5A2CA

Crystal structure of anoxybacillus alpha-amylase provides insights into a new glycosyl hydrolase subclass
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
450
structure length
450
Chain Sequence
ERTWQDERIYFIMVDRFNNGNPKNDYEVDVHDPKAYHGGDLQGIIDKLDYIKEMGFTAIWLTPIFANEKGGYHGYWIEDFYKVEEHFGTLDDFKRLVKEAHKRDMKVILDFVVNHTGYNHPWLNDPAKKDWFHEKKDIFNWANQQEVENGWLFGLPDLAQENPEVKTYLFDVAKWWIQETDIDGYRLDTVKHVPKWFWDEFAKEVKSVKQDFFLLGEVWHDDPRYVAEYGKHGIDALIDFPFYKEASTIFSNVDQSLEPLYNVWKRNVAFYERPYLLGTFLDNHDTVRFTRLALQNRINPVTRLKLGLTYLFSAPGIPIMYYGTEIALDGGEDPDNRRLMNFRTDKELIDYVTKLGELRAKLPSLRRGDFELLYEKDGMALFKRTYEKETTVIAINNTSKTQKVTLDGELEQGKELRGLLAGDLVRSKDGKYDIILDRETAEIYVLAPKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE
publication title Crystal Structure of Anoxybacillus Alpha-Amylase Provides Insights Into Maltose Binding of a New Glycosyl Hydrolase Subclass.
pubmed doi rcsb
source organism Anoxybacillus sp.
molecule tags Hydrolase
total genus 169
structure length 450
sequence length 450
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5a2cA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5a2cA01
3OZOA 1CENA 2A3AA 3T2PA 4CD5A 4NRSA 4RE3A 1WB0A 4LYPA 2WSKA 3T0DA 2ZXAA 1XYFA 2CHNA 4QLKA 4LGXA 1K9EA 4BQ4A 4XZBA 3VD3A 1HJSA 2CERA 3WUBA 2J75A 3A4AA 1V03A 3A22A 3W0KA 2DT2A 1E73M 1B3VA 1KXQA 1TG7A 2PWGA 2DSUA 5GNYA 4JFSA 1GOMA 2CESA 3SUWA 4Z2JA 2DIEA 4JFTA 3ZT5A 4EAMA 2AAAA 1KXVA 1OGGA 2VCAA 2UWFA 5GPRA 4TVDA 1D2KA 2PWFA 1K9DA 4D6FA 2IUZA 1UWQA 1HJQA 1HF6A 1GVYA 1VB9A 2EJ1A 4H04A 4EK7A 3VGDA 4RE4A 5A95A 4MNJA 1X6LA 2XVNA 1D7FA 1R87A 2XSBA 1EO7A 2XVKA 2XFRA 3GXNA 4OJYA 3PTKA 5CSUA 2V3FA 2JE8A 3AMLA 4H41A 2G4FA 4A3HA 4W8BA 3AS1A 2RGMA 4MB5A 1E56A 2WC3A 3GYCA 1CGTA 4BQ3A 5HBFA 4D1IA 1BG9A 1JG9A 3AZTA 4BA0A 4NZCA 2XN1A 4L4PA 4AD0A 1AQMA 4ATLA 2DSKA 5D9NA 4W7UA 4PTXA 2G3IA 5E6YA 2J7BA 3BUQA 1DP0A 2G3JA 2FH6A 2DEPA 2VX6A 2PC8A 5IHRA 1TMQA 1R7AA 3WUFA 3UEQA 3DYMA 1UZ4A 1XRVA 3SCVA 2YLAA 3GNOA 3VD9A 3DX1A 1K9FA 4QFUA 3DHUA 3TA9A 3GTNA 4JFWA 4E8CA 2WZEA 3AQUA 2X2YA 1EA9C 2WLZA 1JZ3A 1LWJA 4LXFA 3W29A 2J8FA 2F1BA 3M46A 3O2LA 2F8QA 3MANA 1WE5A 3GXFA 3FN9A 4UQCA 5F7UA 1OT2A 4UQAA 1LJYA 2V3EA 1VBRA 3WF4A 1FP8A 3TTOA 1JD7A 2F7QA 2J8GA 1WKYA 5FKYA 1TZ7A 4PMDA 2E4TA 1B1YA 5FD0A 1QI3A 1E4LA 3BUBA 5M17A 4CU7A 3MUIA 3GH7A 4M1RA 4DUVA 5BYWA 1JZ7A 4ZXOA 5A8OA 3AICA 4EKJA 2XG9A 4BCEA 4H8UA 3BLBA 1E0WA 3K4AA 4UOJA 4LPCA 4MDPA 1RH9A 3U7VA 1J0HA 1NWRA 1Q6EA 3BVVA 5FL0A 4FLOA 1V6VA 2EACA 3WQ4A 1CLVA 3SUVA 2BS9A 1NARA 2VZVA 5JBDA 3D5HA 1MW2A 1UZ1A 2X2HA 1CBGA 4FF5A 1QX1A 1UA7A 1I1XA 2VC9A 1SZNA 1GQJA 4CD4A 4D1JA 2VX5A 2WHMA 2TAAA 1PBGA 1V6UA 2VR4A 1FFRA 4FNPA 4W5ZA 4D72A 1XHGA 3SCUA 4FLSA 1XD0A 1FHDA 1HVQA 2VQTA 3BH4A 4AIUA 3WNKA 1PZ3A 3KLLA 1VF8A 3OGVA 4OZOA 3L4VA 2D2OA 1EDTA 5A1AA 3OG2A 1UKTA 1DHKA 3OBAA 3AIUA 3WDPP 3KZSA 3L4XA 2O9PA 4IUGA 3F5KA 4J3WA 4FK9A 2ZX5A 2W5FA 3MU7A 2V5DA 3CZKA 1L0PA 1E55A 3QR3A 2EPMX 3FHQA 5JBFA 3D4ZA 1YHTA 2XPKA 3MV11 3A5VA 2DIJA 3A24A 1V6WA 1W1VA 1OBAA 4C7GA 1JI1A 1J0JA 3F5JA 4TVCA 1H3GA 1GJWA 2WYSA 1D3CA 1HVXA 4UQEA 4HU0A 1W1TA 1CXFA 1TQWA 3WMCA 2BNJA 1TCMA 1Y7VA 3N13A 1H49A 1WO2A 4ML4A 1GHSA 4WKFA 1MFVA 1HKMA 2E40A 2OSXA 1VENA 4CVUA 5LA1A 2ZUMA 1TVNA 1B3WA 3B9EA 5DFAA 1E6SM 5HNNA 3CZ8A 3THDA 1A47A 3PN8A 2EQDA 3EDKA 1HL9A 1CXIA 5KZ6A 1NH6A 4HPHA 3ZIZA 2ZX6A 4FNQA 2FHCA 1B9ZA 1QNPA 4ATDA 5IFTA 3W53A 1P6WA 1CLXA 2XFFA 1KCLA 2YFNA 1EHAA 3I3DA 1E43A 3AS2A 1QHPA 4GZJA 7TAAA 1PEZA 2G3NA 2WW5A 3BUPA 3CGTA 3FW6A 3RILA 2D1ZA 2A3HA 1WZLA 3VD4A 2CCRA 3CUFA 1GCYA 1UKPA 3RJXA 4PMQA 1OINA 1MYRA 1XYZA 1V3MA 1E6PA 1OGBA 2WC4A 1UYQA 4AWEA 3BVTA 4OOZA 2WVSA 4CKQA 2CKRA 2E8YA 3MUZ1 1IV8A 2WLYA 4FLQA 1LWHA 3K4DA 3K46A 4AIEA 4GI8A 3HMCA 1W9BM 1BHGA 3WY1A 3VIKA 5A8MA 1JZ2A 2CIPA 1ISYA 3U5UA 2IXVA 2VZSA 2E0PA 2C7FA 3VUPA 2YBTA 1EGZA 4W7WA 4IISA 4RE2A 1JZ6A 1G5AA 3ARWA 5D8WA 3WFZA 3FY1A 1JAEA 3GXIA 1LG2A 1ZJBA 3DYPA 4W85A 3OLEA 1SFSA 1E6RA 3CZGA 3VGHA 4KGJA 3NCOA 4F9DA 3WD2A 1XV8A 3KLKA 3ZOAA 1W91A 3T0AA 4LX4A 3EDJA 3VIMA 1BYDA 3W27A 2VRKA 3OLIA 1E70M 1HT6A 2D22A 1MW1A 4UQDA 1WNOA 4GIAA 1J9YA 3CBWA 1B31A 2PWHA 4HOXA 3PZVA 2WNWA 1CXLA 3ARQA 2GJXA 5CZKA 7A3HA 2YJQA 3PZNA 4H2CA 4U33A 3AIBA 2Y8VA 5DT7A 4H8VA 3BAIA 2QV4A 8A3HA 5A8PA 2DDXA 4PMRA 2YDSA 4P7NA 1NP0A 1W3KA 4MB3A 1GOKA 2CNCA 3LXBA 2E9BA 3CTTA 1ISXA 2YBUA 4B9YA 3ECQA 2D73A 1GORA 1CNVA 1W1YA 3MV01 4UOQA 2G41A 1EHNA 5GQBA 2ZUSA 3AHZA 2WCSA 2ZUVA 2J7DA 4PMZA 3D52A 4LYRA 2OWWA 1UR2A 3MUAA 1ISZA 4AZHA 1OCQA 2WWDA 3QHOA 2XHYA 4J3VA 3MO4A 5BWFA 1GONA 4P8VA 3ZQ9A 3LPGA 3I3BA 5M3WA 3DC0A 3BAYA 2ZX7A 3KL5A 3VNYA 4WF7A 2CBUA 2OW6A 3MSDA 2JEPA 2EPKX 2ZWYA 1WPCA 3AHTA 3LX9A 1V3JA 3WEMA 3AZRA 2WB5A 3ALFA 3BVUA 4OOUA 3H53A 3PZIA 4AEFA 1BGAA 1DEDA 4UQBA 1Z32X 1W9VA 3CHFA 1WDQA 1ODUA 1CGUA 5BCAA 1E3XA 5M03A 3VSTA 2ZIDA 4CCCA 1R86A 4D6EA 2JF7A 1UD2A 1BAGA 4GI6A 4XB3A 4U2YA 4CVWA 1V0MA 1UUQA 3AXIA 1JNEA 1EDQA 1J0KA 1PPIA 6A3HA 2W92A 1M7XA 2XIBA 2A3CA 1VJZA 1UWTA 3CMJA 4MTVA 4XUYA 1QOXA 1UKSA 3AS0A 1C92A 2OYMA 3WSUA 3A47A 1TR1A 1VBUA 3GXMA 3AIQA 4ZENA 4ZFMA 5A8QA 1UD4A 4AD4A 2AMGA 3WMSA 1A3HA 1EH9A 3DYOA 2WCGA 1DWJM 4LYQA 2CBVA 1G01A 3VSVA 1J10A 3DDFA 2X0HA 3GXTA 3AYSA 4GPNA 2J62A 3ARTA 5ABFB 4P8XA 1E4IA 3L2MA 1E1FA 2O9RA 4DM1A 3W37A 1FFQA 3ALGA 1U2YA 1LF1A 1FH7A 1MQQA 2WHKA 1OD0A 4HP5A 2HISA 1UH3A 5A6JA 2OWXA 4R5EA 3NSNA 3T2OA 3IJ8A 2WM0A 3WQ8A 4K68A 3VGFA 3N15A 5D9OA 3WH6A 4V2XA 5EB8A 3HG5A 1JIBA 1KQZA 4MNMA 2WMJA 2XM2A 3WUGA 4UQ9A 2WKLA 2WMFA 4U31A 1KQYA 3ZMRA 2DSWA 2PB1A 2FH8A 4AXNA 2WVTA 3A4WA 3FNDA 9CGTA 3CIVA 5I23A 2CETA 1QPKA 3L4UA 5AYIA 2JEQA 5E09A 4D6JA 3GDBA 3AFBA 3GNPA 2J7HA 1BF2A 3WELA 3QOKA 1TFVA 3ARSA 4HZ7A 4Q22A 1J12A 1Q6CA 3IANA 4H8HA 1B30A 1VFOA 3RDKA 2CPUA 2WK2A 3ARZA 4EANA 1J0ZA 1JF6A 1W9UA 3SCOA 5CG0A 2JFEX 5GNXA 3TONA 2G3MA 1UKOA 4A4AA 1V08A 4W86A 1HXJA 4CU6A 5AYBA 4D6GA 4DUWA 3K8KA 3AIRA 4PUEA 2W61A 3WIJA 1TQVA 5EMYA 2VRQA 1XSJA 3WQWA 1VIWA 5AC5A 3DDGA 1QNOA 5DF0A 1WAWA 3N17A 4OGZA 4TXEA 5I6SA 2VQUA 2E9MA 1E40A 5CPSA 1V0NA 3OLDA 2ZXBA 1KBBA 2XYLA 2ESCA 1XSKA 3VX1A 4UOZA 1GOOA 1SYTA 1QHOA 4ACZB 4AZCA 3B9DA 3RMEA 5DT5A 1V3HA 4CD7A 1TVPA 4W88A 3VGGA 4M29A 1DTUA 2VNCA 4JFUA 4OBRA 4W87A 3DHPA 3CZLA 2FYVA 1UQYA 1ODZA 3L4YA 1JF5A 4PMUA 4JKLA 3WH8A 2OSYA 3VX0A 2O92A 2BY1A 3EYPA 1NWUA 2Y4SA 1ZBKA 4JL2A 5A2CA 4NX0A 1JDAA 3BVWA 1LG1A 2WANA 2F7PA 5FIPA 1LL7A 1RD6A 2D3LA 2VZTA 4X0VA 4EE9A 4PMXA 3UG5A 3ZJKA 4DO5A 1JGIA 4U3AA 1FH8A 4UFJA 1WDSA 1TE1A 2A3BA 1H5VA 1MW0A 1E71M 1KR0A 4C7FA 2XN2A 2WWCA 3GXDA 1JXKA 1KWGA 4FNRA 2GJXB 3MMUA 2J7CA 1GOWA 1XC6A 4D6CA 2BXZA 3ZT6A 4ZE4A 3EMCA 2X05A 3ZSTA 4MJ4A 3EJUA 1EQCA 4AMWA 5A6MA 3VNZA 1B0IA 3CPUA 2BVDA 5C8BB 4KWUA 3SIMA 1GHRA 1BYAA 1JXJA 1R33A 1BSIA 1WP6A 2MANA 3BLKA 3ZR5A 1CECA 4PTMA 4MJ2A 4W8AA 3CH9A 2BHYA 3VO0A 2D0FA 4N42A 3HU7A 2VOTA 4UR9A 4HZ8A 1MW3A 3T08A 4XX6A 4M80A 3MMDA 1NWTA 1JYWA 3N1AA 4IPNB 5M5DA 3WQ5A 3PZOA 1KGWA 3WY4A 1QW9A 1C7TA 5I3DA 1V0LA 3GNRA 4AZ7A 1J18A 5IFPA 3LXAA 3N18A 2E8ZA 1MXGA 3HG2A 3WEOA 1JFXA 4QLLA 3VD5A 3ARPA 4QDMA 4GQQA 2GFTA 4P8WA 3M7SA 3MSGA 4PUDA 2FDMA 5A6LA 2WZHA 1I1WA 3II1A 1JZ4A 2XTKA 2Z1KA 1QHZA 2ZXDA 2X2JA 4N0RA 1HTYA 1NM9A 1UD6A 1XH1A 2ZWZA 3TOPA 3W38A 1C7SA 5IDIA 1QI0A 2XM1A 1U30A 1GJUA 1BPLB 2DH2A 5BXSA 2BVTA 4ZE5A 2YKKA 3EJPA 1R75A 1E9LA 4X0NA 3B9AA 4KRTA 3WL0A 1CWYA 5ABFA 3PTMA 3BLPX 3L2LA 3VILA 1KXHA 1W2VA 3CZNA 2ZUUA 2D23A 3VDCA 1PS3A 4Z2IA 4B16A 2WVVB 1QW8A 2YDRA 3AS3A 4AZGA 3OGRA 3WNOA 1CYGA 4AZ5A 3L4WA 4HTYA 1MQPA 1VFFA 2J25A 4KH2A 3BUIA 5C70A 4JAWA 3MMWA 3SCRA 2DSVA 1XH2A 3POCA 3UR8A 2VZOA 1JZ8A 3M07A 3WNNA 1J0YA 1EO5A 2XUCA 1JYNA 2PWDA 5A2BA 1R47A 4DO6A 4UNIA 1E6NA 3CZSA 5A69A 2UY5A 4AIOA 2D3NA 2WC7A 1E0VA 3N9KA 1EOMA 3AROA 1KCKA 1E6XM 4UFIA 1CEOA 4DWSD 3PTQA 2OWCA 2VCCA 4WKAA 1ZU8A 1BTCA 4WSKA 3OB8A 4MPKA 2JIEA 2JF6A 1Q4NX 2CXGA 2EPOA 2GDUA 4HA3A 4TUFA 2VRJA 3WQVA 1JFHA 4J3SA 3OLGA 3AJ7A 5A3HA 5D9MA 2Y8KA 4AC1X 4CCEA 1FH9A 3ZR6A 1BYBA 1UD3A 4WK9A 2WZIA 6TAAA 2XSAA 3VDBA 3W28A 3HG4A 2EXOA 1HKIA 5I5RA 2CBIA 1PX4A 1M53A 4U3CA 4PYSA 1NOFA 3MUY1 1G0CA 3IAQA 1QI5A 2B31A 3VIGA 4AZIA 1EDGA 1L8NA 1JDDA 1C8YA 4E4PA 2XVGA 4GINA 3LXCA 3CHEA 1U33A 1GQIA 4PTVA 3AI0A 2PWEA 1XCWA 2Y5EA 1AQHA 2ZICA 1UQZA 2GDVA 3GZAA 3WH9A 3QHMA 1UR4A 3VINA 5IHSA 4HMCA 1HP4A 1QI2A 4XZWA 3EMQA 3NSXA 3TV8A 3AMGA 4ACZA 4GKLA 2C8NA 4W8LA 2PI6A 4QCEA 1BVZA 1SMDA 5D9PA 1CXHA 1UKQA 1TQTA 2V38A 4Y7EA 1XH0A 1E5NA 3WDHA 2QF8A 1GW1A 4RL3A 2ZUWA 1C8XA 4DUXA 4D71A 2FGZA 4AW7A 5EBAA 1LL4A 1GUVA 3FAWA 4P7RA 2CHOA 3CZJA 4AZCB 3F4VA 1HP5A 3PZTA 2WMKA 5BRPA 4UTFA 2A3EA 5LA0A 2BY3A 2YDQA 1GOIA 3CMGA 2VUYA 1DWAM 2YIHA 3S5YA 3A4XA 4P7LA 2X2IA 1J11A 5A6BD 3S2CA 2XVPA 3S5ZA 1TUXA 3VVGA 1V3KA 5KEZA 5C71A 1UWRA 3WENA 1GOQA 3FAXA 4BQ5A 1R85A 3G6LA 4E2OA 1VJSA 3AXXA 2V5CA 2IGTA 3GM8A 3A6OA 2GSJA 3B8SA 2QMKA 3WL1A 3ZJ7A 3CUJA 2BV9A 4NZJA 1M04A 2QMJA 2EABA 4FNTA 4AYGA 1R7OA 4TTGA 1B90A 4M8UA 1VEMA 3U5YA 4NXSA 1W9XA 1H1NA 1PX8A 1G9HA 4J7RA 3ARXA 4BZYA 2E9LA 2VVSA 1QI4A 3TTYA 1Q6FA 2CYGA 2VURA 4KGLA 1TA3B 3CUGA 1E6QM 3WBAA 4M81A 2F1AA 2OYLA 5E0CA 5E9AA 3RO8A 1KFWA 3BAKA 3K8MA 4UZSA 5CJ5A 1HJUA 3WMBA 3EJSA 3IAPA 3W26A 5BROA 4CGTA 2BY2A 4Z2HA 2E3ZA 1EIBA 1BLIA 1QVBA 1E4MM 1OWQA 3AIWA 2W63A 1ZBWA 2FGLA 2EO7A 4HMDA 1R34A 1R46A 1SR0A 2BXYA 4F79A 2WSPA 3HN3A 1HKKA 1EXPA 1JYVA 5I2UA 3ARUA 2DPEA 4JL1A 3OA5A 5DO8A 1YQ2A 4MB4A 4PMOA 3N04A 1UASA 1UG6A 1ZB5A 2D24A 3K1DA 5I79A 4UCFA 3L4ZA 4J3UA 5JUVA 3KL3A 2F61A 1DWFM 3AHYA 5LA2A 3T09A 3VD7A 4JIEA 3BSHA 2PBOA 1C8QA 3CUHA 3WDQA 5CLTA 5A94A 4XV0A 5CPTA 4PCTA 1HJVA 3SCNA 4F8XA 5CSYA 3CO4A 5I0DA 4AEEA 1MQRA 4GXPA 3VGBA 1RPKA 4NSBA 1OIFA 2FHBA 2WVVA 2W67A 2XVLA 4IM4A 1JAKA 4S3JA 1W3HA 3W6MA 1HWWA 2VMFA 2WMGA 1NOWA 4GO8A 5E1QA 1HN1A 1QWUA 2WXDM 3TTQA 3BAWA 3AISA 2NT0A 1CDGA 1QBBA 2CBJA 2WMHA 2V3DA 1ECEA 3SCQA 3BAXA 2CEQA 4UFHA 4UFMA 4CUCA 4Q7NA 1M01A 4FLRA 1HIZA 3WD4A 8CGTA 3VGEA 3VDAA 3IGUA 2J7EA 3D4YA 1O7AA 4NRRA 4L4OA 3HJEA 4FMVA 1BG4A 1UH2A 2FE0A 3WDJA 1KWKA 5A6AA 1W9PA 2J7GA 1SMAA 1GVIA 3NDZA 1V6YA 3W82A 4UFLA 2XIIA 5D4YA 1DWGM 3LRLA 4DWSA 4PMNA 3OGSA 1NWSA 5JIPA 1PIGA 3KE0A 3MKKA 4JCLA 3WY2A 4V27A 1J0IA 1CGXA 3AMKA 3AHXA 3G6MA 3O6AA 2EBNA 2Q8XA 4KRUA 1CXEA 3VM7A 1HJXA 4D6DA 3UG4A 2D0GA 3POHA 3W24A 5BRQA 1C90A 3BVXA 1HX0A 2VZUA 4ATWA 2ZX8A 1V3IA 1HNYA 3EJQA 4CN6A 1NQ6A 3ARVA 3WH7A 2QPUA 3VIFA 4PN2A 5A8NA 4MAZA 4AYSA 2UY3A 3VIOA 1C3FA 1FP9A 1X1NA 4UFKA 2BVYA 4Z2LA 4MAVA 1E15A 1OB0A 2HVMA 2VJXA 3BXWA 3EDEA 3VIJA 1V02E 2J79A 4ZXLA 4AD5A 1QBAA 3VTRA 3MS8A 1XCXA 1TQSA 4QP0A 2F18A 3UERA 2JIWA 3VMPA 3BC9A 1CZ1A 2J74A 3AZSA 3GXPA 1KGXA 4CN1A 3SCPA 3LPFA 5JIWA 3PZUA 1GZJA 2RGLA 2XGIA 1E0XA 3WF0A 5CLWA 3ZSSA 2YL6A 2ZUNA 2X8RA 3TTSA 2WMIB 2UY2A 4CU8A 1MVYA 1N82A 5HXMA 1UOKA 3L4TA 4AD1A 1JDCA 2NSXA 4GQRA 1OM0A 1ESWA 3BSGA 1VFUA 1MFUA 2J47A 1DWHM 4HPGA 2OSWA 5AY7A 3AOFA 1MXDA 2DT0A 3WDRA 3FXYA 2J7FA 1XGZA 1CIUA 1J01A 4GO9A 1OIMA 1H11A 5LYRA 4TVUA 2WBGA 1V3LA 2YFOA 3BMVA 5TD4A 3ARRA 5IXEA 4PSPA 2JALA 1PJ9A 1CXKA 1V6XA 5A6BA 1AMYA 2XFYA 2G8ZA 3NIYA 2VTFA 4PCSA 5FCZA 3D50A 3RM8A 1KTCA 2C0HA 2YL9A 4KMQA 4JCMA 3WD1A 3JUGA 4U5KA 3WH5A 2O9TA 3BCDA 4PRWA 5GNZA 4AZBA 4W93A 1GNXA 2WPGA 1W32A 3VDHA 1WDPA 2GK1A 3T0BA 2GJPA 1TA3A 3WQ6A 5E6ZA 3RM9A 3WF1A 2Y2WA 4B15A 1OT1A 1E4NA 1GQLA 3RIKA 1Q6DA 3EJRA 2VVNA 3AIVA 3NUKA 3IJ9A 1OD8A 1EQPA 2W66A 4DO4A 3W6LA 1ZL1A 2D20A 1PZ2A 4MNLA 3WUEA 3FHAA 2NW0A 3EDDA 2YLLA 4W84A 2VO5A 5ABHA 4PBGA 4BF7A 3AMDA 3WY3A 1VAHA 1FOBA 4HZ6A 4CCDA 1V0KA 2YA1A 1H2JA 3GH5A 3BGAA 1BYCA 1UD5A 5E70A 3QHNA 3SEPA 4BQ2A 4HOZA 1G1YA 2PBGA 3PZ9A 3UR7A 5HOSA 4J28A 5HPCA 1JD9A 1JNDA 5BXTA 3VIIA 4JHOA 4OIFA 4WLCA 1UHVA 2DT3A 2UY4A 2WAGA 2EAEA 3F5LA 1K6AA 3U7BA 4FNSA 3WDIA 1H41A 4BS0A 3VSUA 1FHLA 3EBVA 1I75A 2X0YA 1WDRA 1B3ZA 2J77A 1C93A 1KGUA 1O6IA 4HA4A 2OW7A 2XJ7A 5I77A 3ARYA 2J78A 1T0OA 1NP2A 1CGVA 4HU8A 3NYDA 4TX8A 3NJ3A 4PMYA 2OYKA 3W4RA 1XD1A 3E1F1 1KB3A 2O9OA 3NSMA 4MDOA 2IXUA 1UR9A 1QNQA 5I24A 4S3KA 3WEZA 4YPJA 1B3YA 3CC1A 2AOSA 3GBDA 3CLWA 2QPSA 1QWNA 1KR1A 4P7QA 3PHAA 1AQ0A 2OLHA 3RM4A 3ZJ8A 4C7DA 4YHEA 4URIA 2ZE0A 4GZIA 1B2YA 3SUTA 2X09A 3LPOA 1LQ0A 3QGVA 3UG3A 3O9NA 3WD3A 3DX0A 3A21A 2W91A 2Z1SA 5BXPA 2CITA 1H09A 1E72M 3CV5A 5HDRA 2YOCA 1ZBCA 1PAMA 3BMWA 4JKKA 3WKZA 3CZEA 4WSJA 2XWDA 1FA2A 1UH4A 4M56A 1QNSA 5ECUA 3ZO9A 1X6NA 5CGMA 3SURA 2W4XA 3WF2A 3CUIA 4NXKA 2YL8A 5EFDA 5CPQA 3GBEA 2DT1A 4DWSB 1UR0A 4P8UA 3THCA 1ITXA 1RP8A 3IK2A 3WBEA 2VI0A 1JL8A 1UR8A 4QLJA 4F9JA 2DGAA 5CGTA 4OBSA 2ZOXA 5A6KA 3AIEA 2PF0A 2YA0A 1C91A 1PIFA 4M82A 1H0GA 3RCNA 1VEPA 1DWIM 4NZFA 5HPOA 3APGA 2GJRA 2BY0A 4WJXA 1PX3A 3W81A 1GPFA 4PMVA 2YA2A 3CHCA 3KL0A 1R8LA 3WF3A 1UD8A 1BQCA 3UESA 4H7VA 2WVUA 1E1EA 4W5UA 5I78A 4TX6A 3S6TA 4M24A 1E6ZA 3TP4A 1HKJA 4HMEA 4YN5A 3NDYA 2WMIA 2ZUTA 2VX7A 3SCWA 5A6SA 4PEEA 3N11A 4GZEA 4W7VA 1Q6GA 2ALWA 1UR1A 4OUEA 2WHLA 3DX4A 3VM5A 1US2A 3A3HA 3T2QA 2W62A 3KEHA 3RPMA 4PTWA 3PBGA 1W3JA 2VX4A 5FL1A 1VFMA 1HXKA 2F7RA 4HA1A 2BFGA 4IPLA 4U2ZA 4DM2A 3U57A 4MADA 2FHFA 2GUYA 4CN4A 2NT1A 4AY1A 4ACYA 1KXTA 1B3XA 4J3XA 1OGSA 2DSZA 1RP9A 4J3TA 1H4PA 5DMYA 1JI2A 4FNUA 4V28A 3VMNA 1HJWA 1ITCA 4E8DA 4CD8A 3AMCA 3A23A 5AC4A 1LL6A 1H0IA 6CGTA 1O7DC 1UWUA 3SUUA 1CGYA 3LMYA 1LLOA 1G94A 1VEOA 1W2PA 3DX3A 3AHVA 4P7OA 1OSEA 3LRMA 7CGTA 3CHDA 3SUSA 5JBEA 3ZT7A 4D6HA 4ZEPA 2XGBA 5DEZA 4AMXA 5BXRA 5ABGA 4CD6A 1KBKA 4Z2GA 3K8LA 2GK1B 2EEXA 3ZM8A 4B3KA 2VL4A 4OKDA 4AD2A 2BHUA 1W9DM 1IT0A 4B9ZA 2WHJA 4X9YA 3W25A 4NI3A 3H54A 4JHZA 1JYXA 3VU2A 4NF7A 2XN0A 2D0HA 1AVAA 1KTBA 4B3LA 3M6DA 2F2HA 4AMCA 4TOQA 4DWSC 4J27A 1WCGA 3VOCA 2F7OA 3HZ3A 1QNRA 4LQ1A 1CPUA 3KWXA 3OIHA 3MI6A 3PZGA 4JZ5A 4MNKA 3VMOA 1BFNA 3WNMA 3N12A 1W1PA 1CTNA 3QOMA 2BHZA 3DX2A 3GH4A 3I3EA 3D3AA 1S46A 3AXHA 2DQXA 1MWOA 1UWSA 2J4GA 1E3ZA 3SCTA 1ZBVA 3EDFA 2GVYA 4TTUA 1WZAA 3BUDA 2EPLX 4UZUA 1W3LA 4W89A 3VIPA 1HL8A 2QLYA 3ZJ6A 2EADA 3PZMA 4JFVA 3LRKA 4R27A 5CQ1A 4PSRA 1BVNP 2VT0A 3PZQA 1ISVA 3VKKA 2WKGA 2X1IA 3WNLA 4F66A 1UA3A 1E5JA 4YHGA 5CXPA 2QHAA 3AYRA 2VCBA 1BGGA 2ZXQA 1F4HA 3EMZA 3OZPA 2VR5A 4GI9A 1F4AA 1V02A 5E0FA 3H55A 2WCAA 1EOKA 1TQUA 1XSIA 4Z2KA 3SCSA 3HG3A 1ZJAA 4MB1A 4WKHA 3WN6A 3WNPA 3LPPA 5EFFA 3BAJA 3VPLA 2V3GA 3UETA 1NOUA 1IZKA 2CKSA 3BCFA 2DH3A 1US3A 4U5IA 1VRXA 4AISA 3WD0A 2ZX9A 4AD3A 2WBKA 2EPNA 3DECA 4JKMA 3VIHA 4A3YA 1WZMA 5FOOA 1WZKA 5D8ZA 4AZ6A 4D6IA 1UWIA 1ZS2A 2YL5A 5ABEA 1ISWA 1K9TA 1IZJA 3UCQA 2XWEA 5A2AA 1M03A 3D51A 1CGWA 2Y24A 1JZ5A 4QAWA 3RJYA 1GQKA 4HOWA 3EJTA 4QCFA 4WIWA 3J7HA 3WFLA 3IJ7A
chains in the Genus database with same CATH superfamily
4WHYG 1S7UA 1TJHL 1EBPA 2W59A 1I9RL 3TBBA 2GABA 4LGXA 1F2XK 1BVLB 1XUZA 2YUVA 3HRZA 1TELA 1JGDA 2DT2A 3HC4H 1N3NB 4N1EA 1IBFA 3TJLA 1ZSXA 1JNNH 1PIIA 2XNAA 1JHLH 1O5PA 3K74B 3C5SB 2XZCH 2WXKA 2KQNA 3KOXA 2D7TH 3U4FA 5FF7A 3VGDA 1E28B 1R87A 3W74A 4A38A 1HXMA 3ZFHA 1P5UC 1HHJA 1A6AB 3J8F7 4Y1AE 3KLHC 4JNMA 1TPDA 1Z9OA 3F7LA 4M4RA 5ADPL 5F9DC 5AAPA 4KDTA 3T0CA 4AD0A 3CZFA 1JWSB 2VZ3A 2PCPA 3LOWA 2DSKA 1MOEA 3MRGB 1DSFH 1W5OA 4AJWA 3PG2A 4EOWL 5IHRA 3S8WA 1ZJIA 1J5OH 5DU7A 2R8SH 2FPYA 1OOAA 4O52A 4NRZB 4H0IA 4WWKA 4JFWA 4NQED 1HEJC 3S4TA 3Q01A 3IJHA 2WLZA 2J8FA 2JI1A 4QS6A 4G9DB 1TWDA 1DVQA 4TTDD 4XMWA 4N3TA 4DNHA 2Z0IA 1TZ7A 2GJZB 1K6QL 3BUBA 5IW1B 4GSDH 1S7WB 3VI4F 2CR0A 4EKJA 2XG9A 1S78C 2CWNA 3OAYK 3OVGA 1E9PB 3C2EA 4N8VB 2H32A 5FL0A 2XPZA 3D5HA 4EPKA 3EAKA 1A50A 2MSPA 4V11A 3VFRB 3UCDA 5FA4B 1MLCA 3O0KA 3FUMA 1V7ML 4HNOA 3MTWA 3SY0A 1XD0A 1HVQA 3WKPA 3PY2A 1PZ3A 1WZ1L 2J71A 3FS9A 4HQQL 1EDTA 4J8RB 4WW1A 3OBAA 5KS9B 4WTQA 4ZL1A 4LPYA 3KH3A 1SRDA 2J88H 2ZX5A 5C6PB 1ZA6A 1FWSA 4YHYB 5AVVB 2XPKA 5AAWA 2BIOA 1W1VA 4XP1L 1XDLA 2DQTH 3OIXA 2OI9C 1ITUA 1CVRA 8TIMA 1UZ8A 1NC2A 4REQA 4PJ5B 4MA1C 4ZUVA 2BNJA 3N13A 1BD2E 1ZGLA 4J8QA 5I8OH 1WFIA 4WWNA 5CINH 1MFVA 5L6UA 2NX9A 2OSXA 3E6FB 4CVUA 1IC7L 3GB7B 1ACYH 1NH6A 3FDWA 1WAUA 2FHCA 1B9ZA 4KXDA 5F9AC 2EXWD 2GUOA 2XZAL 3HC3H 3V75A 3KH4A 4HGWA 3M17B 3RL2A 3MX0B 1IEWA 3N55A 4P5KB 3P61A 1MYRA 3RPDA 2NSQA 2B59A 2MOGA 3ARDB 3R18A 2WVSA 1T1XA 3N0AA 1P84K 4AIEA 3NAVA 4H6EA 2CHXA 1W9BM 1U3HD 2ADGA 4K3DH 1A1NA 1G1KA 3EPOA 3BGMA 1TU2A 2WP3T 2FNBA 4MWAE 2YBTA 4YSQA 2OXHA 2W9DH 1L5GA 4HTBA 2D4FA 4DAIA 4AGMA 2FO4A 1I2PA 4WU7A 3OJDA 4OB5L 4N9GA 1FZJB 2C3VB 2VRKA 1UFGA 3PPEA 2ADFH 5REQA 2F8OA 4POZC 3HPXA 5HDBF 5KSBA 3ALPA 3MV7D 3R12A 4HYTB 4TO8A 3FT9A 5LBSL 4P7NA 1ZY9A 3NRFA 5FFOA 3ZTNH 1A7RL 3MMTA 5E2JA 4AYFA 5GQBA 5IESH 3HC0A 5AOJA 2DUXA 4G6ML 1SDDB 4Y4HD 1JZGA 3D52A 1T6BX 4XNYL 1TWIA 5AHNA 3PCYA 1X9LA 3NZRA 5I7GA 2EDMA 3GNMH 3KLDA 5BWFA 3ASOB 2WB7A 3N2CA 1Z42A 2MCMA 4GABA 3VNYA 3FCSB 4Z7WE 4FA3A 2YPLE 4IK7A 3M43A 2LT9A 5C9UA 1WIUA 4EPSA 3AHTA 4I89A 2H2SD 5LIYX 5F1KC 1S7XB 2FTPA 2V2HA 1R2RA 3FX4A 4BK8A 3HAEB 1ODUA 2NX5B 4N3UA 1VKXA 5M03A 5FK9A 1KBPA 4NQXB 2I9LB 3LKQA 3Q6FA 3AWGA 1KC5H 1N2RB 1AOHA 1GAFL 1ANUA 3KWVA 3VFNB 3S98A 3CMJA 4G42B 4YL9A 4YGVB 4CQ9A 2G60H 4WEEA 1J48A 1QOXA 1RUML 4X5XA 5JXAH 4CQDA 4IIEA 4NN6C 5ESAB 4ESKA 1U8OA 4XBPA 4RWYH 3W37A 1U2YA 1FH7A 2WHKA 1AXIB 4GSXA 4H20L 4JNZA 3BV4A 4R5EA 4XZMX 5JW5B 4EXKA 1JQVA 4K23L 4N2NA 5DMKB 4JTQA 1XIFA 1HINL 5D5MB 1SUJA 3KGRA 3D7PA 4P46B 2VEMA 3O3AA 1U41A 2IPKB 1YN6A 1NKGA 2Z6FA 2DPKA 2ROYA 1BQSA 4Y2NA 2EE0A 2VWEC 3WELA 3WG7B 2R29L 3KS0H 4HN4A 4GX9A 3RDKA 1QPPA 1U8NA 5K9KB 3GMNA 1JF6A 2V67A 2OQJB 1LOSA 4DUOA 1KNOB 3CXOA 5EMUA 4X7SH 3HZYA 5J6GB 2C3HA 1XSJA 5JHMA 3S97C 4FA8A 5DR5H 3WUWB 4ZGYA 4IIFA 2P10A 4KTDL 1Z6JT 1E40A 3UIYA 3W1ZA 4X60A 2ESCA 1U3HA 2OTUA 4MQTB 2XYCA 4AZCA 5DT5A 4OLZH 2CWRA 1S7SA 1MVUB 2P5WB 3CZLA 2HMID 1URLA 3N41F 3NDZE 4KY1L 4OCXL 5D72H 5DQPA 3CTLA 1Z9NA 3U1SL 4CNPA 4DO5A 4WJ5B 4RAVB 4QRAA 3CH0A 5EU9A 1MW0A 2J4WH 1BGXH 1EFQA 3MV7A 2GHZA 5IG7B 2J7CA 1J1OH 2BXZA 2GK0A 3NA4A 1E7VA 1I7RA 1KCUH 2P5EE 1BVKA 4PJ6A 1MRFH 1B0IA 3U2IA 4B5UA 3H9SE 1KRCC 4AMAA 1Z2KA 4LLYB 3HE6B 3KHDA 4IEFB 1BWVA 4JVWA 1CECA 4ABWA 2PP9A 2ED7A 5CKGA 5I16A 2D0FA 3QJUB 4Y4HA 4D0CA 1I7UB 2EAWA 2PF8A 5F7EH 1VHNA 2OPCA 2NY1C 3LZFH 4F80A 3QGAC 1EXUB 3CASA 1M71B 4IHOB 1J18A 2WLIA 2W07A 3LXAA 4DO7A 5SWZE 3UO1H 1FQ0A 3FL7A 5CN1A 2A7RA 5LBSA 4GIRA 5HI4C 3NRPA 2KZHA 5GGSY 1CIDA 4DKEL 1NM9A 3D2UB 3BRDA 3AWOA 4OTXH 4C60A 2BBFA 4K7YA 3PFUA 5GJSL 3WL0A 4GYBA 1DQDL 3JVAA 1QFHA 1WWBX 1N67A 1DL3A 2Y06L 1ZP4A 4LLDA 1T41A 5EN3A 4HTYA 3RJQB 1KPVA 3NZUA 3MLSL 2HXUA 1WXJA 3NZHL 2V7NB 4OUOA 4F7PB 2HG5B 1SR9A 2G97A 2WC7A 2D3NA 3RGHA 1YE4A 2Q87A 2R56H 2AJ3B 3O3DB 3G2GA 1NAMB 4TSCH 4R26H 1NCDL 3H9HA 5L2KD 4HA3A 2VABB 1VPYA 1NCGA 1X5LA 5G5DA 5J57B 3U30C 4M3JA 4NAMA 2XWRA 3N2BA 1GS8A 4U6YB 5FHAH 2IXQA 3QS2A 1LO3H 2CLIA 2W0FA 3VIGA 1J96A 5AVTB 5I06A 2A5UA 4NHUA 2BPBA 3R6IA 4HMCA 1HP4A 4GKLA 3L3OA 1B0GB 1N0LB 1J2BA 3T2LA 3G24A 4PJXB 4FFZA 2ZUWA 1YEEL 4ONFH 3C9NB 4PH8A 3PZTA 1GZ1A 2YPVA 2J5LB 2R29A 2AZUA 1ETA1 3UG8A 4EOUA 1HILB 1XWYA 5EBMA 3S2CA 3GRWA 3ARBC 1QFOA 4CNSA 3ULUD 2EO9A 2PLTA 5DJAA 1LEGB 4X5WA 43CAA 3ZJ7A 4A7VA 2RHGA 4C4BA 3DIDA 1DVJA 1VZGA 2VXTH 5C0BD 1INEL 2VVSA 1VFAA 3WLHA 2AQNA 5T1JA 1E6QM 3CUGA 4O58H 1F6FB 3P77A 4K8RD 3NOEA 4F8OA 5FR3A 3IAPA 1U58B 1BIIB 1TWZA 3SJVA 3KPRE 3TJHD 4B5XA 2VXUL 3W1NA 1AR1C 2YZ8A 2BXYA 3UGEA 4W1TA 3O6KL 4LCWB 4Q8VA 5AHMA 4A2MA 1UASA 1SJXA 1WCBA 1ZB5A 3UGRA 3K1DA 3SOBH 2MNRA 3DJ9A 3S9ZA 3TW7A 2D2GA 1EEZB 5DRWB 1KIRA 2B8OT 2EIJB 2KC0A 3EX6A 3BQ6A 2V9UA 3GK8H 5FJRA 2P44B 2B9BA 3HUJA 4OUIA 3PTDA 2PRHA 3RWFB 3UYCA 3DV4B 2OYPA 2KYIA 2VLMD 5E56A 1I4FB 1M05B 2JJSC 1QFUL 3RDTC 1IO4C 2Y0SA 3BAXA 2EKSA 4QEEA 3PQYD 2RJHA 4GQ9L 3U9WA 4F37F 2W65A 3DFHA 3N43B 4OZ4B 4NC1C 4C6MA 4L4OA 2WQSA 1HESA 4AGNA 3VUSA 4LB4A 1CLZH 2BASA 3FGCA 4WO4C 2ZKMX 3JTTA 4HUWA 3GZ3A 2VW6A 1WCQA 3CT2A 2VHLA 2EILB 5JYMA 5F7DB 1YDYA 4JCLA 1NELA 4V27A 3M86A 4Y9AA 1KFAL 5L2KA 1OP3H 4KRUA 1HJXA 2F54A 5CC5A 4M1CD 3RAOA 1OC6A 1EHLL 1PV8A 4PJGA 1DHPA 1HNYA 3ARVA 3HW7A 1NQ6A 3T1GA 2A6JA 4U3SA 2UBPC 5F6IC 4E5TA 2GITA 1XCXA 25C8L 2PTWA 1RCXB 3IVKB 2J74A 3MUGB 1YPZE 1KGXA 3HBGA 5CJQH 3WF0A 5EEVA 4XN4A 4MAYC 1FL6B 5DEFA 2CM6A 4L1GA 1UOKA 2P5NA 1Y1UA 4GPVA 1YEIH 2A0LD 4F3FB 3AOFA 2J7FA 1SN2A 2NVDA 5E7FA 1CFQB 5DHXB 3BFWA 2FWSA 2XX0A 2HX9A 1I2OA 5HMSA 5IW3A 3I85A 4JQ1A 4F1ZA 4E8GA 4Y16B 3BH9A 4C56D 5DJ8A 1MQKL 1AMYA 3EW3B 2XFYA 2NR6C 3P93A 3H2WA 2GBAA 1U8JA 3IAGC 4JZNA 2ABAA 5IB5B 4XPBL 4QT5B 5I00A 3DBPA 2E86A 4AQEA 4GAGH 5I17B 4P9MH 1K5NB 1IGSA 5C0BA 2ZZ2A 4AQ8A 1EQPA 1F11A 4JM2B 5IV2B 4JGMA 2INEA 1ZT7A 1JCLA 4S1FA 4BFJA 1JHTB 2OLAA 1VPOL 3NFNB 2V9TA 1FOBA 1YN7B 3ZZLA 2C71A 1H3TA 3BGAA 1JVNA 2M2DA 2NV2A 2VN4A 1UIPA 2L04A 1T99A 4P3CH 3M47A 1BYCA 3V2AR 2PE4A 3LKRA 3Q5OA 4JPIB 2W9MA 3ZJAA 5IFAL 1X38A 3M1BB 3QN3A 3DX6A 4WLCA 4GW1A 2EYRB 4NKMA 1N8FA 2ASHA 3JS3A 2FZ3A 1FO0H 2J77A 2B15A 4RDYA 1O6IA 4HA4A 1HQRA 2XJ7A 1T0OA 1F2JA 3QUZC 3S1XA 4FRWA 3G6DH 3QORC 3MRPB 1TYJA 3W4RA 3QUMH 3N1GC 5G2IA 3CL8A 3S42A 4UM8B 4YQXH 3TNMA 5F4SA 4F33A 3MLZH 1RK0B 1KJ3H 1NBCA 1V77A 3N9GL 5KVEH 1FL5B 1EVUA 2V68A 3PHAA 5IQLA 1B2YA 1R5WB 1TB3A 3QSTA 3PQYA 1RUSA 1FFPA 4NHCL 1FNSH 2WQWA 1NAKL 4FOJA 1DCLA 4MZIA 4PJHF 1LLZA 5AYUL 4DWDA 5D7SH 1Y5VA 4K8GA 1OAYH 3JV5A 2V5YA 4ERSH 2OODA 4OQTH 4MJIE 3O3RA 2B7DT 5C0QA 1JGMA 4PHZA 4I18B 5GRUH 5HGBB 2YL8A 1LE5A 5F93C 3OG3A 5CCGE 2F58L 2FYYA 2VI0A 2G4GA 1UR8A 4QLJA 2GTQA 2Z7GA 2O61A 3OBKA 3SO7A 4PZVA 2BIMA 4GG9A 2FT7A 4FXSA 4PMVA 1BQCA 3RGVB 2DYPB 1E1EA 3O0FA 3GUTB 2ACQA 1MFDL 3GBLA 1X9RA 2WMIA 5C92A 5LHFA 3U0WH 1CD8A 3DXIA 2A4AA 3N34A 1BMGA 1F56A 1VFMA 2WAQA 4KCTA 3B8WA 4X4ME 4LL9A 3RG6A 1F58L 4GP8B 4J3TA 2YR1A 3W9DB 5DYOB 2VWSA 1S3KL 3VMNA 3WLNA 2A5HA 2A6KB 3SUUA 4FQQB 3TH3T 4C56A 1S3TC 1LLOA 1VEOA 4Z7NF 4GZ7A 4GY7A 4XWUA 4TKWA 4S1RH 5EOCJ 4P2QB 4RGMC 3R8GA 4TSAH 4JRXA 2QVKA 5FO7A 4HK6A 1IBBA 2OKOA 4I2XB 5ISZD 5DXYA 4HVBA 4N0CD 1TTBA 2XN0A 1FWGC 5CS7A 4DAGL 7PTDA 3KYNB 5PCYA 1FYTD 5AVHA 5GS0D 3WK1A 4J27A 1VCGA 4TQIA 3O2DL 3THQA 4NJ9L 4X98B 4WY0B 4XOCA 3FB5A 2H3BA 4URKA 4ABQA 4W9JC 2IALA 1HL8A 1N8IA 2EADA 2LE9A 3SE9L 1UT9A 4R27A 1YXDA 1B6UA 4LQFH 5I0YA 1H8NA 2ATKB 4MM1A 3VI3B 4DQOL 4H5SA 4RAHA 1XFPA 1SW7A 3N9SA 5D93B 3EOTH 4YZFE 3RGBA 3GIYA 4PJIA 3LQZB 4XGZA 3W84A 3BCFA 3GSUA 1US3A 4FMFA 4IIZA 1U1HA 1CYXA 4ODWA 2CZNA 3H4WA 1GZHA 2YO3A 5C54A 1YHPA 2KZKA 3HF3A 1BZ9A 3NEEA 3D51A 1FIGH 2XI9A 3LHWA 3M0MA 1AAJA 1JERA 3J7HA 3SY1A 5JLZA 3MRQB 4N02A 4JFZL 3ESPA 5FYKH 3I6SA 5F2FA 5IEHB 4AUYA 4XN9A 5KS9E 1B3VA 1YYML 4DWHA 3OR6B 1YYAA 2VDRB 2AAAA 3ZE1F 5B3JE 3T1FB 4TVDA 5IGXH 1INDH 4AC2A 2IQ9H 1X5GA 3DIFA 3H2PA 2EDKA 4FR6A 4RDQG 3QV8A 2X88A 1X6LA 2XVNA 4PJ5E 4EP8C 2Q86B 1FCVA 1DANU 2XVKA 4LLVB 2NY6D 2WYZA 1RZKH 3LRSB 2VLRB 3EH5B 3UO8B 3FUNA 5EU7C 5I73C 2CLRA 3I02B 4UIKH 3PDOA 5J1AA 4WGHA 2IBGA 4L4PA 1E9QB 2YSSB 2AV7A 2YQ2A 1F3WA 5GRJL 3QQNA 4K3EH 1KJMB 4JTFA 4AVIA 5I1AA 2DEPA 3OO2A 2KZBA 4N0FB 3I74A 1HZHL 3GIVA 4AWTA 5HBBA 1K9FA 1BBDL 4JK0D 1UCBH 4H2HA 3MPCA 4EZJA 3TF7C 3MCKB 1M7DA 4P23D 3I6KA 3W23A 3V8CA 4HBKA 1W72B 3TWCL 2OXGA 4Z1CA 1A4JB 3OU8A 2X2GA 2UWEA 3TPUB 1FYTA 3IJEA 1ZLSH 5ILTL 2CMRH 1XEDA 5KBMA 1YEGL 2R2EA 5LGZA 4UT9L 3K4AA 1ZVSB 2HS6A 2BRRL 2GY7B 4IIQB 3SBPA 2VERA 5J9PA 2HT4D 4B3ZA 4CD4A 4FYTA 3T8XA 3OYZA 3DFQA 4WEBL 5E94B 1ZTMA 1ZK5A 4HEMA 3U36A 1R30A 4YBLC 4C6KA 3KZSA 3O2DA 3U7AA 3CZKA 3FQYA 3EYVB 3KVMA 4ZAKB 1U8KA 4UOW1 5JBFA 4OAWB 1MKFA 4YWIA 5D33A 3D1MC 3HNVL 3SKMB 4GUHA 3JZ7A 1Q94A 2ZONA 1TCMA 5D7IF 2XN9B 5KYXB 4XE0A 3LDBC 1O6TA 2NX5E 1GHSA 5AN7A 4D0DB 4Q7IA 2H6PA 3FF7A 5D7LD 1NF0A 4IJRA 4ODUB 5D4HA 2PGFA 2EQDA 3TURA 4RE0A 1QA9B 3SBWA 3SPGA 3B9NA 2EEDA 5DJDB 3CCHB 1A0QL 3UPRB 3W83A 4XVOA 1I1FA 3NZ1A 1EGJH 4BHUA 1BLNB 4GUCA 1HYSC 2JF1A 3VD4A 2W1NA 3MRMA 3DVNA 3G8EA 4ANKA 4WI0B 3B8TA 5CILH 2GJ6D 5DVPA 5T1DH 3P2VA 5K1VA 1I85A 5AW8B 5LXGH 2LABA 5DK0A 3DVIA 5F4XA 4LVEA 3FB8B 5D5ME 4NUPA 2J73A 4N6EA 4IW4C 1H50A 3G6JA 4KK5D 3VC5A 1E5BA 2ED6A 3O6DA 1V4YA 4LLWA 1M6JA 4CW1B 3GI9H 1SDAB 3C5ZB 4RFEB 1TKKA 2GIYA 1NBZB 1RHHB 3KVJA 4B5WA 3TIDA 5FM8A 2D22A 2HTKD 2PNDA 4N4PA 1F05A 2DQEH 3QCVH 3HS0A 1PD6A 1IARB 2F6KA 1TJGH 1L9RA 2V9RA 1S5WA 1KIQB 2AJZA 3ULVD 1CO1A 3B4NA 3CN2A 4S2SA 3DK0A 4ELDA 1DR9A 5F96L 5DQ9B 4AF0A 2BCMA 5FWQA 4HIJB 3MYPA 4P23A 4I4WB 4IKIA 5CSZA 2J20A 2ABBA 2VGLM 3TN0A 1EBHA 5HDWA 4I9TA 1GYVA 4J3VA 2WBWB 1Z89A 2NSOA 5FO9B 1KLZA 2ZX7A 3KL5A 3MSDA 3BDXA 3FQ4A 5IIEA 2JKLA 2ZAIA 4GD0A 3UBXA 4ERGA 3PZIA 1IM9B 2R2CA 4EN3D 1DEDA 1W9VA 1F8MA 4PCKA 4R4FL 5DURD 3RL1B 4D6EA 3SZ6A 2WNNA 3AXIA 3H7RA 4UDTA 3U7WL 1F6LL 3QC0A 4XUYA 3TMLA 4LNVA 4DEWA 1C92A 2BNUA 3AIQA 3VE7A 1QVOA 2H8ZA 1UZHA 4ZUSB 2DQHH 4PJ8D 3FSAA 3HOJA 5CEZH 2FB2A 3VXSD 4LUJA 5C0JA 4DM1A 3QV7A 1TJPA 5I5IA 1I4NA 4MGGA 1WITA 4LVBA 3LMJH 4KKNA 4LSRH 3F4DA 4ZZ9A 3NSNA 3BO8B 3NABL 4NENA 1SHWA 2DQDH 5T91A 4MYWB 1NKOA 3HOGA 1IAOA 2BWQA 1KQYA 2PB1A 4OD1H 2JEQA 2FX7H 3DXAD 3EBIA 1QTSA 2EVHA 3K2IA 1KTJA 3ARSA 4EEEA 4WFFD 3ZX1A 2RQEA 3FFCD 1VFOA 4L5FL 3WJJC 2FQEA 4XXDA 5FYLL 4X42A 2WK2A 4I5BB 2OPJA 1DORA 4YDJA 2CW6A 3SGEI 2CHWA 2G3MA 2FL5A 3ZKND 3ZUCA 4B9PA 4R97B 1MCNA 3WO3B 3CQHA 4K7FB 4JO4H 2NQ9A 1FNAA 1OCOB 5FF6B 1PKQB 3SAZA 3LKSB 3ASNB 1UT1A 4PLJC 4L37B 2GJ6A 2CDFA 1EZVX 5CPSA 1KBBA 1P0NA 1QR4A 3ZKMD 3TVMD 3RJDA 4W9DC 4NM4L 4X7TB 1OFDA 2LFGA 4HWZA 1M9WA 5HHNB 4QF1A 3QQDB 4PMUA 1Q7MA 2KKQA 5C0DB 5FYLD 2GKIA 1OFQA 4NAQA 4OI8A 1HH6B 3X13A 4XZNX 1NEZB 4CNOA 2LLGA 1SXSA 3IPFA 3WD5L 3UG5A 4DH2A 3TA3C 4TIMA 1R5IB 5CGYC 2P76A 4Y6GA 5IDZA 4FNRA 4MG4A 3QXDB 4L4LA 4WI2A 1Q8MA 3EMCA 2XKNA 3DGGB 4FQLL 2OMYB 3RKDD 4NX5A 3ZS4A 4GACA 5A6MA 3KOWA 4XZLX 5BNXD 3K6SA 4G82A 4IKKA 2A3TA 4PJXE 5LIKX 1C9DA 3RBSA 4PJ9B 4D9PA 4GKNA 3VO0A 3HU7A 1J93A 4GAAA 4UNTA 3MMDA 4HZLA 5I3DA 3UBHA 1JPIA 1Q7QA 4YDMA 3Q05A 3DURB 1H5BB 3JZUA 5D09A 3ARPA 1RY8A 2YDAA 4GW4B 1KM2A 1U22A 3W75A 4YL2A 1VACB 4OUUA 2JWYA 2NY3B 2QTVA 2GYSA 4JRLA 1MJJA 3TT1H 4JDEA 5EBLA 3RVWD 3QY7A 2ZWZA 3R8HA 2ZAGA 3RAJL 5BXSA 4FQXC 2BVTA 5HWJA 2BIPA 5BNKA 3Q1SL 3BLPX 3BPCB 5C0EB 1XLAA 2ICES 4PJFA 5LNEA 5CEYA 3BVJA 1FPTL 1WFNA 2R1YA 5AC6A 4C1LA 2GY5A 2ZUQB 4PJ8A 4N24A 1QBLL 5HJYA 3VXSA 4LW7A 1E42A 3TXVA 4P5SA 1BM3L 2PWDA 2D7NA 1MLBA 4LCWE 3MMEB 1ACXA 3I2CL 3S1WA 1E0VA 1PY9A 1KEMH 4PJCF 1ODAA 4PREB 4DWSD 2ENQA 2VCCA 4WKAA 5HGAA 2ISDA 3VW3L 3I4EA 4AVJA 1A1MB 1WAAF 2Y6SD 4BFIB 2CJUH 4DZIA 5C9ZA 3DXAA 1NU5A 2KI6A 3HVNA 3FFCA 3QT2A 4BWWA 3IDJB 3E0VA 3LHTA 1T6VN 2IMMA 3DUUB 4U10A 4L8DB 1U33A 2NXZC 4PTVA 4LZKA 3B56A 2ZICA 1QI2A 4HWNA 3RITA 3B83A 4GKZA 1R9XA 1K3IA 2H8PA 5EZIL 4CDGC 3VNLA 2EDXA 1XH0A 3V6ZA 4Z42C 1UXSB 3TVMA 3A3YB 5L4MA 5CPOA 4FXGB 4PG2C 4HWEL 4EJ1C 1JCXA 4GEJA 4G7RB 2FWOB 1KELL 2J72A 4M5SA 3WE1A 3IE4A 5J56B 1YJDL 5DD5L 4X80H 3AXXA 3UC0H 1T3FB 4Y19D 5IBLD 4JQAA 2J2ZB 3ZHDA 2QGYA 4TNFA 1MH5B 2UY6A 3KYKL 1B90A 4R83A 3ML9A 1W9XA 2JVUA 1OP5H 4N2FA 3S3GA 3EWYA 2JKIS 1R5VB 4M6OH 1MUJB 5BO0D 4ZFOB 1TA3B 1IFGA 1KFWA 3BWUF 2HPMA 1DDTA 3AXLB 3GQFA 1ZRQA 1SQMA 1HJUA 5BROA 4QYOA 1X7QA 3D2TA 3QJFA 5DJYA 1RUKH 1OAQL 4JPKL 2F5AL 3JUYA 4G7FA 3JWDH 1ZBWA 4U4MA 3PAYA 2GTZB 1RZMA 2H3NB 1SR0A 5GGUA 1T6WA 4N2HA 3CD4A 4DN3H 4O13A 3RLHA 2HTLD 4ZW5A 1REQA 5DDHA 3Q13A 3BSHA 4JKNA 3WDQA 3P4MA 2Z7YA 5HJ3B 4QNPE 4NT6B 4KBPA 4IBWA 3O16A 3SGEH 3SRHA 4GXPA 1RPKA 2ZCKH 4OZHB 5LJYH 4OZIA 2WVVA 3VA6A 3SDYL 2MIZA 5IK3B 3SCMA 3WZ0E 4EO5A 2WMGA 3TTQA 1O0VA 3N73A 4Z7UA 1LK2A 1QUNB 3APFA 3MP3A 4LCIL 1VYRA 4RFOL 4R53A 2LTQC 3STLA 1PU0A 43C9A 3MGTB 3U2CA 4X8JB 4HHAB 3U82B 4HAFA 3X3GL 1KWKA 3C8DA 4ZUWA 1F1DA 2J7GA 3QG6B 3L5JA 2CO1A 1SEQH 2ZCLH 1X5IA 2PN5A 5DQJB 4GUPB 2K45A 3IDMA 4FQHA 1DWGM 3LRLA 4DWSA 4QRBA 4NP4L 5FF2A 1PIGA 4WWPA 1KGIA 1NMBL 1MIMH 3LH2L 3R8BB 1OE1A 3O6AA 4M5ZH 2A74B 3BVXA 5D2NA 1JRHI 5HY9A 4ATWA 4PTNA 4KK6D 2FKPA 2PO6B 2QPUA 4FADA 2ICEB 5A8NA 3KRUA 1N55A 4PUWA 4ZO6A 3RNKB 1H7PA 3VTRA 1I7TA 3K30A 3SI9A 2QSCH 5FJOA 2MPVA 3MNZA 1LTDA 3MJ8A 3S0PA 2PTYA 4K3JL 4W9TA 3OTTA 3GBNL 1D5MA 2CALA 4C6BA 4G7EA 2NSXA 3INPA 1ESWA 2C9VA 1MFUA 1CICD 4NSKB 3GMRA 4ZDHB 5C0RL 4AMKL 5C0CB 1V3LA 4JPWH 4YWSA 2F84A 5JHAA 4I1PA 4FLHA 2P4AB 1K8IA 2MHAB 3HR6A 4S11A 1IT8A 1C29A 3MFFB 5E08L 1UVQB 2X1RA 4EXQA 5E0QA 1A02N 2Y7QA 3WD1A 4DPCX 1UYWH 2XFWA 4Y19A 5J1SC 3ZK0A 2P3YA 3F1QA 4W93A 1GNXA 4N6RB 1KXQE 3VOFA 4XVUC 1P7HL 1QR1A 1OD8A 2D20A 1AMKA 3O0LA 3MLTB 3QIBB 2OTWA 3IACA 3EDDA 3I10A 3DMMC 3TW6A 4HPOH 3D9AH 3FU9A 4GLRI 2UZYA 4IX0A 2Q8BL 3SN6N 4TV6A 2BVWA 4N4YB 4ANXA 5LNWA 1P5BA 2DZWA 4W4OA 2NV1A 5SWUA 1QXLA 5HPCA 1Z6KA 1D2OA 3UZQA 4LEXL 4CDHA 4NLHA 3WTXA 3ZDXF 3R0UA 4FNSA 1BP3B 4BS0A 5D1QD 4JX5A 2VC6A 4PP2B 2R1XB 1F1GA 2VXQH 1YLVA 2L7JA 2VAAA 3ITXA 3TL5A 3GT6A 3MRKA 2AQQA 2HMCA 5B21A 1NMAH 3CIAA 2OL3L 4QXGH 3TZVB 4I2XE 2CZ5A 2H45A 3KBEA 5CFAA 5I24A 4YPJA 4N9EA 1R17A 2OLHA 4TL4A 2QQKL 4DCQA 3Q1EA 4AC4A 3FT2A 1Y6MR 3O9NA 4AHQA 3THUA 2Z1SA 1XIWB 1AXTL 3GMQB 3WIAA 1OAJA 3EOAA 1BWKA 1I3GH 1FORL 5K9OB 3ZO9A 5KINA 5HYJA 3CT7A 2JB6A 1FWCC 1DO5A 3IBEA 4NXKA 5EFDA 4E2DA 3LS5L 4RRPA 4P8UA 3DSFL 3AJXA 4QRPB 1R3KA 2BDQA 3AXMA 4J2QA 2A6IB 3VI3E 1BFVH 4HXAH 2WWKO 2DZTA 2APFA 3FRPB 4DY1A 3NK4A 5JUEH 2VC5A 2WVUA 3L1GA 2HVKB 1P53A 2HKAA 4M7KL 1M42A 1HKJA 5TQ2L 4N68A 1U0QA 3T9PA 4NVTA 3SGDI 2HBXA 3IWUA 3A3HA 4Q4MA 5E6IA 4ADTA 1EJUC 5GZOC 1LLWA 1OZUA 1S5VA 4QR6A 4Y9MA 1UOLA 3VE0B 5DWUL 4D7PA 1AQDA 3N25A 1CICA 2ROXA 2Z92A 4ACYA 1LHZA 4P5UA 5T1MB 1CFBA 4WHCA 1A6PA 3OSKA 1E27A 1J8SA 2FNWA 2XIQA 2X1XR 3CFQA 3FEMA 5E8NB 4HMNA 3BT0A 1RERA 3T81A 3TCSA 2BERA 4CLMA 3KRSA 2IDQA 4E4UA 3QWNA 3PG8A 1SEBA 1XYLA 3MLYH 5L4IA 3I6GA 1QNVA 3PUDA 1I7ZB 3H54A 1P7QB 3FC8A 3MP4A 1QK0A 1NCTA 4HOMA 4M6AA 2VLRE 3TSMA 5MEND 4BCZA 1A66A 4LQ1A 3MI6A 3G5ZA 5I30L 2NQDA 4JZ5A 4Y90A 4MJJA 3HMXH 5CBEA 1PZ5A 4NNPL 3HURA 1A5SA 1JPDX 3PAJA 3L5IA 5T5FH 2P43B 2P88A 4EDXA 2Z35A 4I7WA 1FNLA 5DFWH 1HE8A 2TRHA 2VDLL 4K9JA 5DMGC 4FULA 1QPXA 4UZUA 1JRHH 4HDIA 2EE9A 1M1XB 1W6TA 2BX7A 2Z0UA 2BDNH 5D1QA 1U93A 3S3JA 5U4NA 3L9EA 4FAMA 5EC1B 1Q9KA 3JR2A 5EUOF 4CAGA 1OSZB 4HZMA 2DEWX 2HUEA 1PLGL 2EDNA 4NQQA 5EGRA 3I9GH 1I8JA 4Z0XB 3GBML 4AYID 9XIMA 4P5MA 2J9XA 1DBAL 3H42L 5FDWB 1N18A 4CQBA 3SOTA 2FD6H 3BRGC 4AQAA 3OVPA 1FNGA 3C86A 5FM5O 4JZOB 4TNWF 3DECA 1HOCB 5LCVH 2VUNA 1CCZA 2NQ3A 5AENA 3WIFB 1UWIA 4NQTA 5KVDL 1DUZB 1OT4A 1JMXA 1WV7T 4ABUA 4U1MB 2JJWA 1D9KD 3W39A 4Z95L 4QCFA 4PRPB 3IJ7A 3WFHB 2AGTA 1XXDC 1QLFB 2OL3A 1CMOA 1YMYA 2RJGA 3EHBC 5F7WC 2VXVL 2BNRB 3VD3A 5FFLA 2BO0A 2NY2B 1P0BA 3G6AB 3G0UA 3KDMB 2HFEB 1KM6A 4X9FA 1J8RA 1G7IA 3K5XA 3NCJL 2VISA 2YZ1A 5LAXB 4GLRH 4ODXB 4K2SA 1GY2A 2C6QA 3S3PA 3QH2A 5KVGE 5E8EB 2H3DA 2XSBA 1ZAIA 3OKEA 2GEQA 3MNVA 1KENL 2WJZA 2XN9E 4PJAA 1VYPX 1FAIH 1ZE3C 5TDOA 5D7JD 5JQ9A 5CD3A 3B2UC 5FIEA 5IFHH 1TTPA 4WOQA 4BA0A 4HB7A 1G0YR 3GUFA 5I6MA 1P84J 3EH2A 4X61A 1A5UA 4OLWL 2O6EA 4NCC1 1UJ3A 5L88H 2QQLL 3OB0K 2J57A 2QCFA 3HZVA 3I6TA 1H3PL 4J3OD 4M7ZC 4MQ7B 2NXYD 1XR2A 3GVRA 1S3RA 4QFUA 3GRGA 3CEUA 3DROA 4OCRH 4JM4L 4XAWH 1A5FL 2WZEA 3BKJL 3T0WA 1XIDA 4DJDA 5DUMH 3NJGA 1AJZA 1HK6A 2C26A 4NO2B 3ZLGA 1XDJA 4UQAA 4Y7MA 3MUIA 3SJVD 5MENA 1QNZH 5ES4B 2O6CA 3NQVA 4X6CE 3HJZA 3BLBA 5LWYL 1I3RA 4PJBA 1CJYA 3KW7A 4E4FA 4MLSA 2EACA 1GJIA 4NO3A 4Z0BL 2H6OA 1S6NA 2B77A 1I9JH 4A7UA 3BE1L 3D08A 1T2JA 1S3HA 3OVQA 5GIRB 2DOCA 1T0MA 4MA3A 2TAAA 2VR4A 2ZXWB 3TYDA 1G7VA 3V0HA 4D72A 4GW5B 2WBJC 4MRBA 2KMWA 3V95A 3OGVA 2P8PA 5DT1H 5DHVH 4U28A 1UKTA 3T3PF 4JO1L 2AERT 3SGDH 2WJ5A 1Z0MA 2YAMA 2IO5A 2A6DA 4JANB 5TE6H 1V6WA 4WWID 2FEEL 3QFEA 4RNFA 4HU0A 4FL4B 4AW4A 4JHWH 4GRWF 1H49A 4ML4A 1BM7A 2GAZB 2YPKA 3U6XS 1A2YA 1D9KA 1B3WA 4FERA 3PN8A 1FO0B 3ZE2B 3MNDA 1XBZA 2ZX6A 3B9KC 5KSUA 4RBPH 2WJ7A 2F54D 3QUYD 3F3HA 4GZJA 2XHNA 1J4EA 3CGTA 3QUMB 3KR3H 2IH9A 4XD5A 3TFXA 1PJWA 1E5YA 5E4EC 1OGBA 1PTAA 3E9TA 4MTMA 4XZ9A 1R3IL 3CSTA 3PJSB 1TTAA 3HMCA 4NKOA 1P7TB 3SDDC 3OQ8A 4XWGL 2CU0A 4GMTH 4MJ5A 2EXYC 4DEPC 4LSBA 4WU5A 3DPDA 3ROOB 4G7SB 3VUAA 4H1ZA 2A1WL 5D7JA 5E99H 5D1ZC 2H8XA 3EDJA 1YRRA 5FW7A 1UM4L 4FXKB 2WXOA 2G75B 1V5JA 3SDXF 2QELA 3P0VL 4FDWA 3CBWA 3FOMB 1FNEA 1T66D 5ETUB 2GJXA 1A9BB 3F03K 4GGBA 1DQJB 4CC4C 3OZ9L 3AIBA 5DT7A 4HHHA 3D39B 2NDGA 3X1EA 2MNWA 8A3HA 3BP6A 3VRLF 2YDSA 1E50A 3RWHA 3H3PL 1ASQA 5FECB 1UB5A 2QKIC 5HNRA 5HI5C 4G71B 1H15B 5T9BG 1GPWA 3IDYC 4TF4A 3C09B 1JFQL 5IMMB 3T4YA 3OJMB 4ORGB 4UNVA 2OT1A 1P4BL 3HHSA 1ZLPA 4OJFH 4O5LH 2XHYA 2AQVA 2AQRA 3VCLA 5JIIA 4PUUA 1AH1A 4JY8A 4HV8B 2JEPA 1N0XH 2W9EL 2ZWYA 3QDGB 5ICUA 3MV8E 4FYSA 3VWKC 3WEMA 5DS1A 4H83A 4ERIA 4E41B 2EDOA 1ZXQA 4Q6IA 4JQIH 1PWLA 3E2HC 3RX7A 1KCBA 5K4ZA 4MHHI 3IB4A 4Y9FA 4XB3A 5FKPB 3BXNB 1K8YA 3AITA 4AB4A 2OR9H 4GIPD 3L5MA 4K5LA 4PVLA 3APTA 5C08D 2YN5A 3OGOE 2D7MA 1DVFB 4WAFA 3BZFA 4PS3A 4DEFA 3GXTA 3AYSA 3LCIA 3B37A 4I77H 3OKNB 3HGRA 4RNJA 4X6DB 4ZI8A 2HAZA 4XR8C 1HXYA 3W7LA 1KPRA 1K2DA 2HLFC 1DJZA 5EOCL 1XEUA 3WLSA 5FLUA 2E28A 3CIXA 1JWUA 2FJGB 1O75A 2QVIA 3F8UB 1GGIH 3ARGC 4E9TA 4QTIH 4JKWA 3KWTA 1AUSL 4GVHA 3VG0H 4Q33A 2N7SA 2X3BA 1QWKA 1IQDA 1EJTC 4O16A 5I23A 2MTAA 1K4GA 4P3DA 5E09A 1IIIA 1F73A 3VRJA 5DANA 4TX9A 4YVPA 3KYOB 4PWEA 2XINA 4D3CH 3QUYA 3W2KA 1FLRH 5JMOC 5HJLA 4PTDA 1JF1A 2Q7YA 2HVOA 1L9MA 2IG2H 1E2WA 1HXJA 3TXAA 4CU6A 4DUWA 5ICYB 2YEZB 5MEQB 3O4OC 5KITA 3L7EA 3GDLA 3DDGA 2VLJB 2WLJA 4M93B 1WAWA 4R4BA 3IT8D 3KCPB 4QRUA 1WKDA 1EJ6A 2K9UA 1XSKA 1GOOA 1YNKH 1SYTA 3KPSE 2DI9A 3H3KA 3VQLA 4W88A 4ZBCA 4GRMB 2VC2B 2Y8UA 3TBSA 3UXKA 1ODZA 1CLOL 5HQLA 3UPCA 5G1TA 3CH1B 3N85H 5CEXB 1LM1A 4KJQD 4NAFA 5JHDB 1U8PA 4FQ1H 3BVWA 4NGHL 3IF1B 3IRCA 1YQVL 3U9PL 5IRPA 3LBCA 3ITCA 3GFYA 4C7FA 2EZ0C 1JXKA 1KWGA 4YX2L 4N2CA 1KFKA 2G9KA 4JRXD 3RLGA 1MCPL 2ZRZA 2QKFA 5G4EA 4C55A 4YVVA 3VNZA 2WNQA 2PDPA 4NNYB 2OQLA 1N8ZA 3AALA 5J0BA 4YHKL 5B4MD 3TSBA 2VIRB 3PFMA 4F9PC 1MFEL 4OF0A 2V2WA 1A5OC 2O6FA 1OK0A 3HLAB 3FFDA 2QVHA 3QAQA 2FGWL 4AZ8B 5DA0B 4LIQH 3GSMA 4F1SA 2GFTA 4LAKA 1JV5A 1X5JA 2FDMA 4XH2B 1IEAA 4AV0A 5DCEA 3D25A 4O02L 2ZXDA 4RDBA 1ZWIA 3LQAH 3EH4B 3ROLA 1HH9A 3CUPB 4LE8A 3UXFA 3W38A 4LYKA 1QI0A 4GXUM 4LUSB 1UZGA 3CFBB 3F85A 1PNCA 4XMPL 2XWBA 1QO3B 2D4DA 4LSTL 5E2UH 3DG6A 5C08A 2G37A 3BN9C 4Z2IA 2R1KA 2FMNA 4XNDA 3NL3A 4AZ5A 3CAVA 3V0DA 1ZHAA 3NTYA 3LCLA 1WISA 1MQPA 4EI6B 1GTNA 1XLFA 1XH2A 5FUCE 3ES8A 4TNEA 1R47A 1E6NA 3PVFA 3P80A 4F7EA 3BJLA 4M1DH 3WL9A 2QQ6A 1Q1JH 4OGXH 4OE7A 1G7MB 4A2SA 1S7QA 2DS4A 4OKVB 5XIAA 3AWNA 4FS9A 4K94L 3V1HA 4QHRA 3IKCA 2QQNL 4H0GA 3ZR6A 5KAQG 2HJFB 4OZHE 1XVSA 1PX4A 4YNYA 3RNQB 3LKOA 3CQPA 1YDNA 3MBDA 3IAQA 4RGOH 1JDDA 5BXFB 3AU6A 2B1OA 4LASL 2Y5EA 3MXWL 4JY5H 3KVQA 3UBXG 4NUJA 4FG6C 1OSYA 1LUCB 4XZWA 2IKIA 3EYQC 3AMGA 4ACZA 3SQOH 3KDOA 1E2ZA 3MBWA 4LPUA 4RIRA 3U7YL 3GC4A 1BVZA 1SMDA 5D9PA 2V38A 1UJQA 2AI0H 2UUDK 2W0LA 4LT7A 4LCCB 4M61A 3ZHKA 4DP0X 2CCVA 1GUVA 2CHOA 4IRJD 3PB2A 5H8UA 3MLWH 4F8NA 1I31A 4HWBH 3O6FC 2X2IA 4L05A 5DMNA 3UVIA 3DJSA 4Z3EA 2CC0A 3PP4L 3F05A 4P5TB 2OR8A 4OCYL 4R7LA 4HK3N 1CK0H 2WN3A 3MP5A 1M5WA 2RH9A 3JWOL 3L3HA 3FXIC 5JMRA 1MJ8L 3UTQB 1JR1A 1NBYB 3CDGA 5CZRA 4KVPA 1WQVT 1M6OB 3WFAA 3EUDA 1LBFA 5C0AD 3HBQA 4LHUB 4R8WL 4NO5B 3RO8A 1NKRA 4IG2B 2ZOWA 3K8MA 5BU6A 4FS0A 1XW8A 3EYUH 2BY2A 4WTZA 1EIBA 3HCVB 2QKSA 4ZX5A 1E4MM 5ERWB 2E5BA 1PTDA 2W63A 2WZ6A 4ZXBB 3PWJB 1R46A 5C0CE 2E7CA 3QYCA 1UACH 2I85A 2ZVRA 1OOWA 1F3EA 5CN2A 5AHIA 3PF3A 2YGOA 1AG1O 1M1SA 5LKNA 4KKAC 3KNBA 1WBXB 4QHLB 3P0GB 3IWVA 3T09A 2DDQH 4O2CA 4R7WA 2PBOA 3TLRA 5CLTA 2Z29A 3SCNA 1VPXA 3DBSA 3GO1H 5K93A 3TQKA 1AYRA 3EO1A 4ACTA 4POUB 1HKVA 3GR8A 5B38B 4IMLB 3HHMA 1H7WA 4ZVJA 3RVVC 3AISA 1OE3A 4I3RL 4GYKA 4F37K 3JVGA 2A7NA 3PWAA 5I6XB 1BEYH 4PJ7B 5HVHB 4L80A 4LBSA 2ED9A 5KBDA 5BUAA 3IGUA 1UA6H 2J7EA 2AW2A 4JYEA 4WJG3 3HJEA 5BZWA 4N0YH 4WFGE 1YBQB 1YNLL 4O02A 1DPMA 4JTAA 3GSRA 1T40A 4J6RL 4Q8QA 3KUMA 3M0YA 3CL6A 1NJ9B 4X9HA 5GS2D 1E0UA 1IE4A 2VC2H 3B0XA 4AEOA 4IJCA 2WO2B 2OJZL 3MKKA 3A6BH 3BKYH 2PYFA 3UG4A 2RA1A 2DIKA 1DLHB 3H8AA 2J24A 4HAKA 1JE6A 4NFBA 3W7GA 1OF2A 2VZUA 5DQDH 1TPEA 3KPLA 1VCFA 1ME7A 1TO5A 3EJQA 2ZP9A 2R2HB 4KESA 1RHFA 4AYSA 1T04A 1XDMA 1QYGL 2BVYA 3K91A 2QBWA 1Q13A 1R38A 3NN8A 4N6FA 5L9FA 2WXIA 3VMPA 2Z2AA 4MA7H 5D6CA 3BQUD 4LVGA 2AXFA 5FXCH 5F7AA 3ZSSA 2FBRA 4ZS7L 1AK5A 3L3GB 4ANUA 3H8NA 1IJ9A 1UUSA 3MHFA 2CFFA 3KOZA 3VFGL 2XH0A 1U2HA 2ZPKH 4A39A 4U3HA 2JSFA 3KLSA 4I7UA 1PKNA 5LHEA 4MNQD 2PDBA 1GGYA 1N5YH 4IRJA 4F48A 1YY8B 5C0FA 3P74A 1KYOK 4AIZB 5EBWB 2YGYA 5LKYA 4P2OB 1CXKA 3WXVL 1SOQA 4OVXA 4XAGA 4KNSA 2VTFA 2WSYA 4KVCH 2HJKB 5ENWB 1OAXL 1XDTT 1NC4B 5DGQA 3N40P 1CLCA 1G4EA 1LO0H 3NUKA 1XUUA 4UANA 3KM8A 4S1QH 3W00A 5C0AA 1FC1A 5TBOA 4BF7A 2R2BB 1VAHA 2DAVA 4A04A 4NN5B 3TN0D 1QLEH 4TLTA 4R90H 2WKOA 2D03L 2VENA 5TE7L 1FG2B 3QXAB 1TVBB 1JD9A 4G7YL 1WA3A 1O5DT 1KIUA 1LP9B 1JK8B 4YU1A 2EAEA 4Y8FA 3BTNA 2EDDA 2PPDA 3C0QA 3P30H 4XBKA 4WV1A 1A1OB 1RFDH 4PJDA 1AW1A 3TJEL 1JPGB 2AJVH 2IFGA 1O9ZA 2XA8L 1XBDA 5D2LA 1IM3A 5B39A 4U1HB 2J78A 5JOEA 4QDGA 4TX8A 1FE8H 3AACA 3B7YA 3HR5B 3GSOB 3PM6A 1OL0A 3E1F1 3QNZA 3NSMA 4RGNC 2IXUA 1MHPL 3QQ3B 3BCJA 3X11B 4S3KA 3CV2A 4BSWB 2AOSA 3QEZA 4XMKL 2ALAA 3U2JA 1KR1A 3QDJB 1P6BA 3RM4A 3KBFA 5CP7B 1K3ZA 3QR0A 2APXA 3QGVA 4YHPB 3FTUA 1MFAH 1NUNB 3NZSA 2X4SA 4EMZA 2NWRA 1MF2H 5HPMA 2AAVA 5KZCB 3MKVA 2C18A 4PTUB 4RZBA 3TN4A 4WSJA 1CU4L 5FEBA 1EWDA 1N7MH 4MDIA 3WF2A 3CUIA 1OTTD 2I9EA 1WT5C 2E27H 2JJTC 3MRLA 3U0TB 2G2NA 3M6YA 2IEPA 3TBTA 4PB5A 5HA7A 2VMEA 3APGA 3PJNA 4R0LA 4JD4A 1OWWA 4DVRL 1E8ZA 4YTSA 5I78A 4TX6A 1R3LB 4M24A 3TP4A 3O8XC 5E2TH 3HN5A 1FN4B 1I6NA 1Q6GA 4GRLD 3BQUA 1US2A 2W6RA 1PZCA 3L3DB 3O81A 4Y5XB 3SE4A 4GIYA 3FCBA 4Y2OB 4GBXC 3EWUA 4U0RC 4ZRGA 4PRPE 2WO3B 1S2UA 5HWNA 1KXTA 1SO6A 4MNQA 3W2DL 3HE7D 5DD6B 3DX7A 4RAUB 2EKCA 2QDVA 1ITCA 2UVEA 1OPOA 1ZANH 3O2WH 1FVDA 5J12C 2AP2A 4ILDA 4OGYH 1YEYA 1KKOA 2VE6A 1S9XA 3LRMA 4ZX3A 1WDWA 4JNYA 2P8CA 4FI7A 4JPQA 3VFMA 3F5WA 3L3KA 1TQBB 1YG9A 5HR6A 4IJTA 4PV9A 3G04A 3GSVA 3K2UH 4NERA 4W9GC 3N50A 5HGDB 1JYXA 3UYOD 4P3WA 4AGPA 1DJIA 2WLLA 3UWVA 5DI8A 4B3LA 2QNEA 2HJLA 3GG0A 4HC1H 3OIHA 3KWXA 2XWTA 3SQBA 4B97A 2FVLA 4IUOA 4WUUB 1OCBA 2P5WE 2GHWB 4LRNH 2MMXA 3GXUB 5KZEA 3D3AA 3QIUC 3AXHA 3VFOB 5IBXA 2J4GA 1N6VA 1ZBVA 3IU4L 4TYUA 4GXVL 4AV5A 3GR7A 3XIMA 1JN6B 2CH8A 2NY5L 3DGCR 4N8CL 5GGRB 1AHKA 1PYFA 3O2VH 3DARA 3PNRB 2DQWA 3X3FL 4YN3A 4DZHA 4LL4A 1IGYB 2YRPA 4KFMA 1JOIA 5GGSA 1MDLA 1D5IL 1XC4A 3FYIB 8XIMA 1FFNA 2PP7A 5FOBA 4MB1A 4LCRA 1BXBA 3CVCA 1NGWB 3PHSA 1MG2C 5FUOH 5E6UB 3BPOC 3O11B 3FSTA 1TJ2A 1B4EA 5HGHB 4HX1B 4XP6L 1CDHA 3LKNA 1PDKB 3WD0A 4UT9A 5L6YL 1SU5A 3O6MH 3EKCA 5FOOA 3JT2A 4G8GA 2CA4A 3CSGA 5JO5B 3G7TA 2DIAA 2V5MA 4YMPA 1EL3A 4KFNA 5FCUL 1E67A 3U9IA 3RJYA 2QUMA 3BWUC 5I0ZA 2QFRA 1OX6A 1Q0XH 4JTGA 2LGNA 3QYMA 1XLJA 3EH1A 2VGIA 1G9MH 1V03A 3W0KA 1G7PB 2I5YH 4X4YA 3S34H 3P0YH 3T4AB 1KFJA 3KPOB 2XETA 1BQGA 1K9DA 2IUZA 4JPVL 5FACA 1MRDL 2VM3A 4WDTA 5A95A 3VXMD 3VFSB 1D7FA 1S5HB 4GRLA 4BGDA 3SFKA 4G7VL 4YHLL 2V3FA 2JE8A 4LANA 1OQXA 1RIUL 4EN2A 3K72B 3ZE2E 1X7FA 4IBSA 3LHYA 4NZRH 2XN1A 2NUPA 3SBRA 5E51A 1DSWA 1THCA 3HE7A 4PTXA 3MA9L 2G2PA 4XQ6A 1XGDA 3BUQA 1YE6A 3NIFF 5DELA 2JMRA 5DS8A 1RK1B 1R0AH 2O5XL 4F92B 4R5XA 5KVEE 4E8CA 4O28A 1M7IB 4QCIA 4S10A 4LXFA 1KN4H 4PV8A 4A7GF 3O2LA 4RRPG 1H8LA 3FSOA 5AWNL 5ECJE 3SDAB 4M1BA 2QDGA 1AD9A 1WKYA 1L2QA 3HPAA 5T1KD 5FD0A 5K9JH 2OP4L 2HRPL 1NWOA 1JZ7A 4ZXOA 4XHJD 3CLFL 2LVCA 3BPLC 3BVVA 4OD2A 3FJNA 1FHVA 4IOFC 2BRQA 5C9JA 5EFIB 4ZJ9A 1UZ1A 1SJBA 2VC9A 1KLUA 4UYQA 3W1QA 4L8CA 3D39E 1BZ7B 2ZP8A 4B95C 2XTLA 4L3FA 1XHGA 5GHWL 4ETQA 1FGNL 1F3DH 5LNGA 1CR9H 3BGFC 4OFKA 3KMDA 3SCMD 5A1AA 1DBBH 5I1JH 2GG1A 3KS6A 5CMAA 3QI9B 4HPJA 4J3WA 2BSRA 1XGTA 4OGAC 3L0GA 4O8RA 2PDJA 3VXPA 4A2DA 4E0RA 2DLFL 4UB0L 1BXUA 5CJNA 1E6OL 1G6VK 4QRTB 2PPEA 4C7GA 3BQ5A 3FO9A 3QDGE 1D3CA 1GGCL 1MHHA 2D7OA 4E41E 2RALA 1CFMA 5LXEA 3T42A 3HPFA 2IAMC 1CX9A 3QEGL 1Q9LA 3BKMH 5BZZA 4NQVB 1AP2A 4JJ5B 1K7FA 4WXZA 1G4PA 5I1GH 1NCCL 1DQLH 2XFFA 1LEIA 1DQML 1OLLA 5AB2A 2X7LB 4H8PA 4AJ0A 1T83C 3RRQA 3MBEC 1BV8A 4JFXA 2WY3B 3CEPA 1UYQA 5I28A 4X6DE 2WTRB 3RWJB 1IBGH 3MUZ1 4QKXB 1VKFA 4O9HH 1AGDA 3RTQB 4Q2ZA 3AB0B 4O1BA 3G1DA 4D8OA 1K4DB 4TUOA 3MRJA 4WHYH 3VXMA 1SJDA 4GG6B 3ARWA 4S2BA 3TS8A 3JRKA 1JAEA 1VGKA 3JV0A 3VVVA 3BMXA 3QDMD 5ALCH 3NCOA 3G5YB 3WBWA 3NQDA 2CUAA 5I8CA 3IMUA 4BGLA 3STPA 3IFLL 3TYFA 2ZZ4A 4C57C 3NQMA 1Q8AA 2PWHA 4HOXA 1PSKH 12E8H 2YD7A 1T7XA 4GXMA 2WNZA 3HGSA 1B2WL 2UZIL 1ORSB 2V33A 2AL2B 4ENEC 5A8PA 2OMXA 4Y96A 1NFGA 3EFDL 4L9DA 2OTDA 2D73A 1CNVA 4PBFA 3HI6L 1CURA 1EB3A 1JPSL 5T1KA 3VFVB 3C56A 2F15A 3H7LA 4O17A 4KKLD 1FLTX 5EO0B 2NNAA 4PR5A 1WPCA 3V6OC 2AEPL 2ZTJA 5HWMA 2V69A 3RVUD 5FYKE 5JHDE 3MR9B 5HYQB 1B4TA 3AT9A 4UTBH 4AEFA 2NTFA 3ECWA 4P2RB 4YHIB 3WLWD 1AS7A 3GMPB 2YD0A 4U2YA 4KZEL 4A6YL 2A83B 4BQ9A 1M7XA 2O4EA 1VJZA 4G8IB 4IGMA 5D2YA 5EWIH 2R7EB 3ISWA 4HKZA 4RZ6A 4K6AA 4PB9L 4IRSD 1O6SB 1RUAH 5JH1A 2HX8A 4NKDA 3WMSA 1DWJM 3WTWA 5JIQA 2X1SA 1ILSA 3ILPB 2YD1A 3QPXL 2FGBA 2GT9A 4OY9A 4CRPA 3G9VA 1TO3A 4PJEB 1OZMA 1FP5A 4XVJH 4OZGF 5B7YA 2G95A 1OCZB 4CSSA 4FFZH 2AV1A 4G3YH 2PR4L 5HYJD 5CZVL 5JQHC 3KXFD 4Q4EA 5F89B 2YPVH 4PRBA 1KTLA 2I24N 1ROWA 4OM0H 3GRWH 4LBEB 5IJCC 2PKDA 3WU1A 4LF3B 2OK0L 2GI7A 2CPUA 3HFML 2VEKA 3N1FC 1MY5A 2OEMA 3USZA 4FFWC 4XISA 4Y4KB 1Y18B 4KX7A 2PZ0A 2OGJA 5DF0A 4TNVF 2XQBL 3N17A 2BOCB 5K39A 3QXVA 4JHAL 2VXSH 3OLDA 2XYLA 5KG9A 5E6ID 2LAAA 3WX7A 2VDQL 4ZS6C 5HJBA 1TVPA 4BM7A 1SMOA 2AJYH 4KI5D 1UQYA 5I3IA 4HIEB 3TFKD 3QDMA 1NWUA 1ZHLB 1T5AA 2OKTA 3C08H 9PCYA 2AQPA 1XB6A 3ENLA 4JR5A