 2W9DH 2WIMA 2Z4QB 3PWPE 4H26B 4P5MB 4JDVA 3LVEA 3O0RH 1HILB 3O6ML 3GMLA 2LABA 4CADA 3C09B 2G60H 5I9QC 3ZMRA 1HQRB 3B8SA 4IRSB 1K3ZA 2DQEH 4HBQA 1KCSH 2UUDK 3GJFK 4PGCA 2NY6C 3GO1H 5DURB 2EDTA 5CZVH 4H0HB 3RWHA 4GMSL 4BFGA 1RD6A 1CGXA 4X98A 1NAMB 5E2TH 4KJWC 3MCKB 1VCAA 3CU7A 3W0WD 1SJEB 3O6MH 4NCDA 2EDKA 3WKMH 2OP4H 4F3FB 1CD0A 1F3RB 2B1AL 5INDA 1NBYB 4HIJB 1IM3B 1EO5A 3SKOA 4JRYA 4KVCH 1WWCA 3D1MC 2FYYA 2QHLA 1B2WL 5AWNH 3MNZB 4GMSH 2AKRA 1A7PH 2V9QA 4LASL 4ZUTB 4FQQA 3HMWL 3ARFD 1IGFL 5T1DH 4KZDL 2X7LA 1MNUH 3HUJA 3SO5A 3CDYA 5T1KA 1N8ZB 4WWKC 1TMCB 1GC1L 1A1MB 2VQ1A 1E4JA 2IH3B 4LK4A 5DVOA 2P48B 3QZWA 3TBVB 1E4KA 4YLQT 3GBLA 1G9NC 3TBYB 2GK0B 2X40A 2A0LC 2P43B 4HUUA 3ULUF 3PHOA 3JV4A 3CDFA 2O61B 4V1DB 1B2WH 3PP3K 4LPYA 5FUCE 2FATH 2E8ZA 5HTSA 4LASH 3VD4A 1VGKA 2ZNWA 3HMWH 4UTBL 1CFNB 1P6AB 4KK8D 2OTWB 1HHKA 5B21A 3K2MC 4HV8B 1GC1H 3ULSB 2H9GA 1CGUA 1S3KH 1X6NA 3KHQA 3RWFA 3VWKD 3FZUD 4D9QD 2ZSVB 4MJ5B 3UEZA 5GS1B 3W0WA 3TC9A 4U1GC 3MA7B 3VFMA 4OF6A 3CXDH 4GW4A 5MEPA 2H26A 2HJLA 3M1BA 4M3KB 5CUSL 3HPLA 4PRPB 1SBSL 4G42B 2CSPA 3MZTA 1F11B 4M8QA 4D9RD 1YZZA 5JMOC 3EO0B 1VESA 4ZPVB 1G7PB 1QFUL 4Z7WB 4LSPL 4C56B 1JGUL 5E08H 3OKDB 4BZ1L 5EULV 4UTBH 2H32H 1JZ4A 3ULVL 2WW8A 3W11C 4JFDE 4JHZA 2VLJE 4JKWA 4XCNA 4LOUC 8CGTA 1R5WB 5F21B 4MMXC 2DKUA 1MCFA 4YPGA 2D4DA 2D7NA 5DWUL 5JIHA 2HMIC 2DTML 3RVUC 5DVMA 2G75B 4RISH 5CUSH 2OZ4A 1SBSH 3TJEH 2VL4A 4FA8A 3ISWA 3IDJB 5L8JB 1ZHBB 4LSPH 3K4DA 5J12B 2LQRA 5HJ3B 2ED8A 3MRKA 4BZ1H 2I9LB 3ROLA 2DWEB 3GSNA 1K5NB 4ZSOE 1MREH 1H9VA 3ULVH 3V6OC 1UWEH 4YHML 4JJ5A 3GRWA 3G5ZA 2GJ6B 1G7QB 4N0FA 5DWUH 4J4PD 4MXVF 1JL8A 1Q9KB 2DTMH 4LARL 5TJWK 1XT5A 3AMKA 3JVGC 4Y4HB 3S3PA 5DMGD 1F90L 5C09D 2YOCA 4L3EB 5FK9B 5IB4A 1I1AD 3PV6B 2YD6A 2F8OA 4PJBB 2W65B 4UT6L 1GGTA 1S7RB 3KNBA 3H8NA 3T0EC 3QWOB 1LEIA 4YHMH 3G6JF 3BHBA 1IE5A 4L8SA 3LPWA 1IAOB 4JRXB 2J8UE 2HT4D 3ET9F 2WBWB 4IS6A 4GRLB 2XTJE 4HK0A 5E1AA 4JQVA 4LARH 1U8IB 4O58L 1Q9OA 3T0DA 3MLRL 3QIWC 3DVNA 2BNQE 1F90H 3DV6B 4PRIB 5T3XE 1BF2A 1KYOJ 3VFPB 4WIQA 2R1XA 4S2SB 2BVQB 1U8KA 5I17B 3UPCA 4UT6H 1A4JB 2VDOL 3VD3A 3SGKA 3KPOB 4PRAA 4CRPA 1HEZB 3QNZB 4N8PA 1OD7A 4FTVD 2QSQA 4IDLA 4X6BB 4PJ5B 5E6IC 1Q0XL 2QTEA 4KVNH 5FF6B 3FO2B 4ZO7A 3MRDA 1ES0A 1KV3A 4O58H 2DM3A 2Y72A 3IFPB 4X4XB 3RQ3A 1RIHL 3MLRH 3QDJB 3GSWA 3FQXB 1EX0A 3N50A 4LVEA 4YPJA 1LE9B 4O2FB 5GGTL 3CLFL 1UM6L 4TSCL 4UDTA 1MAJA 3O8XA 3AGVA 4OZIE 4X5WA 4KK6D 3S88H 1J88A 5C09A 2VDOH 3SDCC 5EBGA 4HJGB 2J6EA 2Z9TA 1HH9B 5L8KB 1I1AA 5J0BA 3NZHL 3RDTD 4KXZI 2X4QA 4KC3B 5BW7A 4ZOCA 4WHYG 5HYSA 1MFCL 3RIAK 2RFXA 1Q0XH 4LCWD 1QSFA 4FP8L 1CDUA 3PL6B 4RA3A 3ILQD 4R2GD 3TV3L 4WI3A 3GMPA 1NGXA 1P9MC 2AJUL 2IALB 5EO0B 4PREB 3EJZC 2PF6A 1Q72L 1RIHH 1S5IH 3MCLL 1KELL 1YQ2A 1S78C 4IOIB 3CDGB 4ELMB 3VE0B 5DUPL 2F5AL 1DQTA 5D7JC 4X4YA 3CLFH 1UM6H 4TSCH 3WE6B 2X1PA 2Q86B 4UB0L 3QAZC 4P23B 4TOYL 3FFCB 5D2LB 4CU6A 5KSUB 3ARVA 3U30B 3GHEL 1BVKB 3QUZC 1R3HB 1XAUA 3NZHH 2WWKO 4BK5A 4HUVA 2W0FB 4JN1L 4X9GA 5C71A 4U0QB 1AXSA 3K46A 1MFCH 3DETD 4NJ9L 3TO2A 1U8QB 1OGAE 5TE4L 4FP8H 3AFLA 4O2EB 3UAJC 1P1ZB 3P0YL 2G9HB 3TV3H 5DJDB 4EUPG 2AJUH 4NQSA 4JFYA 3MCLH 1KELH 3RAJL 2R1YA 1HI6B 1I3GL 1UJTA 1EBPA 4I2XE 1EJOL 2F5AH 3MOBL 5F7HA 4P3DA 5I74B 4UB0H 3KPRE 4QRRE 4Z8FL 3C08L 1JWSA 2YD1A 3H0TA 4Y16D 3FB5A 2VWEE 5E4EC 4TOYH 4ORGB 3QRGL 1S9VB 3GHEH 4EDXB 1S7VB 4DGYL 1J8HE 3NPSC 4JN1H 1FZKA 1WBXB 1ZVYA 4NN5C 5ESVB 2VLRD 1T1YA 3FO1B 4NJ9H 1EHNA 4NSKB 1JF1B 5TE4H 1QLRB 3KPSD 3DRTB 2X1WL 3R8QA 1DUYA 5I6XC 3P0YH 4H25B 3IJYA 4F8QA 3REWA 1CLCA 3RAJH 4LEOB 4K3HA 1I3GH 2A6DB 3LEVL 4X8JB 2E27L 5HYJB 1EJOH 3QEQD 3WXVL 3MOBH 1ACZA 3FMGL 3WV0A 4OM1L 2YPLA 3FB6A 5E9DB 5JOFA 3C08H 1QSED 1JRHL 1UWXH 1OB1A 3PQYE 5I16A 5ADPL 2DJUA 3QRGH 3ULVF 2OSLA 5F7DA 1JMXA 4M93B 3QCVL 2BHYA 3QUXB 1L4IA 4IRJB 3NH7L 4BQ6A 1LP9E 4XH2B 4JQXC 3TJHD 4IOFD 4DVBA 1CDYA 1S5HA 4JFQB 3TYFB 4AJ0A 4ZMAT 1D5MA 5I19L 1S7TB 1H3WM 4UIKL 1UXSA 1RHHA 1TJHL 1IKFH 3LEVH 2DM2A 2E27H 2J88H 3WXVH 2VISB 4ZFOL 4OM1H 2HP4A 3G5VA 3S5LB 5DJ2A 3QI9D 2QHRL 3MLXL 4UV7H 4XCFH 4JZJC 4KKCD 4NZDA 1J0JA 1L0QA 2AVGA 1YQVH 1KB5L 4Y16A 4LNRB 4Y5VA 4QRTB 4DKFL 3BAEL 4W4OC 3QCVH 1LILA 1URLA 3NH7H 2C4FT 4U1IB 3PV7A 3HZMB 5J11C 3OAUL 2AGJL 4CN1A 2HLFC 5I19H 1A0QL 3GMQB 4UIKH 2E7CA 5EU6B 1CBVL 5GGRB 1BBJB 3CSPA 3QPQC 3LEYL 2P8PA 1PKQB 3CMGA 2DN7A 3T2OA 2VABB 2QHRH 4DZBA 3MNWA 4ZXBB 3QEQA 4GW5B 2NX5D 5E94B 4Y1AE 1ZVSA 4E41E 1NEZA 1KB5H 1QSEA 2BXZA 1J9CT 3MNVB 2I07B 4DKFH 4BM7A 3BAEH 4NQVA 5C07D 5GGTA 5BS0B 2WUCL 2ATKA 5B22A 1FL5B 3DV4B 4IMLA 1NFDA 3OAUH 2AGJH 1AQDA 2B5IC 2L0DA 5LXGL 4CMMB 2AV1B 1A0QH 3F65A 4F9LA 4PTUB 1NFIA 4LHUG 5CMAB 1CBVH 3WHE0 3LEYH 3D3VD 5F71A 2JJSC 2P42B 2BNRD 5DQJB 1U93A 4WHTB 3LN4A 4XNYH 3GSVB 3SE3C 2R4SL 1LO2L 1UB5A 1M6OB 1DVFB 1ZSDB 2OTUA 5ILTL 1ROWA 3QI9A 4QRUA 5D7IB 1OLZA 4M5YL 3DECA 5C1MB 2WUCH 4NDMA 1BZ7A 3LKRB 3VXSE 3WJJA 4BQBA 4HZAA 3MBXL 3V5KA 3O2DA 4KK5D 5ICZA 3OHXA 5LXGH 4DQOL 3RUGF 3K81A 1A9EA 5IT2L 3MJ6A 3SBWA 4WJ5A 1FZJA 5DR5L 3RU8L 4FXGA 1EVUA 4Z7UF 3GBNL 5SWQB 1KIRB 3ARSA 2GITB 5EN2B 2R4SH 1LO2H 4LCUA 3SKMB 5CD5D 5ILTH 1C8PA 4OCLC 3OKNA 1IGIL 1YEFL 2NX5A 1ZA3A 3ECBA 2Y06L 4M6OL 1LD9B 3MJ8B 5CIPB 3RPIB 1T66D 2CR3A 3MBXH 1MHCA 5BVJA 5C07A 1I75A 3T4AA 4DQOH 4NC0B 4NQDD 5IT2H 2RB8A 1AFVL 3DUSA 2QSTA 3VXMB 3EDJA 3BE1H 4FNLL 4LF3A 5DR5H 3RU8H 4DAGL 3BP5B 4ZOEA 5I1LB 3GBNH 5LAXA 1AQKH 3F12A 5J4MA 5LWYL 1MAMH 4RAHA 3KHOA 4PG2C 2AV7B 4FS0A 1MIML 4OGAD 1IGIH 1YEFH 2VN4A 4MQ7A 4M6OH 1JGLL 3P73B 3GSQB 5JZ7C 4WFFD 5BJTA 5F6IB 1UG9A 1WVZA 4DJMA 1AFVH 5DLML 3WIHL 3U9UA 1YY8A 4F7EB 5C6WH 1FSKB 2AXHA 5FB8B 2WQ8A 5JHDA 1ZK9A 3ZKXC 4KTEL 2CKBL 3WFZA 3JZ7A 4DAGH 1KFAL 4F7MA 2XA8L 3U7YL 1MI5B 4UOW0 1J05A 1BD2D 5IFJA 3DUHA 4ZFZA 4JG0L 2ZZUT 3RWCB 5HI4D 4D0CA 1MIMH 2ICWA 4FFWC 3KYKH 5HGDA 4M9OA 1JGLH 3NFPA 2WLZA 3BKCH 5F89B 1J1PL 4YE4L 3WIHH 4OGYH 1CFTB 2CMRL 4PJFB 2DLTA 3SPVA 5GZNC 4KTEH 2CKBH 1Q94A 5T33H 4DWHA 1KFAH 2UY7A 4D2NA 1F00I 3LD8C 1KCRL 2XA8H 3U7YH 3DMMC 3ES6B 4BA8A 3I6KA 1F8TL 1GGCL 2EDXA 4JG0H 3FOMA 4MMZC 2VUYA 4I18B 4WO4A 1KPRA 3I85A 3OAZH 3OJVC 1A3QA 1LVEA 1TQBB 1NMCC 4XGZB 5BQ7B 4JCMA 5JOPE 1J1PH 4XZUB 3QO1A 4BKLB 3BP7A 3REVB 4YE4H 4GKZB 1G7JB 5IMOB 4YHPB 5IM7B 2CMRH 5JXED 3W5NA 4UZGA 4GG6A 1VDGA 5FHAL 4XXDB 3LHPL 3TF7C 2V2WA 1KCRH 1X5KA 3MO1A 5HGBB 5IROC 1A7OL 1SYVA 1F8TH 1GGCH 1ORQA 4LCIL 4OBRA 3S35X 4MDJA 1JZ6A 2Y4SA 3ILPA 4NQED 5DFTA 1BD2A 1JTOA 1JPFB 4JFHE 3UTZB 2X4OA 5ALCL 5CJOL 2VR9A 4Q2ZA 3VWJC 2NZ9D 4X7FC 1X5JA 1D3CA 3H9SD 4HEME 5D8JL 3RWIA 4GQ9L 5HI5C 4HIIB 4XTRC 5FHAH 2R23B 4FQ1H 1PFCA 1LO4L 3FTGB 1OTTC 4XVUD 3N85L 5IW3A 3AC0A 3B43A 4MX7B 4PJGF 1I7ZB 1RZGA 1G84A 4LCIH 4Z7VF 2NY1D 1QACA 4PJDE 5C0AD 5KANI 4OGZA 3L3GA 1FL6A 4PJ9B 1JK8B 2WBJA 3SHSA 2VKXA 4L4TD 5CJOH 1IEBB 3W82A 1CIUA 1AR2A 3LQMA 4OFIA 4NO3B 2A73B 2V5MA 4GQ9H 4MZ3A 4TTDC 4F33B 3T2QA 1OARH 1RZKC 1TZHB 3CC5A 1CL7I 1NBQA 3KLAA 5SWZA 3N85H 5TQ2L 5IB2B 4PGEB 5JXEA 1EAPA 1X5LA 1XH3B 2AAVA 3CSYA 3EIFA 1LO0H 1B0RB 4PG9B 1MEXL 2EICA 1PY4A 3A6CH 1GIGL 2IPUK 5DJAA 3IJHB 1AGDB 2X1QA 2BNUA 3BRFA 5JORB 3VXUD 3P40A 1J0IA 4NQEA 3WFEL 2VLKB 5GSRA 1T89A 2KQNA 3PWUA 2DIBA 2DB8A 5B38G 4Q9BA 3V95A 3FT2B 3H9SA 5TQ2H 4PP1D 2E3VA 3TNMA 3BOVA 4BUGA 3VFRB 2OCFD 4KMTL 4MAYC 3FN3A 4NP4H 5DJXA 3STLA 1AHWC 4TQEL 1FH5H 1MEXH 4OKVA 3ROOA 1OSZA 1ITBB 1GIGH 3BESR 3EOBA 4JZNA 2YSSA 1JNHB 4QKXB 4XVJH 3Q1SL 5D93B 4ZG1A 1ZLWK 2CRMA 1ZGLB 3F7QA 1HQ4A 4NIKB 5FOJA 1HHJA 2VRAA 3DIFB 5C0AA 3H3KA 2HTKD 3WFEH 5B39B 4L4TA 5CSZB 1UB6A 3X13B 1FL3A 4I5BB 1BF8A 2DM4A 1DANT 3SEPA 3JUYA 1ZT7B 3HRZA 1P2CA 4UQ3B 2EC9T 2H1PL 3WUZA 4OUOA 3SO3C 2NY4D 3MXVH 3HAEH 3KLHC 4KMTH 3HNTH 3QA3A 3U0TA 1NMBL 2FGZA 4TUJB 5IIEB 4MNQB 4HUKB 4TQEH 3TP4A 3GHBH 5F9JB 4ZAKD 1I4FA 1JYWA 3Q1SH 2NY6D 1JTPA 2ZUXA 4OD3L 4P59L 2LU3A 1ZT1A 5JPMA 5GS2D 2VZSA 3BWUC 1ZHKA 2OXHA 3DVFA 3RVTC 1JHTB 1VHPA 2GW5A 4JM2F 4ZODA 2R0WL 5JDSA 4M6NL 5IBTH 3HFML 3DX7A 5D1XC 1A14L 4KKAD 3VXUA 4H8WC 4YR6A 2H1PH 1PQZA 5E9DE 4TPRH 3QWQB 4PJCE 1NMBH 5E5UB 1F97A 2X4NB 4H88L 4GRWE 2YRZA 3WUWB 3NCBB 1DQQA 4DZ8A 3NA4A 1DBKL 2FEEL 4P59H 4P57A 3OKKB 3F62A 1UKSA 2AXGB 5CWSB 2BSTB 4X9BA 1KIQA 3ARDC 3D39E 3BVNA 4OUUA 5GGSA 4I0PC 5C0EA 2F15A 4M6NH 4MA3B 3HFMH 2XTJC 4N5EC 1YA5A 2CRYA 1DBML 1DQMH 3HB3D 3MYJA 5D7LA 1H5BC 5ESQA 2P5WA 3SJVE 3HE7A 3TWCL 1IEHA 3JV4B 4RMSA 1A6ZB 5HPMA 4H88H 3RIFF 3DNKA 1NFKA 1MJJA 3DXAB 2A0LD 5LBSL 4EJ1C 4OCMC 3L5IA 3I75B 1DBKH 2NY3B 5AD0A 4KI5E 3HC3L 2E9JA 4ZAKA 1F4YL 4AENA 5FXCH 3V7AG 4Y0GA 3W2DL 3BZEB 5JIIA 2HTLD 1MCWW 4PTTA 5FYKU 2CLRA 5EFIA 5IMLB 4P46B 1WCBB 3VFUB 5F44A 3TWCH 4ODUA 1QFWL 4K3JL 4JDZA 3DX8A 2MQ3A 4RMRA 3OKMA 4JY5L 5EU4A 1VB9A 2LVCA 3DURB 3JV5A 4YAQA 3FONA 5BXFA 3HC3H 1NGPL 4ZUVB 1IL1A 4R6UA 1D6EA 3ETBF 4WV1A 5J6HB 1FJ1B 3W2DH 5IB3B 4OSUH 1RUAH 4PLJC 5INCA 1W72B 4KKNA 1A47A 2NXYB 5ABDE 4QXTB 4LOUD 3HR5A 5CJQL 4NQCE 2ORBH 5IMMB 1QA9A 3FJTA 4K3JH 3G6JB 4N8VG 1G7LA 5IEKA 5D7KE 4NNXB 4GSDL 5F1IB 3D0VA 2HMID 4JY5H 2D2OA 4J3VA 4ONFL 1BQHG 3RVUD 4F58L 3CH8A 1NCBL 1QVOA 1VENA 4JKMA 1NGPH 3T65B 3IVKA 4MD4A 3IKCB 2ESVE 4N90E 2VDNH 5FYJE 1LK2B 1P4IL 4JJ5B 1T1ZB 2QLVB 1KPUA 1ZGLP 1YJDL 2J7LA 2NY2C 4QO1A 5A2KH 4I3GA 2BDNL 1SEBB 2GSIB 5CJQH 4ZPTB 4F37K 4DN3L 5ECJE 4OF5A 4JFOA 1D5BB 1M71B 5J06A 4H1LG 4K55A 4HKZA 4Y2DC 2VWEC 3GZKA 1PYWA 4D0BA 1NCBH 5IV2A 1CFQA 2FH8A 5ENWA 3LKQB 2JELL 1RZFH 3DGGA 4KQ3L 1P4IH 1BZ9A 3RY6C 2DKMA 3QDGD 4ZNEA 4ZS7H 1YJDH 3GIVA 1PY9A 5KVEH 1I8IB 2LU4A 1EHLL 3T0ED 1L9MA 3WNMA 4WTWA 2BDNH 3JV0A 3LKOB 1F5WA 2PYEE 4FQIL 5I8EB 4RFEA 1U8LB 4WVRA 5C0BD 3D85B 1UH2A 1WC7B 4DN3H 3DVNB 1RJYB 3R06A 5DRXA 2VIRA 3SGJC 4UUJA 2QR0B 3C8KA 3VFSA 4UNUA 4GXVL 3BFOA 2R0ZL 3QIWD 4BQCA 4BFEA 3W81A 3L3KA 3L95B 1ZHNB 1UJ3A 4HDIB 3TESA 4P2QB 2JELH 2H3NB 2EC9U 2PXYC 4Z18A 4AEFA 1UZ6F 3Q3GB 1G9EA 5DTFA 2DI7A 1BVLB 3EO1A 4LVHC 5DMKB 5D1ZC 3MFGB 2IEPA 1EHLH 3RNQA 2AXFA 1ES0B 1TJGH 2BJML 3B9VA 3FHQA 1MCCA 2IBGA 5E6ID 3C5ZB 5EC2A 3OKOB 3VGGA 1MI5E 3W9DB 2FHFA 3V6OA 3F8UB 5FOBA 1M7IA 5DRNA 1XZ0B 1FZMB 2NY5C 1RZIA 4GXVH 2X70B 1J18A 3ZE1E 1IM9A 4PBXA 2WIIA 5EUOF 3GB7A 5GRWA 2K1MA 3BQUC 4HH9B 1MHHA 2RFXB 3WIFA 1BJMA 3QNXA 4H0IA 4NCC2 4LSUL 5FO8B 4HAFA 1D5ZA 3MV8E 3S37L 4RFNB 1P84K 3B6SB 4QHUA 2H32B 3ZZ1A 2BJMH 2X89D 5D2NA 1NCWL 2YZ1A 4PJ8A 3SKNB 2XKNB 2OZ4H 4G80B 5J9PA 1CVSC 1KCLA 5KN5A 1ZLVH 4GMTL 1KGCD 2BK8A 1BJ8A 2YD4A 5D5ME 1NGWB 3AAZA 5DT1L 5ETUB 4B7LA 2DMCA 5BRZE 3IU3A 2IADB 5D70L 4HUVB 1RI8A 2XWJB 5T5NF 2FSEB 4N0UA 3BIBX 5GSVB 2V5TA 4LSUH 3QUZD 4RDQG 4DGVL 3S37H 5CS7A 1I1FB 2HG5A 3RTQB 2R1YB 5C9KA 1EIBA 4RBPK 1NCWH 5AEAA 1ITCA 3UAJD 4MD5B 4HG4J 4YK4B 3VGBA 4D94A 4WU5A 1Z3GL 1G0XA 3FB5B 1JWMA 3OQ3B 1YYLL 3GUTA 1P69B 4CVXB 3MRIA 5D70H 4X7TB 3NPZB 2VDRH 2PYFB 2V7NB 2OJEB 4JLRB 4AT6A 5DZLA 3WNKA 5B8CB 1CE6A 4LU5L 4DGVH 1I3UA 4WUUD 3HG1D 5C0CB 5MEOA 1LO3L 1WT5A 1RJLA 2YN3A 1EXUA 2PO6B 1P6FA 4ETYA 1JGVL 1JI2A 4QWWC 4D8PB 5CLWA 2FLRT 3IDXH 2C26A 4JO3L 4G9FB 1K4DB 4XPAL 1KENL 3GMNA 5JOFB 2X89A 4LKXA 4LPCA 3ESUF 4Y4FB 1Z3GH 3BN9D 3L3DA 4JB9H 1NGZB 5KZCD 3I3BA 5F7DB 3QG7L 2B4CH 3MV9D 2YPKA 1GRWA 2RJMA 2G2RA 4IHOA 5CLTA 5IVZA 4LU5H 1B3JA 3W39B 3OKLA 3UTTD 1LO3H 4YJZL 4OFPA 3BPOB 4F57H 1JGVH 1IFHL 1E27A 2X2YA 3LS4L 4JO3H 1DR9A 4XMKL 4XPAH 1KENH 2WV3A 1KLFA 3VG9B 4K71B 3V0WL 2R2EB 1MCHA 3CFEB 4EQ3A 4S1RL 2P5EB 3QG7H 3TA3C 1R5VA 1U8MA 2VLKE 1FNFA 3FHAA 1HXMA 2R9HD 5IBUB 2BMKA 2DYPD 3G04A 3LQZA 5ESAA 1IFHH 4NO0A 4WUUA 3HG1A 4LHQB 3E6HB 3LS4H 1R3LB 3AREC 4TNWK 1OY3B 4NFBA 5CGYD 3VJ6B 3D25B 4XMKH 1FFOB 3QDMD 1W0VA 3RL1B 3PABA 1PSKL 5FYKL 2IH1B 3V0WH 3QPQD 3RUGB 4QOKD 3VDCA 4S1RH 4MS8C 4ESKA 2NW3A 2YWYA 1AD0A 3P4MB 3FT3A 5T3ZE 1BGXL 4Z7UB 1JMZA 3P9LA 3MV9A 1DUZA 3BPLC 4U1LB 4ONGH 5DHVH 1IC7L 5IOPB 2VR4A 2NY0B 4ERSH 5JHLL 2FIKB 3ARTA 3DSFH 5EDXA 4L9DA 3VGDA 1FO0A 2AERT 3LZFL 5J12C 2NLJB 4UU9A 3UTSD 2Q3AA 1YNTA 4XX1G 5H37G 2HFEA 1E0OB 1ZHLA 4MNHA 3KDMA 3V0VB 5BMFL 3EFFA 1KJVB 1EJ6A 3GMRB 3I2CL 4XPFL 4C59B 2ARWA 5T1LB 3AUVA 4QGYA 1BGXH 4MCYA 4YGAB 3VMOA 3DROA 1VFBB 4OV6F 3O4OB 1FG9C 3ZSSA 1IC7H 43CAB 2Z0BA 4U1MB 5KG9A 5F7UA 3DVIA 1FNEB 3LQAC 1XGTA 2YK1H 4JRYE 4WJ5B 4Z0XB 1U92B 3HE6D 5JHLH 2DYPA 3MV7A 3H6JA 3S6CA 3K74B 1WQVT 3SDDB 3ZE0F 3LZFH 4PP2B 4NRXB 4EUPA 5DRWA 5CEZD 3IDMA 4PJAF 3B9EA 3QXDB 3GSUB 5FM4A 5HHMD 5BMFH 3SDXA 4OCWL 3HUJE 5IJVA 3QDMA 2Y36L 5CBAB 3I2CH 4XPFH 4OLUH 5JPNB 5F9AC 4BH8B 3G5YA 5F9WC 4GRLC 5BVJB 4RGNB 4JFED 3KPPA 5EBWB 4FQHA 5DC9B 2CK2A 2CK0L 1KCUH 4LLVA 3WEXB 3NCMA 3IXTB 4LPTA 1JBJA 4DOHB 4DK3A 3ME0A 5EOQL 4UDUA 1XGUA 2Y36H 1T21A 4NYLB 3UTSA 2F74A 4L5FL 1I8KA 4F7PA 3IKKA 4HLZH 3BJLA 4MNGA 3O45B 5BJTB 3W0WE 2VAAA 2FRGP 5D6DA 3SE3A 2MTPA 4FN0A 5JZ7D 4Y5YB 1IJ9A 3SKUD 2X4SA 2ZUQB 4G8EB 5FHBL 5DF0A 2XZQH 3ARBC 2C3XA 4HWBL 4KHTL 2BRRH 3ZDZF 1QBML 3HE6A 1FIGL 5IFJB 3CFJB 3MRLA 2CDGA 1LEKB 5EOQH 5LQBL 3B5HA 4W70A 3CFBB 4L5FH 5I1GL 4ZFOB 5MENB 3OXRA 4E42B 4HIXL 3LH2L 5K59F 1X3DA 1FFNA 1XF4B 3PL6C 3DRQB 3KXFB 3U36B 2MPAL 4LSQH 1A6UL 4JFPB 4FFWD 2IMNA 3RJQB 1KB5B 1PZ5A 4JFEA 1Y6KR 4LSRL 3G6JE 1FVCA 3QXTA 4R90L 2YMXL 4WFED 1BLNB 5CEXB 2KUTA 1YMHB 4J1UA 4KHTH 4QTHA 1OOAA 4LLMB 5GZND 4WY7L 1FIGH 3S5LG 5CBEA 3IJSA 3IDGA 3MRCB 1NGYA 3ARRA 5LQBH 2P46B 4P5KA 3CUPB 5I1GH 3BUYB 1AD9B 4GKNA 1CGVA 4K7PL 5EU3A 4EEEA 4HIXH 3LH2H 1N59A 3DMMD 2MHAB 3W9EA 2FD6L 2MPAH 2VO5A 4PJGB 5E8OA 1ERNA 2YBRB 5MP6L 1A6UH 3QXAB 4FZEL 3TM6A 1F4HA 3GK8H 4Z7VB 4D9QE 1CXLA 4PG2A 3PWPD 3UJIL 3QT2A 4LKCA 3TPKA 3HI6H 4LSRH 5I74C 4YXKL 4R90H 4PIRF 2YMXH 2PTTA 3F5WB 3OBAA 4M48L 2AK1L 4WY7H 2M26A 1IAKA 1JGEA 3Q6GL 4XBEH 4JANB 4HXAL 4K7PH 4LKXB 4U0RC 5T1MA 4QHLB 4YC2C 1ND0A 2GHWB 3MACL 2F8VA 4POUB 5FA3B 5MP6H 1IGJB 2NPLX 4PJIA 4X99B 4P4RB 3UJIH 2IFGA 5KW9L 3HS0B 3FL7A 4YXKH 1J8KA 1YEIL 2F53D 1TVHB 4M48H 2D7OA 4FQLH 2AK1H 2CDFB 3CNKA 3DX9B 4XTRD 4KJQC 5EOCL 1XGRB 3Q6GH 4P9ML 5TQ0L 3FQNB 4NKMA 3QUXC 4IRJC 3VI3F 1FLRL 1G1CA 1F2XK 1FPTH 2ADIA 3VFVB 1QHPA 4PV8A 3T09A 1G7MB 3NCCB 3P77B 3MRFA 3DMMA 3RVVC 7FABL 2CDEA 3PGDB 4LPWA 5J7CC 1XF2B 1JRHI 2CJUL 1GGIL 1T04B 2Y6SD 2VDQL 2AQ2A 3BO8A 4S0SD 1Q8MA 1YEIH 3OX8B 1N5YL 2XN9B 3N1MC 3BKML 3HTLX 5K93A 5C09E 4YEFA 1T1WB 3CDCA 3BWAB 4HHAB 2G5BA 1JI1A 5TQ0H 4QHMA 4YHZL 4KI5C 3H2WA 1T7ZA 1FLRH 1QSFE 3V5HA 3GDBA 4WU7A 1RULH 3S9DB 2DL2A 4HUNB 5IROA 2PN5A 2VXQL 1CDBA 1FFQA 4LLQA 4PGBA 2Q7YA 3L7EA 7FABH 3H9YA 1OP5H 3BP6A 2CJUH 2IG2H 3VA6A 1GGIH 3IU4L 4JEGB 2CD0A 4G9DB 4CU8A 2OK0L 4ZXBC 1N5YH 2APWA 3BKMH 3HC0A 1ONQB 1X5AA 4JM2B 5KANG 3G5XA 2C1PB 5F7YC 2F53A 2CKBB 3R1GL 4YHZH 5DEGA 3DTXA 4Y5XA 4HX1A 5GS0L 5KS9A 4MAYD 2NYYC 4HWBA 1X5FA 1CDHA 2E7HA 3WO4C 3N0PB 2XKUA 2VXQH 3X11B 4PJ7A 4HUWB 2B20A 3TIEA 1FL3B 5DC0A 4G8GB 4JFDD 4ETQB 4JCLA 2VLJD 4K7PY 1CG9B 3IU4H 1P2CB 3MGAA 1MLBA 1RU9H 2OK0H 4QHKJ 1MQKL 3RZCD 1BJ1H 2XOTA 4JFXA 1L0YA 4ZUWA 2Y1VA 3IXAB 5FYLL 1RAMA 5H2BA 1IARB 2Z31B 3BXNB 2QSCH 3R1GH 1WSST 5GS0H 4HC1H 1P7KA 4U6XB 1CTOA 1QRKA 2ICWJ 3QSKB 1S7QB 2A83B 2HT2D 2ARJA 1RUQL 2GCYB 4U7SA 3GGWA 4AMKL 4P48A 4R4BB 4WHDA 1YC8A 1KOAA 3RVTD 1ODAA 3O3EA 5KS9F 4J3XA 2YPLE 3L3OB 3QJHB 4FMKA 4YFDB 4D0DB 1XIWA 1CI5A 5F7MC 1MQKH 1F4XL 5D1XD 5C8JA 5HHQA 1O7VA 3OJ2C 3FKUS 3UXFA 2V2TB 3RVXC 4P57B 1NCDL 1AGCB 1B0GA 1RK0B 3SN6N 1BWMA 2VSCA 4GUPA 5DHYA 2DLGA 1A6VL 1RUQH 2VSDA 2X9YA 2ZSWB 4OUUB 4MAYA 1II4E 2XYCA 3P30L 4AMKH 1C5DB 3CFIC 1NSNL 3KPQA 5I8OL 3BP4B 3RI5F 3ARDD 4QGTA 5DYOA 1MFNA 3L5WB 3MBEA 4JFFA 4I0PD 4JFDA 1F4XH 5E8NB 1BOGB 3VXRD 2XTJD 5HPMB 5I1DB 1SJHB 1BJ1J 3VFOA 1KIPB 2FJFA 4OV5A 2J2ZA 5IHUL 4RNRA 2BNQD 4CJ1A 3RZCA 1I1RA 5T3XD 3OL2A 4GG8A 1FCGA 3JV6A 1HZHL 1P7QB 4TNVK 4U2YA 3TBSA 5L0QB 1EFXB 1A6VH 1N4XH 1ADQA 4E0RB 2GK2A 1YC7A 5KSAB 1TTFA 4CGTA 4R4ND 1DBBL 4JY6A 3P30H 3ZKSD 2VMFA 4E5XA 1NSNH 5I8OH 3IFOB 5AZ2L 4H20L 1GGUA 5F8QC 5DDHA 4K8RD 3TZVB 1T2QL 3QEQE 1B90A 1FDLH 1IEAA 2EXWC 2MSPA 4GOSA 3SGDH 1XCQB 5IHUH 4K3EL 2EZ0C 1BVZA 3HI1A 4NFDA 3C5JA 4FMFA 5IGXL 5D1XA 5J8OA 5F9OH 3EBAA 3MLSH 1HZHH 1NFDE 2YXMA 1U6AL 2XFXB 4P4KD 3MLZH 5E8DL 3TVMB 3P4OA 1WISA 3JTTB 4ZQKA 1CXHA 3WSQL 5FIEA 1DBBH 3O6FB 1HINH 4KJPD 1LNUA 5HHNB 3UTQB 1FNAA 2XQYG 3PGFL 5AZ2H 1BFOB 25C8L 4XVSL 5C92A 1MFBL 1QA9B 1T2QH 1DJSA 4KMLB 1OP9A 2N7BA 5F8RC 3A67L 5B38A 4I18C 4I0PA 4K3EH 3VXRA 3LPFA 3RWEB 2ADGB 5IGXH 1QFOA 3K4AA 1H5BA 4LCCC 4M7ZB 3HAEB 4WENB 1U6AH 4EKXA 1S7SB 3AXLA 5E8DH 3C6SA 2NR6C 2Z92B 4G8FA 3HCVA 3WSQH 4MD0B 5GGUB 1NBZA 3FCTA 4X6CF 4JVUA 1MCKA 3PDOB 3PGFH 5HHOD 25C8H 1EH9A 1GGBL 4C4KT 1VEPA 2AEPL 3VRIB 1NCAL 2DBLL 2OMNA 1FAIL 4L3AA 2JK5A 4KAQH 1EGJL 4NQXB 2NX5E 1MCPH 1CCZA 3CCHA 1CD9B 1L6XA 4JKPL 4QRRD 3ARZA 3MRJB 5C07E 2Y5EA 5E8EA 4POZC 4P5TC 1BZ9B 2BVUA 4LVOC 5IK3B 5ACLA 3GIVB 4KJYA 5I1EL 1QEWA 1XGQA 2COQA 2I26N 5BZWB 4B53A 4P4KA 1H15A 5EUOB 3E2HB 1YMMB 5IG7A 2EDBA 1GGBH 1FZOB 3BGFB 3QHTC 2ZWLT 2AEPH 2CO6B 1NCAH 5EPMA 2DBLH 5F1NA 4AEIL 2JB6A 1QO3A 1FAIH 5DUML 1DN0B 1EGJH 2BVOB 2A1WL 5E00A 2XTLA 5A2JH 2PCPA 3KVQA 3NIGE 2E9IA 4O4YL 1MPAL 4JKPH 2WINB 3PQYD 5F6HI 1CFVL 5ACZA 3E0GA 5IF0A 3U4EA 3EO1B 4ZYKA 5JHDE 1UM5L 5GS2H 2ITDB 2UWEA 3HI5L 5HHPB 2IQ9L 4HJ0D 3GSXA 5C6PB 1TJIL 2X42A 3RX8A 4RMQA 1U58B 5D1ZD 5HGGS 8FABB 5TDPB 5LGHL 4AEIH 3WFBL 3VFNB 3C60A 5HHOA 3FB7A 3IS0X 1F13A 1FVEA 4JG1H 3DO7A 2A1WH 2XPGA 4NM8H 1NKRA 3T04D 3WUWG 1HKFA 1KTRL 1DLHA 3SDAB 3KXFE 4O4YH 1MPAH 5HI3D 4M9PA 1G9NL 2CIKA 3EJYC 2Q8BL 5KBNC 2VAJA 1W8NA 2ZUYA 4JM4L 2C9AA 3B9DA 1S8DB 4QRRA 4DKEL 4ZFGH 2FHBA 3QXUA 4QHUB 1WFUA 4HJJL 4X7SL 2IQ9H 2Y07L 2JCCF 1BX2A 2YUZA 5L2KA 5F3HA 1YUHB 1TJIH 1D9KD 4NNYB 4XBPA 5L2JA 5DMIL 4Q0XH 5LGHH 1AO7D 3B9KB 4U49A 3D0LA 2FBJL 1T0NB 2WLYA 4QRPD 5FCUL 2GSGA 2NXZB 3RL2A 4HCRL 2DTSA 4N0UB 1G9NH 2DJ4A 1QRNB 4Y1AD 2ZCHL 4MB4A 3P2TA 4L29A 4JM4H 4GS7B 4DKEH 1SVCP 4HJJH 4X7SH 2Y07H 1J0ZA 3UPAA 4HWZA 1GVIA 4HUMB 5CD3A 3O3AB 4NN7C 5C0JB 4WNQB 1AGBB 3WN5A 2R8SL 4KPHL 2D7PA 5DMIH 3VI4F 4APQB 2EYRB 1AKJB 3VRJA 2EYSA 1LP9A 1YN6B 2FBJH 1GCFA 2RQ8A 2VLLB 5FCUH 1AGEB 5J13B 3NCFB 1FFRA 4IEFB 5DURD 3V6FA 1BD2E 4X6EA 4FQXB 4N8VA 1ZWIA 5FDWB 1P4LA 1PD6A 5HVFB 4NKOB 5FGCE 5FGRA 1F2QA 5EWIL 3BW9B 1F6LL 4QT5A 4YHIB 3MGTA 1HHGA 1PX3A 5IVXA 4LSSL 2I24N 1AGFB 3FO9B 3ZO0A 4AZ8A 3RNKB 4YGVB 2EO9A 2ZPKL 4PGDB 2R8SH 4KPHH 4JKLA 1JGDB 5KVFL 5ITFB 5JW4M 1I3VA 32C2A 1KNOA 1D9KA 4KGLA 3LS5H 4QWWD 3L3DB 1CT8A 3UPRB 2WZPD 1AO7A 1VFOA 4YDLC 2Q76B 1IRAY 4XI5C 3S7GA 4QRPA 4IBLT 3MRGA 4H1LA 5FECB 1V7NL 1JPGA 2Y7QB 5EWIH 1RZ8B 3QJFB 5IHZA 4WI5A 3H42L 1E4KC 3H3PL 3OKLB 4LSSH 4QYOA 4BQ9A 4Y1AA 3AVEA 5SWZE 3IETA 3FQRB 2EIDA 4H26A 4P5MA 2XN9E 3WJLC 4JVWA 4WW1B 2ERJC 5AUMB 1HILA 5KVFH 1H3PL 2FEEI 5CKGA 1HDMB 3FN0H 3FAWA 4IRSA 1H8OA 4Y89A 4JPIB 1V7NH 2LAAA 3GKZA 5IJKA 3QHZH 2A6IB 5JQ6L 3H42H 3L7FB 3CD4A 2A9ML 3F6IA 2VZUA 1ZOXA 2BMKB 4YZFF 4LQFL 4V2CB 2HLAB 6CGTA 1NAMA 1U8PB 4HFWB 3H9SE 2FX9L 4NO0B 3L5XL 4V2BA 1H3PH 1SJEA 3X17A 2UZYB 1MCBA 4R26H 3ARFB 4F3FA 4B0MM 1KJ3L 4PRPD 3HR6A 2GFBB 1NBYA 3CXHK 4HWNA 4HIJA 3L6FB 1OSPL 1IM3A 3VH8B 2MNUA 4UNVA 4ODHL 1KCVL 2D7TL 3K7UA 3WNNA 2AP2A 4X7CC 5C0AE 3S3SA 1A2YB 2ZCKL 1EFQA 3MNZA 4L4TE 1S9YB 4PJAB 5FV1L 2A9MH 4WFGD 4YBHA 4A6YL 5IEHB 4MS8D 5E4IA 4LQFH 4ZUTA 2DMKA 5GGQL 3HLAB 1N8ZA 3L5XH 3IGAB 5I73B 2IH3A 1BWWA 2E6QA 1KJ3H 2VR5A 3TBVA 2HFEB 4LIQH 1OSPH 2KQMA 1U8HB 3TBYA 4EVNA 2GK0A 5EIQA 3VW3L 4ODHH 1KCVH 3VWKB 4QRQB 2D7TH 5HYFA 2O61A 2MQCA 4V1DA 1RJCA 5K9JL 2J4WL 2ZCKH 3MOAH 4A6YH 4Y4KA 4HPYL 5EA0L 4FQJL 3VXUE 4WRLA 1X5YA 5AAMA 2GJ6D 2AJ3B 5GGQH 2R4RL 1N6UA 4ZTPL 5JOPD 4HV8A 3ULSA 4X6DF 4KDWA 1ZXQA 3V8OA 2ZSVA 4PUBL 4Y4HD 4MJ5A 3GMOA 5GS1A 1FORL 3HMXL 1QPPA 2OM5A 3MA7A 4L3ED 3TBWA 1YEHL 5I0ZA 4LGPB 2VL5B 2MWCA 1DLFH 1WBYB 6FABL 4PRPA 4G42A 4MZ2A 1F11A 5K9JH 2J4WH 1MFAL 3EO0A 4ZPVA 1G7PA 2F9BT 4Z7WA 4C56A 1H8NA 4OB5L 4DUWA 5EA0H 4FQJH 3OKDA 4JQVC 4XMLH 2EDOA 5D7LE 3O3DB 2P5WE 2H8PB 3KPNA 1DZBA 4JRXD 4FQHB 2R4RH 4ZTPH 1DEDA 1UFUA 4GRLD 3IDYC 4CW1B 1YPZA 1R5WA 2A74B 4FRWA 2BX5A 3UO1L 4PUBH 3SGKC 3HMXH 1PBYA 1YEHH 1KTLB 2G75A 3LV3B 4PJHF 4NN6B 1IC1A 6FABH 4RGOL 1MCQA 1MFAH 3IDJA 3RA7L 1ZHBA 2Z8WC 1D7FA 4OB5H 1EEUA 3STZB 5HJ3A 1H3VA 2VAAB 2W07A 2I9LA 2DWEA 4J7RA 4PJ5D 3C5ZC 5C0FB 1K5NA 2F54B 4KRLB 1JUFA 2BCKA 2DQGL 3O8XC 4JRWA 4Z7OE 1J11A 1AH1A 3QIBB 5DMGC 1JZ7A 2GJ6A 3QDJD 1G7QA 4I9WE 1Q9KA 4L4VB 2QKIB 4Y4HA 3O6LL 4HPOL 5BW7C 5HDBE 4PJXF 1FYTB 4RGOH 4L3EA 1CLZH 5FK9A 1YPZF 3RA7H 3ZLQC 2BRQA 4TVPE 4OCXL 4PJBA 2HVKB 4NKIH 1YEDB 1S7RA 3CFKB 3CK0L 3L1OL 2UY6A 4ODVL 5A16A 3QWOA 3PL6D 4AYFA 3X14B 1MCEA 5FDYA 1F4AA 1Q9LB 3FT4B 5TF1L 1YN7B 1IAOA 3CX5K 4JRXA 5CFHA 5DHVB 2XZCH 1G7IB 3WO3B 5D7SL 1C7SA 4FTVB 1U8IA 3IJSB 2XIDA 3IDGB 4N8CL 4I1NB 5DQ9B 3O6LH 4HPOH 4P5KB 3DV6A 4PRIA 3FFCD 2VLME 4OCXH 4HMCA 4S2SA 2BVQA 5I17A 3RTQC 1FNHA 1WAAF 3KPOA 3L1OH 4OZHF 4I3RL 4ODVH 1HEZA 3QNZA 5LG1A 3SCMB 1XR8B 1UZ6E 1JWUB 2CLZB 2OR7A 2X09A 4PJ5A 4X6BA 3DI2B 5LVEA 1FIEA 5TF1H 1V3MA 3FO2A 2YPVL 5FF6A 4LHUB 3RDTB 1GHFL 3HC4L 4RMUA 3IFPA 4CMHC 4X4XA 4N8CH 5F70A 2OL3L 4KK6C 3QDJA 4PPTA 1U3HB 2PW2B 3BIAX 1LE9A 4O2FA 3OV6A 3CZFB 1WCQA 1AIFB 5I1IL 1T2XA 3MRNA 3QULB 5GRJL 2IQAB 1PG7X 2W0KA 4HJGA 1HH9A 2PO6C 1C5CL 4HS3B 4R2GC 4G6AC 1SYSB 4X7DC 4ZFFB 1SVZA 4YO0B 3RKPA 4I77L 1MELA 2YPVH 3PL6A 4Q7DA 2ADJB 5HYJD 1LEGB 4WDIB 1GHFH 3HC4H 2IALA 2OTPA 5EO0A 1DEEB 4PREA 4ELMA 2OL3H 2M2DA 5E9DD 4IOIA 3CDGA 3VE0A 2ED9A 4XCCL 3WE6A 3WMSA 2Q86A 4KJQD 1K9TA 5I1IH 5GRJH 4P23A 3FFCA 5D2LA 5KSUA 1BVKA 3QUXD 1R3HA 4IRJD 1FGVH 1ED3B 1VGEL 1I9RL 4F15B 2YA0A 1IAIM 2QEJA 2ZKHL 3VG9C 4O2EA 4K71C 1P1ZA 2G9HA 2VLRB 5DJDA 2MMXA 2D31B 3GIZH 1JZ2A 4Y16C 1A9BB 3KPSB 3D6GA 5B3NA 3DUUA 1HI6A 3X3GL 4HS6B 5F7LB 3OMZA 1ZLUK 1ZE3C 4LDEB 1MCOL 1N26A 2C1OB 3GJEB 3NIFF 1XF1A 4ORGA 5IW6A 3DHJA 1S9VA 4EDXA 1S7VA 3CPLB 1VGEH 3CGTA 5D2NE 1WBXA 1TVBB 1I9RH 5ESVA 4D3CL 4EN3B 3FO1A 4NSKA 1JF1A 1QLRA 2ZKHH 3DRTA 1GYAA 5EU6D 5JLZB 4H25A 1BIIB 3I3DA 1LGVA 3S36X 1DE4B 2P8MB 3QIUB 4LEOA 2A6DA 4X8JA 3X3GH 4N0UE 4ZXBD 5HYJA 5KS9B 3RHWF 4AQOA 2IWGA 2HRLA 1N64L 3EOTL 2K9UA 5DMJB 1MCOH 1EK3A 1RZJC 1CXEA 4F9LC 5BS0D 4OF7A 2EE6A 3HN3A 3O2VH 1OP3H 3TJHC 3J8F7 2NYYD 3KAAA 3AS1A 4D3CH 3RP1A 4B41A 4EXKA 1MLBB 2ICCA 1N7ML 3QUXA 4XP6L 5A2LH 5C08B 4XH2A 4MYWB 4JFQA 3TYFA 2XKSA 1S7TA 4KHXL 1A64A 1IQWH 4JHAH 4NQCD 3QEHB 4LLAA 2VISA 3WJJC 3O4OC 5C0IB 3EOTH 4PGZA 3S5LA 3SE8L 1DVFD 4QRSB 2A6KB 2H6PB 5ANMB 3WL9A 2F19L 3SBWC 4LNRA 2ESVD 4QRTA 1ORSB 4N90D 1WZKA 2DS4A 3OB0K 1N7MH 3D87B 4L9LB 2VE6B 4XP6H 4U1IA 4DKDC 2C3VB 3HZMA 5GIRB 4KHXH 3GMQA 1HH6B 2CUIA 1FBIL 1P53A 5EU6A 5FGSA 5EU5B 5GGRA 3I02B 1BBJA 1PJ9A 4WW2B 3FRPG 3HZYB 4A2MA 3SY0B 3TLRA 5KAQF 1PKQA 3EYFB 3D2UB 2VABA 4NM4L 4ZXBA 4GW5A 1TIUA 5E94A 2JJUA 2BNRB 3RVXD 3O9WA 3MNVA 2I07A 1Y18B 5BS0A 3LDBB 2AJYL 1FL5A 3DV4A 5FUZL 2N7AA 3VXMD 3ZDXF 2CLVB 2D9QB 4L1DA 2AV1A 2PYED 4PTUA 3NIDF 4PB0L 1FBIH 4UT9L 4RNRB 5CMAA 5E03A 1YNLH 3OAYK 3S34L 3MR9B 4I0KA 2UZIL 3JV6B 5DQJA 4JGJA 2XWTA 4WHTA 1DQJB 4MLIA 4NM4H 3BEWB 3BDBA 5I30L 3GSVA 4N0YL 3GM8A 5L6YL 3S96B 1M6OA 1DVFA 1TZIA 1N6VA 1ZSDA 4HUXA 4WUUE 5D7IA 3HG1E 2IPTL 2ZUQC 2AJYH 2EIZB 1UYWL 3IFLL 1UEMA 4MAUL 4CKVX 5FUZH 3DARA 5DK2B 4XXCA 1R5IB 5JIKA 4KGJA 4LLDB 3K80A 3TIDB 3TO4B 4PB0H 4X6FB 4UT9H 4LLYB 4X6CB 2VITB 3K4ZA 1MI5D 4S0TD 4OCYL 3RX5A 4XVTH 5FKPB 2UZIH 4NQDB 3IAPA 5IQ7L 2EXWD 1XCTB 4RSVA 2SEBB 5SWQA 2WP3T 2FO4B 5I30H 2EZ0D 4BSVA 1KIRA 2GITA 4QTIL 5EN2A 3SKMA 5L6YH 1KT2B 1KLGB 2IPTH 4U6VL 3HZKB 1UYWH 4MHHI 3IFLH 1LD9A 4LAQL 3VD7A 3MJ8A 5CIPA 3RPIA 3MV8D 4LCYB 5F3BB 3PGCB 1CD8A 4G7YL 4QF1B 5B38B 4WO4C 1R6VA 3VXMA 4IJ3C 2DD8L 3E6FA 4OCYH 2XACC 1YEEH 3BP5A 5IQ7H 5I1LA 4ZDHB 3PWVB 4OZGF 4OGAC 1MY7A 1RZKH 2GIYA 4NHUB 2NQCA 4OAWB 2AV7A 3FAXA 3S4SB 3MV7E 4U6VH 4LAQH 3ZKMC 4Z7NE 3GSQA 1R3JB 2YA2A 4XNZC 3PWLB 1I7TB 5ISZA 4G7YH 1K2DB 3B2UC 1CDCA 3SDXE 3PWNB 4F7EA 4KI1A 4CN6A 2BERA 3QDME 2JK5B 4J2XA 1XF3B 4PY8J 5EOTB 4EI6B 5HI4C 2DKSA 1OAQL 2VDLL 5IR1B 1R24A 1MI5A 2VXTH 1MJ8H 5J56B 4JO4L 3RWCA 2AJZB 1UEYA 4XPBL 4ZOAA 1UKTA 2YD7A 5B3JE 5DSCB 2AI0L 5F89A 3WFDL 1CICB 3KPMA 1CFTA 2FHCA 4WFHD 4PJFA 3UTSE 3ZDYF 2WBJC 4J8RB 1JNLL 1MWAL 2JCCB 4I48B 2HVJB 3LMJL 1OAQH 2VDLH 1CU4L 5IF0B 3ES6A 3VGAB 3QQNA 4HMEA 4JO4H 3SOBL 4OJFH 5EO1B 1I7UB 4XPBH 4I18A 4M8VA 2VQUA 4KUCD 5A43C 5JXEC 4ODSL 4XGZA 4DN4L 3WFDH 4BKLA 1I8MB 3REVA 4GKZA 1G7JA 4DEPC 5IMOA 4UBDC 4YHPA 5CEZE 1YEJH 1U8NB 2QBWA 1JNLH 2R0LL 4XXDA 4OIAA 1DLHB 1MWAH 3LMJH 3U46B 4EXPX 5HGBA 1CU4H 4RAUB 1I9JL 2P1YA 4H8WH 3CU1A 1T89C 5E5MB 3SOBH 5EBLB 4PJFF 3PJSA 4LSTH 4YDKL 4JFEE 4RGMB 1JPFA 2VLKD 4ODSH 3UTZA 4XC1L 2HFFB 3EJYD 3JTSB 4DN4H 4JM2C 4XBPB 5L2JB 5EG6C 2NY1B 5KVMC 3EZJB 3MGOB 3MXWH 1WEJL 5D96B 1OHQA 2LAGB 3CAFA 4YHYC 1WIUA 4HIIA 3ZTJH 2R23A 3MA9L 3FTGA 1CD1B 4ODTH 4R97B 4MQSB 4MX7A 5FYKE 1QR4A 1I7ZA 2IAMB 4Z95L 1KJ2H 4WWID 4L29B 5DEZA 4KKLD 2VDML 4YDKH 2YC1B 3BX7C 4MVBC 1JK8A 4PJ9A 5T3ZD 4XC1H 1IEBA 4NGHL 3CXHJ 5TDOA 4NO3A 5L7XL 2A73A 5I75B 4G43B 5SX5H 2EYSB 2DF3A 1WEJH 1R0AL 3TBTB 1DP0A 4PRBB 3V6FB 2B7DT 3MA9H 1PDKA 1TZHA 4MNQD 1OAXL 1KTDB 2KL6A 3UDWA 1BECA 4PGEA 5IB2A 1D5XB 2JJWA 1BQHB 5J6GB 3NA9L 4EIGB 1S7UB 4GAJH 1LK3L 1XH3A 4PJIE 2ATPB 4O2CB 5I15L 3ULUD 1B0RA 2DLFL 4PG9A 1CIDA 2DQTH 3HPJB 5SX4I 1D6VL 3IJHA 5SWSB 1MQ8A 1S9WB 1AGDA 5JORA 5L7XH 4Y8AA 4F7CB 5I66B 2VLKA 4KROB 1R0AH 4JRYD 2FJGB 5IVOA 3T2NL 2FCBA 5C0NC 4K7FB 1BAFL 1OAXH 3FT2A 3IFNL 4NWTH 5EZIL 4H1LB 2APTA 3VFRA 5BVPL 3CVIL 3NA9H 3LCYA 3DBXB 1LK3H 2GT9B 5I15H 5GRVL 2DLFH 1MHEB 1HOCB 1X5GA 1JNHA 2DBJA 1D6VH 1EHXA 3HE7C 2F58L 2IC2A 4JREC 2X4UB 3C6LB 4MSWB 5FGBC 4HWEH 3DIFA 3WKML 2OP4L 1OW0C 2BVEA 2NY4C 5CSZA 3X13A 5B39A 5KSVB 7CGTA 3C2AL 4I5BA 3T2NH 5EZLB 1ZT7A 4UQ3A 1BAFH 5DC4B 3IFNH 2XA3A 4ZAKC 3OJMB 3DXAD 5EZIH 4KVCL 5BVPH 35C8L 3GMMB 3CVIH 5KSAC 3VXOB 5AWNL 4YXLL 4TUJA 5IIEA 4MNQA 4U1JB 1A7PL 4LSDA 3P9MB 5F9JA 1LE5B 2EDFA 2F58H 1X5IA 4XB8A 5T1DL 3SGDI 1MNUL 4KKAC 1IQDB 4EQ2A 4XAKE 3RRQA 1JHTA 2KBGA 1QR1B 5K9QI 1NEUA 3C2AH 2F53E 1KEGL 4J3UA 5DJ6B 2GTWB 5KS9E 2AQ1A 5C3LD 1T7WA 3EDFA 3B3IB 5DVLA 4WV1C 3UMTA 35C8H 4X6DB 4PJ7E 4YXLH 2X4NA 4WWKB 2FATL 3LRGA 2AK4B 3WUWA 4FOMA 4MA1C 5BO1L 2NY5L 3OKKA 5C08E 2AXGA 3HB3C 4W6YB 5CWSA 2NXYD 2BSTA 3VFWB 2EEDA 1S3KL 1JJUA 1CK0L 4P9HC 5T5NG 4MA3A 1KEGH 5SV3A 1K85A 3QXWA 1QHOA 4P2RB 5DXWA 1XGYL 4EVNB 2P24B 3CXDL 4K9EC 2X9WA 5EU7E 4JGMA 2V5RA 4MJ4A 4QCIB 3WIIH 3IYLW 1A6ZA 3SE4A 3WJLA 4EOWL 3V7MA 1N5AB 1EERB 3NBNA 3DXAA 5E08L 4Y4KB 3C2SA 2UYLB 3I75A 3ARYA 5BO1H 2NY5H 4PJHB 1T5WB 2HTLC 2HJKA 3KYNA 3T4YB 5I76B 4KH2A 3BZEA 1CK0H 4MQXD 3EYVB 1A6TB 3VXNB 1HYRC 3GMOB 2H45A 1RQ5A 2J8UF 5C0GB 5IMLA 4P46A 3CIQA 1EEZB 1WCBA 1XGYH 3TBWB 3BSZH 3VFUA 3G6AB 4RISL 3OR7B 4N1HB 3TJEL 3QQ4B 4EOWH 4P2OB 5AAWA 2XT1B 1L0XA 3FO0L 3DURA 3PWJB 2MFNA 1AC0A 1T22B 3KPNB 4K07A 1MREL 4ZUVA 4JFFE 1NCCH 4PJXB 1UWEL 5J6HA 1FJ1A 1YPZB 5IB3A 1MHPL 1H0DB 2OR8A 5CP7B 1W72A 3D85D 2B0SL 1BFVL 1UJ3C 2X4RB 4QXTA 5HY9B 1WITA 5IMMA 4NRZB 1TZGL 3T3PE 3ZE2E 3G6JA 2Q8AH 3U48A 1E28B 3ELAT 4NNXA 5F1IA 3FO0H 2WQRA 4NOFA 1AR1C 4OZIF 3ZKQD 4ISVB 3T65A 4Z78B 3IKCA 4M00A 4WEMB 4OLVL 1JUFB 4MJIB 2BCKB 3NZ8B 5EIIA 4AY0A 1PG7L 1LK2A 1MHPH 1T1ZA 5J1SC 4U1SA 3C5ZD 1MRDL 2B0SH 1BFVH 4L1HA 1SEBA 4OZHB 3MSPA 2GSIA 3O8XD 4OGXL 3QZWG 3QDGB 4ZPTA 1TZGH 3IDIB 2ZOKB 1B4JL 1D5BA 3T0EB 2IJ0C 4AM0B 2VZTA 1M71A 5F9DC 5C0BB 4HIEB 4M7LT 4HEPG 1QSFD 5D2NC 1OAZL 5A16B 3LKQA 4PJ8C 3B5GA 2BOBA 4OLVH 4JO1L 3CVHL 2HFGL 1PG7H 2W60B 3CSBA 3IAQA 1I8LA 2GQHA 5HVHC 2C3HA 4BZ2L 4KVNL 1O0VA 3NN8B 2YKLL 4G3YL 1I8IA 2X9XA 3VXRE 1MRDH 3EOAB 3LKOA 3ZT7A 4OGXH 5I8EA 1U8LA 3T1WA 3D85A 3LY6A 2R69L 1WC7A 1RJYA 1JTTA 3ZSTA 1B4JH 2HYMA 2QR0A 4GS7C 1SQ2N 1EUTA 1FN4B 3S88L 2DQIH 3Q6FB 3D48R 3WXWH 1ZA6B 3UTPD 1OAZH 3L95A 1ZHNA 1MVFA 4HDIA 4MQTB 3HNSL 4P2QA 2H3NA 1QQDB 4JO1H 3Q3GA 3CVHH 2HFGH 5TDNB 4HKXB 3ULVD 3RTQD 1BVLA 4BZ2H 4A6YB 5CZXC 3QEGL 3ESVF 5DMKA 2YKLH 4G3YH 5C0DB 2Z93B 4LMQI 1OTSC 1QSZA 4S11A 2A77L 3OPZH 1S5IL 3SDCB 1OT1A 3C5ZA 2R69H 2FBOJ 3OKOA 4U6TA 5FYLE 3VH8G 3W9DA 1JFQL 2XQYK 3BIKB 4BH7B 1XZ0A 4X5XB 1FZMA 4O00A 2X70A 3MRNB 4KXZH 1WT5C 3N9GL 2FL5A 2ITCB 5FYJU 4NZJA 2ZJSL 4PLKD 2QQLL 3HNSH 4H5SB 2YEZB 2FGWL 5C0CD 4HH9A 1S9XB 2MOVA 3QEGH 5CJXC 2PO6D 5D7JB 5FO8A 3OR6B 2EKSB 3B6SA 2J8HA 2H32A 2VZVA 5CEYB 1WV7T 5KTEL 3QAZB 4G6AD 2A77H 5MHSD 2YPLD 2JCCE 4OFVA 1KSRA 3UJJL 4Y4FD 3QUZB 3SKNA 2EH7L 2B39A 2XKNA 1JFQH 3ARUA 4G80A 1SMAA 2DQUL 1JIBA 2ZG2A 3N9GH 4J3SA 2UWEE 5IHLB 1NGWA 2ZJSH 5ETUA 4LQ1A 2IADA 2ZUSA 1A6PA 2QQLH 2XWJA 1SM3L 2FGWH 2FSEA 2VZ3A 5C3TA 5DA4A 1TCMA 5GSVA 5HHOE 3LKNB 1EA9C 3NCJL 4J3WA 4L8CB 1I1FA 5KTEH 1QD0A 2C3GA 3RTQA 2YD8A 1SHMA 3DUUB 3MFFB 3UJJH 1A6AB 4NBXB 4XCEB 2EH7H 3VI4E 3LQAH 2VB5A 1X4ZA 4MD5A 4NN5B 5HYQB 2DQUH 4ZUSB 4OZ4B 3BDYH 1GAFL 1YEGL 3L3HB 3LEXB 5IW6B 3V7AE 4M4RA 5I6XB 3X12B 2AQ3A 1CFSB 4CVXA 5L2KE 4X7TA 1SM3H 1UVQB 1CGSL 2PYFA 2V7NA 3UROR 2OJEA 4JLRA 2K7QA 5B8CA 5KZCB 3NCJH 5D9SB 3OKEB 1HWHB 3PXHA 5C0CA 3BGMB 4N9OB 1FQ9C 1MAKA 2PO6A 3BN9C 4D8PA 1IKFL 2J88L 4OKDA 3M17B 4G9FA 3UTTB 1K4DA 4HGWB 3QYCA 4Q74A 2M8XA 2P8LB 4Y4FA 1GAFH 1A7RH 4UV7L 4XCFL 1L7IH 5DI8B 1YEGH 4N0CC 1NGZA 2WMPA 2D03L 3MJ9H 1VERA 1YQVL 2EXYC 1CGSH 4ZTOL 5I73C 3J7HA 1RIUL 4IIQA 2ILLA 4UILL 4CDGC 3NCYS 3W39A 1NC4B 5E7FA 5TPWH 4JZJB 2J5LC 1MCNA 1T1XB 5DD3L 3F7PC 4C58B 4OLXL 2YRLA 1T20B 4L8BA 4QLRA 3V4VL 3WFCL 5EBMB 5IVXE 1J0YA 1OM3H 5T1LD 2Z91B 5J11B 4MWFB 5F7NC 2R2EA 4JHBA 3WL9B 2D03H 3CFEA 2V9TA 2R9HC 2OS7A 2P5EA 1Q9WB 1J86A 4ZTOH 2RR3A 1RIUH 3RFZC 4WGVB 1A1OB 4QOKB 5DD1L 4UILH 3B8YA 5CGYC 1F45A 1WLHA 2GTZB 1OF2B 1JYVA 3SDDD 1AO7E 1A5FH 2ZCLL 1TTUA 1IMHC 4MA7L 3HZVB 5ADOH 1A3LL 4QRPE 5DD3H 1SY6L 4OLXH 1NDMB 3O4LB 4XP1H 3E6HA 3VJ6A 1R3LA 2ZNXA 1PZUB 5I1CL 4XRCB 3D25A 3V4VH 3WFCH 1FFOA 3MREB 1INDL 3RL1A 4LL9A 1JN6B 2PW1B 3WLBB 4XNYL 3TH2T 5ELIA 2IH1A 3RUGA 2OL3B 3BPNC 3ARPA 2O5ZL 2Z35B 3O9WB 4KQ4L 4P3WA 1FNGB 4NBZB 4RGND 3P4MA 2CIIB 4LAJH 5DD1H 1TDQA 4Z7UA 4B5EA 3EJJX 4U1LA 1PG7W 5IOPA 4NN6C 2ZCLH 4MA7H 3EZ8A 1A3LH 4QNPE 1CTNA 4AIXA 1SY6H 4M1GL 2FIKA 3VFGL 4MA8L 4ZUUB 1CQKA 5I1CH 4LSVH 1NUGA 2XWTB 2NLJA 1INDH 4ZO9A 5D6DC 1Z6JT 1A6WH 3V0VA 4Y19A 2O5ZH 1TZIB 1KJVA 4QXWA 4HUXB 4KQ4H 1GJIA 3GMRA 5IB5B 1MFDH 1QNZL 5F1OB 5T1LA 1NC2B 3QIBC 4YUEH 5HHMB 4KRNA 1HSBB 4OZGB 1BEYL 1VFBA 3HE6C 4X9HA 5JHDD 3WHXB 43CAA 1VADB 4U1MA 4ODWB 2WAHA 2BOCB 1FNEA 4KWUA 4Z0XA 1HCFX 1TENA 1U92A 3BE1L 4M1GH 4X6DE 3U0WL 3VFGH 1FFPB 4MA8H 2Y5TB 3SDDA 4PP2A 1U36A 4NRXA 1AQKL 3N1PC 2ZG3A 2IANB 3EHBC 2AEWA 3CZJA 3QXDA 3T3ME 3GSUA 5MEND 4LLUB 5DZNA 1MAML 5I71C 4BSVB 4RZCB 3WD5L 3KXFD 2ZUWA 1DFBL 5CBAA 1QNZH 4GRWH 4RCAA 5JPNA 4BH8A 3CSGA 4OLWL 1BEYH 3CFDB 4HLZG 3WDIA 4KDVA 3K0WA 3O81A 4XNMA 1JPST 5EBWA 2BVTA 4JAMB 4V1DE 3U0WH 3E6FB 5F7KC 4PRDB 2W91A 3WEXA 4WO4D 4Q6YA 4MGXA 4RMWA 5DHXB 2Z8VC 3IXTA 1OWRM 2WWKT 3WD5H 4PJHE 1YY9C 1RPQA 3SCMC 3EYQD 1DFBH 4NYLA 1CGWA 4OQTL 4LMQE 1HHHB 3QUML 1KC5H 3KYKL 4PRHB 4U3CA 4OLWH 3V79C 4EBQH 3O45A 5F88B 1Z5LB 3BKCL 4PGJA 5ISZB 5CJ5A 3KS0J 4OGYL 2BVPB 3ZKMD 3VFTB 4PRPE 3RBGA 2OLDA 2CRZA 4AIZB 4O9HL 5CP3H 4Y5YA 5T33L 4G8EA 4GLRH 3B2UD 4Z7WE 4C56E 1KF9B 4Z7QE 4J23A 1R24B 1NH6A 3BH9B 3VU2A 2VH5L 3CFJA 3MLYL 4R7NB 1LEKA 3H9HB 4MHHG 4OQTH 2WK2A 4WFGE 2Q20A 4J3OC 3CFBA 5MENA 4ZFOA 3KJ6L 3DHMA 4E42A 3QUMH 5M7QA 5DD6B 1YPZE 2E8YA 2CGRH 3RGHA 1XF4A 1JHKL 3P4NB 3DRQA 3KXFA 3U36A 3U4BL 5HDOA 2UUDH 1Z2KA 1CR9L 4UOW1 3LD8B 4JFPA 3GJFH 3QUKB 3KPMB 4R96B 5FYJL 5LGJB 1KB5A 5DEFB 1F6AB 4C54A 4O9HH 2FX8L 1A22B 3VMNA 1BLNA 1MOEA 5CEXA 1YMHA 3LN9A 5HBBA 4LLMA 2DWDB 2KPNA 2VXSL 3Q48A 4U6YB 2WBJD 2VH5H 3MLYH 3FRPA 4AIOA 3X3FH 3MRCA 3CUPA 4ONHB 3BUYA 3KJ6H 1AD9A 4MJIE 2MHAA 1JHKH 2GJ6E 2ZG1A 3U4BH 4PJGA 1CR9H 2YBRA 3ZHLA 3QXAA 3IRPX 4N1CA 4OZHE 4Z7VA 5FYJH 1TPXB 5SWZD 2A6JB 2R1WB 4FQCL 4HQQL 1WFNA 1KYOK 1REIA 2XN9D 5FO7B 4FQ1L 4L3EE 4E9LA 2FX8H 3TN0A 1Y0LB 5I8KH 4UBDD 4PJBE 3F5WA 2C4FU 2VXSH 1L6ZA 5T5FL 4BFIB 4R9HA 5GJSL 4LRNH 3FB8B 1OQXA 3VWJB 4R7DB 5HGHB 3PJSB 4JANA 1UGNA 4QHLA 1X7QA 4JRXE 2AJVH 5FA3A 1IGJA 1TFHA 3QIUC 2EIBA 4X99A 4HMDA 3PP3H 4P4RA 4FQCH 4HQQH 4Y5XC 4CUCA 4QXUL 4PRIE 1OARL 3I9GL 3HS0A 2V17L 4JM2D 3DGCR 1BFSA 1TVHA 2R2BB 5T5FH 1NKOA 2CDFA 3DX9A 4NO5B 5GJSH 4FFVC 1LO0L 3FQWB 1XGRA 1QLFB 3BYYA 3A6CL 4RQQB 3FQNA 3LN5B 1GH7A 4PJ5E 3ZTNL 1Z9MA 3VFVA 4GJTB 3H3BC 5TDOB 1G7MA 2Y6SC 1A7NH 3P77A 1OCWL 4BSJA 4PBVC 1CL7H 4MVBD 3QEUA 3QDJE 3PGDA 3I3EA 2BP3A 4EIZC 2GUOB 4QXUH 1XF2A 2JJTA 3I9GH 4XX1E 3TNNB 2V17H 4L8DB 1T04A 2FECL 3Q2CA 5EU7C 4GXUN 1ETZB 2Z31D 1YDPB 5DO2C 3OX8A 3QH3B 2XN9A 3M07A 4NP4L 4PJCF 1T1WA 3D69B 3BWAA 4HHAA 4WUKL 1A8JH 5MEQB 1J7VR 1F