5A2CA

Crystal structure of anoxybacillus alpha-amylase provides insights into a new glycosyl hydrolase subclass
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
450
structure length
450
Chain Sequence
ERTWQDERIYFIMVDRFNNGNPKNDYEVDVHDPKAYHGGDLQGIIDKLDYIKEMGFTAIWLTPIFANEKGGYHGYWIEDFYKVEEHFGTLDDFKRLVKEAHKRDMKVILDFVVNHTGYNHPWLNDPAKKDWFHEKKDIFNWANQQEVENGWLFGLPDLAQENPEVKTYLFDVAKWWIQETDIDGYRLDTVKHVPKWFWDEFAKEVKSVKQDFFLLGEVWHDDPRYVAEYGKHGIDALIDFPFYKEASTIFSNVDQSLEPLYNVWKRNVAFYERPYLLGTFLDNHDTVRFTRLALQNRINPVTRLKLGLTYLFSAPGIPIMYYGTEIALDGGEDPDNRRLMNFRTDKELIDYVTKLGELRAKLPSLRRGDFELLYEKDGMALFKRTYEKETTVIAINNTSKTQKVTLDGELEQGKELRGLLAGDLVRSKDGKYDIILDRETAEIYVLAPKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Anoxybacillus Alpha-Amylase Provides Insights Into Maltose Binding of a New Glycosyl Hydrolase Subclass.
pubmed doi rcsb
source organism Anoxybacillus sp.
molecule tags Hydrolase
molecule keywords ALPHA-AMYLASE
total genus 169
structure length 450
sequence length 450
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5a2cA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5a2cA01
5BXSA 3WMBA 4Z2KA 1WDRA 4FLOA 4IM4A 4MADA 2J75A 3UR8A 2JF6A 5CXPA 1FFRA 3VIKA 2W62A 4B9YA 4AZBA 2W66A 4EE9A 2Y4SA 2WMJA 1W32A 2CBVA 1ZBKA 1E0VA 2J78A 1JNDA 4W5ZA 4NI3A 1D7FA 5BROA 4BA0A 1OD8A 3SIMA 4X9YA 5CQ1A 1A3HA 1I1XA 4FLSA 5BYWA 3W29A 4JAWA 4Z2GA 3VIMA 3MMUA 4NXSA 1UG6A 2EBNA 2DT2A 3ARYA 1GJUA 3CZSA 3NSNA 1B3YA 2YFOA 1KCKA 1FH9A 1W1VA 1W3HA 1VEOA 2CEQA 2CHNA 1V3KA 3QGVA 4UZSA 3VMNA 1WDQA 3DX1A 4F8XA 1QNRA 4HZ8A 1BGGA 5A3HA 1VBRA 1VEMA 3W26A 1QI4A 2ZX7A 2WCSA 3AHTA 1RP9A 2X2HA 2BXYA 3KE0A 5EFDA 1KFWA 4J3TA 3CUFA 2G3MA 2ZX9A 4PSRA 3W0KA 4OUEA 1JL8A 3L4ZA 1UD4A 3CHDA 3BAIA 1VRXA 3W38A 2JE8A 4UFHA 4CKQA 3CHCA 4CCEA 3BMVA 1C8XA 2OSYA 3U7VA 2YA1A 2A3EA 1JZ7A 3TP4A 4KGLA 3CMJA 1FHDA 3AI0A 4F79A 1OB0A 4CN6A 3FAXA 2J7EA 4W8LA 2CCRA 5BXRA 3UEQA 4DWSB 3MUY1 3HG3A 2Y24A 2PWDA 3WH8A 2VURA 7A3HA 2ZX6A 2JIEA 2VMFA 1EHAA 1ISZA 1VF8A 1M01A 3WIJA 3VSUA 1R46A 1T0OA 3FHAA 3W27A 2FGLA 1OWQA 4TX6A 2EJ1A 1WZLA 4NXKA 2C0HA 3K46A 4LGXA 3CHFA 1PX3A 1US3A 1EDQA 1BG4A 4J3VA 4L4PA 5DT5A 3WBEA 1GOQA 2CIPA 3WMCA 3PTQA 3GH4A 2WVUA 3WDIA 2F18A 3VIFA 4FMVA 4P8VA 4UR9A 5A8PA 4CD5A 3FN9A 2WMIB 1VFFA 3BVTA 1BQCA 4P8XA 5M17A 1PZ3A 1V02E 3AS3A 4CCDA 1TE1A 1V3LA 3W4RA 2EADA 1W3KA 4PN2A 2Q8XA 2WHKA 1UZ4A 3GXMA 3AIWA 2YLLA 3ZQ9A 1ODZA 1KCLA 1VBUA 3WH7A 4Z2IA 1PX4A 3L4XA 5E9AA 1GOKA 5GNXA 1MXGA 2X2YA 4NZJA 3MUIA 4AW7A 4GIAA 1TCMA 3MV11 4QCFA 1NWRA 3VIGA 4UQAA 2WMIA 1ITXA 1KB3A 5IFPA 5M5DA 4U2YA 4WSKA 4PMUA 3U5UA 4R5EA 3ZIZA 1KBKA 4AZ6A 2VQTA 2VZTA 4P7RA 5IDIA 5C8BB 3AMCA 1ISWA 1E6ZA 4GKLA 3LX9A 3DDGA 3NJ3A 2CBUA 1UWTA 4P7NA 2OW7A 2X2JA 3UG4A 5I79A 4X0NA 2RGLA 4FNTA 4NX0A 1B30A 2ESCA 1US2A 1UR0A 4AMXA 2EPOA 5BXTA 2NT1A 1EQPA 2J47A 3ZMRA 1JG9A 4V2XA 2XN0A 1QNOA 1UA7A 1DWGM 1LLOA 4MNKA 2D23A 4OZOA 3A21A 2DT3A 4PSPA 4PMZA 1Z32X 2YBUA 1HVXA 2J4GA 1GUVA 2VCAA 3DX3A 4FNSA 4DO4A 5E70A 1JZ4A 1TFVA 1GVIA 4AZCB 1TVPA 2ZUWA 3M46A 5FKYA 1R75A 4DUXA 1V6VA 2EPMX 3AZSA 3SCOA 3SUSA 4DWSD 5EB8A 4DWSC 4QDMA 5EBAA 1HKKA 1UZ1A 1CNVA 3OLIA 3WH6A 3WEZA 2PB1A 1JYXA 3D52A 3BAYA 2V3DA 4OOZA 5CPQA 1GQIA 1J10A 4JIEA 5I0DA 4KRUA 2WC7A 1E6NA 4AMCA 3IGUA 3HU7A 3N11A 4AXNA 4FLQA 2XSAA 3UG5A 3T0BA 1QHOA 1HXKA 2CERA 3WQ5A 2AAAA 3VM5A 4PCTA 1V6WA 3VGGA 2EAEA 2ZUUA 4UQBA 1JI1A 4PMVA 1R8LA 5ECUA 1EDTA 1OIFA 4HU0A 2VX6A 3VM7A 2XIBA 2Y5EA 3MO4A 1BPLB 3EDEA 2Y2WA 2D0GA 3U7BA 2D0HA 3BH4A 1O7DC 2DSVA 4A3HA 7TAAA 3PZ9A 1LL6A 2V5DA 3TONA 3PTMA 4AISA 1H49A 4D6HA 2DSZA 1HKMA 4UOQA 4FNPA 2YIHA 1O6IA 2DT0A 2VCCA 3QHOA 4YHEA 1DWJM 2BHZA 5CPSA 3RM9A 4GZEA 3VMOA 5I77A 1NOFA 1NWSA 2PBGA 5FIPA 3SUWA 2DGAA 4F66A 2GK1A 2VZVA 1TG7A 2RGMA 1NM9A 2DIJA 4J3WA 3CIVA 1JI2A 3T0AA 4TVCA 1W2VA 4OOUA 2GSJA 3VPLA 4KWUA 1CGUA 4TVUA 1S46A 2EPKX 1QNQA 3TA9A 3AYSA 4NSBA 2ZIDA 2XHYA 5A94A 2EEXA 4U3CA 4IUGA 1VIWA 5D4YA 1JYNA 3OLEA 3PZOA 1E3XA 1WP6A 3EYPA 3OB8A 2YL9A 2VRQA 1BYDA 3LRKA 3VIOA 1QI5A 1H0GA 2QMJA 1HF6A 2BVDA 4DWSA 3ZSTA 3VDCA 2QF8A 3KLLA 1QI0A 5C70A 3DYMA 2GVYA 2E0PA 1UD5A 1LWHA 4H2CA 2E9BA 3NCOA 1WPCA 1FOBA 4TXEA 1G94A 4H7VA 1UA3A 4JKLA 3L4TA 1V0LA 2GFTA 4KMQA 4GQQA 1JDCA 4LQ1A 3SCTA 3WENA 1CLXA 1CEOA 3MSDA 2DH3A 3AICA 2BS9A 5HOSA 1H1NA 1JZ5A 3FW6A 1WZMA 1C93A 4HMCA 4NZCA 4E8DA 1J12A 4Z2JA 4XZBA 1VJSA 1XCXA 1JYWA 2E8YA 1OGSA 3AYRA 3WMSA 4JL2A 2ZXQA 2Z1KA 1XCWA 1KWGA 3WDQA 1W9DM 1E4IA 2J7HA 1M04A 1AQMA 2BHYA 3W82A 4IPLA 2WM0A 4TUFA 5E0CA 3EDDA 1DWAM 1ECEA 2O9OA 2PWFA 3D5HA 1GVYA 4AMWA 4J3SA 2CNCA 3DYOA 4C7FA 4B3KA 4AZCA 3ARWA 1UR9A 4W86A 4CU7A 3AJ7A 1QOXA 2FYVA 1TA3A 1CXIA 3SCUA 4DUWA 4CN4A 5ABEA 3N04A 1KTCA 3FXYA 3ZT7A 1BGAA 5I23A 2PC8A 2XN1A 3MKKA 3VGFA 2QLYA 2WMFA 2WVSA 4W89A 3FY1A 1QVBA 2QV4A 5I2UA 3DX0A 2WC3A 2YDQA 4CVUA 2EABA 3SUUA 1UUQA 4Q22A 4F9JA 1JAKA 1NP0A 1D2KA 1R34A 5F7UA 4JHOA 3ZJ7A 1I75A 2XGBA 1HJWA 1AMYA 1JXKA 5I5RA 2NW0A 3GTNA 2D24A 1H2JA 3T2OA 1QBAA 1UQYA 1SMAA 2WC4A 3BAKA 2CKRA 2FGZA 3E1F1 3EBVA 1ZJBA 2XM1A 4RE4A 3WUFA 2CPUA 4Z2HA 2XUCA 4LPCA 3AIEA 3HG4A 2J74A 3A22A 3GDBA 4BS0A 1V6UA 3WL1A 2DH2A 1FFQA 2XYLA 1ZL1A 3ZM8A 1CECA 1VAHA 1XD0A 2XVKA 5BRPA 3BAJA 1QW8A 1CGWA 1PIFA 3LRMA 5DMYA 2D20A 5JIPA 3K4DA 3VX0A 3AIUA 1H3GA 3HG5A 4XUYA 4WF7A 1V03A 2VZSA 3CTTA 4ATWA 3QOKA 2E3ZA 4JZ5A 4OJYA 1HX0A 1XSKA 1HJVA 2PBOA 1MW0A 3HG2A 3H54A 2E9MA 2XVPA 2WKGA 4J7RA 4TTUA 4HA3A 3VDHA 1J9YA 2WZIA 1TUXA 3OA5A 1UQZA 4H04A 4UCFA 4MB1A 1E1EA 3POCA 4PTXA 2WCGA 4LYQA 1UWRA 1GHSA 1U30A 1LWJA 1BLIA 4HMEA 3LPOA 3RMEA 2VRKA 1KQYA 2J7GA 2W67A 4ML4A 2ALWA 1DWHM 4GQRA 1WDSA 3VVGA 5JIWA 1Q6GA 1G01A 2WANA 2VQUA 5IHRA 2F7RA 2DSUA 3CLWA 1V0NA 3GM8A 4PMDA 2WK2A 3VMPA 3BAXA 1QNPA 5FD0A 4QAWA 1Q4NX 4MNLA 5A6JA 3CZGA 4V27A 2OSWA 1LJYA 1JNEA 2ZOXA 2VVSA 1HP4A 3PZVA 3N15A 1U33A 5DO8A 5A6BD 5LA2A 1GPFA 3A23A 4JFSA 2DSWA 5AYIA 4UNIA 4M29A 5KZ6A 2ZUMA 2PWGA 4AD1A 2XFRA 3BUIA 1E6XM 3WQVA 3W6LA 4U33A 2XIIA 4UFLA 4J27A 1JXJA 2X1IA 1E4LA 2DQXA 3EMCA 2XWDA 2O9RA 3L4UA 1XH0A 1QW9A 1QBBA 4BQ3A 1ITCA 1FP9A 5A8QA 2WHJA 2D1ZA 1W9UA 3VDAA 2X8RA 3VX1A 1X6LA 4U2ZA 3GXDA 2W91A 3NSMA 1KXQA 4B15A 4MB4A 3SUVA 1ZS2A 2QMKA 3WEOA 5I24A 1B2YA 3DHUA 3I3DA 2XFFA 1ZBWA 1W1YA 4EK7A 1CGVA 5A6SA 1G1YA 3DHPA 3WFZA 1BTCA 1E70M 4YPJA 4A3YA 5TD4A 3ARPA 4W8AA 3N9KA 2WWCA 2J7FA 4WKAA 2AMGA 1HKJA 3AMKA 3GXPA 4U3AA 4HZ7A 1BYCA 1UWSA 4N42A 2D0FA 1V08A 4YHGA 2W5FA 4WLCA 2ZXDA 3AMLA 4PTVA 1UD2A 4GPNA 3IK2A 3L2LA 4GO8A 2VL4A 4C7DA 1ODUA 2F7PA 1E0XA 3WF2A 5D9PA 5BWFA 1E1FA 3GXTA 1QWUA 1WKYA 3MU7A 2WMHA 5D9OA 3VSTA 3THCA 3UERA 3M7SA 2ZICA 4TOQA 4KRTA 3ZT6A 3BUQA 1KBBA 1QX1A 3A47A 2VTFA 3ECQA 1TMQA 1UKOA 1MW3A 4LXFA 3UG3A 1JFHA 1VJZA 4P8WA 3D50A 3OZPA 4MJ2A 2CITA 3CZNA 1F4HA 3PZTA 3EDKA 5A6BA 3IAQA 1E9LA 4ZE5A 4XB3A 3RM8A 1CXHA 3WQWA 2W92A 5ABHA 5FCZA 1E3ZA 1KXTA 1ISVA 3LPPA 3RILA 2EPNA 2X0HA 2D73A 2XVGA 3L4YA 3AHVA 3WUBA 4V28A 3AMDA 1FA2A 4UQCA 3ALFA 2Z1SA 5LA0A 4QLLA 1E6RA 3ARUA 1DWFM 1E71M 1UWIA 3ZSSA 2AOSA 2WKLA 3WNOA 1IZKA 2G3IA 1DP0A 4WKHA 3WKZA 3A3HA 3H53A 3SUTA 1QPKA 1NP2A 3AZTA 4GO9A 3WQ6A 1EIBA 1V3IA 1JFXA 1GOMA 1CXKA 1GQJA 4MNMA 3SEPA 1JDDA 1WZKA 3OZOA 4F9DA 1KR1A 3FNDA 4AD3A 1PS3A 1C7SA 3F5KA 1RD6A 2O9PA 1OD0A 1YHTA 3HMCA 4BQ4A 4AZ7A 2D3LA 3H55A 2G41A 4QFUA 3WDHA 4M82A 5CSUA 1AVAA 8CGTA 1UD3A 4CUCA 1HL8A 3ARZA 4WIWA 4EAMA 4NZFA 4M81A 1E73M 1OBAA 1EOMA 3AMGA 2E4TA 1GONA 3AROA 3BLBA 4LYPA 1MFUA 3VIPA 1HWWA 2YA2A 1PZ2A 4AZIA 1XH2A 3HJEA 1CTNA 4HPGA 1UD6A 1CGTA 3OG2A 4TX8A 1NARA 2W61A 3AS2A 5CGMA 3IANA 4JCMA 2GK1B 1OSEA 3WDRA 3G6MA 2VJXA 1KGXA 1VEPA 3CZ8A 1V0MA 1GORA 3ZJ8A 3WNLA 3WSUA 3AZRA 3W53A 1RP8A 1C7TA 1EA9C 3B9AA 4BF7A 2ZUTA 1J0ZA 4L4OA 2IXUA 3VSVA 1QHPA 3GNPA 1VENA 4IISA 3BSHA 2CBIA 2FHCA 4FLRA 4JKKA 5A2BA 4K68A 2EPLX 3W81A 1R47A 1K9EA 3ZO9A 5A2CA 1OIMA 2TAAA 4ACZA 3ARQA 1DHKA 3GH5A 3AS1A 4AD5A 3BUDA 3ARRA 2EQDA 3VOCA 2FE0A 5A69A 2OYMA 4M80A 2VX7A 3F4VA 1LL4A 3S2CA 4OIFA 4W87A 1TQWA 1KQZA 5JUVA 3F5LA 4HA1A 2E8ZA 3WD4A 2CBJA 3IAPA 4FNUA 1OT1A 3OLDA 3CO4A 1PEZA 3M07A 4MB3A 1KGUA 2O9TA 1PPIA 5HPCA 3BC9A 3M6DA 5A8OA 1K6AA 2V3FA 1NQ6A 2BVTA 3CBWA 3IJ7A 2EXOA 4Z2LA 1R33A 1C8YA 2CESA 1JIBA 2WBGA 7CGTA 1BSIA 1PJ9A 2ZX8A 2CHOA 5HNNA 2HVMA 1XH1A 5GQBA 3WDPP 3BCFA 1B0IA 1SYTA 1KXHA 4CVWA 3GNRA 4ZXOA 1VFMA 2VUYA 5ABFA 3RJYA 2BY3A 1C3FA 2J8GA 4AZGA 2PWEA 3EJTA 1ZBCA 1V3JA 2EO7A 4AYSA 1EH9A 2J77A 1XYFA 5CSYA 3CUHA 1UYQA 1V02A 1J01A 3LPGA 3QHMA 1Q6FA 4XV0A 1EO5A 1NH6A 3WD2A 1IT0A 5AY7A 1Y7VA 2VC9A 4OKDA 3T0DA 1R87A 2DDXA 3LXAA 3SCSA 4PMRA 1R7OA 1ZJAA 3N17A 1GCYA 4PMXA 4W7VA 3BLKA 3LPFA 4CGTA 1J0KA 1XSJA 1LF1A 1CIUA 2DEPA 4MTVA 4WKFA 3T2QA 1LL7A 2QHAA 3AHYA 2D2OA 4BZYA 1V3HA 1KR0A 1M03A 3WNKA 2XN2A 4MAVA 3RCNA 5IFTA 2BXZA 5CGTA 3VUPA 1TQSA 3VIIA 4FF5A 4D6IA 1W9BM 4N0RA 3CH9A 1H4PA 1H11A 3WH9A 1ZU8A 1MXDA 3WFLA 4CD8A 4C7GA 8A3HA 2WZEA 3ZOAA 3TOPA 4AEFA 3K8KA 2XSBA 3WD0A 3CC1A 3I3EA 4GI9A 2GJRA 1ISXA 2DPEA 2ZX5A 3KLKA 9CGTA 3N18A 4JFUA 1TVNA 3MI6A 4Q7NA 3DC0A 3GBEA 1E72M 5A1AA 1HNYA 3K8MA 2GUYA 1EOKA 6CGTA 2F8QA 1OT2A 4HA4A 2VZUA 1K9FA 3AQUA 3CUGA 3SCQA 3GH7A 3BCDA 4PUDA 4CD7A 5I6SA 1DTUA 3WNNA 2XFYA 2WYSA 1OINA 2XPKA 4B9ZA 4LX4A 1W3JA 3B9EA 4D1IA 1J0JA 1R85A 1JF5A 1CGYA 1B3VA 1MQQA 5A2AA 4B3LA 4UFIA 4CD4A 3L2MA 4URIA 1WO2A 3CZLA 6TAAA 1UHVA 1QI2A 2PF0A 2XVNA 2XWEA 5M03A 2VCBA 3CV5A 3ZT5A 3KWXA 2X0YA 3TV8A 5D9MA 2WAGA 4D72A 4JFWA 1PAMA 1BYAA 4J3UA 1E5NA 2OW6A 2A3HA 3DECA 4A4AA 3UETA 1LG2A 3AOFA 4AEEA 4AD4A 1B9ZA 1MYRA 3UR7A 3IJ8A 2A3AA 1PIGA 1SZNA 1E6QM 1UD8A 2JALA 1CZ1A 4GZJA 5D8WA 4AC1X 3RM4A 5CJ5A 4NRSA 3EMZA 3GZAA 1W2PA 3HZ3A 5I3DA 3VTRA 5DT7A 1HL9A 4PTMA 1QI3A 2WNWA 1C8QA 3J7HA 2ZUNA 2HISA 2WMGA 4S3JA 2WWDA 3WY1A 3IJ9A 4DM2A 3PZUA 3MUAA 1HTYA 2OYKA 1GNXA 4D6GA 5E6YA 3RIKA 4PYSA 1MWOA 2W4XA 1B3XA 1E15A 1RPKA 4PCSA 2OLHA 1HJSA 4EKJA 1UH2A 5E1QA 4S3KA 2QPSA 1GOIA 4D71A 3A4WA 1XV8A 2OWXA 1OGGA 2VRJA 4WSJA 3D3AA 4ZE4A 4HOZA 4GI6A 1DWIM 1MQRA 3NYDA 1GZJA 5AYBA 3A4AA 2WZHA 1CENA 5IHSA 4E4PA 1QWNA 1BVNP 3ZJKA 1MQPA 1LG1A 4MPKA 3VNZA 1LQ0A 1WZAA 3I3BA 3D51A 1YQ2A 3CZJA 2YL8A 3BVXA 3SCRA 1PX8A 1B3ZA 3AS0A 4PMOA 4AY1A 3RJXA 4PMNA 1UKSA 1BYBA 1G0CA 3B8SA 2O92A 5AC4A 2G8ZA 4UQ9A 4FNQA 3CHEA 2FHFA 2WLZA 2J7DA 4ATDA 1XGZA 1ISYA 5A6MA 2W63A 2WHLA 4R27A 4M24A 2C7FA 4MAZA 3QHNA 3ARSA 4JL1A 3VDBA 3VIHA 4EANA 2QPUA 2V3EA 2CXGA 2VNCA 2OYLA 4AD2A 3WNPA 3EJPA 1Q6CA 3APGA 2G4FA 5A6AA 3AIBA 3SCPA 3GXFA 1UKTA 3CUIA 2VR5A 2XG9A 3SCNA 2OWWA 2X2IA 1I1WA 4PTWA 4QLJA 3N12A 2WB5A 4B16A 4UQEA 3DX4A 3ALGA 3ARVA 1TR1A 3KEHA 1UWUA 2DSKA 1W9PA 1JZ3A 4P8UA 4CD6A 2WMKA 4HTYA 4HOWA 3EMQA 3S6TA 1GJWA 4PMYA 1P6WA 3EJRA 2E40A 1E43A 1ZB5A 5BXPA 2BHUA 1TQVA 4HMDA 3AFBA 3MV01 4UTFA 4AIOA 4HP5A 1CXFA 4XZWA 3AXXA 1J0YA 1SMDA 3A24A 3BMWA 4PUEA 3WNMA 1G5AA 4P7LA 1UR2A 3QOMA 2CYGA 2EACA 1OM0A 1WAWA 5JBDA 1L0PA 1VFUA 1W1TA 4TVDA 3ARTA 1MW2A 1TQTA 3MUZ1 4J28A 3WQ8A 5JBEA 3K8LA 5DFAA 2YBTA 3JUGA 3T09A 4J3XA 5KEZA 1B31A 3LMYA 4D1JA 1TQUA 3VKKA 3U57A 3W24A 2A3CA 2XTKA 3AXHA 3KZSA 2ZXAA 4BQ2A 3UCQA 2GDUA 1E6SM 3AXIA 2YL5A 3PZIA 4RE2A 3WH5A 1MFVA 5HBFA 2YDRA 3BXWA 1NOUA 3ARXA 3WELA 2WBKA 1GQLA 1EO7A 3MMDA 1CYGA 1JD9A 3A6OA 3LXCA 5AC5A 5CPTA 1HN1A 1BG9A 1CXLA 3GBDA 3WY3A 1H5VA 1J11A 4MDPA 1WCGA 5GNZA 4UOJA 3VD3A 1IV8A 3AIVA 4NRRA 1XHGA 3BGAA 4U5IA 4W8BA 4PRWA 3POHA 4U5KA 4TTGA 4IPNB 4AD0A 2BY0A 3CZKA 3VU2A 1MVYA 4D6EA 2VT0A 1CGXA 1HP5A 2GDVA 4HU8A 3VIJA 2WVVA 4WK9A 2J7CA 4CU6A 2YKKA 1Q6DA 1NOWA 2BVYA 2F7OA 1C92A 2JEQA 2J79A 1BHGA 1VB9A 3WY2A 4GI8A 4M56A 1V6XA 3AISA 1OCQA 1EQCA 4ZENA 1M53A 2WSKA 3OLGA 1BAGA 3LRLA 1E4MM 4W7UA 3K4AA 4ZEPA 4ACZB 4JKMA 3A4XA 3A5VA 1AQ0A 2WXDM 3T2PA 1W91A 4X0VA 1SR0A 4JFVA 2UY4A 2UY2A 3PZNA 2IGTA 1TA3B 3WY4A 1HJQA 1F4AA 2VR4A 4E2OA 5LA1A 4OGZA 2YDSA 3KL3A 2WVVB 4W84A 3TTOA 4LYRA 4GXPA 5A8NA 5A95A 3NUKA 1ESWA 4M8UA 1W9XA 2PI6A 4W93A 3GXNA 4QP0A 3UESA 2FH6A 2VVNA 3AIQA 1SFSA 4PBGA 1J18A 3VD7A 2JFEX 3VGDA 4RE3A 1FP8A 5E0FA 2JIWA 3CGTA 1E55A 2JF7A 4UFKA 1B3WA 3WN6A 3S5ZA 3N1AA 1WE5A 5HDRA 5JBFA 1C90A 2GJXA 1XD1A 2ZE0A 3WL0A 3VGBA 3AHXA 4KH2A 4D6FA 2YLAA 2YOCA 3N13A 1B90A 4H8HA 2Y8VA 4AIUA 1A47A 1NWUA 5GNYA 2D22A 2J7BA 1FH7A 4PMQA 1JAEA 3O6AA 1GW1A 1B1YA 3CZEA 4DO5A 1NWTA 3U5YA 4U31A 4P7OA 1QHZA 5IXEA 1UR1A 3GNOA 1JD7A 4UOZA 1N82A 3WEMA 1VFOA 1G9HA 1UR4A 4MB5A 5EMYA 2XGIA 2YA0A 2XVLA 3K1DA 3WF3A 1CLVA 1KXVA 3BUBA 5ABGA 2GJPA 4W88A 2GJXB 3O2LA 1E40A 2XM2A 4P7QA 4OBRA 3PZMA 4AIEA 3VD5A 1UR8A 4ACYA 2X09A 2PWHA 5BRQA 4QCEA 3DDFA 5C71A 2V38A 1IZJA 3D4YA 4MNJA 4ATLA 3T08A 2ZXBA 3MSGA 1FHLA 4BQ5A 3PHAA 2J25A 5CLWA 1K9TA 2BY2A 1KGWA 3CPUA 1M7XA 2WW5A 4HZ6A 2B31A 5D9NA 1C91A 5FOOA 3RPMA 1O7AA 2V5CA 1UWQA 3TTSA 4PEEA 3BVVA 1HKIA 1R7AA 5A6LA 2NSXA 2WHMA 3KL5A 3ZJ6A 1V3MA 3CUJA 1UH3A 3BSGA 2BFGA 4W7WA 2ZWZA 3WD1A 1UASA 3RO8A 2G3JA 5CZKA 1WDPA 3VGHA 4NF7A 4KGJA 1R86A 4ZXLA 1H0IA 3B9DA 5FL0A 1HJXA 2X05A 2E9LA 3SCVA 3THDA 2Y8KA 3VILA 3OGRA 3NIYA 4Y7EA 1XSIA 4W85A 4HOXA 1KWKA 3EJUA 2ZUVA 1W3LA 2YL6A 3G6LA 1L8NA 3W28A 5ABFB 1GHRA 4W5UA 1AQHA 1JZ8A 2J8FA 1BVZA 5FL1A 3WF0A 2G3NA 5CLTA 1MW1A 4JHZA 1X1NA 4AZ5A 3PN8A 5A6KA 1RH9A 1X6NA 4DM1A 1H09A 3MANA 1HXJA 1K9DA 3WF4A 2F7QA 3WDJA 3HN3A 3F5JA 2BV9A 3WUEA 1JDAA 3L4VA 2XJ7A 3TTYA 6A3HA 1UOKA 2V3GA 2DT1A 2BNJA 5EFFA 2WPGA 1CDGA 1W9VA 4AZHA 4D6DA 2VO5A 1HVQA 1WNOA 1OGBA 2MANA 2FDMA 3S5YA 1JZ6A 5BCAA 4JFTA 4UQDA 5CG0A 1JGIA 1XC6A 5A8MA 3O9NA 3AHZA 4OBSA 2D3NA 1EDGA 2UY3A 4H8VA 4XX6A 2F1AA 4CCCA 4BCEA 2UWFA 3GXIA 2VOTA 4HPHA 4AYGA 3BVWA 2A3BA 3OIHA 2FHBA 3MS8A 3DX2A 2ZUSA 1ZBVA 3VD9A 1EHNA 3AIRA 4CN1A 3WF1A 3OBAA 1XRVA 1BFNA 3SURA 3VINA 4UFJA 2YFNA 5GPRA 3ZR5A 2VZOA 3PTKA 1CXEA 4CU8A 4UZUA 3BAWA 1E0WA 1W1PA 3NDZA 2CETA 5D8ZA 1CBGA 2J62A 3FHQA 4UFMA 2VX5A 1KTBA 2F61A 3LXBA 3BVUA 3W25A 4ZFMA 1Q6EA 1V6YA 3PZQA 1HT6A 1XYZA 1JYVA 3DYPA 2DIEA 1HIZA 2OSXA 3VD4A 2F1BA 1H41A 5DEZA 4YN5A 1V0KA 5E6ZA 2ZWYA 2BY1A 3EJQA 3EDFA 1E56A 1WB0A 5LYRA 3QR3A 1JF6A 2IXVA 3L4WA 3WBAA 5M3WA 1QNSA 3PZGA 1D3CA 4RL3A 2WLYA 4WJXA 3PBGA 3NSXA 1JZ2A 4H41A 3VO0A 1UKQA 3D4ZA 3II1A 1E5JA 1GOOA 4E8CA 4DUVA 4D6CA 4FNRA 4D6JA 2WSPA 2CKSA 1UH4A 2WVTA 1HJUA 2JEPA 4MJ4A 5I78A 1EGZA 4FK9A 2VX4A 3WD3A 5HPOA 5HXMA 1TZ7A 1EXPA 1CWYA 1E4NA 2YJQA 3VNYA 5E09A 2FH8A 1J0IA 4MDOA 3EJSA 2NT0A 2OWCA 1GQKA 3SCWA 4M1RA 3ZR6A 1FH8A 3BUPA 3WQ4A 3MMWA 4DO6A 4GZIA 3CMGA 1E6PA 4QLKA 1J0HA 4AWEA 1GOWA 3GYCA 3OGSA 2VI0A 3OGVA 2UY5A 3BLPX 3WUGA 3EDJA 3VGEA 1DEDA 1U2YA 3NDYA 3FAWA 1CPUA 3TTQA 3KL0A 2C8NA 2WCAA 2F2HA 1PBGA 3W37A 4JCLA 3RDKA 2IUZA 4GINA 1UKPA 4H8UA 1BF2A 5DF0A 3W6MA
chains in the Genus database with same CATH superfamily
3GIYA 3I74A 1O9VA 2X7LB 4GAGL 3TA3B 4Z2KA 1D5IH 1WXJA 3GK0A 4MADA 2Q20A 4Y9CA 2CR6A 4B3VA 3UR8A 3CH1A 4WFFD 3QRFM 5CCKL 1CFQB 1Z66A 1GYLA 3IANA 3BSMA 7ENLA 2W62A 4JRYB 3OC8A 1WBXA 3C56A 5ETUB 2IDQA 3GRIA 3LBMA 1HH9A 3A6CL 4Q8VA 2CBVA 4QSHA 2MPAH 2ESVE 2OMTA 2NMSA 3LS4L 2CO1A 4I0KA 1J6PA 1ZCCA 4JNMA 4Q6KA 3T1FA 4G5DA 3T44A 4FI4A 4XI5D 2Z31A 4BA0A 1RZFH 4GISA 4X9YA 2H5UA 3DTUB 4NJGA 5F7EL 1A3HA 5FOBB 4DJEC 5DVPA 5LCVH 3E49A 5DJCA 3PLYA 2HNHA 2CO6B 4X6DF 4RNJA 5BYWA 3QRLA 5HYEA 2WSYA 3C6SB 4JAWA 2YK1H 4GYPC 5FJPA 1YAIA 3DI1A 5J6SA 4YHLH 3RPIB 3T04D 2HPMA 4QOKE 4EDXA 4HXAL 2W65B 1BF5A 3LSBA 1KT2A 1SBBA 2DT2A 2EBNA 1QTSA 1G9EA 1SMOA 4ODUB 5F96L 4HJTA 4DX3A 4HC1L 4KI5D 4E68A 1B3YA 2IPWA 4MFDA 1E9QB 4HV8A 2B1OA 3EJZC 4AQEB 3WD5L 4HIBA 1JZHA 2Y06H 1I8LA 4KXZI 3RGBA 2VDQL 4FFVD 1N8ZB 4K94C 3KYOA 4MS6A 1L0QA 2CLRA 4H8WH 4KDTA 5GS0H 5DD0L 1XI3A 3URAA 4HJGA 2QUVA 2Z1WA 3W7NA 2YPIA 4QY8A 3VI2A 3AO0A 4JPVL 3X17A 3VMNA 2X6UA 4N2FA 2DU2A 3G1DA 3FTXA 3VFTA 3N6HA 4HNTA 1AZNA 2ITEA 4FQJH 1Z42A 4W81A 1IWBA 3GMOB 3W9ZA 5A3HA 4YTRA 2WXMA 5DTFA 3U6RA 4D7BA 1QPRA 4LCWB 4MGGA 3GSVB 2VENA 1MWAA 4NN5C 2EECA 2NDGA 5EZIL 3LS9A 1VEMA 5DVOA 5EU6E 4PVBA 2MMXA 2XU9A 1W72A 1DBAH 3D25B 3E8UL 4G7YL 2M1KA 4DP7X 1YYLH 2XQ0A 4RKAA 4ZYKB 3KE0A 4DP5X 3MA8A 1FO0H 4OZFH 2NOYA 5FLUA 3K6SA 5TDOA 4J3TA 4DCQB 3CUFA 4NJAL 4PSRA 1CYWA 3NURA 1MSSA 4OTKA 4HUNB 4JQ3A 3MCMA 3VI4E 4OUEA 1JL8A 1H6EA 5DJYB 4FG6D 5EOQL 1XF3A 1MNUH 3KPNA 1VRXA 4V1YA 4I5RA 5LNSA 1HXMB 1GAFL 3RLUA 4UFHA 4HUXB 4PHXA 4TVPL 1AXTL 3GBML 3LY0A 2FNBA 2JNZA 2OFQA 4CSZA 1C8XA 1A7QH 1EFZA 3U7VA 4NRXA 2J44A 1AG6A 2RACA 3B2MA 3H3PL 3QFGA 4FKHA 5GRUL 1JZ7A 3GC4A 2CGYA 4FQXD 1BZ7A 4PRAB 2Q8AL 4ZGYA 3K2UH 3EXTA 5RUBA 1DCLA 5BJTB 1YEHH 5IHLB 3KBFA 4XMPH 3C2YA 2OMWB 2AXHA 2ABAA 1FWSA 1WBYB 4J3OF 1LJMA 3L9YA 2VDLB 4G6AD 3QPXH 3FN0L 3JZEA 4ANUA 3C60C 3SJVB 2CCRA 1MDAA 5FIEA 1M7PA 2RCSL 3P2VA 4Z1CA 5KBMA 4Z0JA 4A8IA 4HWZA 3MUY1 3GJFB 3OD3A 4UV7H 4HHWA 4FX8A 3APFA 5I8CB 1FNGB 4G8IA 1A5LC 2Y24A 2DWXA 3QZMA 3V4VL 2VURA 4H19A 2JIEA 5HI5C 4F40A 1NJJA 1ISZA 2K45A 3G3LA 4PS4H 3TVMA 1IMHC 1M01A 3IFNH 3NFPA 1R46A 4Q7BA 4AVNA 3QZWG 3W27A 1G0DA 2R14A 4P57A 4BFIA 1JULA 5HULA 4U3SB 1XF0A 4LF3B 4NXKA 1BOYA 1NANI 4XHJC 4ZQPA 4KX8A 1CFNB 4KMTH 5L88H 4JYEA 1PX3A 1EDQA 2ZAHA 5J04A 1KZQA 1U95B 4MA7L 4WHYH 3OKNA 2WKOA 3PAZA 2B7NA 4L4PA 4IZGA 3RO6A 1GOQA 3UIZA 3OVQA 5DO2D 3DV4B 4M1DL 5GS0D 5DHVA 1FNEA 2FIKA 2EE0A 3HMXL 2MQ3A 2NSOA 5A2JH 1OX6A 2VGBA 3VIFA 2OCFD 4O4VA 2HFTA 4FMVA 3IV8A 1WIOA 1CDUA 4P07A 2P80A 3FMGH 3R10A 4XO9A 3U0PA 1F58L 5HGHB 3FN9A 3T6QC 3O2WH 3QP3A 8XIAA 2E76C 3SGJC 4RGOL 3LEVL 1FQ0A 4NWUL 1FRBA 4HYRA 4JJHA 3RWCA 3HR6A 5HVGB 2MH4A 4ENEC 3IDXH 1IIIA 1IC4H 4P8XA 1PZ3A 3HCVB 5GS3A 3P80A 1F4YH 3PBVA 3L21A 4N4QA 4DXVA 4H9UA 1YNTF 2NY3C 2G95A 2EADA 1ZLUH 3VFPB 2JK5B 4WWPA 1CK0H 5IFJB 5F21B 3WUWG 4YHPA 4KERA 1UZ4A 4C90A 3G8EA 5CD3A 3JT0A 4GMTL 2VXQA 3X3GL 3CM4A 3ZKQD 3DO3A 3PM6A 2GI7A 1K72A 2Z0BA 1KCLA 5JPNB 3WH7A 2YARA 2C4FU 2X9WA 4PJCA 3S3DB 4GKSA 2NY1B 2R2HA 1U2CA 4LSRH 2VUOA 1NOAA 2XXCB 4LGSB 3IMUA 1HQTA 2F84A 2ONEA 3NXLA 4PR5B 4A6YB 5H6HA 1SXCA 1A1OB 1ZOXA 1CN4A 5ILTL 2CXEA 4UMBA 4X5WA 4AW7A 4IRSD 1TCMA 3TFXA 1WKDA 5E8PA 4A2GA 4ZW3A 5DZLA 4KKNA 5I8EB 3CFNA 3TNMB 1S3KL 1R3JB 1JUKA 1N70A 5SWSE 3VIGA 2PODA 2O30A 4HC1A 5DMGD 3GR8A 1JZIA 5C09B 4AJVA 5FDWA 3Q48A 5IFPA 1UCWA 1MEWA 3CAWA 1XIGA 4U2YA 3DX9A 3QXTA 3SYOA 3U5UA 2AEPH 3F65A 2ZT9C 1ICQA 1I53A 1NLBH 1KBKA 4WSGA 4LU5L 2N1TE 5I06A 5KW9L 2DOCA 1N5AB 4URTB 5JNYB 4XC1L 1JCXA 1JV2B 3VTTA 3PQYD 1EX0A 4P7RA 3QO1B 1FO0L 2OI9C 5LHFA 3AMCA 5JXEA 5T1LB 1Q6OA 2NR6D 3IGHX 2CBUA 2CKBA 1UJQA 2YEZB 1K03A 2X2JA 2Z7UA 4N3TA 5K9KB 2VDRH 2BX7A 2WINA 2YC1B 4LEBA 4Q0XL 3W5NA 3CLMA 3A3YB 4F7MA 3S1UA 2X44D 1QBMH 1RLBA 3T2NL 4WJ8A 4XOAA 4ZO8A 3T78A 3DNKA 4PJEA 2NT1A 3ML9A 4WNSA 3K2UL 5D71H 2OEJA 2AKRB 3ZMRA 5JHAA 1TPWA 4NPYA 4YMZA 1JG9A 4QXVA 5F1OB 3MREA 4ZMVA 1UXLA 3H3PH 4JQIH 2FWOB 4XMLH 1DWGM 2D23A 3A21A 2UV3A 3HFML 4LAZA 2ZAIA 3L3IB 3EYOA 3PBMA 4GBUA 1A1NA 5T1DL 3BAEH 3KZPA 5DSCB 5CZRA 4NT6B 1SJHB 4HQQL 3DFYA 2GTWB 4DO4A 1QBLH 4TNWF 1RZJC 2Y06L 3UYOD 1AP2A 2YB1A 4OV5B 4NRYA 3E0WA 5F89A 4IOIA 4PGLA 3Q6FA 5K4XA 3KVLA 1GVIA 2DD8L 1PZ5B 1FLRL 4YR6A 3UAFA 2Y07L 2ZUWA 5F1SA 1R75A 5IQLA 4DUXA 1TKKA 2EPMX 3FKRA 3FRUA 3PWJB 3CG8A 4N24A 2W0LA 4ZT1A 3CDGA 3I85A 1YNKL 4HUKB 4WO4C 3EFOB 1TVHA 4ZNEA 5EB8A 2Y0SA 3QPQC 4A8LA 4NNXA 2R29L 1UM6L 2CKNA 3IT8D 3WHE1 5C0CE 3VXQA 4EO5A 3H70A 2WP3O 5EO0B 4TN9A 3BI9X 5F8RC 4ROQA 2YBVA 3TO4C 3WO4C 3M0HA 4KRZA 1A65A 4N2KA 2WINB 2YC1A 1QNZL 1Z9SA 4GS7C 4WU5A 5JIHA 5KBKA 1CNVA 4MJIB 4OWGA 3OIXA 2AXGA 2E7CA 2XQYK 2INEA 2F19H 1D5ZB 2LOEA 1KELL 4IHCA 3WEZA 2F6UA 4K38A 2MPVA 4Y9GA 1A9BA 2V3DA 3K91A 3JTBA 4QJ5B 3DN5A 4FQ2H 3AUVA 1E9PA 1MWAH 1GQIA 3ID7A 3C61A 3ZL2A 2QELA 3QIWD 5L9DH 1DQTA 1KFKA 2WPBA 4P23A 1SJMA 4MQ7B 5HVHB 3QIBB 4A29A 4NGHL 5J8LA 3IGUA 2IGLA 4YSOA 4XBGB 2CE6A 2CM5A 4F2ME 1J8HE 5LLIC 2CAKA 3HG1A 1Y18A 3HMWH 1JWMA 3LNHA 4YFDB 5H94A 3RU8H 3UXLA 4FLQA 5AKRA 4TOYL 4PG9B 3T0BA 3UG5A 3HE6B 4LU0A 4X60A 2C9SA 1HXKA 3WQ5A 3JT2A 4F37K 5A7EA 3Q2VA 1SLUA 4FN0A 4N8CH 1Y0LA 2V69A 5E1IA 1VD6A 2ZWKA 3OB0K 5BZXA 1FTXA 4X5RA 4U28A 2PLCA 3EO9L 1VPQA 2OZ8A 4RRPM 2D7TL 4RFNB 1WAEA 3AQXA 2EDRA 4LCYB 1JI1A 5ITBH 4ML9A 3RVUC 1GT8A 1JCVA 4PR5A 4A6YA 2A7RA 3HPJA 3FYOA 4JIQA 1LO0L 3CDYA 3ZDYB 4K7PX 4K7FA 4RBPH 3NTCH 4KJWC 3FO1A 3PJSA 1MCPL 4HZLA 3MJYA 3STBA 3PJWA 4HIHB 4QRFA 4JZJB 3TLLA 5DJ0A 4C5YA 2MKWA 2W65A 5D1XA 4UR7A 1J9QA 3N2XA 5J11B 2D0HA 3BH4A 4QDWA 3S83A 2FBJL 4JJ5B 4A3HA 7TAAA 3PZ9A 2V5DA 12E8H 3G22A 4TU1A 5ISZB 3ZLGA 3HI5L 1KEGL 3BANA 5C1MB 4JTTA 3Q43A 5CLYA 3KXQA 2FJFA 4Z08A 2A6NA 3TBVB 5ILTH 4W9JC 4HVXA 1CUOA 1JS4A 1R3HB 4I7ZC 1XTMA 4HS8H 4KUCF 5DUPH 3A3XA 2AV7B 1ZANL 3C2OA 2WNGA 2VCCA 3QHOA 3TWAA 4Q52A 3I68A 1XLDA 5F88B 2VR6A 4IX0A 4YHEA 1ZPUA 4EE2A 3T1GA 2BHZA 2KX9A 1G7MB 2KUTA 4OBTA 3RM9A 1JCLA 2G2PA 3K6NA 1CG9A 2B1HL 3REVA 5FCUH 3OJVC 3VMOA 4EWND 2H2PD 1NDTA 1NOFA 2BH0A 4JTSA 4UCGA 1NEZB 4LP8A 2YD2A 3MTRA 3BKMH 1QEWA 3EH2A 5FIPA 3CL8A 1KBPA 1EFXD 1CFNA 1D5MA 3QIBC 4MAUH 2FPVA 4N9BA 4OB5H 2DIJA 2C1IA 1DXEA 1F58H 3WQEA 3GKWH 3SPGA 2ZBTA 1JWSA 1HKWA 5TQ0H 5ABDE 3FONA 3TBWB 4P2OB 1E4KC 1KM2A 5HNTA 1JI2A 1CLOH 2CA3A 3KWVA 1EZVY 4XPHL 4YO0B 4DEPC 3CX5K 1KTDB 4XXWC 2ISSA 1FNEB 2FIKB 3IJYB 2QCLA 3E3QE 3H7UA 4NJJA 2XKUA 1IBHA 3V7AE 2BMKB 3QXVA 3TYCA 3MODL 4UB0L 1LE5B 4HZAA 4X6CB 2VDML 2XG4A 1L7TH 5EBMB 2CLIA 3SFKA 4JXCA 1TTAA 2QCCA 4XPTH 1EBAA 1P69B 4P9HH 1QNQA 1E5ZA 2EPKX 1KBVA 3WYRA 3CJPA 1RPQA 3GJEA 2ADGB 5F3HB 3SIKA 2XH0A 4IL0A 4NSBA 1GYWA 1OZUA 1Q8MA 4JJ5A 4KHXL 2BOCA 4MDJA 1XIHA 3CBKB 5A3ID 5D2NE 4C55A 2B0MA 4YHZL 3CHRA 2DL2A 3UZVB 5FB8B 2HUEA 3SO3C 2KLSA 4XGZA 1K8ZA 1XLAA 4D9PA 5D1ZI 3WKQA 4G8GA 4K55A 4YSPA 1FPTL 1ZEAH 3B2PA 3RIAF 4EIVA 1WP6A 3X3FL 4QD2E 3OB8A 4G80B 3AUOA 4KVCH 3ES6B 3LRKA 4JTUA 2OCCB 4PJ8B 2UYLA 3P4MA 4N0CD 2FEDD 4AC4A 3IJHB 1OVZA 3ZVHB 1XM3A 4K9EC 1U91A 1DVYA 1ZIAA 4NCC1 1FWNA 3BLOA 1CLCA 5C70A 2DV0A 5IOBA 3HC4L 3NOYA 2EINB 1SYVA 3L12A 1UD5A 1YY9C 2R59A 1R9FA 4WEEA 3GG1A 4QLRA 4P2AA 5E9DA 4O0KA 1F6AA 3E2HC 3OR7B 4QRAA 4YSRA 3UDWA 3VFUB 2CLLA 4ZBCA 4E38A 2C3XA 4QRUB 1Y18B 5H94B 5CEZH 2OJPA 2E9BA 2IADA 3RAJH 1BPVA 1FOBA 2D2HA 2XI9A 2WOQA 5I1KH 1EHLL 5I77A 1D6VL 2RQEA 1UA3A 3C8KA 5CCZA 1RY7B 1U3HD 3O41A 4JR5A 1NAKL 3AUWB 3W71A 1JDCA 1FBIH 2B1AH 2FT6A 3QUYC 3IDYB 4LQ1A 4YN3A 2R24A 1FN4B 3RTQC 3T3PE 2KQMA 4K71C 4K3HA 2NUTB 1WV7T 5GRYA 3VXNA 5AOUA 4WUKH 3MA9L 5FA3A 3GNML 1C93A 4UMSA 1ORQA 3D5OF 4HIIB 1UZDA 3ENLA 2Z4TA 4XZBA 3T2NH 4HUUA 4KETA 1UB5A 3GLEA 4C1KA 3MQIA 1XCXA 2EYRA 2NY6B 3NYKA 5DC0A 1IGFH 3U9WA 2ZSWB 2AEQH 4K3EL 2E8YA 2GWNA 1DLFH 3DI2B 3VKDA 5E03A 3GHPA 3GBNH 3STLB 4CRPA 5EO1A 4Z7WE 2E7BA 3ECWA 3EB2A 3QWOB 1J87A 4WCYL 3LH2H 2HRPH 4C6DA 1WFOA 1YKWA 4X7SL 4DGIH 1FHGA 1NCCL 1SU5A 3O2DL 4JAMA 1AYOA 2C14A 4N25A 5G2WA 5EF0A 2B7QA 1SFHA 1AQMA 1QRNB 3PSVA 2BP0A 4NVTA 3ILDA 4GKTA 4EF8A 2PPGA 2BCKA 3W82A 4IPLA 1Z9SB 4O4YL 4PUBH 5CEZD 3FU9A 1GVOA 1EEXA 2BINA 1D9KD 1P9MA 4XNXH 5J5DA 3IU4H 4QYOB 2O72A 3O6FA 5D7IB 2CMRL 2QDVA 4Z5RA 5GIRA 1DWAM 4L4VB 2RTTA 4GRLC 1IFHL 1SY6A 5E8DH 3RUGB 5C0GB 1AE6L 4AHOA 1C5DB 1W8EA 1TRDA 1KCWA 4OGYH 3D5HA 4C6NA 2JIXA 2HG5B 3LKRB 4H8PA 4J3SA 2HE5A 1CGSH 2HTLD 3N50A 1ME8A 4AUBA 2CHDA 3UMTA 1GTNA 2FT7A 4CU7A 2Z9TA 4WJKB 1KCXA 1BZOA 3XINA 4DK5A 5BNXD 2FYVA 3NIFE 1RK6A 4YDLC 3ECBB 1AGEB 2J55A 2Y7QA 1DR9A 2WIIB 1TYEB 3ZQWA 2IPJA 3UR2A 4OI8A 1XAKA 3H7VA 3L0GA 1N0XL 2NY5L 4PRTA 2HLAB 5FM4A 4PD4J 1FYHB 5EOCL 1SBSL 3R06B 4N9OB 5IEHB 2YPVH 1KV7A 4W68A 3PG8A 1E27B 4HGKC 5LNDA 3AT9A 4RGNB 3B8VA 1FUYA 3ZT7A 3BW9B 3V6ZA 5C6WH 1UZ8A 1YDPB 5C2CA 2HQAA 1D7CA 2XN1A 3MKKA 5DZPA 3WHE0 2PC8A 3ANUA 5E2UL 3L66A 1QSFB 1DLHA 2QLYA 3CPGA 4PC8A 4BQ9A 2P5WE 4IRJD 3DUSA 2QV4A 4LVNB 5KS9E 1KTKE 3E2QA 3COTA 4IW4C 4FYQA 2WC3A 4B5UA 2NZ1A 2YRBA 1MFBH 4UTAH 3H8NA 3PWNB 4EIZC 1I60A 2G3XA 4YDVB 1LQ2A 4PJ5D 1ADOA 1M65A 2B5IB 2DJ4A 2BNRD 1EZUA 2LLGA 3BV4A 3GTNA 2FZ3A 1CICC 4WW2A 3JTSA 3ZTJH 3C9NB 1F56A 3T2OA 1LO3L 3CDFA 3PCYA 4N28A 4OM1L 3CHOA 1J5CA 2G0WA 3SAZA 3TJ4A 3LZPA 2BVOB 4HSHA 3GS6A 1RVFH 3IFOA 3RI5F 4A7UA 4RNRB 5CJ8A 4G6AC 2QT6A 1XR2A 3UCRA 1W0MA 2C7UB 3MA7B 1IM3A 3N55A 3M64A 1NGYA 4WWKB 3ZZQA 4IGSA 2BRRH 4P2RE 3OJ2C 3QLLA 4K8RC 2XUCA 4GX8A 4LPCA 4L29A 4JQXC 3G5YB 4KTEL 2OPJA 3PG2A 4L61A 4NQTA 2E9WA 5DC2A 4AKOA 3VFCA 3GDBA 4JQ4A 3PUGA 1PSKH 3QUXA 2OLSA 2D4FA 3URBA 5IB4B 4V1DD 3G1FA 4U1JA 4WY0B 1NDGA 1XLCA 3OPZL 4GXVL 3DURB 3H12A 3T07A 1CECA 3CQFA 3D6GA 2VYOA 1HXMA 1XD0A 1ZE3H 5CC5A 3LCXA 5JHDB 1QW8A 5A2LH 5MENA 1Z5LA 1CGWA 2ICES 1NBVH 1RIHL 4G8AC 1PIFA 5MP6L 3NPWA 4OKVB 5DMYA 2PPAA 4P5MB 5TE4L 5I16B 4A68A 5JIPA 3LTYA 4O0ZA 3VX0A 2E6JA 4LCCA 3RRAA 2GCYA 5JQ6L 1H3GA 3CAFA 1QWGA 3UR5A 2NX5E 4WF7A 4W9HC 3EGJA 1ASPA 3OR6B 1YMYA 3ME3A 2VXVL 5HY9B 3QJUB 4I1NB 2HXAA 4S1RH 4FEZA 4PULA 4AVOA 2FD6L 3GHBL 4F15B 3V9FA 4JZ5A 1HKLH 3Q6FB 1P9MC 2EZ0D 3RKDD 4GBXC 5DS8B 4MMZA 3TCLA 2PBOA 1MNNA 3TOYA 3R1GL 3HPLA 2AQOA 1PZ5A 4HXBL 2VLJE 5T33H 2PP9A 3P8IA 1NDZA 4G80A 3H54A 2E9MA 1Z89A 3I9AA 2IC2A 4LMQE 3VNKA 3RGHA 1B3IA 4M1GL 3BHBB 2NNAB 5INDA 1J9YA 3DG6A 1FWRA 2WZIA 2P8LA 4KZEL 4F15C 1IVLA 3LHZA 2NY2C 3OA5A 1YJDL 1UQZA 4IOFC 1E1EA 3RU6A 3MACL 2WCGA 1MFMA 3N40P 2CDEB 3NCCB 5F1KC 5CEYB 3HJZA 4LYQA 3JWNG 1LWJA 1BLIA 2A73B 3RMEA 4KO7A 4F0KA 4YE4H 2NX5D 1VKXA 2ALWA 3DIFB 4QE1A 2LU3A 4X4YA 4XAYA 1VRSA 7PAZA 3TWCH 1P5BA 5AFAA 5CZVH 5DR5L 1D2OA 1TZAA 4KKBD 5KVDL 1TV2A 3G1RA 3FJNA 4CDHA 1AE6H 4P2RB 4NO0D 3H2NA 2GABA 2F7RA 3GD1C 2GC4C 4Q6YA 2DSUA 1BIIA 1FWJC 1V0NA 3CYJA 2WN2A 3MOAH 4P5MA 4TL4A 1A4MA 4F7MB 5REQA 2R51A 3QUYA 5FO8B 5EU7C 5EU7E 3VMPA 1KB5H 4RMTA 2VR9A 5IW6B 3QXWA 2HMIC 2HJKA 5I1DA 3CV7A 5I02A 4IJBA 3Q6GH 4R7NB 1F61A 1NGZB 7ODCA 1DVFD 3BO8B 4Y4HA 4DPCX 1LZOA 5A6JA 2VSDA 5H37H 2VLRE 3SO5A 3AITA 4MNGE 4MMXB 1UWAA 3MMEB 1JNEA 2VVSA 1BOGB 2R69L 2BSED 1HFUA 2HT2C 1U33A 5DO8A 4NAMA 4J3BA 3HFYA 4JIIX 4BEUA 4UILL 4F3FB 1GPFA 4IGMA 4JS7A 5LG6A 1OAXL 2PYEB 5L0QB 1NC4D 4LJ3A 4B2DD 1F02I 1BMWA 1KPUB 3Q5TA 4Z0BL 1G4EA 3KBSA 4M29A 5C7XH 3NZ1A 3QULA 2DI7A 1VIZA 4XVJH 2PRLA 3H9YA 2ZUMA 4HD9A 3F6IA 3O6CA 4KW2A 3RPDA 1W37A 3ATFA 4TXVB 3ILEA 2PP3A 2X9XA 5DYFA 1UWXH 2IWEA 1DVFA 2P49B 3DOIA 2EC8A 2CU0A 1NGYB 4LVNC 3NG5A 4BJHA 4U33A 5E8EA 2XIIA 2GW5A 1L6XA 3RVVD 4F20A 1JXJA 4A04A 1CR9L 3VQLA 2YEQA 2YXXA 5I26A 1EEQA 4FTVA 3I02A 4G5ZL 2EDWA 4JY4A 3QUXB 4MNQD 4AKPA 4K1GA 3LV3B 2MIZA 1ONQB 1ZWIB 4XMZA 5T3XD 5ICXB 4PCNA 3E5PA 1IE4A 1RK0B 1XLLA 1WA3A 3BEVB 1CQYA 4N1HB 3RP1A 4G7EB 2VDOH 2OMXB 3T0XA 2GEQA 4ZQMA 1XH0A 1QW9A 3EFDH 1L9TA 5GGQH 3NBNA 2J9XA 3KVMA 1FP9A 1LCOA 2LTQB 1MAJA 3BEWB 4XXWA 4DNLA 3M47A 5IM7A 4XGZB 2CALA 4IGNA 4YS1A 1HWGB 2V9TA 4PP2B 4WW1B 1CF1A 4D8LA 3RWJA 4J40A 1C08B 2OQJB 4YHYB 2Q3XA 4Z3JA 3AU0A 1JUEA 3HG1B 2YKLL 3MRKB 1E27A 1EXGA 2CLZA 3ESNA 3AY4C 3GXDA 3KYKL 3CFEA 3OMZA 4KKAD 5D6DA 5B39G 3INPA 3QIBA 1PLGL 3ZVIA 2DF3A 3B0UX 4ABQA 1KXQA 3FH5A 4ILDA 2UZXA 5ITBL 1QSFA 4M02A 3IJSA 2XYBA 4L4VA 4MB4A 5GGSB 1O5DT 1XDTT 4PMEA 3SUVA 2BMKA 2GJ6E 1Q0YL 1N5YH 1B2YA 1XB8A 1SXAA 3SGDH 3DVFA 4NILA 5EEXA 1FG9C 2B14A 1XRTA 2QJGA 5KJRL 2XFFA 4C56A 1ZBWA 3H2QA 1NCWH 3I6LE 1M6JA 5D93B 2ZPKH 5KVFH 3QHZL 3VFGH 1VGKB 3IFPB 1G1YA 1D5BA 4YPJA 2OI9B 1E70M 1QABA 3TZVA 1Z3NA 3VTMA 1E7VA 4US5D 4FP1A 3ARPA 1DVZA 3IWPA 4LHJB 1A6ZB 4W8AA 3VFOB 2RHEA 2UX7A 4E9QA 5MEOB 3FOLB 4K3JL 2Z8SA 1RZKL 1ICPA 1LP9A 4Y7OC 3ZRSA 4FX6M 4GPVA 2VR3A 4GAJH 1MOEA 4PLJC 4HU4A 2J7FA 2LU4A 1JERA 4JTLA 3Q1SH 5DMJB 1GC1C 3BPCB 4KAQH 4LLQA 3GXPA 1HKJA 2YSTA 1ONWA 3EOSA 4U3AA 4XPBL 5AYUH 1BYCA 1J96A 4GH1A 4TV6A 1LE9B 2RJGA 1EP1A 1GVQA 3UCCA 5T3ZE 4ZMLA 4YXKH 4F5CE 4MAUL 2PCEA 2ZZ2A 2W5FA 5AYYA 2XPGB 4DPAX 3KEDA 1GPOH 1XLMA 4U1MA 4YK4C 4LCIH 3TYFA 2B4GA 2YSWA 3BW4A 3C2RA 3M6YA 3QUZD 3OQ8A 3IK2A 3D2UA 1SZFA 1VFLA 4C6LA 1DBMH 1AGBA 5FF3A 4JN6A 2OTUB 1MFCL 2VL4A 3IMSA 3L6FB 1ODUA 2F7PA 4RMSA 5F6IB 3CB8A 3P77A 3UZYA 1K85A 4PRBA 5K7JA 43CAB 1N2VA 1KJ2B 5BWFA 4ELMA 3QI9B 4KV5E 3VJ6A 5I8CA 1DFXA 2YDAA 4QRPE 3SDXE 3HAEG 1JRHH 3DFQA 4BQ8A 1A50A 3D18A 2HG0A 1AD9B 2VYRE 3H2PA 2A4ZA 2V8ZA 2WSQA 3M7SA 4PGBB 1X5GA 2XQYG 3W74A 1HAUA 3R79A 3ZT6A 5FXCH 4RZ5A 4HSNA 5DVMA 5C0RH 2VTFA 4GKNA 2YUWA 1NJ9A 2P8PB 5HJGA 5J56B 2SEBB 4ZXBB 5KAQG 3PAJA 4PUUA 5SX5K 2R2EA 5A6TC 1MW3A 1OZTG 4LDEB 1M7IA 4P48A 5HHVH 5DTFB 3EF7A 3UG3A 3W0WB 2Q5BA 5H2BA 5C0JA 3U6RB 1IEVA 3EWZA 3IVSA 4W6XB 1T20B 4MJ2A 1FWEC 2A74B 2AKZA 2CITA 4AB4A 4Z7OE 1WFJA 3M1ZA 3ZFHA 2ZTBA 3IVKB 5CILH 5F3FA 3FVDA 5A6BA 1E9LA 4NEHB 3UZVA 4M7LH 2QGCA 1ND0B 1XCFA 3NOIA 1LBLA 1FCBA 4N6QA 3BIKA 5ABHA 3MOQA 3IN2A 3NDYE 3P0WA 2AC0A 5FCZA 3FUKA 3VFMB 2BOEX 4JEGB 1HTIA 3O6YX 3WMLA 1XTLA 2XTLA 2EPNA 3EBGA 3P77B 3EOEA 1AOHA 4JANB 3R11A 3MV8D 2G3FA 5HJ3B 3D0LA 3TEWA 1VACB 3WKYA 43C9A 1EZ2A 4UIMB 1JNLL 3HE6C 1R9YA 4HGWB 2Q3RA 4Q4OA 1FZKA 3AMDA 4R53A 3EWDA 4NQVA 4UQCA 4BDVA 2QIWA 2V2XA 5ALCH 3EA1A 4HCLA 4BINA 1KKOA 4QLLA 4HSQA 3IJHA 1KJ3H 2ICWJ 3QDGD 3RPIA 5DYOB 1DWFM 4OM0L 1E6RA 4MPKA 4MNQA 3ZSSA 2AOSA 1OW0C 5KVEE 5TPWH 3VFUA 3O2WL 3S1XA 2JCWA 5EBLA 4OZGB 4NQXB 1OFBA 3ASOB 3AZUA 3G5VA 3TQKA 1ZHAA 4MNGA 5HGAA 3V4VA 4EIGB 4EZMA 1RQHA 1QPKA 1SZRA 2OGYA 4GX9A 1DSWA 3V0SA 2Y7MA 5IQMA 3BHBA 1EIBA 1V3IA 4UTIA 1BCIA 1EHKB 1CD1B 5B7EA 4AX6A 4XN5A 5D2LB 4GS7B 3ZLHA 3NQ2A 4N90E 3OZOA 5CPOA 4XNZB 3ZE0B 1F73A 3TW7A 2QQLH 3GS0A 2PS2A 3EYUL 3FNDA 32C2A 2DWEA 3KM1A 4FS0A 5C0BD 1EKOA 4CJ0A 3QR1A 1XW8A 4QNEA 5CP7A 1RD6A 1AXIB 5FGCE 3AXLB 2O9PA 1HH6A 4YDLB 3JBG7 3MUCA 1HSAA 3Q94A 4NL1A 3M17B 1DORA 3AQDA 3ZTNL 2X4OA 2GBUA 4H6QA 1JF1B 1U8OB 3QNXA 3MO1B 2NYYC 1UD3A 4KXAA 3L65A 1SO6A 2P8CA 2FQFA 3E2VA 2PLTA 2W9LA 4M81A 1ZTXL 1KB5A 1D7BA 1DVSA 4X6CA 1VCGA 5EZLA 1RZFL 1OBAA 3SY5A 1FWXA 3FLUA 3UPRA 1OP5H 3AROA 1OWRM 4JFHD 4NIYE 4PU2A 1PVNA 2Z2BA 3WN5A 3VIPA 2YW4A 1TPVA 1XH2A 3HJEA 3FBQA 1UD6A 1GRWA 4R6UA 1OVDA 2B0SH 3MUXA 1AG0A 1UWXK 3AS2A 1NGPH 3EAKA 3ESMA 3TIEA 4FXSA 4GA8A 3ZGHA 4HJWA 4KQ3L 2ZYIA 2GK1B 4X83A 1G5GA 3NK4A 2ENJA 3U30B 3N73A 2AW2A 2B20A 5GRJL 2VDNH 1CFTB 1TTBA 2Q8BH 3BEVA 3G6MA 5FM5O 4RAVA 1ZK9A 4WOQA 5E6SB 3V4VB 4UAHA 1F2JA 4PRIB 3MCYA 3W7JA 3WN5C 2GSGA 3AZRA 4G6FD 1DANT 1G7HA 2AERT 4XCNB 4O2CA 5BZAA 4DGVL 4L4TE 5AAMA 1RZJH 2B1AL 3VD1A 4K37A 3AY4A 5D8JH 1QTPA 3LKNA 1KENL 1KA9F 3MRPA 1J0ZA 5DGQA 3NQVA 2IXUA 3E3QC 1IT9L 1UXSB 4JMNA 1FF5A 5CCGE 1MVUB 1OGAE 2FB4H 1S2UA 2EDOA 4K7PL 2VMEA 4ZX5A 1H62A 5E08L 4IISA 4ONVA 3UXKA 1TPEA 1JUFB 1I8UA 2GT9A 3MXVL 4P4KB 2P8PA 2R23A 3VOJA 5D09A 1QACA 4FLRA 4RBPK 1W5MA 3QR2A 3L1FA 5FK9A 2EPLX 3OHXB 4CC1A 1T1WA 2QQLL 5A43C 3W81A 3RWHB 3TN3A 1IKNC 3GBNL 5DJ0B 4RIRA 1K9EA 3PHSA 4UZGA 5DJAA 5C0AE 1OIMA 3FFCA 2JLLA 4H20L 1A0EA 9XIAA 4PE8A 1KCSL 3QO0B 3TGXA 1XBVA 4CQ9A 3AS1A 2DUZA 3QB7C 4X80H 2TRYA 4L3EE 3WS6C 1UZ8B 3DIPA 3QY8A 4AD5A 1YNTA 3BUDA 2EQDA 3N1QC 4Z3IA 3GUWA 1P84J 2Q87A 1ZUAX 2ZUXA 5IW3A 4AITA 4BKLB 3U2CA 3UZWA 1S5IH 4L3CA 3VOCA 3L7EB 2I07B 5DHVH 4MJIA 1R5WB 2FFCA 2Y62A 1IGCH 1FVCA 2OYMA 2GTZA 4LLUA 1SNRA 1LL4A 4LKCA 3F85A 4TLSA 3GVVA 3TJEH 5G4HC 4PCYA 4OGAC 1KQZA 5IBXC 3K30A 4BI6A 4AUJA 3F5LA 4JX5A 3T0EC 3ERPA 4XG1A 4EPEC 4QOKB 4YXLL 1U8PA 2EVFA 5DDHB 2VEIA 4QRQA 1FC2D 4U1HB 1MJJB 3OLDA 5LO7A 4PBDA 4Y4HC 3ZKMC 5AKQA 5HHQA 4TMPA 3CO4A 1MRCL 3M07A 4X4YB 4ICMA 3HBLA 1KGUA 3QFDB 2O9TA 5I1IL 3NOEA 3SY8A 2RCSH 4LCSA 4NQED 2WKOF 1HNFA 3LEYL 3W7KA 1SOQA 1A6ZA 3GLDA 1J2BA 5G4NA 1K6AA 2V3FA 2WO3B 4NZUH 5G4WA 3AG2B 1TXKA 4DB7A 5ANHA 1XGYH 4JPKL 3IJ7A 2NTFA 1GGCH 4LVOB 3TUUA 3LYEA 1SY6L 3CVBA 2N4IA 3ME0B 3S9IA 1R33A 3WKZA 1Q1JH 4OQTH 1CO1A 25C8L 2XXFA 1X98A 1W16A 4GNVA 2YPKB 4JPVH 4N5UA 3GSNA 3CLEH 1PJ9A 4ODSL 2CHOA 2QUUA 3NJMA 1REIA 2HVMA 5MHBA 5MKGA 3BCFA 3MHUA 4MA3B 1SYTA 2BTMA 1RA0A 4CQBA 3TT3L 4ZXOA 4LLUB 2VUYA 3RJYA 2BY3A 5IR1B 1VRDA 1XR8B 2XWBB 4P9HL 4L6DA 3UTSA 5DMKA 3DGCR 4MFEA 1V3JA 4PRPB 3W56A 3EAUA 5F97E 4AYSA 1FORL 4XO5A 3VWJC 4MZ2A 2GTZB 2V9RA 4YHKL 1KTNA 1XYFA 2J77A 2TYSA 3LPGA 3REQB 4ZS7L 3ARBB 1BZ7B 4PRAA 4R8WH 3S1GA 4RMQA 5C09D 3WFAA 4FQXB 4Y2OA 4DN3H 4L4LA 1OLZA 1FFPB 4I4WB 3CC5B 5KYYB 3EXLA 2Z26A 3CK0H 4HJFA 1Y7VA 5AY7A 1WEJL 1RSFA 2X4PB 2PF8A 3EWWA 3HPZA 3JTTB 5EN2A 4OKDA 1YEIH 2YGYA 1CF8H 1R87A 2CM6A 5FKPA 1P7BA 1MRFH 3SDXF 3H22A 4PMRA 4KK9C 3S2NA 1I7ZA 1IIKA 3K2KA 1ZHKB 3PYCA 5DURD 4QLWA 3NVTA 1HQRB 3QV7A 2QQKL 4KK8C 7PCYA 1TWSA 3G5EA 3G6JE 3H7BB 2ZF8A 4GG9A 4CGTA 4DCQA 1UP0A 1FIGL 1X7QB 2Q8BL 2ICWB 5F7YC 4WKFA 2YS4A 3C2AH 1S78D 3T2QA 1IZCA 2XN9B 4WI9A 3F7VA 2QHAA 4NKDA 4LNYA 3CFIC 1EANA 1NCBH 4OSUH 1F76A 1MVUA 3UWVA 2OQLA 1NUNB 1UXSA 4MUPA 2BOFX 1OF2A 1I8LC 2P5WA 1PJWA 3ZIMA 4JHBA 4OT7A 5CO1A 3WD5H 4BSVA 4CMMB 2A21A 3WNKA 1QAWA 3MA7A 3JQOB 3RCNA 4DO7A 3APDA 5SWUA 3C5ZA 3MR9A 4U6VH 5CGTA 1E90A 4DFHA 1NF7A 3FX4A 5IJBC 3W83A 1TETL 4S23A 1FQ9C 3V9EA 4DJFD 4OJFL 1W9BM 2P76A 1NUGA 2P43B 4XPHH 1PD1A 5IVZA 4NKMB 2Q10A 3WH9A 3WFLA 4JN2B 4WEMB 1OCRB 1IT9H 2R1PA 4LCQA 8A3HA 1VZWA 4IOFD 4DKEH 4U1NA 2OTDA 3TOPA 5KG9B 3P61A 3WLOA 1BRLA 2F8XC 3U4KA 5DQPA 5E4IA 4JR9H 3SDDC 2XSBA 1DQQA 3DO7B 2W80C 1CDCA 3I3EA 2OPCA 3HGRA 1TU2A 1PDKB 1YNQA 2ATPB 4HF5L 3N6JA 2ZX5A 1T3FA 1MJUH 3CL7A 3EWBX 2NQ5A 1VGKA 3IFPA 3D4CA 4EZKA 5ICZA 3MI6A 3NQMA 4QMEA 3URQA 3NPZB 1NPUA 3EYQD 4KKBC 3QW4B 4G83A 3AGWA 4UOW1 3H7BA 2N3JA 4P06A 4CKVX 5J3HD 1E72M 1A1MB 1CDJA 4J12A 4WW2C 1CICA 3RITA 3KPLB 2B9AA 2GUYA 5F0MB 2R69A 5EA0H 4BZ1H 2FQEA 2JCCE 4G1NA 5LNWA 3R94A 5B1BB 1OT2A 2F8QA 2QCDB 2G5WA 2HZHA 3LUTA 1K9FA 2EVJA 3AQUA 4W4NA 1CR9H 5H35B 1KFAH 4RFOL 4ZMZA 3GSXA 5ACZB 2ADYA 4BK4A 2D3VA 4WGXA 1E28A 5C2BH 4XNMA 2HMID 5FESA 1HC1A 4BXSV 1DTUA 5HHOB 4R96A 4DZ5A 5LNRA 4X7EC 1HZHH 5FC9A 4HBKA 4N2NA 2WYSA 1DVFC 4PV9B 5KZCB 2XPKA 3UZJA 4EI5D 4UTWC 1DJIA 3P84A 1HCVA 2P9RA 4WFGD 1N59B 4I3SH 1UZHA 3FYPA 4HN4A 1TPXB 3QDMB 3CBRA 3QXDA 5IB1A 5IVNA 3WFEL 1CGYA 5BMFL 4PJ5A 5E0QA 3V0FA 1MF2H 1TTFA 3T8QA 1HOEA 3X2QB 2CLHA 3KS5A 3OHIA 4IICA 4ODWB 4EN3A 4I1PA 1IGSA 3FO2A 1G7UA 3EPOA 5AHLA 2C9RA 2FGWL 3V3WA 5ISZD 1GPWA 3L9BA 6TAAA 3EIFA 5I1IH 3MDWA 4PJEF 2KC0A 4RWYL 4Z7NB 3CTLA 3G3DA 2QJNA 3R8GA 2XWEA 2R56L 4OJFH 3TL5A 3UTZA 2JTDA 4KKCD 4OLUL 5AVSB 3M43A 3E74A 4MA8L 3KWXA 3FQNA 3ZT5A 5I1AB 5D9MA 4YYCA 4FMKA 4JFWA 5F1NB 4K7FB 3NL2A 3S6OA 2PU0A 4HEME 4IFKB 3B9KD 4MQXC 4KZ0A 2A3HA 4NO5A 3FT0A 2HEJA 2WXRA 5J8OA 2FSDA 2JKTM 3QUXD 4L4VE 2OL3L 2Q7NA 4MNQB 3UJJL 4EUPA 5KTEL 4AEEA 2IQ9L 3KHJA 1PEWA 1EAJA 2EIZB 3PGDB 2I26N 4I1RA 3SKUD 1T0MA 4JTRA 4AD4A 4PJAF 1TTIA 2B5IC 5ADOH 1RZ8A 1R5WA 2AJZA 4PREB 5D5MA 1KDIA 3OC5A 2QPEB 3QDGA 4KNUA 1JR1A 5D2NA 5KANI 3PAOA 4MMXA 2XZAL 1U6AL 3MOBL 1BMZA 1HSBB 5GJSL 3V9CA 1ZALA 1LLAA 3QC5X 4KJQC 2JALA 3S9ZA 3MP4A 4YSUA 4AC1X 1JHKL 3M1BB 1KN4L 9XIMA 3SD2A 3TIMA 3BUVA 1TZHB 4GIPD 1DBML 1G0XA 5LDUA 3LHTA 2PCFA 3HQPA 4GRWF 4FF9A 3DESA 1DQJB 4PTMA 4PRIE 2O7QA 3CU1A 3O4LB 5K1JA 2ZA1A 3MV9B 2WQXA 2HUHA 3N06B 3WIHA 2YX0A 1IT7A 3WLWC 2E47A 3W7GA 6XIAA 3PZUA 3MUAA 1HHIA 2JKSA 4MMXC 5B1KA 5IVXA 3OXRB 1KBLA 3DHDA 4G43A 5I0ZA 4AFYA 2EDDA 5BPPA 3VG0H 1IR2A 3NJVA 5DJYA 2ORBH 1P7KA 2ACUA 5DFTA 5I71B 4MMZC 4IUOA 1MWOA 1W8NA 4UDTA 5MEQA 4AYBA 3UY8A 5I30L 1HK6A 4ELMB 3ZKSD 2NY5H 3PBUA 1K4HA 3MP3A 2L7QA 1SUXA 5E1QA 1UQSB 3UVAA 2OJZH 2QPSA 1GOIA 5IGXH 5F4WA 2G2NA 5FYKU 3L5XL 4JPIB 1L9OA 5FO7B 3KDNA 4DJFA 3A4WA 4N2CA 3SKMA 2QR6A 5HI3C 3DXIA 3C5ZD 2ZC8A 4LCCC 5DRZB 2NY1C 4O13A 2H45A 4ZMWA 2VXSL 4KPLA 5DQDH 3RGVA 1ZVHA 2BOCB 2Y36L 3HBZA 4ZX6A 1RUKL 1GH7A 4GI6A 1H15A 2BNRB 5T3XL 4IIBA 4QNPF 3U2JA 2WW8A 1CFQA 3E12A 4DKAA 4G8GB 3FDGA 1VKFA 1YDNA 4JDEB 5BOOA 1JZEA 1R0AL 1OTSD 1QWNA 1BVNP 2DQIL 3KH3A 1KRBC 2NY7L 2FFIA 3U7AA 2AJSL 1OTTD 4O18A 2Z64C 5FECB 1UC5A 5DD6B 1BTMA 1KB5B 1HEZB 3H2MA 4IMGA 1KJVB 3NCFB 4P3DB 3RYSA 3VNZA 5L8KB 2O61A 3I3BA 2FB2A 4JQXA 3D51A 3DRTB 3QJRB 5F7WC 3N9RA 3C87A 1WC7A 3LN5A 5F72S 5C0GA 2YL8A 4QOKD 1MUJB 2C18A 4UTJA 1F11B 3L3OA 1I1AD 5DRIA 4PMOA 3LKPB 4E0CA 4XNZC 5IB1B 3ABLB 4GUCA 3NA9H 1FZJA 3RJXA 4NCDA 3ARFB 1N3NA 2Z8RA 4WHCA 4WV1C 4U1JB 5AZUA 1MCEA 2INZA 1FVEB 4PGDA 4WY0A 3ZE0F 3NPUA 3IGXA 4Y9PA 1ML0A 1KG0A 5JORA 4AU0A 7FABH 4FNQA 4XISA 2C9PA 4CW1B 3P69A 5C07D 1H8NA 1SM3H 4P2QD 3ZDZB 5L6UA 2SODB 2WLZA 4DZ8A 2J7DA 4APQA 1XGZA 1GXEA 4OGYL 1FDZA 1MNSA 4FQIH 5A6MA 1P0KA 4J2PA 1ZPLA 2B16A 5FO7A 4M24A 4R27A 3G5VB 3GMMA 3LTVA 1IUZA 5CD5D 1JVLA 1H8LA 2DJUA 4A2MA 5I1LA 4RWHA 3VIHA 1DN0B 3UP8A 2XICA 1ETA1 1OAUH 1R3HA 2F08A 2NXZD 4R0LB 1YYAA 2V3EA 2FKPA 1SOSA 4EI0A 2VMCA 1IARB 4UT6A 3GGWA 2OYLA 1O0VA 2ZWSA 2Z35A 3SY0B 1FY6A 3WNPA 4AD2A 3SE8L 1Q6CA 3FQUB 4HPXA 3A9IA 4EACA 3HIZA 4WEBH 2G4FA 3N9SA 2ITCA 4Q56A 4E4UA 3TN0B 1A0DA 1K8YA 5DVKA 4PL1A 1AHWA 2OR7A 1Q1PA 3MBXH 5CWSA 3AIBA 1L8PA 2OKOA 2X16A 2LVCA 3KR3H 4BH8B 1ZY9A 2AVFA 4WK0B 2H6PB 1NSNH 4F2UA 1I4FB 2P8MA 2XNAB 3GW0A 2X2IA 3ETSA 3MLZH 3SE6A 1I1WA 3B2XA 1XFCA 3PU7A 4ZMGA 4B16A 4KTDL 4RISH 3RY6A 1M1XB 1RIVL 1F1GA 5E8EB 1FE8L 3M1BA 5JOPD 1B3OA 1RK5A 4AWUA 3ALGA 3S35X 3MV7B 3O45B 1OD9A 2PNDA 3KEHA 4KRPC 4S0SD 2FCBA 5JW5B 5LAXB 1E65A 2DSKA 3DK2A 4Z76A 3BV7A 1P4LA 2C1PA 4AM0A 4O1FA 1QUNB 1QHQA 5DMKB 5CIPH 1DQJA 5AOKA 5INCA 2V2WB 2AABL 1FGNL 1ED3B 4HOWA 3S6TA 2RAGA 3PF2A 2E40A 1S3TC 3F84A 1XIIA 4TRPH 4KNTA 2QTEA 5C3IA 1O6SB 3V5HB 3Q58A 5HMEA 3NSFA 1Z0MA 2CIIB 2PF6A 4KMLB 4DEPB 5EGRA 1NAMB 1T1XA 5I9QB 5C0BE 3WCYA 1F97A 4L9LA 4UNTA 5GZOD 2YXWA 3ULUL 3PXHA 4HGXA 5KBLA 4WFEE 1OOAA 2EH7L 5CLZA 4WXZA 3P3BA 2J2ZB 3EO1B 1DBKH 4AIOA 1OEPA 1NLDL 4PI2A 5FO9B 2ZNWA 1CXFA 1TJIH 5DHVB 4F7KA 3ARBA 4F7PB 1J9SA 1OV8A 4UTAA 5J1TC 1KBJA 4G7FA 4XN4A 4WOZA 3KOWA 5DMNA 1IVTA 3VD0A 4ZJ9A 1YEGH 3R0UA 2DY3A 2F54E 4URKA 3RFZB 4PB3A 4KNSA 3C8HA 3UZQB 4QS5A 4YBHA 3FN0H 3P9MB 2WXFA 4QF1B 5AWNH 1U91B 4MMWA 2OMYB 2EACA 3KWTA 1OM0A 5F1NA 1WAWA 2KZ1B 3BMXA 3QDGE 1DV7A 1HJCA 2EKSB 4OUIA 4BFIB 4BE5A 1VHPA 5MI0C 3W3BA 1P2CB 3GRBA 1W1TA 3OZKA 4LC6A 4XD4A 4TVDA 3ARTA 1MW2A 4DP1X 3VCNA 1Z7AA 2APBA 2WBJD 3CX2A 5JOPE 3MUZ1 3B0YA 4NPYB 5IGXL 5B39A 4A6YL 2K8MA 4UM8A 3MZ2A 3N25A 5D2VA 4LSVL 2YXGA 3JUZA 3GJFK 4ZFZB 3K8LA 3FTYA 4EI6B 2YBTA 4FALA 1S5NA 3RTQA 1WAAE 5HDWA 4KK6D 4LALA 2QAPA 2FRGP 1S9VA 1QFUL 3TA4D 5EBWA 1ZGLP 2PXYB 5E2TL 1B31A 3GJEB 4S1RL 3LMYA 2E7LA 1IXQA 4QE5A 3QKZA 1T8XA 3U57A 1T1XB 3TJHC 1J9CT 5JXAH 4WO4A 3L68A 3HNSL 5KMYA 4QRNA 1UJ3C 4NUGL 1YZZA 3NH7H 4JZNB 3O3EA 4MD0A 3TT1H 3QSKB 5AB3A 2ZXAA 5JOEA 2NW2B 4K8RL 1T2XA 2Y7NA 1IHIA 1QATA 5F0LB 3SDCA 4PL2A 3EO0B 1RXLA 4WHDA 3PREA 4A8RA 3V7PA 4PP1C 3UPAA 2YL5A 1B88A 3SYQA 3A64A 3NEVA 2KPWA 3WH5A 3KXFB 1ZT4B 2IH3A 1J8VA 2X3CA 5HBFA 5IBXA 1H3XA 2YDRA 4LCIL 1OIOA 2X2GA 4EPBC 3QUMA 4F7EB 5FAJA 2WXPA 1X5JA 1A22B 2DKSA 4U1HA 4XO3A 5IB4A 3MMDA 4EX4A 1PFCA 3WSQH 3S0CA 3OKLA 2E6YA 3NZRA 4I3RH 4FJZA 4QOKA 4POZC 4MDRA 5BVPL 3B9OA 3T5WA 4HT1L 2ZSVA 2Z0IA 1A8ZA 4XI5C 4S2CA 2VLLA 1AXTH 1JV2A 4JM2B 3WS6A 3SN0A 1BG9A 3QYSA 1QRND 3A4EA 5GGQL 4BFAA 1ETZA 3GBDA 2BIQA 5D96B 1J11A 1H5VA 4J8QA 1V51A 3H8AA 2DIKA 4HPYL 3L2IA 5EEYA 1D2PA 3MDJA 4MDPA 4X6CE 4DESA 4UOJA 2OBGA 4GACA 3VD3A 4XN8A 4EVNA 4OCXH 4GMTH 1IV8A 2IJ0C 1NCDH 4G6JL 3Q8BA 4JN2A 5BOPA 5JXEC 5ISZA 1NSJA 1K2DB 5KTLA 3MJ9L 4PRWA 4KO9A 4TNGA 2IS7A 4U5KA 4R97C 3RNQB 5BRZA 1GKOA 5ACMA 1NFBA 1OP9A 3L5JA 3S7GA 1TT6A 3LHWA 3K6IA 1RY0A 3BE1H 5KOVC 5CS7A 4GRWB 3DGGA 1MJ7H 2WJ7A 5JYLA 2QKIB 4R2GD 4M6MH 4BA8A 4HU8A 3SYAA 1X7SA 3I9IA 3GMLB 3QFJB 5AAMC 3RZWA 5BV7B 2W60A 1QFWI 1KKRA 4NP7A 3V36A 3BWUF 2BVYA 4HCIA 1NOWA 1I7RA 2F7OA 1OYAA 2HVJA 4Q9BA 5EC2A 1XWYA 2JEQA 3H2EA 4X61A 1L9RA 1SQ2N 2A77L 4M1CC 5HDBF 4CMHB 1VB9A 1WFTA 1N64H 5CUSL 1F11A 3WY2A 4D9LH 2ZZ1A 1V6XA 3AISA 4XWGL 2PCPB 2W95A 3CT2A 2XBTA 3L3GA 1QYGL 1OCQA 3GFZA 4ZENA 4GUHA 4DZHA 1M53A 1NEPA 1S9YA 3KD4A 1JDEA 3DUSB 4ZO6A 2G96A 1DE6A 4QROA 1DBJL 3JV4A 4JMXA 1URIA 4X98A 4QQUA 4B95C 2PYFB 2CJSA 1BBDL 4YUEL 2V4LA 3FCGA 2FJSA 3TBTB 4B41A 3GR7A 1EA0A 4JLRB 4HYVA 4ZEPA 1TSIA 2QVMA 4FFYH 3V0JA 1E5UI 4JKMA 2NV9A 4C6FA 2LW3A 5REQB 1ID2A 1A5FL 4XMKL 1DVXA 4FA7B 1F3WA 1AI1H 1NKOA 2WXDM 3K80A 4G6MH 3SODB 2FB3A 5CZSA 5BU6A 4TNVK 1QO3B 5E2JA 3LHPL 1TCRB 2GSHA 1YMMD 2AEWA 2QSTA 2UY2A 2REQB 1AP2B 2DQCH 5AL0A 2HVBA 1YE4A 1UUSA 3EOUA 3L9CA 4PWJA 3NQEA 1F4AA 1V8HA 3U46B 4E2OA 1MUJA 3V0EA 4OGZA 3DGBA 1H5BB 4JQAA 5LGYA 2CU9A 2EHHA 3ARGB 2IH9A 3KL3A 4OTXH 4C6CA 3BH8A 3EYUH 3TTOA 4LRIC 1T03H 1MUMA 4LYRA 3IRPX 4G1MA 1QOKA 4P49A 1KPRA 3I65A 5LXXA 2HJFB 3NUKA 4M00A 1ESWA 5PCYA 3BN9D 1VCBC 3CDGB 3QIUD 4M8UA 1W9XA 2J8OA 1URLA 2W07A 3MGTB 2CBPA 2PI6A 4JX6A 4X9IA 1BWMA 4DGIL 1RCXB 3UESA 2E27H 4FIRA 1XKYA 4GCAA 1JNJA 4GQZA 2FMNA 1F6KA 1JK9B 1SFSA 2CO7A 3S2LA 5HHVL 5B38B 1J18A 4ODVL 3L95B 4V2BA 4ZR8A 4P23C 3GXUB 2DYPB 3E6FB 2UVEA 3ATBA 3V6OA 1JVKA 4XNXL 1QG3A 1L6WA 4K07A 2V5LA 1T66D 1S7WB 1WDAA 3IBEA 3S48A 4R83A 1INEH 3K3QA 2RDXA 1BD2E 3L54A 5HDRA 2CLEA 1JPTH 5IF0A 3ABMB 3HZYA 1BFTA 4M62L 4EIBA 1XD1A 1F4XL 3TFBA 2ZE0A 1W6WA 3VRIB 4RMWA 5TE6L 4JKPH 5TF1H 3KDMB 1PKNA 1O5KA 3G3MA 3IKCA 3OKMB 2JGYA 1QTWA 1JWMB 4HHAA 3N13A 5IHUL 1TITA 1QUMA 2XUWA 5GRXG 2Y8VA 4AIUA 3FA4A 3DGRA 3F6JA 1AS6A 1W5PA 3WK3A 4I48A 1T5WA 2YN5A 3OXRA 5AVQB 1BVLA 5IEKA 1LOLA 4ERSL 2IH1A 4X63A 1L6ZA 1QFOA 1OYBA 2HJLA 4MASA 3Q05A 4J9JA 1YQVH 1GW1A 4UIOA 2JKEA 3QSRA 4ZX4A 4ZYKA 3NDOA 1G7IB 2QKSA 5ABZA 3KPSE 4PGBA 3U5YA 1T1YA 4RMBA 3D25A 3QRGL 4C83B 4F8PA 4NZ4A 4C6IA 3HS9A 4WJEA 5DFWH 2IBZY 2HT3C 2DWDA 5E6IA 1BZQK 3IPFA 3CFMA 3WEMA 1XUUA 5CD3B 3OX8B 2VC6A 1CYXA 1EGJA 5I3FA 5I1GH 3RJDA 2J13A 3DKLA 3TKFA 2A74A 3UJIL 3PJLA 4UINH 3VXUE 1I9CB 3W70A 1PUDA 3ZUNC 4X5WB 3K1DA 4BKNA 5K39A 1X5KA 3ECUA 1I9RH 3QDJA 4X80L 2GJPA 3W39B 1A5CA 2C13A 1ZQ5A 4RGNE 2Q6WA 1YMMB 2AQNA 1MN4A 5I1JL 2M8XA 4NO5B 1EJWC 2I1OA 1CCWB 3PP7A 3HVNA 4G2AA 4JTCA 1MI5D 1ETJA 4D0DB 2X09A 1Z2K