5A16A

Crystal structure of fab4201 raised against human erythrocyte anion exchanger 1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
226
structure length
226
Chain Sequence
b'EVKLQESGPGKLQPSQTLSLTCSFSGFSLTTSGIGVGWIRQPSGKGLEWLAHIWWSASKYYNTALKSRLTISKDTSNNQVFLKIASVDTADTATYYCARAYYGNYGGYYFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB4201 HEAVY CHAIN
publication title Crystal Structure of the Anion Exchanger Domain of Human Erythrocyte Band 3
pubmed doi rcsb
molecule tags Immune system
total genus 41
structure length 226
sequence length 226
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2015-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5a16A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5a16A01
1HCFX 3QCTL 4KJQC 4NN5B 4X4MA 4Z7VF 2NZIA 3VCLB 5JXEC 3KWWA 2FD6H 4Z18A 1OTUC 4QTIL 3LV3B 2AEPL 2SEBB 2CRIA 3WFDL 1E28B 3K8LA 2Y07H 5GRZA 1WICA 5HGBA 1EEUA 3UBXI 3FN3A 4XVJH 1XGRA 2KDGA 1OAKL 1Y6MR 3QCVL 1I1AD 3Q6GL 2R56L 3TVMB 2B1HL 5GS0C 3BGAA 1Z0NA 2NZ9C 4L3ED 5EOTA 2R2CA 3D0LA 4U6YB 1QYGL 3DROB 1ZA3A 2GUOB 3RL2B 4OFDA 3BAEH 4C55A 3BD5A 3T3MF 5CSZA 4S1SH 3HE7D 4OGAC 1XCQA 1YPZB 3NCEB 3U30C 4Z7WF 4MQXD 4WV1A 3SDCA 1FVCA 1XGTA 1EFQA 2FJFB 4PJXE 1OM3L 1JIBA 1T2JA 4AH2A 2OJZL 1CU4L 1MFAH 1Z6JT 3WXVH 2EZ0D 4CRPA 3MACL 2F54A 4NQXA 5IJVB 3VMNA 5IW6B 4G43B 3A6CH 1T6VN 4X6CF 4CJ1A 2Y36L 3FN0H 2F8VA 1FRGL 5HPMB 3QDGE 1KCRH 4NJ9L 3SE3C 3TV3L 4UV4L 5LAXB 3MJ7B 1MI5B 3NN8A 3C9NB 4JN1H 4HUVA 2FBOJ 4G7VH 3HLAA 1FIEA 4NJAL 2A9NH 1NMCC 2DLHA 4JFDB 4Y5YC 3WXWH 3PL6C 1XF2B 3VRJA 3C2SA 2D7QA 4UUJA 4OLXL 2FECL 4MB4A 3K4ZA 4M1DL 4G6FB 2BNQE 2O5YH 4NHCL 1L9NA 2QSVA 1FL6A 4KJWC 5D2LB 3MCKA 1FG2A 2AXGB 2IH1A 1OSPL 1KXQE 1TIUA 3SJVE 2AJYH 2AK1H 1HILA 3S37L 3TH2T 4IDJH 1MHEA 3BN9D 2RAMA 4S0TD 1DQJA 3QHZH 1OWRM 3UO1H 4LARH 5IFJA 4P2CG 2X5PA 2A6DB 3L5WB 4NQDB 5HHVL 1F3RB 4JE4B 2OCFD 5E8DL 1KTLA 2FGZA 1RHFA 1TJGH 3ORJA 3OAYK 3BMWA 1IC5H 3OKOA 4YDKH 1Q38A 3MRRB 1R0AL 4JM2F 3Q6FB 3WMSA 4NCDA 4D0DA 3LH2H 3QXWA 3MTRA 1LK2A 2FHFA 3B5HA 2HTKC 4G5ZH 3OAZH 1MCRA 5C07B 4N0UE 3U9PL 5F7NC 1A4JB 3ULUC 2MQ0A 4QRTB 5ACLA 2XWBA 4XAWL 4HIJB 1H0DB 4Y5XB 1PBYA 4F58H 5SX4H 3JUZA 4XB8A 3GSNB 4P2QE 4X98B 4FQXA 3LKPA 3ZO0A 3RGVC 5ADPL 4HKBB 4X83A 2H9GB 5EOCH 3ARBA 4J23A 2VZ1A 3D69A 5HGHB 3GB7B 2GSIA 4OCXH 2WMPA 1WEJL 4AT6B 4N68A 3B9DA 1KJ3H 4EKXA 4ENEC 3QIBA 1FSKB 3FQXA 3AFLA 5F3BB 1T4KB 2B20A 4U1KA 5I17B 3WHE1 2OMNA 3TESA 2VAAB 4HGWA 4RFOH 3HMXL 1CF8H 4IMLB 4O5LL 4FQPA 4FXLA 3HR6A 4JG1H 1VEPA 3SE8L 1S9XB 4Y8AA 4OLZL 4HBCH 1DBBL 3SDYH 1NEUA 4QXGL 3JV6B 3B4NA 3TA3B 4YDVA 1AD9B 4K8RC 2E8ZA 5M7QA 5FOBA 2Y1VA 5BRZA 1ZE3C 5JHDB 4P4RB 2XQBL 1I7RA 1A2YA 1GGCH 1II4E 1NFIB 2JB6A 4GRLD 5FA3B 1MJ7L 2B4CC 2K9UA 4XH2B 1I7TA 2ICCA 1F90L 5F9WB 4DEPB 4NO2A 3MNWA 4D9RD 4KRNA 1T0NA 3ILPA 4JLRA 2QQKL 1B6UA 5E7BA 1I7UB 2RBLA 4M93B 4ZS6D 1ZWIB 4N1CA 1JK8A 5BV7H 1WK0A 2F54E 4BFIA 4K7PX 4P23A 2ESVA 5EC1A 4D2NA 3RWFA 5I1HH 1S7XB 2OMBA 3EJYC 4JQIH 2EDYA 2NY4D 4WGVB 5EOQH 2VZTA 1VESA 1NFDB 3BMVA 4WRLA 3OJVC 4YAQA 3VXSB 1SJHA 5ETUA 5D1XA 4NT6B 2ZNXA 5H37H 1FVDB 1U91B 4Z7VB 4HDIA 1N7ML 5IM7B 4DGYL 4LAQL 5E6IB 4I3SH 2VXVH 3P4MB 1YMMA 2GJ6E 3P11L 5GSRB 4M6NH 3DMMD 3BP6A 4P5TC 4YDIH 3P73A 3VGBA 5I1LA 1DQLH 1EEZA 1FPTH 2D03H 2QHLA 5LBSL 4J8RB 4N5ED 1U8QA 1HXYB 3W0WA 4CVXB 2ENYA 1MHHB 5ILTL 3FB7B 3LQAC 4LQFL 2V2WA 4TVPE 5E7FA 1PKQE 4RZCA 4OZFH 3P0VL 5DJCA 5T3XE 2PO6C 3CH1B 1VFOA 1CL7L 1CR9H 1TFHA 5IKCB 2LE9A 3P4OA 3MLVL 5TE4H 3GRWL 3IAGC 4MA3A 1UACL 1S7RA 2K7QA 4R2GC 5JW3H 4F33A 4I3GA 3FQWA 3NMEA 2VC2H 2ZJSH 1NGWB 4Z7WB 5C0CE 5K33A 3OJDA 4PUBL 3VFPB 3UZVB 4JKKA 4KAQH 1T2QL 4HK0A 5B38A 4PRPE 5C08B 1JBJA 1J0IA 1AP2B 5F93C 4LMQI 5B4MC 4P46B 2JB5L 4KV5E 4DGIH 3LS5H 1DQQB 4JRYB 3WEXA 4PRHB 2HT3D 2D0FA 3MA9H 4X6CB 3MLWH 3BGMA 5E9DB 3W5MA 3G6JA 3WD5H 3GM0A 2YK1L 4KQ4H 1TVBA 4XC3L 5GPRA 3NFSL 4TNVF 4WEBH 1OARL 2Z8WC 5DHVH 4OIIH 2X89D 4I48A 4P48A 4LSVL 4PV8B 5I30H 1IC7H 3F7VA 3QPQD 3AC0A 2VKXA 1CFBA 4ODHL 3O4LA 4HS6B 2ZKHH 3KHQA 4FFYH 5I74C 4MAYC 5IOPB 4MSWB 2EDEA 3GBLA 1U8NA 5DR5H 2EDLA 1TTUA 1DQTA 5E8OB 3RPIA 2IJ0C 2NY1C 3HB3C 5CCKH 2A74A 2HKFH 1UWEH 1JNLH 2E7BA 1Q9OA 4KJPD 5JIPA 4G6KH 3ZKMD 4JZJC 4BQ8A 3SO5A 1MHPH 2OZ4L 3DUSA 3BKJH 1U6AH 3VGGA 3JSSA 3FO9B 3O6FD 1J1XH 4XI5C 1M6OB 4Z8FL 2H6PA 1A6VL 4FQ1L 1X5LA 1JGUL 1ZSDA 4GAJH 4DKEL 2V7HB 4D9QE 3VA6A 2PYEA 5DJ6A 4GG8B 2X42A 3ZKNC 2VXUH 4F37K 3KPQA 1XH3B 3FFDA 4JM2B 5I6XC 4YHIB 4J3TA 4U1HA 2PW1A 1BGXL 4LPWA 3SDXE 2FIKB 3T0EE 3MV9E 1XIWC 1RK1B 4Y19B 1P7KB 2OJEA 2ICWJ 2X41A 5JLZB 1R3LA 3T04D 2Y4SA 4N90E 2PYFA 1QSFA 1B2WL 2ESVE 3U4EB 2QADB 5ADOH 1QBBA 5IBUG 3DRQB 1IE5A 4KC3B 1TNMA 3CFCH 1INDL 5J0BA 2H2PC 1IC1A 3G08A 2NX5A 3MFGB 4WU5A 3T0BA 3TO4B 4JM4L 4F15C 4PGDA 1AO7B 3V8OA 2Y9RT 2VWEE 1T5WA 2XY2A 1XCTB 3MC0A 1D6VH 1A21A 4YBLC 3OR6A 1HYSC 3DBXB 3FTGB 5F7DB 1TQBC 3M8OL 3ZTJG 3N85L 5L6YL 2OTPA 5I73B 4R7NB 3VFTB 4PRID 5MERB 5IBLD 5MP6L 4Q0XH 3ULSA 1HE7A 4MA7L 5T1MB 3MRLB 2XWJA 1QSEE 5C3LD 3D39B 1PSKH 1OW0C 1AJ7L 3EYSH 1OB1B 4JFXA 1C16A 2DIJA 5IVZA 1Q9LB 3ABZA 1KIRB 1AKJA 3NPZB 4FS0A 3PWVA 2FBJH 2B5IB 3IYLW 3CJJA 1VFMA 3VXME 5GGTA 3ARDB 1Q94A 4QRSA 2BVPB 1QHOA 2G5RA 4KTDH 4JPIB 3MNZA 4KRLB 4X6FB 5A3ID 2IAMD 3PWPB 1ZGLM 4N8CH 4NKMA 3UXFA 2VLRA 4DVBB 1WJ3A 3MRBB 2RHEA 4R3SA 4XMKH 3L3HA 4MNGA 3G6JE 5EO9A 3E1F1 1H3UA 1BECA 3H9SD 3MLXH 5EB9A 5CP7B 1A7QL 4QRQA 2I27N 1PJ9A 4NN5C 3VFRB 1P9MA 3HNVH 2CPCA 1E6JH 1MCPL 4QTHB 3O6MH 3CMOL 3O4LE 4LNVA 5CJQL 5A2LH 4BH7A 1TVHA 2FWOB 1A6UL 5ITBL 1WWBX 1XR8B 2VLMD 3KR3L 1BFOA 4KKBD 2P7TB 2R0KL 2AV1B 3OGCB 1S78D 4M7ZC 3RBSA 3QHTC 3TVMC 1HZHL 1UWXK 5EBLB 4UIKL 1AD0B 4ZSOB 4JJHA 1Q72H 3RA7H 3MJ9A 5I1JL 1MY5A 3QDMB 1NBVL 25C8H 4QHMB 1OT2A 1BWMA 3C6SB 2XZQH 2Y5TB 3LKNB 1YN7B 4R96A 4XBPB 5C0EA 5EU5B 2QSCL 3IFLH 4M5ZL 5IIEA 3UDWC 3ZLQC 1W0VB 1ZLUK 2EDWA 2I5YH 1S7VA 4KUCF 3ESUF 1OP3H 4N0RA 3VXUA 2E9JA 3KWWB 2DM4A 2PYEE 2P48B 4PJ8A 3UTPE 1MWAH 1M05A 4LCWD 4N8VB 3C6LD 5TF1L 1EHLL 2WWMC 4JO2L 2BJMH 1NC4D 4HGMA 5HGBB 2VNCA 3L1OL 3CD4A 1AXIB 1KG0A 4PRNB 1ZGLP 3S34L 4KWUA 3BRDA 4KVNH 3D3VA 4NKOA 1L9MA 5EPMA 1ZA3B 1ZLSL 2BZDA 5GRVL 1BBJB 4PLJD 4HUWA 4U05A 1G9EA 5CFHA 3TJHD 2QLVB 5CSZB 1EX0A 3IKKA 4G8FA 4XNXL 4OFVA 1C5BL 1MJJA 1XCQB 4K7PH 3QUYC 5KN5A 2CMRH 4YGAB 1JZ3A 3RWHA 4GH7B 1FVCB 1XGTB 3HI5H 3W9EA 3O9WA 5CEYB 1JRHL 3JTTA 3OMZA 3TT1H 1EGJH 4G6AD 4NQXB 3DRTA 4WTZG 4UAOC 2Z4QA 4TVPL 3K7UA 4R90L 1U3HA 1CIUA 3G6JF 1PEWA 3GIZH 5T3XL 4MJ5B 5D7JC 1XR9A 3KJ6H 4Y2DC 5FM4A 3NN8B 1A7OL 3C2AH 4HUVB 1CD9B 3HLAB 2I25N 4GBXA 1RMFH 5GJSL 2FX8L 2BVUA 3MLUH 4X7DC 3VRJB 1SEQL 3LEXA 2YKLH 4QCIA 4AIXA 2N1KA 4MA1B 1WCBB 1UJTA 4M02A 4I77L 1A0QH 5JXAL 4LGPB 1FL6B 2DLFH 4ZUTA 3MCKB 1FG2B 3MLSL 2IH1B 4HIIA 4Y8DC 4Y5XC 1YYML 1T3FA 1JI2A 3QDJD 1HILB 3I50H 4X7TA 1DQJB 2VLRE 5A2JH 4KZEL 2W9DL 2NLJA 1WT5A 5IFJB 3D9AL 3GJFH 3TF7C 1RUAH 3HE6C 4P2RD 2E6JA 4I4WA 4YFDB 4YC2C 5EIIA 1B3JA 1KTLB 3O45A 2W91A 4NUJA 3HUJB 1FSKC 3FT3A 2VYRE 4OIAA 3GSVA 3OKOB 3D2UA 3SDDA 1UKSA 5HHOD 4ELMA 1ONQA 2ED7A 4MMZC 4GRMA 4UOW0 5DMGD 1LK2B 4IRSD 4EI5D 3KYMA 4N0YL 5DJ2A 4H20H 5KVEL 4XCFL 2BVEA 1T0MA 3QB7C 2YD1A 2WQRA 5EC2A 1D5MA 4FQXB 1F3JA 4FFWC 4XWOC 5I8KH 2I07A 3LKPB 1R3IH 2F5AH 1P6FA 2DTSA 3OXSA 4ZD3H 1AFVH 3ARBB 4EBQH 1ZOXA 2LAGB 3D69B 4WO4A 3BGFB 1A3LL 1NANI 4OF7A 5DJYA 1I4FA 4PREB 4XPFL 2O93L 2VDOL 3SO3C 2ITDA 5DYOA 2DMCA 4CW1A 5J11B 3QIBB 1WIPA 1F4AA 3CMGA 4M7LL 4F9LC 3ARED 1AC0A 4U1KB 4LLUA 3T4YA 1X6NA 4HGWB 1RUML 2VR4A 1D5XA 1JI1A 2AK4D 2CK0L 1RUQL 4MJ2A 4PY7B 4UILL 4LVNB 3CXDL 3EOYG 5ICZA 3F12B 3HAEA 3LDBB 4YDVB 4UI2A 5IB3A 5D1ZA 1U8HB 4YHLL 5FOBB 3D3VE 1LDPH 1A3QA 5BRZB 1P7HL 5AUMA 2P4AB 5F7FA 1I7RB 1A2YB 3QUZA 6CGTA 5DD5L 1S7SA 5F1KC 5C92A 1WBZB 1AR2A 1I7TB 4TNWF 4NO2B 3MNWB 1T0NB 2VZSA 4JLRB 4NKIH 4HIHA 4J3UA 4BH8A 3FCTA 3QQNA 1JNNL 4L9DA 1JK8B 2D9CA 3ULVF 3HPLA 4MJ6B 3PNWA 4HWEL 2PCPA 4BFIB 3BRFA 4P23B 5EC1B 3HRZA 3VRIB 5FUCC 3RWFB 5BS0E 5GGSA 1SEBA 3NAAL 1DQDL 4JQVA 5EZLA 2V2XA 2AEIT 4HD9A 3C8KA 3C5ZD 4NN6B 5GGQH 4BFBD 3ZYOA 4JN2A 1SJHB 5ETUB 2ARJB 2ZCHL 4WCYH 5D1XB 1F11A 4ZAKD 2VH5H 2X05A 3VXRB 3KPLA 4JGMA 5EU4A 2E7LA 1FIGL 4NYLA 3VFOA 1GVIA 5KSAA 1YMMB 4P46C 4NWUL 5B22A 2W60A 3BP6B 2APBA 3P73B 5I1LB 1EEZB 3FT4B 2DM2A 4OD3H 1U8QB 3W0WB 1S5IH 5IGXL 3RTQD 3MUY1 1AXTL 2V2WB 4RZCB 5DJCB 1VEMA 3IETA 5DZOA 3DSFH 4WI5A 5ESQA 3KXFE 3P4OB 1UB6A 3HNSL 4NQCA 5BQ7A 3HMWL 2QV2A 4MA3B 2FO4A 1S7RB 1CLOH 1GSMA 3X3FL 4OQ1A 1J1OL 2R0ZL 4F33B 3FQWB 1JF5A 3ARGA 5E94A 3OJDB 4UBDC 1CFNA 2X09A 4HK0B 5B38B 1WZ1L 3O2VL 2EC9T 2IH3A 4GQ9L 1KIQA 5DSCA 2YPVL 4Q6YA 4X6DA 4LSPH 5HDQL 4PG2A 3VW3H 3WEXB 5L2KA 3JWDL 2XY1A 3BGMB 3ZE2E 3LKQA 4LVEA 4WFHE 4ZFOB 2EE6A 1NMAL 3HZMA 3AS2A 1AY1L 3PWLB 4PYGA 2EH8L 4OGYL 4I48B 5T33H 3GHEH 4LRNL 3CX2A 2ADJA 1TTFA 3F7VB 3GI9H 3WUWG 3NA9L 5IFHH 1UJ3C 4JM2C 4Z0BL 2YUVA 2QQNL 5EO0A 4XPAH 2I9TB 2ZUSA 4F7MA 5EORL 4Z0XA 4AEIL 4NN7B 1W72H 1S9YA 4K94H 5I1IH 3RPIB 3RNKA 4IJ3C 1CFTA 1NANH 2HP4A 1Q9OB 2DQIL 1RFDH 5J56B 5KS9A 4OD2A 1UQSA 3SCMA 3S96A 1Q0XL 3DUSB 5T1LA 3WLBA 3Q0HA 2HA1A 3KLHC 3TO4C 4HS8H 3CK0L 3PGFL 1JTOA 2R9HC 4K9EL 4PGBA 1ZHBA 3E8UL 3QWQB 3A6OA 2I24N 1A3RH 3GSWA 2O5XH 4M6OL 1OGAD 5DJ6B 2M8XA 3BN3B 3G5ZA 4F3FA 3MCLH 1MY7A 4K71B 3KPQB 1SQ2N 3U2SA 1ITCA 5E5RB 3UTSD 4PGCA 5KVFL 4U1HB 4Y4KC 2PW1B 1CFQB 4U1SA 3WHE0 1NKRA 4KHXL 2OJEB 1R3LB 5D9SA 2WZPD 1KJ2A 2PYFB 1I85C 4Y4FD 1QSFB 3C60D 3GGWB 2Q8BH 2NY5L 1N64L 4WU5B 2NX5B 4OLVL 5C0IA 2GHWB 2BNRD 4PJIA 2P5EE 5CD5C 4UT9H 5GGTL 1AIFA 2H2SC 1T5WB 2CIIA 5EA0H 1KN2L 1DVFD 3VH8G 1I1AA 1A47A 3CZFA 3PDDA 4LLAA 3THMH 5F8RC 3ZE0E 4HJJH 4QOKD 3RX7A 3ZE2F 3H9HA 4WW1B 3EO0A 1UC6A 2V9RA 3SBWC 1C5CL 3T2NL 2P45B 3ULSB 4WNQA 4NNXA 2XWJB 2OI9B 1VDGA 2GJJA 2OS7A 3WFCH 1MAKA 1FO0B 3HE7A 4XBGA 4JFXB 4EXPX 1RUPH 4WGWB 1C16B 6FABH 3V6FA 5IVZB 4YHKL 3G6AA 5E5MA 3QUXB 3G9AB 4PJBA 3PWVB 5GQBA 1F00I 1QACA 5A1AA 1CS6A 1D5BA 3QIWD 1Q94B 4QRSB 3Q3GB 1A64A 2D9QB 5CEZL 3MNZB 4OBSA 4FQHA 2AEQH 5SWZB 5AZEH 1TZHA 3SKUD 5LGHL 4X6DE 5J13C 3TLRA 3VFSA 2XTJB 2Q6WA 1DLHA 5E70A 2YD6A 4XAKD 5FO7A 4NKMB 5K9QI 2FYYA 4JPVH 1X4XA 4R3SB 4HUUA 3L3HB 4MNGB 5H2BB 5EO9B 1FGNL 3BQUC 4U49A 4DVRL 1P6AB 2GYSA 4QRQB 1E4XL 4BQ6A 3CLFL 1J8HE 1IGFL 2VN7A 2NY7L 5FHBH 4NO3B 3SN6N 3B8SA 4KI5E 3UJTL 1IC4H 2C7UA 4G42A 1TVHB 4BH7B 2ATPA 4WJ5A 1BFOB 5IMLA 1NUDA 4YHOH 2GEEA 1IZKA 1PW3A 4K7PY 4NQED 5IROA 3A67H 1ZGLA 4XMPL 4W6XB 4ETQA 1NCAH 4MZ2A 3MREA 1JPTL 4WW2A 5KS9E 2AQ3A 1LQSR 1AI1H 1T7WA 4R96B 4ODVL 3LD8B 3WKML 4LL9A 5C0EB 2BVQB 4UB0L 1BEYH 3QQ4A 5IIEB 1FNSL 3D87B 4WV1C 2X10A 3SDCC 2BCKA 1S7VB 1P4IL 1XGYL 1NGPH 4OM0L 4U6VL 3VXUB 2L0DA 3HNTL 1ZT7A 4NO5A 1HKFA 4H26B 1M05B 1RULL 2ZUQC 2W9EL 4JFPB 5L8LB 1LK3L 1Z9LA 4UV7L 5TDOA 3NZHL 1OQOA 5E2WL 4FQCH 1SY6A 3RVUD 1RZ8A 5ACZB 5JZ7C 1QBML 1MLCA 5J8OA 3O3AA 1PLGH 1QRND 1YDPA 4DK6A 1KG0B 3D3VB 4NKOB 5EPMB 5CSGA 1MAJA 1OTSD 3QG7H 3PHSA 4O4YL 5C0BD 4PLOB 5IVOA 4JKPL 3KPSD 5SX5H 5D7LD 4RA0C 1EBAA 3WDJA 4G8FB 5C0JA 1MCHA 1MJJB 1QLEH 3WNOA 3MV01 5KN5B 1IFHL 1IGTA 3RWHB 4ZOCA 2AABH 4XMLH 4GW1A 4J1UA 5DMIL 3W9EB 3O9WB 4X6DF 3JTTB 4LSDA 5ALCL 1MELA 2MQ3A 3DRTB 2QSTA 2Z4QB 5ABDE 1AR1D 2DKMA 2NY2D 4H0GA 4NNPH 1HXMA 1KNOA 5E00A 4GRLA 3BFOA 1F4WL 4GBXB 2Y7QA 3C87A 4YHYC 4WVRA 2F58H 3TCXA 4XCNA 1K6QH 2R69H 4KI5F 1BLNA 4KK9C 3LEXB 4PD4K 4QCIB 3EDKA 1RZKL 4LSSH 1WTGT 4C57C 4TULH 5LXGL 4HLJA 3BDYH 4NQTA 5JR1H 2KH2B 4HK3N 5I1CH 4QKXB 3LVEA 5CZXC 4HIIB 1BQHA 4S2SB 5EDXA 3EHBD 3T4AB 4GOSA 1T3FB 4FQXC 5KS9F 4K23H 1L7IH 2JF1A 4X7TB 1IAIH 3NCBB 2KUTA 3ARBC 4GMTL 5JNYA 2WK2A 2VXSL 2VE6A 3CLEH 1RVFL 1WFTA 5DGQA 3I75A 4I4WB 4PGEA 1QEWB 4G7YL 5EIIB 5INCA 4XP5L 5FDYA 3O45B 1HDMA 2BSTA 5J11C 4NUJB 1NLBL 4PJ9D 1BJMA 3DMMA 3FT3B 3L5JA 3O2DH 2OR7A 3B2UD 3GSVB 1V7MH 3SDDB 5F70A 1IGCL 1NAKH 4ELMB 4Q6IC 1ONQB 3WN5A 1JYXA 3D6GA 1VERA 1J8KA 3KYMB 2Y25A 5DJ2B 1T0MB 5F1NA 2GFBA 5IB2A 5I19H 5EC2B 5MEQA 4Y4HC 4HH9A 4HT1L 4QRUA 3S6CA 4E41E 4K3EL 4C83A 1VENA 1EFXB 4W6WB 1S9KC 2C5DC 2Y23A 4K3JH 4OZ4B 5LGJA 3OXSB 1PVHA 2FHBA 3HC0A 5I8OH 4HPOH 4WO4B 4QNPE 4X9BA 1QBLL 5DJYB 4PJIF 1H8NA 1I4FB 5JIKA 1FV1A 3FRUA 3NFPA 1Q1JH 4LCCA 4L9LA 3V0VA 4G9FB 4HKXA 2L7UA 1JZ8A 2ITDB 5DYOB 4CW1B 1CFVL 2B1AH 2ZSWA 5T5FL 3T0EC 1EA9C 5F44A 3RWDA 4LLUB 1G0YR 4XVUC 3KPOB 1D5XB 4FNLH 3IDXL 1DBJH 3BSZH 2ZCKH 3T2QA 3HS0A 1ORQB 3D18A 4P23C 4LVOB 5ICZB 2V6HA 3MRJA 1BF8A 1QPPA 3HAEB 4MDJA 5DD0H 3ALWA 2X89A 1DBAH 1YECL 5IB3B 5D1ZB 3FT2A 5DF0A 3UTTB 4N9GA 1EVUA 2DLTA 2AJSH 2VWEC 5AUMB 1WUNT 4O02H 1DTUA 1S7SB 1T1ZA 1DBKH 3OG4B 4I3RH 4U6XA 5BVPH 4K55A 5FFLA 4YK4B 1N26A 1QFWL 3MBED 4HIHB 2IAND 4BH8B 4S1RL 1VB9A 3FCTB 5IHZB 3F8UB 1X5XA 4FFZL 2DQHH 2J4WH 4S1DD 3R1GL 5DWUL 3Q2CA 3O6FA 1KCVL 3HG1E 3PNWB 5D6DA 3IDNA 5I75C 3IFNL 4YPGA 4N5UA 3PQYD 1JZ6A 5GGSB 1SEBB 1UG9A 2NXYD 5EZLB 2AV7A 1VSCA 2DMKA 2V2XB 4D0BA 4GKNA 2DJUA 3IAPA 1J0HA 1SM3L 2A1WH 2FB4L 5FKAA 1TCMA 4JN2B 1I1FA 1F11B 4D9RE 5EBWA 5I16A 2IPUG 3KLAA 3KPLB 4I1NB 5EU4B 4IRJD 2AI0H 4N8PA 3VFOB 1SJEA 1YNKH 4V2CB 2HT4C 1D7FA 4GRWE 4X4YA 4Q7DA 2J8UE 1JL8A 3V9FA 1N0XH 1DBMH 2CUHA 2W60B 5DMJB 5F7YC 3AAZA 2NY0B 1V3JA 5KSBE 2APXA 4PG9A 4PY8J 3BPNC 4WW2F 4OLWL 4JPWL 3VE0A 4ZPTB 5FM5M 5DT1H 3K2MC 8FABA 1C5DB 1UYWL 3IETB 1S7UA 2IQAB 3K81A 4P0DA 5ESQB 1YEHH 2OP4H 1UB6B 4NQCB 4MD0A 5DO2D 3BEVA 4QRRB 2W0KA 5DQ9A 4HJ0D 4QYOA 2XRAL 4FQQA 2C4FT 1X5YA 4NN7C 1CGSH 3ARGB 1AGBA 5E94B 4PRIA 1UWGH 4BM7A 4OTXL 3WS3A 1FG9C 5D71H 2PF6A 4H8WH 1CLZH 3OL2A 1KIQB 5DSCB 1JF1A 4X6DB 2X40A 4PJEA 1V8HA 3RRQA 5DRXB 4CMHB 3JWDC 4CKVX 5L2KB 4EN3A 1ADQL 3LKQB 1H15A 2D0GA 4HGKC 1TXKA 3N1FC 4JFED 4AQ1B 3EYOB 2VDPH 1RZFL 1GC1L 3HZMB 1AQKH 4NO0D 5HI4C 4PJAB 1OAUL 2CUMA 2VDMH 5GHWL 2MTPA 1JHLH 1RZJH 2HLFD 2ADJB 4K71C 4BZ1H 4LBEA 2FX7L 1DQML 3SOBH 4HJGA 4PD4J 5I15H 4F7MB 3HC4L 1A8JH 4PB0L 4Z0XB 1IM9D 3WDHA 1ZHNA 1VPOH 2IAMA 2Z93A 2Z9TA 5ALBL 3HR5A 4PBVC 3TH3T 1S9YB 2J8OA 3RNKB 4NSKA 1A6WH 1NCCH 3H9SA 4LIQH 3VGHA 3UJJH 4IMKC 2J6EL 3SDAC 1UQSB 3SCMB 5F96H 3FOMA 5D8JH 3S96B 3V4PL 4BELD 5T1LB 3WLBB 1N5YL 1IRAY 1RSFA 2HJKA 2EDFA 2WBJC 4PGBB 1ZHBB 1T66C 5J3HC 3W81A 1YYLL 3X11A 3I2CL 2XN9D 1IGIL 3IXTB 3GSWB 5EUKA 4DN4H 4P2OD 4FQ2L 4GRWF 1RIUH 3G5ZB 4F3FB 2J8UF 2IFFH 4XP4L 1NAMB 4YHPB 4WY7L 3U2SB 1FH5H 1BVKB 1LO5A 2VZUA 5FYLH 2D4DA 3EYQD 4PGCB 1IEBA 4OZIA 5TQ2L 1K4DA 1GZPA 1X4YA 2OI9C 4U1SB 3AM8C 3K1KC 1XF3A 3LHPH 5D9SB 1KJ2B 3C08L 2MOVA 3DX9A 1XZ0B 4HCRH 1HSBA 2JIXD 4IOFD 3G04A 2NY5C 2VDLL 2X4SA 4LCUA 4RGOL 1ZLWK 1TQCC 1CVSC 3R8QA 2AKRA 4LCWA 5C0IB 2BMKA 3ME0A 3C6LA 1G7LA 4GLRI 3BKML 3KHOA 4PJIB 2C3VA 3S97C 4CU6A 4FA8A 3R4DA 1AIFB 5F1IA 4MA8H 3UBXA 3O4OB 1NC4A 1RK0B 2CIIB 3SKOA 3DX8A 3O2WH 4I9WD 2FO1A 4H1LH 4FP8L 1I1AB 1JPGA 1RZ7H 4P3WA 3CZFB 4OCRH 1Y6NR 2XTJC 4YXKH 4L3EB 3GI8L 3ULVC 5E99L 3H9HB 4UQ2A 2VDKH 3EO0B 4X9GA 5IBTL 4OM1H 3DXAB 4NNXB 3BRGC 2GW5A 2XT1B 5DURD 2IG2H 3G6DL 3U79A 3K8KA 3TBYA 3HE7B 4XBGB 1P9MC 2HKHL 3GMQA 5TE7L 3QQ9D 5E8NA 4NC1E 1KFAH 3V6FB 1FL3A 2ARWA 2EO1A 4ZNEA 7FABL 3G6AB 5E5MB 4BSJA 4OB5L 3EJZC 4LASL 4PJBB 1MIML 1X9QA 2PR4H 2YMXL 1Z0MA 4NCC1 1D5BB 3GZKA 2YD5A 4HXAH 3WLWC 4FQHB 3FRPG 4WI3A 3RVXD 4YXLH 3VFSB 2Q6WB 1DLHB 1UWXH 3JWOL 5FO7B 3I6GB 1IGMH 1F6AA 3ZHLA 1XGPB 3JVGA 2FYYB 2R2BA 4KPHH 4HUUB 3HZKB 4LLDB 2BSED 4MYWB 2AJUH 4F80A 5KJRH 3HI6H 3KS0J 5F7MC 1MCOH 1YQVL 5ANMA 1E4KC 4PJ8C 1GJIA 1NLDH 5CHNA 1ZLUH 3SPVA 4P3CH 1I1RA 4OI7A 2ATPB 3QDJA 5IMLB 4OCLC 3V4VL 3E3QE 4OGZA 3BPLB 3WO4C 1ZGLB 1BP3B 4Z7NE 5CIPA 4ETQB 3ZSSA 5FCSH 3MREB 5IVNA 4MD5A 4O9HH 4P2RA 3RX5A 1AE6H 5GGVY 3V6BR 5FV1L 1RIHH 4AMKL 4MNQD 2ADGA 1RD6A 4R4ND 3M1BA 3QQ4B 1MRCL 4X9FA 1YEDA 1U8MA 4JGJA 4BUGA 2Y72A 3S3JA 1G84A 1A5FL 1INEH 4IIQA 3KGRA 4IRSA 4LGSB 1R5VA 5DLMH 4EI5A 4NO5B 3O9WC 3MOAH 5DZNA 1OCWH 5TDOB 3RVWC 1S8DA 1HQRB 3C09B 2P24B 1U3HC 4PJ5D 1MLCB 1LILA 1CTOA 5KANG 4OZIE 3O3AB 5C8JA 1YDPB 5DC4B 5J57B 2HAZA 2LAAA 1MFEH 1P1ZA 2CKBH 4YR6A 2XTLA 3TZVD 2D7NA 2E7CA 4P57B 2COQA 4JR9H 2I9LA 4RBPK 2YD3A 5C0JB 5GRYA 3AREA 3RVTD 1NMBH 4M43H 3TT3H 3GHBH 4DQOH 2ZCLL 4NOFA 2ZUYA 3FJTA 2AK4A 1FBIL 1IGTB 5TE6H 4GW1B 5GRVK 4MXQD 4J1UB 2P43B 1OAXH 4PJEF 3KYKH 2YD7A 2YRPA 5C09D 2DL9A 3WJJA 4UT6H 2EE9A 5JOPE 1CE6A 1C12A 4OFPA 1GIGL 4U6TA 1H3GA 5E4EC 5EZOL 3NCFB 2ZG3A 1WT5C 2CKNA 4XCEA 4G8GD 3V7MA 5HHQA 1HXMB 1R5WA 4NHUA 5A2KH 4HMCA 4XB7A 2H41A 1DUZB 1KNOB 1KB5L 5E00B 4ONFH 4GRLB 2Y6SC 4YHML 4NM8L 1KJVA 2Y7QB 3KYNB 4MB3A 5D1QD 5C0NC 1BLNB 3VJ6A 1IZJA 1YUHA 3GNMH 4ZNEE 1X5ZA 3GO1L 1RZKC 3SDDC 1EUUA 1P53A 2VQ1A 3FHAA 5FK9A 1IGJA 2BC4A 3KPMA 2NYYD 4NBXB 5AEAA 3VI3E 5L0QC 1RY7B 2CUIA 4X99A 4XP6L 2YPLE 2XQYG 3TJEH 4Z7NF 1BQHB 4Y0GA 3SY0A 4UDTA 3PP3K 4L4VD 3EJJX 4GO6B 3PGCA 2NY4B 3K2UH 3PABA 2D2OA 5I1GL 3C5ZA 2EKJA 4OD1L 3K8MA 2DIBA 4NRZA 5JNYB 2V2TB 2VE6B 4ZAKA 3WNPA 4UNVA 3I75B 4PGEB 4U1NA 3REVA 3ULUH 5INCB 3RHWK 5CUSL 1HDMB 2BSTB 2VLJD 2ILLA 2X1XR 3LB6D 1AO7D 3DMMB 1FYHB 1MUJA 3VXNA 4UOJA 4TUOA 1QQDA 3R0NA 4KK6C 3WN5B 3BD3A 3RTQA 1QSVA 4OZIF 2ADFH 3K4DA 3MRMA 1MIEH 4XNZC 5IB2B 2D0HA 1IGYB 3UCRA 3P0GB 1HHGA 1REIA 4P2RE 4QRUB 1PYWA 2FATL 1PG7H 4C83B 4OSUL 1F97A 1RIVL 1OAZL 5LGJB 4M8QA 3QUZC 3HC0B 3UBXG 3CFIC 4S10A 1FV1B 3FRUB 4CU7A 5DA4A 3NFPB 4LCCB 3SKMA 4L9LB 3V0VB 2B7DT 2GJZA 4HKXB 3H7LA 1G9MC 2EXYD 4QT5A 5EZJA 2JLLA 2W0PA 4YK4C 2OK0L 4U7KA 3SGDI 1BQLH 3WNKA 1LGVA 3S4SG 1HNFA 2ZSWB 4JFZL 2NQCA 2Y07L 3RWDB 2XKUA 1FYTD 1DSFH 4XVJL 3DO3A 3EZJB 3HS0B 4OT1H 3D18B 1GGIH 1D5ZA 2BRRL 2F8XC 3MRJB 3FFCD 4JDVA 4POYA 4J4PD 4MDJB 1G6RL 5FYLD 2YEZB 4XPGL 5D7SH 3CDCA 4N9GB 1U92A 3WNNA 5CMAA 4BZ2H 3BAEL 2FEEL 2VJXA 3BP7A 4AK1A 4EEEA 5H37G 3IXAA 2E7LC 3CFBB 2V5YA 2ZOKA 1T1ZB 2G75A 3IDIA 5KSAC 2FSEA 5I0DA 1N2RA 2Z91A 3NBNA 3JWNC 4M1GH 3EYUH 3L5HA 4YH6A 3K1DA 1MWAA 3WXVL 3ZHDA 5JTWA 4I13B 5HYSA 3QUMH 3EYFA 3FN0L 5EG6C 3O6FB 1KCRL 4OZFG 1FAKT 1KLGA 3IDNB 4FMKA 3ZYZA 4GS7C 4YPGB 3MV8E 4JN1L 3VD4A 3WE6A 4G7VL 2AV7B 4D0BB 1WBXB 4GKNB 2OR9H 3WXWL 1OGAA 5KVDH 2X70B 5FKAB 3DVGB 4ORGA 5D93B 5FYKU 5EBWB 2EDXA 5I16B 3NH7H 4LPCA 3KLAB 3UTSA 4IS6A 4EIGB 5E2TH 3LQAH 1SJEB 3STZA 2Q3ZA 1DDHA 4X4YB 1J5OL 4PG2C 4P5MA 4HPYL 3QXAB 4Y4FA 4JRXD 4TUKH 1ZAGA 2IMMA 1JV5A 3AAZB 4EVNA 5J12C 4OF3A 1EGJA 2CH8A 5D2NA 4DTGH 3C60A 4IDJL 3RI5F 4RRPA 3S37X 4PG9B 3WUZA 5IFAL 1T1YA 4RGMB 4GG6E 1LO2H 1Z9MA 3QHZL 3VE0B 3EIFA 2BNRA 8FABB 5DJXA 4XGZA 5HJ3A 5I18L 2RQ8A 4KI5C 5C0AD 3BJLA 1NCBH 1S7UB 4E5XA 1AHWA 3VRLE 1KEMH 1DVFA 4MD0B 1TJGL 4WWKC 4B7IA 3S88L 1A7RL 1WAAA 3BEVB 5AZ2L 5DQ9B 4QYOB 4KU1A 3QEQE 5IB4A 3LKSB 4FQQB 1IC5L 2EEDA 5MI0C 4PJDA 1LE9B 1Q9KA 1AGBB 3VWJC 3QFJD 4PRIB 4QOKA 3WS3B 3LH2L 3S98A 3VD7A 5DQDL 4WFGD 1JF1B 4PJEB 1LO0H 2KBGA 3EBAA 4HWZA 4F58L 3P9LA 1UM4L 1JWMA 4PJ7A 3EW3B 2VTFA 1H15B 2DBLH 4HIEA 4NFDA 4LCIH 1GC1C 1NCUA 1R6VA 3GJFA 4KJQD 2ERJB 1UM6H 3QIWA 1OTUD 4YDLC 5MENA 1JTTA 4LBEB 1OGTA 2J2ZA 1RJCA 4GKOA 5DFWH 1F58H 4XNMA 4LMQE 5E08L 3I3EA 5DQJA 5FDWA 5GS1A 1OAYH 2IAMB 2Z93B 5KBNC 1TJHH 3HR5B 1T20A 3VGDA 5DFTA 4RFOL 1CF8L 5TPWH 5DRNA 1JYVA 1FO0H 2GCYA 3VFUA 5L8JB 2NZ9D 4NSKB 3RFZC 1F8TH 3H9SB 2VZOA 3N50A 5B8CA 1Y0LA 3FOMB 2RCSL 2DOCA 4L4TD 1N59B 3IDJA 3WFHA 3SGDH 1HKLH 1ZVHA 5DUMH 1MH5B 2HJKB 3F58H 3BDBA 3WJLA 3RZCA 3M17A 1GGCL 4G6MH 3X11B 1IT9L 4GSDL 2IADA 1ACYH 4NZJA 5I1EL 5EUKB 4R4BA 1X6LA 1I1AC 3V0WH 4LKXA 1A9EA 4FTVE 5IG7A 2JCCE 1K3ZA 3IS1X 4NQEA 5DK2A 3SE4C 1MRFH 4WU7A 1LO5B 3GKWH 3ARPA 2NNAA 4CMMA 1IEBB 4OZIB 3JBG7 4TSBL 5EBGA 1K4DB 1GZPB 4YBHA 3BZFA 2YA2A 5E1HB 5HYJD 4IOSD 4Y1AD 2DQUL 4MQXC 3G04B 5ESAA 4POUB 5EOQL 2X4SB 3WIHL 1QOKA 4P9ML 5I1DA 2P49B 3OWEA 4DJMA 4LCWB 1OF2A 2BMKB 2FECI 2MWCA 3F5WA 1G7LB 4BQBA 2C3VB 2J12B 3UBXB 3O6LH 1NC4B 1YJDL 4HF5H 4JVUA 3DX8B 3SKOB 1I9EA 4I3SL 1BIIA 4O00A 1QRNA 5CILH 1JPGB 4M48L 4M6NL 2Q86A 1YEGH 4KTEL 5HHMB 2D03L 1T1XA 1F6FB 3TPKA 1BHGA 1V7NH 3H8NA 4XPTL 4JHWH 4P99A 4UQ2B 4TNWK 2F53D 5BV7B 5D2NE 4HQQH 4L8DA 4WI7A 1FP5A 4X7SH 3U82B 5DI8B 5D7LA 2X9WA 5DVOA 1H8SA 1ACZA 1CK0L 1FL3B 1IL1A 1TJIL 5TE4L 1CVRA 1FNLA 5JW3L 1BM3H 3ARFD 2VC2L 3FQTA 4PJDE 5C86A 4MXVE 4KAQL 5IROC 2H1PH 3ULUD 5T1DL 2A6JA 1IKFH 1KENH 1JMXA 1YY8A 2CQVA 3T8XA 5D7IE 4WW2C 4RX4D 3VFVA 3QNXB 4PJ7E 1NGQH 2R2BB 3CVIL 3RGVD 1RU9H 5GRWA 5IESL 4OZGE 4G80A 4L3AA 3KYOA 3U0PB 5BMFL 2UWEA 5AYQA 4LFHD 3HTLX 4G8EA 5KVMC 4NNYA 5L7XH 5ANMB 2FCBA 2JCCF 4ENED 1WTLA 5MENE 5CHNB 3SPVB 3VXRD 4CDHA 5IWLC 5JIIA 3QDJB 1VGKA 1UVQA 1OD9A 4ODXA 1I9IH 5ENWA 1KELH 5C2BH 5CIPB 2Z35A 2JJSA 4K8RD 4MD5B 1MHPL 5JDSA 4ZTPH 1JPST 2AEPH 1KUMA 3FN9A 4JVPA 3WFDH 3CAFA 4PJ9A 5I1AB 3QWRD 5ITFB 2ADGB 2F8OA 2ZSVA 1K8IA 1OAKH 3QCVH 5HHOB 3Q6GH 5IVXE 3RBGA 2B1HH 5FYKD 1GHFH 4IIQB 4IRSB 1R5VB 4EI5B 5T1KA 1WF5A 3CDGA 1S8DB 1N3NA 3BUYA 1INQA 1W72A 1O7SA 5C8JB 4RMUA 1NKOA 1P1ZB 2W07A 3EUUA 4YR6B 4GRLC 3MCG1 1P84K 2DTML 2ZP0T 4OIBA 1C7TA 1T21A 2MHAB 1OM3H 3BO8A 4DN3H 1HSAA 2OJZH 2BVTA 1U8IB 2ORBL 2I9LB 3MACH 2YUXA 3WFEL 5B3JE 4LF3A 1WAAF 4EQ3A 2J1KA 3MV7D 4ZS6C 5SWSD 2WQ8A 1TITA 2Y36H 1HINL 2NY3C 3AREB 5E2VL 1FRGH 4R0LC 4PJDF 5IV2A 4MXVF 3MJ8A 4NJ9H 1D6VL 2AK4B 5D5ME 4AQOA 1G9NC 4KUZH 1QUNA 2N4IA 1QRNE 1EZVX 5D7IF 4X9HA 4HH8A 4NJAH 2O61A 3T2OA 1VGEH 1CE6B 1C12B 4PJ7F 4UTAH 3ZDYE 4D3CH 3UYRH 4F7PA 4OLXH 4OZGF 4XCEB 3IDGA 3G9VA 4M1DH 5HHQB 1R5WB 2PO6D 1BZQK 1XF5B 3EYSL 4HIXL 1SJXA 2WUBL 1AGCA 5FGCB 3VU2A 4ZXBA 1KJVB 1ERNA 1OSPH 1CDCA 2BXZA 1E27A 3DMMC 1YUHB 3BKCL 4NZTL 2VQ1B 3S37H 5FK9B 4OLUL 2IANA 4Q58C 4OCYH 1IGJB 2BC4B 3KPMB 3DJ9A 4U7MA 8CGTA 4O58L 4X99B 1G7QA 4PRDB 4JZNA 5B4MD 4KTDL 3O6KL 3SY0B 4UDTB 4MJID 5HHVH 3PQYA 4RNRA 3PGCB 5ACMA 3AY4A 3LPWA 3QI9D 3MRHA 3C5ZB 1I9JL 5ISZD 4NRZB 3MLXL 5FGBA 1JNJA 4ZAKB 3P0YL 5FA4B 3QNZA 3U9PH 4LSQL 4XAWH 4MAYD 2D7PA 3SE9L 1JYWA 3O6ML 1KTDA 3NABL 1BD2D 1MUJB 3V5HA 3VXNB 4TUOB 1S7WA 1QQDB 4OF5A 5D72H 5ADPH 4NQVB 3RTQB 1KJMA 5GS0L 3DIFA 3W11C 4U6YA 2WP3O 4XX1E 3RA7L 3RL2A 1HHGB 3QPQC 4PPTA 1CDUA 5IF0A 1BZ7A 5DD6A 2VR5A 2XZQL 4MDIB 3NGBB 2QTEA 3QXUA 2F19L 1MCIA 4L8CB 3FZUD 5B3JF 4M8QB 1CI5A 4FFVC 1EO5A 3MYJA 4O5LH 1PEZA 4X6BA 1XGQA 4POZC 3ZKND 3DUHA 2GJZB 1J12A 2BNUA 1I9RL 3GFUA 4QT5B 1CT8A 4OLZH 5EZJB 2EDTA 1DBBH 3MRPA 1ZTXL 3SHSA 5IJVA 3U7WH 2HMIC 1JCKA 1X5KA 4CUCA 4KK8C 3ZL4L 3SKNA 2XZCH 1XIWD 4PRAA 2XQBH 5EUOE 5SWZD 4XXDA 4JFEA 4HC1L 1MJ7H 3WS6C 4NO0A 5J89A 2P8LA 3OKDB 5EZIL 5D6CA 2H2PD 2QQKH 3KS0H 5CMAB 5D93C 2BHYA 3SQBA 3BP7B 3AXLA 4Z76A 5FCUL 4YPJA 1IM9A 5AD0B 3U1SL 3WV0A 2G75B 5D2LA 5C9JA 4K7PL 1N2RB 3BYTA 3LSOA 4RGND 4CGTA 1HYSD 2M26A 1ZEAL 2Z91B 4PJGA 2P5WE 5M94B 3EOTL 1MCSA 1MWAB 5A2IH 3L3IA 1HWHB 4HUXB 3TT1L 1JZ2A 5HYSB 1IARB 2VXQH 3L7EB 4RGMC 5GZNC 5LWYH 1HN1A 1U41A 3PJSA 3BE1L 1KLGB 3QULA 1N7MH 2E9WA 4DGYH 5GS2H 4JFHE 4XXCA 3LOWA 2UWEF 3P11H 3WE6B 4TVSa 1KGCE 2XN9A 1CXIA 4JCLA 4P2OA 1OGAB 4LCYA 4XHJD 3PXJA 2VIRA 3MLUL 4M3JA 5LBSH 4ORGB 5AYUH 3Q6FA 4C58B 1WFOA 3E0GA 2IMNA 3UTSB 5ILTH 3GMLA 5B21A 5F6IB 1HHHA 2HWZH 1LEGB 1DDHB 2GTWB 4XX1G 4QRTA 2Z0BA 3B9KC 5DFVC 4F8TA 2W92A 3ARQA 4HULB 3MMEA 4Y4FB 4X98A 4EN3C 3MLVH 4EVNB 1A6ZA 2JIXA 3C60B 1T1YB 2HYMA 1LD9A 4ACPA 1Y18B 5BOZG 4CVWA 1KTRL 2BNRB 5DJXB 1T2QH 5HY9A 5HJ3B 1RUAL 5EU6D 1P84J 4E5XB 1AHWB 4P4KC 1NAMH 3BVNA 1A14L 2GK0A 1DVFB 4GAYA 4C56D 1I3UA 1BQSA 5A3IC 5IB4B 2IAMC 3OKMA 2VAAA 3BESR 3E3QC 1Q9KB 4QOKB 2LV4A 1X5IA 2DQTH 4XC3H 3Q5YA 1OARH 3LZFL 2CO6B 4M6AA 3EOBA 1FAIL 4HWZB 3ARUA 1MCWW 4KDWA 4GXVL 3P9LB 1JWMB 4ODHH 2ICWA 4IDLA 2WP3T 4HAGA 5KAQG 5JHDA 2EIBA 3X14A 4JHZA 4JO4H 1NFIA 4ZD3L 5FA3A 1AFVL 4ODUA 4KKBC 2B4CL 4Q9BA 4R8WL 1YPZE 3QIWB 1OGTB 1FLRL 1MSPA 4XNMB 4GMSL 5HDBE 2A83B 5J6GB 2WWMD 3ILQC 1ZVSA 3O2DA 4JGUA 3TN0C 5FDWB 5DQJB 1F02I 5GS1B 3DV6A 5EN2A 2R4RH 2P8MA 1T20B 4RIRA 1A6VH 1LHZA 4JREC 1JGUH 3VFUB 4OLYL 1HH6B 1MI5E 3G5YA 5I71B 1ORSA 2LTQB 1Y0LB 4LHUD 4ZO6A 4JFDE 4GAGL 3VXSA 3IDJB 3WFHB 2N56A 1LDPL 3C6LC 3B6SB 1BGXH 3M17B 2IADB 3QUYD 5D96C 1CTNA 2XNAA 3U0TA 3QHFL 5IMKA 5GSRA 4ZODA 2CRMA 2HJFA 4R4BB 4LKXB 1A9EB 5D2LE 5TQ0L 5IG7B 4DUWA 4NQEB 1K9TA 5DK2B 3ROLA 1MCLA 4NKIL 4WU7B 1NEZG 3QA3B 1HXYA 3TWCH 2NNAB 5HVGB 4UTBL 5BV7C 1INDH 1ZT1A 3F7RA 4PLJC 3BZFB 2D7OA 5D7JD 4Y2DD 5IEKB 3MJGX 4MNQA 2XPGA 1EUTA 1DP0A 3O0RH 4LNRA 4LEOA 4NM4H 3IJYA 4YQXL 4NQDE 1EFXD 5ESAB 4MQ7A 1KCSH 3M8OH 1MAMH 2XN9E 5L6YH 2VLKD 4WCYL 3F5WB 4HUNB 5MP6H 3VFPA 2VH5L 1NDGA 4PP2A 3ZHKA 3RKDD 4PJ5A 3ALPA 5C07E 1BIIB 2DF3A 4L5FL 1AJ7H 2Q86B 3MRGA 3TZVA 4TRPL 1T1XB 1G6VK 5J1TC 1F5WA 1HH9A 3MODH 2PETA 4L8DB 3W39A 1DANT 2BHZA 5C0BB 3H9YA 3KPSB 3HE6D 5D7LB 4HLZG 4WFFD 1WIUA 4X0KA 4A6YB 1YPZF 3UTTD 3AROA 1S7TA 5BO1L 1IL1B 3LPFA 4MSWA 2FDBP 4F7CB 3UPAA 5BW7C 4ZYKA 2VABA 4JEGB 3FQTB 3OPZL 2CRYA 4Z7QF 1QFHA 4JQXA 1LEIB 2MJWA 2A6JB 5CLTA 3VG9B 1A7QH 4YUEH 4KZDL 5BXFA 1YY8B 4G8GA 3T8XB 3VFMB 5CJ5A 3CGTA 5ID0A 1KC5L 4PR5A 3VW3L 3IS0X 4XWOD 3VFVB 4FFWD 5LCVL 1RZIA 5BCAA 1MCPH 2IPUK 5D1QA 5JHDE 1D3CA 1A6UH 5ITBH 4G80B 3PV7A 3KYOB 5IMMA 5HGDA 2UWEB 5C3TA 4LPVA 3IDYC 2Q20A 4G8EB 5IJKC 3GHEL 3ARVA 4EI5C 2Z8VC 4UIKH 5D2LF 1XH3A 5E5UB 2J7LA 5F9OL 1UH3A 2JKXA 5D70H 4PJGF 4L4VA 4RFEA 4XPAL 2AERT 1RZGA 2EDJA 1LEKB 3QRGL 5BVJA 1A02N 1CYGA 1VGKB 1UVQB 1W72L 1P7KA 2QSCH 1X5FA 4FZEH 5ENWB 4M5ZH 2Z35B 1ZVYA 2JELL 3WIFA 5DJAB 4I0PC 5CJ8A 2ZG1A 2HFGH 5DVKA 3O3BB 1KT2B 3AB0B 5SV3A 5JDSB 1NFDE 4GKSA 5ERWA 5TF1H 1EHLH 3VXSE 2VLJA 4PJ9B 4KKAD 4JO2H 1FCGA 1AO7A 1G1YA 2DM3A 3AREC 2ZSVB 4J3VA 3N9GH 2RJMA 5K59F 4Z7VE 2AXFA 1A3RL 5CWSA 2A9ML 3SGKC 3FTGA 4QRRD 4RBPH 1CGTA 1SVCP 1G0DA 3S34H 3WO3B 4R7NA 5MERA 1UCTA 4DKFL 3WJJC 3CDGB 1ZLSH 3DSNA 2EH7L 1N3NB 3BUYB 1T83C 2WIIA 4XNXH 3TNMA 3D85B 1C5BH 1JHTA 3OAUL 3A0OA 5D7KE 1RURH 4RAHA 1JFQL 1KIRA 5MHSE 4PLKD 1HSAB 2ED9A 2XKSA 2AJVL 1U8KA 3ZKQD 3BIKA 5CZVH 4LF3B 4NBZB 1CICD 2VDNH 3CVHL 1OT1A 4R90H 1NBYA 5GS2D 4H88L 3RL1A 5IV2B 5T3XH 4JB9L 5EA0L 1VKXA 1T04A 1FYTA 4UIMA 4XRCB 5DEGA 1A7OH 2FX9L 2W0LA 3SQOH 3EFFA 3FFCA 4LEXL 2O61B 4JFFD 3THML 4J4PA 5GJSH 4PRHE 4HJJL 4X6CE 5E9DE 3C5ZC 1B90A 2EYSB 4F7PB 4MHHI 5HYQA 3IDGB 4ZAKC 1EHXA 3LMJL 3TBVA 3U48A 3PGDB 3WFCL 5E95B 5GGSY 4XT1C 5JXAH 5GISL 5SX4I 1LP9A 4HCRA 1RUPL 3MLSH 6FABL 2R1YB 1E27B 1DJSA 3ZTJH 3QPXL 1NCNA 1YYMH 4DK3A 1XR8A 5FECB 5K9QG 3MBEB 2IANB 2GK2A 5CINL 4UBDD 3LRGA 5TFSL 4KZEH 2W9DH 5IK3A 1G7QB 4LLYA 2M1KA 3VDBA 4H1LA 2AEQL 2P42B 3NACL 3PQYB 5DD1L 3AU1A 4RNRB 4NC2B 1NFDF 1VACA 5EU5A 3GJEA 3RWCB 4L3CA 3AUVA 3PDOB 2VMFA 3KYAA 3NIGF 1I75A 1CE1L 3QNZB 4KKLD 4IRJB 5KVEH 2EIZA 4EDWH 1M1SA 2XA8L 3KVQA 4N8VA 4Z77B 1YEKH 4Y5VA 1KTDB 5DC9B 3V5HB 4JRXA 4EQ2A 1IAOA 1S7WB 4X6EA 3VGEA 1K85A 4YHOL 1E4WL 2YZ1A 3OB0H 4PRNA 1KJMB 4D94A 3ZT5A 4Y19E 4JDZB 1A3LH 4ZPVA 3DIFB 1OAQL 1A6AA 4LGRB 3S5LA 4PJCA 2VDOH 5C0AA 2PXYC 3KLHD 1BBJA 3DXAD 4XWGH 5IF0B 3X3GH 1BZ7B 5DD6B 4XCCL 5I1KH 2R9HD 1HOCA 3S3SA 4ODSH 3QEUB 4NP4L 1AO7E 3MYJB 3T09A 1RUQH 2KQNA 3OX8A 4UILH 4X6BB 2KL6A 4BK4A 1HQ4A 1XGQB 3J8F7 2BNUB 1FE8L 1CT8B 1IAMA 5CEYA 4OI8A 4OZHB 5GXBB 3L6FB 2DLGA 3MRPB 4J6RL 1QD0A 1FGVL 4Y4KD 4JY4A 4XNYL 1A1MA 3SKNB 4PRAB 4MJ5A 4JFEB 4XXDB 4R97B 3B83A 4QWWC 3D39E 4NO0B 3BIBX 2P8LB 4HK3J 5D6CB 1XFPA 3BP5B 4DOHB 3QG7L 3MGOB 3FQNB 1M7DA 1WCBA 4Z7UA 3AXLB 4Z76B 5CD5D 2H2SD 2AVGA 1IM9B 4D0CA 2UZIL 1QLEL 4CU8A 5CAYB 2ZUWA 3CPLA 4QXTA 5C9JB 1JZ7A 4HG4K 3LSOB 3DETC 3SJVD 1M4KA 4B0MM 3L7FA 2AABL 4PJGB 4UNTA 2NPLX 4Y4FC 3S9DB 1T6WA 3GSNL 3QJFA 5D2NC 3L3IB 3QQ3A 3C60C 3PWPE 5GGVL 5JQHC 5DJDB 3BWAA 2R39A 3TCLB 1B0GA 2HH0H 4L4TA 2ZCHH 1YEEL 5T3ZL 3PJSB 4K2UH 3QULB 1VFBA 2FZ3A 2CKBA 3MRCA 3MGAA 3QCUH 5FO8B 4O2EB 2G2RA 2XKNA 2XN9B 4NWUH 3HUJA 35C8L 4P2OB 1J05A 4LCYB 1K6QL 2VIRB 5C0RL 5JOFA 2EKSA 1U9KA 1OSZA 3T0AA 5HPOA 4LSSL 5IGXH 1Q0YL 4TULL 3AS1A 3GMLB 2QKIB 2O26U 1HHHB 5B39A 3SE3A 4P2QD 1MCWM 2ZG2A 4Y88A 4ZSOE 5HYJA 3X12A 3MMEB 1BZ9B 5DDHA 2H45A 4Y1AA 3HNSH 1A6ZB 4NC0B 3HMWH 3QDME 5TDNA 2JIXB 1YN6A 4X8JA 5DVNA 3X3FH 4HW6A 1L7IL 3BQUD 1J1OH 4R26H 1UM5L 1LD9B 4ZQKA 1KB9J 2R8SL 2X9YA 4PREA 4IM8A 3CLEL 1WZ1H 1RUKH 3O2VH 5HY9B 2ZPKL 1GPOH 3QIWC 4GQ9H 4X4ME 2YPVH 3F62A 3BVNB 2GK0B 1RJZA 5HDQH 4GAYB 1JE6A 4QHKJ 3JWDH 3OKMB 1CZ8L 3P40A 4PY7A 1G7IA 2FGWL 2F53A 4EZMA 4RA3A 3F12A 3N0PB 1KBGL 2EH8H 4U0RB 3VGAC 1XEDA 5DURB 5B8CC 2LTQC 3EOBB 5H94A 4EI6A 4YE4L 4F7TA 5I19L 1U8HA 5L2JA 3NA9H 2ICWB 1E0OB 4Z0BH 3KG5A 2QQNH 1DN2A 3JZ7A 3CSYA 3X14B 3RZCC 1DUYA 4AEIH 3OAZK 1CDBA 1MFCL 2XQYK 3ARFA 1WBZA 4ODUB 2DQGH 2FL5A 4PJFA 2PUQT 1EZVY 4WFEE 1GGYA 4O51A 1ZVSB 4WFGE 1MJ8L 2B1AL 2WLZA 3DV6B 1J86A 5EN2B 3NCYP 4RX4A 5JZ7D 2P8MB 4MJ6A 3CK0H 3PGFH 4RIRB 4K9EH 5JHLL 4FNLL 3E8UH 2G9HB 3RGVA 5JW4M 3BSZL 2ZCKL 3VRIA 3IAQA 5E03A 1H9VA 3G5YB 1ORSB 4M6OH 3Q1SL 2HG5A 1NPUA 2HVKA 1LP9F 3U46A 4KROD 1S7QA 5E1AA 2ARJA 3UC0H 3QEGL 1QNZL 2QHRL 2AJSL 5KVFH 3CSPA 3VXRA 1XGUA 5BZDA 2AP2A 4O02L 2GJ6D 1OP9A 3AS0A 3RVUC 2ZUVA 4KHXH 1DBKL 2XNAB 3U0TB 5IMKB 2E7HA 2HJFB 2VRAA 2WAHA 1Z3GL 4U1GC 1CBVL 3ROLB 4KMTL 1KOAA 3FT4A 2Q7NA 4YXHL 2W65A 4GAFB 4TVPD 1NGYA 1N64H 3OKNA 1ZT1B 2J4WL 1SBSL 4JKLA 1IEAA 1OLZA 5T3XD 4OLVH 2X7LA 3QWRA 4MNQB 2XPGB 2GSGA 4LNRB 1AC6A 4LEOB 1KN2H 1I8MB 3IJYB 3P9MA 3BDXA 1RQ5A 4Q97A 4MQ7B 4N8VG 5EO1B 1UZ6F 5C0CD 4ZO7A 2A1WL 3HUJE 2H8PA 1F2QA 5JPMA 2DDQH 5CS7A 4PRPD 1NDGB 4PP2B 1C5CH 4MLIA 4XNQA 1AR1C 2NY2C 3BT2H 5CIPH 4PJ5B 4M7JL 5INDA 5CZXD 12E8L 2X6MA 3E6HA 2FHCA 3IJHA 1N0XL 3MRGB 5TJWK 3TZVB 2X4RB 3QFDA 1UZ8A 4NWTH 4ALAL 4F9PA 4ZFOA 1WC7A 3QUMA 4Y7MA 1CDIA 1HH9B 3W39B 3MLYH 5DHXB 4GUPB 3PWLA 3OKYA 1KF9B 5DT1L 3MV7A 2IPTL 5SWSA 4X0KB 2JE8A 3ZDZE 5CEZH 3HI1A 4F7EA 3IFPA 4ODWA 1S7TB 2WNGA 3B8YA 4Q9QL 5LGHH 2V7NA 2I9TA 4ZYKB 2VABB 1PX4A 4HBQA 1CGSL 4P9HL 5C09B 1UWGL 3RNQA 3V4UL 4DVRH 5CGYD 5D71L 2UUDK 3QSKB 1CLZL 5BXFB 4G8GB 1IGFH 3AB0C 4HFWA 4Y4HD 5ID0B 4PR5B 2PO6A 4U7SA 3S35X 4Z95L 4FQIH 4L8SC 4I2XA 1RZIB 1UADC 4JDTL 3UJTH 4FQLL 2NY6C 4PJ9C 5D1QB 3STLA 5BRZE 2VDPL 3B2UC 3UTQA 4D9QD 1B4JL 5LGKA 1EK3A 4Z7UF 5HGDB 5J1AA 32C2A 5IMMB 3VXQA 2BOCA 2VDML 3ZKXB 4MLSA 4XMPH 1CXKA 3V5DA 1P4BH 2DYPD 3H3KA 5F7KC 1FZJA 3SOBL 1JPTH 3T0ED 4MJIA 4L4VB 5BZWA 4RFEB 3MV9D 1RZGB 1CFQA 2XZAH 5BVJB 4XVUD 4N90D 3WKMH 3RDTD 3GBNL 3QI9A 1CGVA 4ONGL 1UEYA 4UB0H 5CP3A 4E9LA 2E3VA 5HYIA 5IT2L 2FJHA 1FNSH 5ISZA 3WIFB 2E9IA 3GGWA 4U6VH 3HNTH 3QP3A 2AJZA 5D8JL 2NTSP 3P2TA 4F2MA 1MFBL 4MZ3A 4GKSB 1RULH 2W9EH 2CO7B 5ERWB 4LHJB 3VXOB 2UYLA 4MAYA 4XNUL 3HUJF 4UV7H 2VLJB 5IQ9A 5IP4A 4KUCD 3NIDE 4BYHA 1BD2A 3VXRE 3H42L 1QBMH 2AXFB 1YNLH 2HFTA 1MRDL 3GIVA 5CWSB 5EU7E 4HWBA 2OL3B 1YMME 4YX2L 4X80L 3EDEA 2RGSA 4APQC 2EDBA 5E56A 5GZOD 1QFWI 2E6PA 2IQ9L 4CN4A 4JZJA 4WW1A 1QSED 4O4YH 1A1NA 2JJUA 2CR6A 3L3KB 3W0WE 4PTUB 1BJ1J 1QA9A 3T65A 1TPXC 2WIIB 3I9GH 3FQRB 2OXHA 3TNMB 5I9QC 1FO0A 5KW9L 4J3XA 2PTTA 1JHTB 4LVHC 3ZDZF 4HCRL 4ZXBC 3QUXA 3QO0B 3L9RB 5DMIH 3VXMD 3ZMRA 1U8KB 3BIKB 1GGUA 1CN4A 4OQTL 2VSDA 5ALCH 2A38A 2WIMA 3IRZA 3A6BL 4F57L 1UCBL 1NBYB 4W4NA 3RL1B 3Q3GA 3DUUB 1MPAL 4JG0H 4M6MH 4MA8L 1JN6A 1MEXL 3F65A 4FMFA 1XIWA 1VKXB 1T04B 1FYTB 4UIMB 2QBWA 5DEGB 5SWZA 1D6EB 2OLDA 3QAZC 4CVUA 1RZ7L 1FZOB 1UGNA 3EFFB 3FFCB 1F4WH 3RWGA 2NXYC 1K5NA 3RUGA 3HRPA 4MCZB 1SMOA 2BK8A 3D0VA 5H2BA 1ZMYA 1RZKH 4OM1L 5HYQB 1LO4L 3TBVB 2DB8A 2IG2L 5JOEA 2Z31B 1LP9B 2FR4A 4NO3A 3ZTNL 2BERA 3O4LD 4ELKA 4PJFF 2R2EA 3NIFE 2DBJA 3ULUF 1NL0H 4KTYA 1QZ1A 1X3DA 5IK3B 4IRZL 4AJ0A 3GUTA 1L0QA 4LLYB 4HXAL 1RVFH 4P49A 4H1LB 1OW0A 4LFHG 3S36L 3B5GA 4G7YH 4YXLL 1CQYA 3AU1B 1IGML 3M45A 4I2XE 5DO2C 1VACB 2BVQA 2DM7A 1ED3A 3GJEB 4HJ0C 4L3CB 2JJWA 1IGCH 1BVZA 3NIDF 5BOPA 3M07A 5KJRL 2PYED 4K07A 3UTPD 3GMPA 2Q7YA 2N7BA 4NOBA 4Z6AT 2MQCA 3R0MA 2EIZB 4H26A 4RISL 3EAKA 4JFPA 1NLDL 4Y5VB 4JRXB 5GJTL 4AIZA 1IAOB 4UDUA 4K3EH 4MJIE 4X6EB 2Q87A 3BYYA 5ACZA 5HBBA 4U1LA 1EVTC 4KY1L 1Q9WA 4Y16D 4ZPVB 2XIDA 5HHMD 5DEZA 1KPUB 1A6AB 3S5LB 4UMGA 1QSFE 5DGRA 3SDAD 1PZ5B 4PJCB 3STBA 1EV2E 5A40E 5EU6A 2DQJH 2HLFC 5C0AB 5ECJE 1AE6L 5HGAA 2FJGA 4KGJA 4NGHH 3N1GC 1UFUA 1CFVH 1BFTA 4MXWH 1NCWL 5T5FH 2WBJD 1HOCB 2NX5E 5J3HD 1RIHL 5B38G 1JGLL 4Y89A 1NFKA 3L3DA 3W2DH 3IDXH 3OX8B 3QFJB 1HQ4B 4M8VA 1YEJH 3QJHA 5DLML 4HSQA 4TSAL 1PKOA 1YECH 1OCWL 3P4NA 4JY4B 3LRSA 3W9DA 1A1MB 4ESKA 2IF7A 4S0SD 4DZBB 4D9LL 1MCDA 3UDWA 5F9DC 2UVEA 1NC2D 1G7JA 1QFWH 5SV4A 3NIFF 4S1RH 1M7DB 4Z7UB 3NTCL 2UY6A 3OKEA 1KEGL 3EYQC 2YHGA 5DWUH 1FORH 4BUHA 4D0CB 4M43L 1KCVH 3CPLB 2DQEH 4QXTB 3TT3L 3IFNH 2EE2A 4S2SA 5KZCD 5TE6L 5C0FA 2DAVA 3L7FB 4NZUL 1LWRA 3T4AA 4UZGA 5SWZE 2MPAL 1MCJA 4GXUN 3QJFB 2VLRD 2XTJE 1YNTA 3QQ3B 4IOFC 1SM3H 3RWIA 5C7XL 4LHUA 2YD4A 4UT6L 1MREL 3BWAB 3ULVE 3VFNA 1B0GB 4L4TB 3RIAF 5DK3A 1JF6A 2YUWA 4MNGE 3RPKA 1OWWA 4EOWL 1VFBB 4LPYA 2FZ3B 1QEWA 4R6UA 2CKBB 3MRCB 3U30B 4H5SA 1RAMA 2AAVA 3LS4H 3QUYA 2G2RB 2XKNB 1J05B 3EJZD 3IKCA 5JOFB 2KKQA 1BFSA 2EKSB 4RGNE 1OSZB 4ZO8A 1NUNB 3UEZA 3DTXA 3VDAA 1CDGA 3O8XD 4OLWH 5CEZD 4KMQA 1EMTL 5B39B 3VMOA 2XZZA 4U0RC 4JRWA 1UYWH 5D7JA 4Y2DA 5DRZA 2YUZA 1DANU 3TA3C 5HYJB 3UAJC 4W70A 3X12B 4X5WA 5DDHB 4OCWH 4Y1AB 5TDNB 1YN6B 3K2UL 1EFXA 4X8JB 3ZT6A 5IHLB 3EFDL 3GMNA 5AAWA 4OZ4A 4IHOA 2VLKA 3ARTA 1BOGA 5C2UB 4ZQKB 2DWEA 4M62H 4OTXH 4QLRA 1KLFA 5CLWA 5F9WC 3IU4H 4DEPC 4G9FA 4JFOA 4PJ8D 4PJHA 3VXUE 1RJZB 3S35H 1PD6A 3ARYA 1SYSA 4M93C 4U3HA 2EDKA 3RVXC 4OKVA 1ADQH 5DA0B 4FZ8H 4XPBL 3KPOA 3GJFK 4YJZL 4U6HA 1G7IB 1RZFH 1ORQA 4LU5L 2F53B 1JMZA 1FNEB 1GC1H 2ADFL 1T0PB 1OAUH 4ZS7H 5GHWH 5H94B 5FM5O 4EI6B 3HE6A 1OVZA 1X5HA 4F7TB 5L2JB 3UTTA 3ZYJA 3X13A 5FUZL 4JAMA 3B5TA 3V79C 1K4CB 1DQMH 3RVVC 1HIML 1KULA 4DWHA 4HS3A 3CSYB 1DUYB 1KCKA 3BEWA 3HC4H 1ND0A 4PB0H 5ALBH 3T3PE 2X4PA 3ARFB 5E6IC 4YDJA 1VCAA 5F71A 2XXCB 4GQPH 4QEGA 2FL5B 4PJFB 1WQVT 3LIZH 2K3TA 2OTWA 2J6EH 4AEHL 5IHZA 5CSBA 2MCPL 2BFVH 5FM8A 4O51B 3V4PH 1N5YH 3KJ4B 1U3HD 1KCLA 4QHKI 1P2CA 3EO9L 4G3YL 4GW5A 3RUGF 4RAUA 2CGRL 2J88H 5BS0D 1MCBA 2VITB 3RGVB 1YEFL 3I6KB 1GGIL 4A6YH 2VZVA 4L29A 4R4NC 1IGIH 4K3GA 2HG5B 2HVKB 2XACC 4XP4H 5FYJU 4PLNC 3U46B 4WY7H 1S7QB 5E1AB 1FQ9C 2DKSA 2PN5A 1VADA 1RI8A 5BZDB 1XGUB 4F9LA 5TQ2H 4RMWA 3HMXA 5E8EB 3U0WL 3LEVL 2X4OA 1P7QD 1T22B 3H9ZA 1T5XA 1DFBL 3EYUL 3IT8D 2W65B 1NGYB 2VUOA 2VO5A 4ZFOL 3OKNB 3RKPA 4O2CA 1NH6A 3NZ8A 2CJUL 1IEAB 4ZPTA 1HHKA 2X7LB 1U8LB 3BKMH 4KK5D 1C5DA 3KXFD 3CSGA 2GSGB 2XWTA 2IQAA 2Y6SD 4FXGB 3P9MB 4XHQA 4QRRA 1DL7L 2OR9L 4MD4A 5A43C 3D2UD 2NMSA 1XAUA 4JY6B 1KCUH 3GI8H 2H8PB 5E99H 5JPMB 5HDOA 4WI4A 4WHDA 4XNQB 4ELME 5E2TL 4Q9RH 4FRWA 1P5VA 5JDJA 4ZOBA 5INDB 4I8DA 5DRXA 4RSVA 3E6HB 2DWDA 2HKHH 4OF0A 4WFHD 2XI9A 1J1PL 2CSPA 3IJHB 1CXLA 3LEYL 4K3DL 5TE7H 1JPSL 4ZFGH 1JNHB 4TUKL 1N6QL 4JHBA 1IBGL 3QFDB 1UZ8B 3JTSB 4LLQA 4OB5H 4DTGL 3UJIL 3EYOA 1WC7B 3QUMB 4LASH 5AWNH 2C26A 1ROWA 1FFOA 2YMXH 3BJ91 2PTVA 4PJAA 4R7DB 3T3PF 2EDOA 2VLLA 1UB5A 1CICA 5F7HA 2NYYC 3MV7B 3ZKXC 3BHBB 5SWSB 3HI1B 1JJUA 3IFPB 1NCBL 4F7EB 1GXEA 4ODWB 1YY9C 2C1OA 4G9FE 4CN6A 1Z9SA 2V7NB 4QXUL 3JWOH 1G7HA 1XF4A 3RU8L 4P9HC 4JFFA 2CLZA 4MCYB 4U0QB 3RNQB 4LKCA 3ET9F 1A9BA 2QADC 1CDJA 4DAGH 4HFWB 1A7NL 1A7PH 2LFGA 2NTFA 1CD1A 1WSST 2PO6B 2H32B 1YQVH 3WFBL 4OGXH 4I2XB 2HJLA 3UTTE 2DBLL 1U95A 5HD8C 3STLB 4NRYA 3QUZD 3UTQB 2XXMB 5FHAL 3TBTA 3L3JA 5J1AB 32C2B 3VXQB 3IXTA 3LKRA 2BOCB 5A16A 3V5DB 1RZJC 1UM6L 1NAMA 4YHPA 5JPNB 5I73C 3BWUC 1BVKA 1CDYA 1FZJB 4YGVA 3MV11 4MJIB 4KKCC 5DD3H 5BZWB 3V2AR 1HNGA 1N6UA 1OAYL 1R24A 3OR7A 4AMKH 2CDEA 5HI5C 3QI9B 3FHQA 2BHUA 3OF6A 3CNKA 4YWGL 1FO0L 3VI4F 2YA0A 1T7YA 2FJHB 5ISZB 3BIAX 1XZ0A 5HVHB 4TOYL 1A5FH 1X7QA 2AJZB 2R15A 4LOUD 4F2MB 4MMXC 5T5NG 4WUUB 2B5IC 2P5ED 1UJ3A 3KNBA 5DK0B 2UYLB 5I74B 4MAYB 5DUML 3T0DA 5ICXA 5T5NF 4JHAH 5IQ9B 3F58L 3ARDC 1BD2B 3I02A 1RK0A 2BDNL 3IFOB 5HI3D 5KSAD 4ELMF 4KRMB 3GIVB 4DW2L 2APTA 3MSPA 5H35B 1CCZA 1MRFL 4L3EA 4KRPD 2ZUXA 4J4PC 4XP9L 3QBTB 3ZKSD 3ULVL 4JZJB 2OZ4A 1I8LA 3L3GA 4P59L 1A1NB 2ZWLT 1QA9B 3DXAA 4Y2OA 3T65B 4NPYB 3H3BC 2PTTB 4PJXA 1FBIH 2ICWI 3LRHA 5K9JL 2B0SL 1V05A 2HRLA 2N7AA 4NQCE 3L5XH 1IEHA 1IAII 4PJHF 4QRRE 1W0YT 2B39A 2V5MA 1GIGH 4Y4KA 3MNVB 1T03H 2A0LC 5EZOH 3U4AA 1JN6B 3O6LL 1XIWB 3AMKA 3HAEG 3MJ9L 3QXDA 1I85A 3MZGB 4JFQB 4LP4A 4MVBC 4YHMH 4NM8H 3I6GA 1NCDL 3RWGB 1WCQA 1XGPA 3RUGB 1K5NB 5L2KE 1QFUL 4X7CC 3D0VB 5F89B 4JHWL 3REWB 3HZKA 4LLDA 5CBAA 1J8HD 1R3KB 1NDMA 4KHTH 4F15B 4MX7B 4PJAE 3GMRA 1MCEA 2DLEA 3MRQB 2FR4B 2NXZD 2ZUUA 4WWKD 2C3GA 4ONHA 3QNYB 4RGNB 4ELKB 2R2EB 1TQBB 4ODTL 3BXNA 4LRIA 2LVEA 1BM3L 4LLWA 4G8IB 3VWJD 3TBSA 3WHXA 3SBWA 4OD1H 3GUTB 2H1PL 3MXWL 1E4JA 3EKCA 3MRIB 5CUSH 4UT7L 1QP1A 5IEHB 1KPRB 1NGQL 5KOVC 4M9OA 1PQZA 1ED3B 4WTWA 1QBAA 4NFBA 3SGEI 4YZFE 1IMHC 1Z5LA 1WVZA 4N0UA 4UINL 1C7SA 1EIBA 5FYJE 2XG4A 3GMPB 2HRPH 2Q7YB 5I76A 2Z92A 5JW5A 5L7XL 2WBWB 4JO1H 2Q8AH 4JO3L 3DVNA 4AENA 1A22B 3ZDXF 4W68A 4P2QA 4HKZA 3MR9B 1HQRA 2H26B 2P24A 4AIZB 4UDUB 2FATH 3U4BH 3OHXA 1OAZH 4YEFA 4U1LB 5KOMC 4JJ5A 3WFZA 4ERSH 1GGTA 1Q9WB 3BQUA 1XMWA 3MRKB 1X44A 2P47B 1VEOA 4LDLB 3V52L 1CFSA 1P69B 5EU6B 5IHUH 4P57A 4ZTPL 3DPBA 2OK0H 5HGAB 2FJGB 4MA1C 1MF2L 4C56B 4NKDA 4JFZH 1QSZA 3PG2A 2LU7A 3DWTA 5DJ0A 3L3DB 4PJIE 4XC1H 3FMGL 3QZWB 1N8ZA 4M7ZB 2OQJA 2BRRH 1GHFL 3FONB 1I3GL 3QJHB 1G6RH 5EU3A 2BY1A 4XPGH 4CADA 4L3EE 1E6OL 3P4NB 1L7TL 3LRSB 4AL8H 3W9DB 1YC8A 2OSLA 4W6YB 1QPXA 4AZ8A 1VFAB 4ISVA 3DXAE 3MO1A 5F97E 1I8KA 1DUZA 4DKDC 4GKZA 1T7VA 4PJAF 4YO0A 3IU3B 4HZLB 4U2YA 4LSTH 1UA6L 1FZKA 3U83A 2E27L 3KYNA 4M1CC 1W8OA 4DN3L 1G7JB 2GY5A 1JWUB 4PJBE 4XCYA 3OAYH 5KSUA 4RWYL 2R0WL 3NFNA 4OV6F 2BP3A 3OKEB 1JZ5A 1EJOL 3TO2A 5F9AC 4OUUB 5C0FB 1QTYT 4KUZL 4OUOA 3BP4B 4Z78A 3KDMB 2ID5A 1YNTB 5SX5K 3JV4A 3RWIB 4LHUB 4UU9B 1LNUB 1VGEL 1URLA 3QXVA 3VGFA 3VFNB 4UTAL 4D3CL 3DV4A 3UYRL 3BGFC 2V2TA 4YZFF 4MQSB 4B50A 3QWOA 3LQMA 1B4RA 2GJ6A 4H5SB 3QUYB 4U3XA 3RIFF 1J5OH 1TETH 3QIBC 1S9WB 4LLMA 2K7PA 4HPYH 3IKCB 3MLRH 4TUJA 4HHAA 4WI6A 4LSUL 2R0LL 3DTXB 4OCSL 4OCYL 5C0GA 4LVNC 4UAOB 5IFAH 1PKQA 2QQLL 3BISA 4MNHA 5D7JB 3LDBC 1BJ1H 4Y2DB 5I18H 5DRZB 4E41D 1WIOA 1IGYA 4X5WB 2FNBA 3S88H 1A7RH 4I18A 5DUPL 5AZ2H 3D85D 3GMNB 4ZUWB 2JJTA 4IHOB 5C0CA 2VLKB 1BOGB 2XFXA 3NCCB 3TFKC 1G7PB 3ARFC 2DWEB 1F6LL 4PRPA 5DQDH 1NSNH 5CJOH 4JFOB 1G9ML 4PJHB 5CKGA 4BJLA 1SYSB 5IB1A 1UM4H 1UKTA 4OKVB 2IWGA 3KJ4C 1P5UA 1F4YH 2D7TL 3ESVF 3QIUD 1DCLA 5D72L 2EDNA 4U6HB 3DO7A 3SGEH 3VFWB 3SKJL 5FV2A 1K8DA 1N4XL 5FEBA 1NUGA 2QEJA 3HE6B 3FB5A 2YEZA 1NGXA 4YC2B 4NN6C 2GT9A 1GL4B 3X13B 4PJXF 4JAMB 3T1FA 3GSUA 5D1XC 5E08H 1KN4H 4HS3B 3BEWB 1ND0B 4PJBF 3CFBA 2X4PB 5JO5A 5EU7C 2CLVB 1ZLVK 3T0XA 4BSWA 4YDJB 2YRZA 4Q6IA 4NUGL 1CGYA 2IC2A 2ICEB 4JVWA 2OTWB 1AXSB 3VXPA 3I3BA 1IVLA 1FC1A 2RCSH 3U7WL 4Y4HA 5IQ7L 3HG1D 5F7UA 1U8PA 1P2CB 2MNUA 3G5XB 4GW5B 4RAUB 2XZCL 1SVZA 4M7KH 5E2UH 2ITCA 4FG6C 5GIRA 1IT9H 4L29B 2L7JA 2IALA 4GSDH 4HWNA 5JQ6H 5I1EH 3R8BB 1K3IA 1IJ9A 1KLUA 1WBXA 1KXTB 1YEIL 5FUOL 1V3LA 2X70A 3S3PA 1V5JA 3QR2A 3DVGA 3SO3B 3OJMB 4G6JL 2DYPA 2YSSA 1VADB 4KQ3L 4RMVA 4TPRH 3SDXA 3T0EA 3QEHA 2NY3D 4HMEA 4QHLA 3MV9A 4TSBH 3RWEA 1QFWM 1EO8L 5DS8A 3RDTA 2X4OB 3UZQA 1T5XB 1PZUB 3QXAA 2DQUH 4JPKH 4KDTA 2W59A 3C5JA 3PV6A 4I0KA 2MFNA 4OF8A 3JV5A 3WIHH 4F9PC 2V9TA 4P9MH 2VXQL 1A7BA 2YXMA 4O2CB 3NZ8B 1HHKB 2XICA 4NCC2 4PYHA 5LWYL 5MEPA 15C8H 5GRJH 2F9BT 2V5RA 3D5OF 2AJXL 2XWTB 1BAFL 1YJDH 3LAFA 1MOEA 1YC7A 3IB4A 1EO7A 4M48H 3V0AC 4NKQB 4MD4B 4R4FH 4KTEH 3LKSA 3N1PC 1B0WA 1SMAA 5ICYA 1LE9A 1DEEA 5AYUL 2F5BL 4XPTH 1I1YA 4TTDD 43C9B 2EXWC 1QSEA 3V6OA 2HWZL 1YA5A 1UXSB 4LLVA 4LSRL 4TQEL 2DWDB 1LE5A 1CK0H 2P8PA 2UUDH 4MAUL 1TJIH 4LLQB 1DLFH 2YD2A 5C70A 3VXMA 3LKOA 1FFOB 2AGJL 3TYGL 5FYJL 2VLLB 1UB5B 5FAAA 1CICB 1WZMA 3CFEA 3RGHA 3DHMA 2AXHA 2OL3H 5T1DH 1FNFA 5KTEL 2R2HA 1NAML 3RZWA 2C1OB 4RMSA 4BKLA 2J3SA 1OP5K 1PG7X 1DN0A 1G7HB 4OBRA 1XF4B 3G5VB 4JFFB 4W4OA 2CLZB 3CVIH 4WTZA 5JORA 5IESH 4NZRL 2EICA 3QI9C 5IW3A 3WIIL 2GIYA 2DQTL 4LKCB 1KJ2L 1ETZA 1WWAX 2YD8A 1D5IH 4LDEB 4M3KB 3IVKA 3W11D 1A9BB 2ENSA 5BMFH 5HVHC 3TEUA 2NTFB 1CD1B 3PWUB 5DJ8A 3LQZA 1N59A 1MH5A 2HJLB 5E6ZA 4BFEA 1U95B 4M61A 3RX8A 1IQWH 3GK8H 4NRYB 5FIEA 4FFVD 4JO4L 3TBTB 1IILE 3L3JB 1OPGL 2OTUB 3LKRB 3UPRA 5A16B 1BQHG 4POZD 1KPVA 4E0RA 1FLTX 4HMDA 4YIQA 2D7MA 3PP4L 2HMID 5TGBA 3B3IB 4YGVB 3RJDA 4MS8D 4KK8D 4AEFA 1D9KD 3KPPB 1R24B 2R4RL 2AJ3B 1QLRA 3OR7B 4HV8A 2CDEB 5HHXL 3FZUC 5EFIA 2IGFL 1CLCA 2VDQL 3W5NA 1X7QB 3QUXC 4ZDHA 4ZOEA 1JPFA 1BJ8A 1UJ3B 2YWZA 1FHGA 2W9LA 3KNBB 4XP1H 1GAFL 5ICXB 4Q2ZA 3VDCA 2CIKA 3I02B 3CCHA 1HHIA 5E0QA 4S11A 4TYUA 4YHZL 4PGJA 3WSQH 1I8IB 4IJ3B 4PV9B 1ES0A 1EEQA 4M5YL 5F7EL 2DTMH 4L1HA 4S1QL 2Y06L 3MOBH 4Y16A 4IMKA 3SDAA 3ROOA 1B88A 3L3GB 4B41A 4CNIA 4ZTOL 5DMYA 3TWCL 2YRLA 1F4XH 2ORBH 5GZND 3WFEH 5DI8A 1CXHA 2WBJA 1HINH 2V17L 5E2VH 1MNUL 3O0RL 4X4ZA 4E42A 4NM4L 1OTTC 3NCMA 2XV6B 3MRDA 4PJXB 1MFDH 4RGNC 2VDRL 2GTZA 1KCSL 3O3DA 3O11A 3MXVL 4KV5F 2V9QA 1MAML 4NZDA 2R4SH 3VMPA 3QDGB 4Y4KB 4PRIE 3RHWF 5DFVD 3B9KD 3V6OE 1H8OA 3AM8A 3QYCA 3QXDB 4PJEE 4HIXH 5FF6A 2YA1A 1HEZA 2WUBH 4EN3D 3FO0H 3QNXA 1NC2A 3LD8C 1UT9A 2R23A 4XHJC 3BKCH 5CBAB 3MODL 3P9WB 5L88L 2B2XH 4NZTH 4OLUH 2BNQB 3U0PA 1NDMB 3BZEB 1H3PL 3CC5B 1MQ8A 1F42A 4O58H 3GMRB 4XTRC 1HHJB