5A2CA

Crystal structure of anoxybacillus alpha-amylase provides insights into a new glycosyl hydrolase subclass
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
450
structure length
450
Chain Sequence
ERTWQDERIYFIMVDRFNNGNPKNDYEVDVHDPKAYHGGDLQGIIDKLDYIKEMGFTAIWLTPIFANEKGGYHGYWIEDFYKVEEHFGTLDDFKRLVKEAHKRDMKVILDFVVNHTGYNHPWLNDPAKKDWFHEKKDIFNWANQQEVENGWLFGLPDLAQENPEVKTYLFDVAKWWIQETDIDGYRLDTVKHVPKWFWDEFAKEVKSVKQDFFLLGEVWHDDPRYVAEYGKHGIDALIDFPFYKEASTIFSNVDQSLEPLYNVWKRNVAFYERPYLLGTFLDNHDTVRFTRLALQNRINPVTRLKLGLTYLFSAPGIPIMYYGTEIALDGGEDPDNRRLMNFRTDKELIDYVTKLGELRAKLPSLRRGDFELLYEKDGMALFKRTYEKETTVIAINNTSKTQKVTLDGELEQGKELRGLLAGDLVRSKDGKYDIILDRETAEIYVLAPKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Anoxybacillus Alpha-Amylase Provides Insights Into Maltose Binding of a New Glycosyl Hydrolase Subclass.
pubmed doi rcsb
source organism Anoxybacillus sp.
molecule tags Hydrolase
molecule keywords ALPHA-AMYLASE
total genus 169
structure length 450
sequence length 450
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5a2cA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5a2cA01
1FFRA 1ZS2A 3VSVA 1OD0A 4QCFA 2GJPA 3A6OA 1ISYA 1CNVA 4PRWA 4MJ2A 5FCZA 2X2HA 1NP0A 1QBBA 1E55A 2ZUWA 1HT6A 2VZUA 1NARA 5CSYA 1VB9A 4PSPA 3QGVA 1WZLA 2QMJA 1JG9A 1RP8A 3W6LA 4A3YA 3N12A 2BXYA 3OGRA 1DWAM 4HU0A 2FGZA 1BG4A 1TCMA 1M53A 3I3BA 5BXSA 2VCCA 3IJ7A 4J7RA 3QOKA 1BVNP 2O92A 4TXEA 2PC8A 3FNDA 4W5ZA 3HG2A 3WY2A 2W61A 3WQ4A 1R33A 3DDFA 2CBVA 1RP9A 3HG3A 2WC4A 2OWCA 3MMUA 1EH9A 2J78A 5IFPA 5D8WA 4D6GA 1HNYA 1R8LA 3EDFA 2XHYA 2YDQA 4HPHA 3MUAA 1XSKA 3WNNA 3SCNA 2JE8A 1Q6FA 2YFNA 1ODZA 4GI8A 4M24A 4HOZA 1VJSA 1PIGA 2DSVA 3LPPA 2CNCA 2G4FA 1PJ9A 1WDPA 1J0HA 3CIVA 1E73M 4Z2KA 4ZEPA 2GJRA 2J7DA 4GZIA 4HOWA 4AC1X 3DX3A 4IUGA 4D6HA 1EDTA 1E6RA 3SUVA 1MXDA 3U7VA 1HKKA 3ZSSA 3LRMA 2BHUA 1OCQA 2PWHA 4A4AA 1XHGA 2VURA 4UFKA 3VIIA 3BC9A 3D4ZA 1F4HA 1BYAA 1VAHA 3APGA 3LRKA 1NM9A 4FNQA 3W0KA 1E71M 2ZX5A 1QHZA 3IK2A 2FGLA 3AIQA 5HNNA 3N1AA 2Y8VA 1HL9A 1CEOA 2WHLA 2XVKA 3AHXA 3ARZA 4W7UA 5CZKA 2CHOA 3DX1A 1W9DM 1I75A 3NJ3A 3SCOA 1XC6A 5E9AA 1E1EA 1KWGA 3VDAA 1UG6A 1UD5A 5A2CA 4JAWA 2OSYA 1EHNA 3CHFA 3WD3A 3WF1A 2XPKA 3L2MA 1OT2A 2WANA 1RPKA 1R7OA 2VRJA 3D50A 3VIHA 1CECA 3W81A 1AQHA 3U7BA 3GBEA 3WDRA 2O9TA 5A69A 3HN3A 2DPEA 1W1PA 1JYNA 1C93A 4J3SA 4UCFA 3CZKA 4P7RA 4HA3A 3VGEA 1CLVA 1GQIA 4TTUA 4AISA 4EK7A 2V3DA 3WEMA 3K8KA 4NZCA 4PTXA 2PWEA 1JD7A 3OG2A 5IHRA 2XM1A 1D3CA 5JBFA 3F5LA 1GQKA 2DSZA 3EJQA 3AJ7A 1EO7A 3RIKA 4P7NA 1W3HA 1JNDA 1UD2A 4W8BA 2WC3A 1H5VA 1TFVA 2ZUNA 4EKJA 3POHA 1LJYA 3UETA 3A22A 1JAEA 1CXKA 3RJYA 3IAPA 3F5JA 2EACA 2ZXQA 3AICA 3D52A 3VD5A 1E15A 4CVUA 1JZ7A 2BY2A 2EQDA 2D23A 5IXEA 3BCFA 7CGTA 4L4OA 4PCTA 1E72M 4FLQA 3ZO9A 3T0BA 3AXHA 4JCMA 4UQAA 1GOIA 3MUZ1 5LA0A 2ZE0A 2FHFA 4CKQA 3AIBA 5FD0A 3LPGA 4DM1A 4AZCB 3WNMA 3M7SA 1HVXA 2W5FA 4UQEA 4JHZA 3VIOA 1QNRA 4JCLA 1GORA 2W66A 1PBGA 4UFLA 1OBAA 4MB1A 2E9LA 2VQTA 1OGGA 3AHYA 1KBBA 1VFMA 3VKKA 2XIBA 4DWSB 4MB4A 4AMCA 3THDA 2F7OA 1WKYA 5A6AA 5ABGA 4PMXA 4V27A 3RM9A 4CD7A 4NXSA 1HIZA 2J8FA 1NOFA 2WBGA 3WD2A 4J27A 3D4YA 2BNJA 3VNZA 3VIKA 3GXNA 2EPKX 3GXPA 1CGUA 4P7OA 2X0YA 1OT1A 3BH4A 1B3ZA 4QDMA 5D9PA 5BCAA 4JFTA 1SMAA 3VGFA 3WNLA 4CD6A 4ACZB 1H11A 4H7VA 3OLDA 1GHRA 2CBJA 4F8XA 5I23A 3AIRA 1JFHA 1Q4NX 3AZTA 5DT5A 4E2OA 4CU7A 1UA3A 3FY1A 3K1DA 5JBEA 1HN1A 4UFJA 1QX1A 2ESCA 3GH4A 1LLOA 2PB1A 1VFOA 2VRQA 1ZJBA 2Q8XA 4D6CA 3VGGA 4OBRA 2D0FA 1LL7A 3K46A 4DO4A 3PZQA 3CHEA 1UR1A 1C8XA 3ZT6A 2WKGA 2ZIDA 4UQBA 4B15A 4AMWA 1MWOA 2PI6A 3HJEA 3W38A 1OIFA 4RE4A 4H2CA 7TAAA 1IZKA 5AC5A 2WB5A 4CCCA 3BAYA 2F1BA 3CGTA 5CPSA 1XH0A 4MNLA 4P7LA 2ZX8A 3GBDA 1H2JA 5I79A 3HZ3A 1MFVA 2YL9A 3EJSA 3VDBA 2J7FA 1HJVA 3AHVA 1CBGA 3GXTA 3DX2A 3M6DA 1TUXA 5LYRA 2EPMX 4TVDA 3EJTA 2J7HA 2CCRA 4TX8A 1ZBVA 2WYSA 1JYXA 5ABHA 4R5EA 3SIMA 1MXGA 2NT1A 2EEXA 1ZU8A 2ZUTA 3AISA 8CGTA 4H8UA 1MQQA 2WBKA 5A8QA 1EA9C 1B2YA 1HP5A 2FDMA 2CBUA 1BPLB 1KTBA 3UESA 1SYTA 2A3AA 4AW7A 4LX4A 3AMGA 1CGXA 3QHNA 1PZ3A 2WXDM 4J3XA 5GPRA 5IDIA 3MSDA 1HJWA 5ABEA 5EMYA 1WPCA 4CCEA 2VX6A 2JFEX 3ZJ8A 2A3EA 3EJPA 3KL5A 2CHNA 2XVPA 3BUDA 2YLAA 3VMNA 1XV8A 1CWYA 2V3GA 4V28A 5FIPA 1QNQA 2ZX7A 5AYIA 4X0NA 1C8YA 3L4VA 1TQTA 3FN9A 3CZJA 2J7BA 1V0NA 3DDGA 3PTMA 2FHBA 4DO6A 4K68A 2OYLA 1BSIA 2IXVA 4UZUA 3UR7A 3BAXA 5AC4A 3EDDA 4XB3A 2VZSA 1UH4A 3WY1A 4H8HA 1NH6A 1DWFM 4J3UA 2V5CA 4W87A 5EFDA 3EJRA 1B31A 4AD0A 2QPUA 3RJXA 1H49A 1E6XM 3SUTA 2V5DA 1J18A 1C8QA 4GZEA 5IHSA 1LWHA 4MB3A 4CD4A 4GO9A 1OD8A 2UY5A 3MUY1 2OSWA 1E4MM 2WLZA 1I1WA 1I1XA 4FNRA 1W1YA 4XUYA 3RCNA 3BXWA 1G94A 1UH2A 3VPLA 4FNSA 2YL6A 3AFBA 2VNCA 4UOQA 3ALGA 4U33A 2D20A 3CZGA 5E70A 1UASA 1V3IA 2DIJA 1D7FA 4GI6A 5CJ5A 1E6PA 4NRRA 1NWTA 1Q6GA 2BVDA 1J11A 1M01A 2WPGA 2YA0A 3AXXA 1KGWA 2XVNA 1QI0A 3AHTA 3S5ZA 1FP9A 3NCOA 3AOFA 1O7DC 3ZJ7A 5DT7A 5KZ6A 1GNXA 2QLYA 3FW6A 3VGDA 5BYWA 2J7EA 2WZIA 5JBDA 3WH9A 1FFQA 3TTYA 3SEPA 3VIMA 1QVBA 3SUUA 1Y7VA 4WKFA 3WEOA 3NSMA 2BHZA 2XWDA 2DT2A 2OYMA 4FLSA 1SR0A 5FL0A 4D6DA 5I24A 2WVSA 3VO0A 1B1YA 3EBVA 2VO5A 2E0PA 1JF6A 2D73A 2OYKA 2JF7A 3WFZA 4AD4A 3WQ8A 1JZ3A 1UWQA 4MPKA 5CLTA 1KR0A 3KZSA 4DUWA 4OBSA 4A3HA 5A6KA 1J0ZA 1E56A 1CPUA 1HKIA 3ARRA 2J25A 3BAJA 2WW5A 3N04A 1HKJA 1QPKA 3WNOA 4LGXA 1QI5A 3VTRA 1S46A 5C8BB 4AIUA 1JI2A 4MTVA 2BY0A 4J3WA 2ZWYA 1U30A 2W62A 5AY7A 3EDEA 3I3EA 4OUEA 1DEDA 2XFFA 4KMQA 1VFUA 1DWIM 2XUCA 1O6IA 3VDHA 3PHAA 4F79A 3WDIA 1UKTA 4BQ5A 2CKSA 3MV01 1QHPA 1V02A 5FKYA 3A47A 3ARPA 4C7DA 3ARVA 3WUFA 3UEQA 3GDBA 1KQZA 1XH1A 2WZEA 3WH6A 1V3HA 3GZAA 1BLIA 1NWRA 2UY2A 2GJXB 3UG3A 1DWGM 4ACYA 5C71A 4AEEA 3QOMA 2WSKA 3SCVA 1Z32X 2G3NA 2WKLA 2GK1A 1V6XA 2WCAA 4YN5A 3WBEA 1KBKA 3WD4A 2ZXAA 4ZXOA 2D24A 1EIBA 2YL5A 2ZICA 2IGTA 5A2BA 4M82A 5BROA 1HXKA 4U5IA 2EPNA 2BFGA 1CGTA 2CETA 1VEMA 2BV9A 2AAAA 1UD8A 4W5UA 1W32A 4C7FA 3VVGA 4W89A 2JEQA 2XWEA 3OLGA 3L4WA 5DF0A 4EE9A 4ZXLA 1ISVA 1R87A 3L4UA 3J7HA 1E3ZA 4J3VA 1H1NA 3VUPA 1A47A 1KQYA 4M80A 3S5YA 5KEZA 4OJYA 3BUQA 1K9FA 4KRUA 3AMLA 3WH8A 1CXLA 5A1AA 4Q7NA 1QHOA 1HJSA 2WVVA 2G3IA 4NZJA 2WCGA 3N18A 4HMCA 5DMYA 4V2XA 4UFHA 1BTCA 4RL3A 2FYVA 2NSXA 3W27A 3VSUA 4ZFMA 4AY1A 1HXJA 5HXMA 2XIIA 3W37A 5DO8A 1ZBCA 2D0GA 5FOOA 4B3LA 3L4TA 4ZE4A 5BXRA 3SCTA 1V6WA 3U57A 4WF7A 2IXUA 2X0HA 3JUGA 2WLYA 4DUXA 2J74A 2WMFA 2J79A 4IISA 2JIEA 5E1QA 1BGGA 1CENA 3N11A 4CGTA 3IJ9A 4Y7EA 4N0RA 3ZMRA 4CU6A 1B90A 1JDCA 3LRLA 3OGSA 1J01A 2WMIA 4AZHA 2EO7A 5JUVA 1JDAA 1UWIA 3LX9A 5I77A 1W3JA 1UD3A 5E0FA 2XFYA 1BFNA 4FNTA 4NI3A 2OW7A 1KGUA 2VT0A 2WHJA 1QOXA 3KLKA 2A3CA 1UH3A 2GVYA 3HG4A 4D1IA 4HZ7A 4WSJA 4PMRA 1R85A 1OM0A 4HOXA 4TTGA 4AYSA 2PBOA 2ZUSA 1V6UA 1NWSA 4DWSD 2DIEA 1AQMA 1W3LA 4E8DA 1QW8A 4LYPA 1GW1A 2YFOA 1FHLA 3WUEA 3WY3A 1HKMA 1V08A 3GXFA 3VIPA 2X09A 1YQ2A 1BF2A 2G8ZA 3VD7A 3DYMA 2BVTA 1JGIA 4U31A 1KXHA 2OW6A 2Y24A 1OGBA 1G0CA 1VEOA 2YLLA 3FXYA 4OOZA 3A24A 4U2YA 3VIFA 3PZVA 2WWCA 3UG5A 1HF6A 1UKQA 4TVCA 1HL8A 1UWRA 2G3MA 2C8NA 3E1F1 3PZMA 1V6VA 2YA1A 5A2AA 4M8UA 1GOQA 1L0PA 3VM5A 4MAVA 1J12A 1K6AA 1MQRA 3QR3A 4JFWA 1GONA 5A6SA 1LL4A 1W1TA 3KLLA 2W67A 2A3BA 3W82A 1H41A 1UZ1A 1JL8A 2WM0A 3MANA 4W8LA 4HPGA 1VRXA 1J10A 1VF8A 4F9DA 3RO8A 4PTWA 4AZCA 2BVYA 1O7AA 5CSUA 3POCA 1E0XA 1M03A 3QHMA 4GZJA 3T0AA 5M5DA 1UHVA 2OWXA 1UUQA 1H3GA 1TQUA 1J9YA 1QNPA 4QLJA 2MANA 3VMOA 2FHCA 4HZ8A 4Q22A 2BHYA 3CZ8A 3D5HA 4UTFA 1WNOA 1IZJA 4OOUA 4UR9A 5HOSA 1R46A 5A6MA 4P8WA 1JXKA 1HJXA 4PTMA 5IFTA 2PWDA 3OA5A 1V02E 4LYRA 4HA1A 1DHKA 1JIBA 4JL1A 3VU2A 2VX5A 1HX0A 4F66A 2VJXA 4BS0A 2F18A 5D9OA 3U5YA 2NT0A 4PCSA 1V3LA 9CGTA 2QF8A 2EAEA 2XN0A 2ZUUA 1G5AA 3OBAA 3EJUA 5E09A 5GNZA 1TVNA 4AZGA 2J47A 2VZOA 3T0DA 4XV0A 2XJ7A 1V0MA 1AMYA 4JZ5A 4ATWA 2VQUA 2X8RA 2YL8A 3LXCA 4CN1A 1FH8A 5JIWA 3VIJA 5EFFA 2ZWZA 4WSKA 1R47A 4P7QA 1TMQA 1C7SA 1CGYA 1XSIA 3B8SA 1C7TA 1EOMA 3GNOA 3WUBA 2JALA 2RGMA 6TAAA 1EXPA 1UR9A 1W9PA 1EDGA 4DWSC 3N17A 4AZIA 2XM2A 4M81A 3UERA 4WK9A 4AZ5A 7A3HA 3ARWA 4HZ6A 1WZKA 3D51A 4M56A 1B3VA 1X6NA 3SCQA 5D4YA 1ITCA 3WKZA 4AIOA 3A3HA 5CXPA 1DTUA 1NWUA 3OIHA 3WD0A 4PYSA 1MFUA 3WMBA 1W3KA 1U33A 5LA1A 3CPUA 4AIEA 4XX6A 3BVUA 4TX6A 3BAWA 4W7VA 3SUWA 5M03A 4UQ9A 1V6YA 4UFIA 5TD4A 3WF2A 3EDJA 2XGBA 3WF4A 1R34A 3LPOA 1SFSA 5I3DA 3CMGA 1B3XA 3VX1A 2J7CA 4GQRA 4W88A 1GOOA 4IM4A 1JZ5A 1HVQA 3AYSA 5A3HA 3AROA 1YHTA 2WZHA 1H4PA 2XYLA 2WHKA 2VZTA 4MDPA 2ZUVA 3PZGA 4AMXA 1MW1A 4H8VA 3ZR6A 4CN4A 3TTQA 3OB8A 3ARSA 3O6AA 1E1FA 2DSWA 3EYPA 1K9DA 1F4AA 5HBFA 3AIUA 3MI6A 1BQCA 4NSBA 1UD4A 8A3HA 5CLWA 4D72A 1PX8A 4XZWA 3WDHA 1TQSA 2EPLX 3FAXA 4B16A 3F4VA 3WL0A 1IT0A 3TTOA 1H0IA 2D0HA 1Q6DA 2VI0A 2F61A 4B9YA 2WAGA 4P8UA 1V3KA 4W86A 1Q6CA 1TG7A 1WZMA 4LYQA 4Z2LA 1TQWA 2W4XA 3L4XA 3WL1A 2VTFA 4AD1A 3K8MA 2YDRA 2Z1SA 2E40A 2C7FA 3LPFA 2DH3A 1UR8A 1WDSA 3DX0A 5BRQA 3ZQ9A 3WMCA 1JZ6A 2VL4A 1WCGA 3WSUA 1OB0A 1LF1A 1J0KA 1B9ZA 1GQJA 1JAKA 4PSRA 1NP2A 2XN1A 3IJ8A 1QBAA 4MDOA 4UZSA 3WH5A 2DQXA 2VVSA 4L4PA 3VDCA 2G41A 4QAWA 3S2CA 1GOKA 3NUKA 3EMQA 4W84A 2WK2A 3T08A 2HVMA 5M3WA 3AIWA 2WHMA 1WO2A 3GXIA 4HMEA 1JZ8A 2Y2WA 3RM8A 1QWUA 1JNEA 1NQ6A 1IV8A 3DYPA 1TA3B 3GH5A 1ZL1A 3CHDA 1US3A 2XSBA 1E70M 3CO4A 3SCPA 4AZBA 2TAAA 4MNMA 4GINA 1VENA 2D22A 1ZB5A 2IUZA 4B3KA 1OIMA 3DECA 2WSPA 2YIHA 2UY4A 1A3HA 2OSXA 4LXFA 3BMVA 4OGZA 2PWGA 1CTNA 3VMPA 3IAQA 1GZJA 3BSGA 2ZX9A 4D6EA 3NYDA 5GQBA 5GNYA 2Z1KA 3TTSA 5BXPA 2HISA 1ZBWA 3VD3A 2WWDA 1E5JA 1KB3A 1KCKA 1V0LA 2W92A 1PIFA 3CUIA 1BYDA 3VX0A 1K9EA 4KGLA 1VBRA 1JXJA 1LWJA 4UQCA 4C7GA 3GH7A 2EBNA 1EDQA 3A4WA 3BLPX 3WQWA 3VGBA 4N42A 3ZJKA 3O2LA 3VGHA 2VZVA 4MJ4A 3ZJ6A 4W8AA 4QLLA 1ODUA 3BMWA 3CUJA 5HDRA 2YOCA 1XYZA 1GJWA 2BXZA 4PMUA 4QLKA 4LPCA 3K4DA 1OGSA 3L4YA 1P6WA 2CIPA 3ZT5A 4J3TA 3CZNA 1T0OA 3CZSA 3GTNA 3T2PA 5BXTA 5I2UA 1WE5A 1UWSA 4M29A 1US2A 2F2HA 1GUVA 3CV5A 2UWFA 2BY3A 3MUIA 5AYBA 4JIEA 1UKSA 4XZBA 1LL6A 1Q6EA 3G6MA 3AMCA 5I78A 3VIGA 2JF6A 3MS8A 1VIWA 2ZXBA 2GDUA 4PMVA 1W9BM 2J77A 4PUEA 4DUVA 1X1NA 4PMNA 2W63A 1BVZA 2QMKA 2D1ZA 3PZTA 4EANA 4GXPA 3H53A 2WMIB 2DT3A 4M1RA 3GM8A 1XCWA 3BAKA 1R75A 4BCEA 5EB8A 2O9OA 1KXQA 1UYQA 4URIA 3VD9A 2VUYA 3ARUA 2WMKA 2E4TA 4U3CA 1G01A 3CZEA 3W24A 3BUBA 1UQYA 1UD6A 1QNSA 1HJQA 4JFSA 2AMGA 3KL0A 4HTYA 4WIWA 1UR0A 5A8MA 1E3XA 4UFMA 4JHOA 3AIEA 4JL2A 1V03A 2GDVA 2QV4A 4CU8A 2C0HA 1MVYA 2CYGA 3AXIA 1AQ0A 1KGXA 3BVWA 1G9HA 3BLBA 4MAZA 3AMDA 3FHAA 3WQ6A 3AQUA 1GVYA 1XCXA 1PS3A 5I6SA 3OGVA 1CGVA 4UNIA 1HP4A 1FHDA 1UWUA 4CD8A 2WNWA 3VOCA 2XFRA 4YHEA 1GVIA 3EMCA 1UKPA 4HU8A 4P8XA 3II1A 3GYCA 4X9YA 4MB5A 2W91A 4P8VA 2J75A 4GIAA 3TONA 3AYRA 4U5KA 1SZNA 2Y5EA 3CUGA 5HPOA 1OINA 2D3LA 4R27A 2WMGA 4ATLA 3H54A 3AS2A 3EDKA 3CZLA 1JI1A 4BA0A 5A8NA 3AS3A 3KE0A 2VR4A 3VILA 1CXHA 3EMZA 4CUCA 1PZ2A 2CEQA 3HU7A 2EADA 4WKHA 1UZ4A 2VX4A 2J4GA 3WBAA 1VEPA 4E8CA 3DX4A 1XSJA 3RM4A 4Z2IA 3MV11 5E6YA 1EO5A 5CPQA 5F7UA 3A21A 1NOUA 3AZRA 2E9BA 4S3KA 1CXFA 3WDPP 1J0JA 4QCEA 1D2KA 4KWUA 4JKKA 1H09A 1UR2A 1E9LA 4W93A 1BYCA 1BG9A 2XN2A 3K4AA 1PAMA 1FH9A 3BVTA 3WH7A 5CPTA 3FHQA 1CGWA 2QPSA 1EOKA 3H55A 4PMYA 1BHGA 4AD3A 2GSJA 5DFAA 1WDQA 3CH9A 3WIJA 5A94A 3BUIA 3ARYA 4GPNA 2ZX6A 5A6JA 4HP5A 4FNPA 3M46A 5E0CA 2GUYA 1JYVA 3GNRA 4ZENA 4DWSA 2Y8KA 2VCBA 4GO8A 3KEHA 2X2YA 3BCDA 1CIUA 2CKRA 3PZ9A 4FNUA 3O9NA 2VX7A 3RPMA 2X2JA 2RGLA 1E43A 3BLKA 3CUHA 4WJXA 1VJZA 2VRKA 5JIPA 4AEFA 2JEPA 2F7RA 1X6LA 2X2IA 1M7XA 3LXAA 1ISZA 1WB0A 1KR1A 1E5NA 5CGMA 3WFLA 5A6LA 3TP4A 3W53A 3NDYA 4ACZA 2DT0A 3TV8A 4AD2A 3AI0A 4NF7A 4PMQA 3PBGA 3LMYA 5BWFA 1HTYA 4GI9A 1HWWA 3CBWA 4BQ4A 3ECQA 3WMSA 3A4XA 2ZUMA 4CVWA 2J7GA 4Z2JA 1E6SM 2F8QA 2WC7A 4DO5A 2J62A 5D8ZA 2YBUA 5ABFA 1FH7A 1CYGA 3L2LA 3PZNA 1UKOA 4FLRA 4MNJA 1LG2A 1W2VA 2PF0A 1U2YA 1J0IA 3NSXA 3W26A 4AWEA 2XVGA 4CD5A 2ZOXA 3N15A 4D6FA 3TOPA 1OWQA 1UA7A 1WZAA 3KWXA 1TE1A 1QI3A 4PEEA 1ZBKA 5GNXA 2D2OA 1V3MA 1E6ZA 3PZUA 1C3FA 1MYRA 1GPFA 3WENA 3WQ5A 3ARQA 3CMJA 2F7QA 2EABA 3HG5A 1WP6A 2O9PA 1ISXA 1CXEA 5A8OA 1H0GA 4Z2HA 4MNKA 1E6QM 1MW0A 3CUFA 1J0YA 2VR5A 1V0KA 1B0IA 2XG9A 4GKLA 1R86A 1QWNA 3FAWA 1W2PA 3OZPA 1W9VA 2X05A 1CXIA 1RH9A 3L4ZA 3D3AA 3PZOA 3ALFA 2WVTA 4E4PA 4MADA 4PMOA 5LA2A 5A8PA 2EJ1A 1KFWA 3VM7A 4KH2A 4ATDA 4UOJA 3W29A 3DHPA 1KCLA 4D6JA 1E0WA 5E6ZA 2FH8A 5CQ1A 4B9ZA 2PWFA 3BAIA 6A3HA 4ZE5A 3VINA 2G3JA 1TZ7A 3T2QA 3NIYA 1WAWA 3SUSA 3UR8A 2UY3A 3OLEA 6CGTA 4TOQA 2A3HA 1QW9A 3BSHA 4H41A 1KXTA 1QI2A 3WY4A 1E4LA 1UQZA 5HPCA 3A4AA 1KTCA 4BQ2A 3WF3A 2XSAA 2GJXA 3B9AA 1JZ4A 3F5KA 1GJUA 4S3JA 2NW0A 3ZM8A 2F1AA 4PBGA 4CCDA 1LG1A 2DSKA 3BVXA 3BVVA 1HJUA 4UOZA 3U5UA 2VOTA 1FP8A 3MMDA 2VC9A 3ZT7A 5DEZA 4GQQA 1TA3A 3THCA 3AZSA 5I0DA 4FF5A 3NSNA 2OLHA 4NZFA 1KXVA 2WMJA 1JYWA 5ECUA 5A6BA 2J8GA 4IPNB 5BRPA 3WDJA 3WNPA 2WMHA 1B30A 3WQVA 3W28A 5I5RA 1UOKA 1BGAA 2DT1A 2QHAA 3G6LA 4JKMA 1M04A 4J28A 2DDXA 3WEZA 3UG4A 1PX4A 3AS0A 4UQDA 2B31A 3AIVA 3CC1A 1RD6A 1G1YA 3UCQA 4PMDA 2BS9A 3I3DA 2ALWA 2DGAA 1XH2A 4H04A 1W9XA 2YBTA 2CITA 2BY1A 3A5VA 2CBIA 5D9NA 1DP0A 3W25A 1XYFA 4OIFA 4CN6A 1PX3A 1C91A 3W4RA 2DSUA 1L8NA 3ARXA 3AMKA 3WDQA 3IANA 4NXKA 1BAGA 5C70A 1E6NA 3WN6A 1JDDA 4TVUA 3BUPA 2VCAA 3VD4A 3RMEA 1K9TA 5CG0A 3SURA 1DWHM 3VSTA 1ESWA 1PEZA 4TUFA 1ZJAA 4FLOA 2YKKA 3ZR5A 4QFUA 2WVVB 2EPOA 3VNYA 1JD9A 4D6IA 4DM2A 1E0VA 3HMCA 3AHZA 3SCWA 3GXMA 3B9EA 3MKKA 3CTTA 3IGUA 3SCSA 1PPIA 3DHUA 1CDGA 1GQLA 4WKAA 4X0VA 1V3JA 1OSEA 4D71A 3PTKA 2EXOA 1W91A 1EQCA 3WUGA 1MQPA 1NOWA 2WVUA 2Y4SA 2AOSA 1KWKA 2F7PA 1TR1A 4PTVA 3T09A 2JIWA 1XD0A 3DYOA 4KRTA 4AZ7A 1E4NA 1QNOA 4AXNA 4KGJA 3WELA 2E8ZA 1FA2A 4HMDA 1VFFA 1ITXA 3WF0A 1FOBA 1ECEA 1GOMA 5ABFB 3M07A 1TQVA 4NRSA 3S6TA 2YDSA 1LQ0A 1BYBA 1W1VA 4U3AA 2E3ZA 1WDRA 3RDKA 1C92A 1XD1A 1XGZA 1MW2A 4W7WA 2DH2A 4PN2A 4NX0A 3ZOAA 2CERA 1ISWA 4IPLA 1E4IA 3MO4A 3BGAA 4W85A 1TVPA 2V3FA 4OZOA 1EHAA 1AVAA 4RE3A 5CGTA 1W9UA 2FH6A 2WCSA 1R7AA 2CPUA 4WLCA 3GXDA 1JFXA 4OKDA 2X1IA 1CLXA 1XRVA 3KL3A 4Z2GA 4QP0A 1MW3A 3A23A 3QHOA 2XVLA 3W6MA 4BF7A 3LXBA 5EBAA 4BQ3A 1CZ1A 3N9KA 4ML4A 1DWJM 2O9RA 3NDZA 1B3YA 2ZXDA 4RE2A 2D3NA 3WNKA 4PMZA 2XGIA 3GNPA 1GCYA 4AZ6A 3N13A 3SCRA 4AD5A 4JFUA 3SCUA 2VMFA 3OZOA 2DEPA 2V38A 3B9DA 4JKLA 5A6BD 3MMWA 4YPJA 2YA2A 5D9MA 2GK1B 4HA4A 5M17A 3DC0A 4JFVA 1GOWA 1B3WA 1SMDA 2PBGA 3CHCA 3PTQA 3ZSTA 4FK9A 4PUDA 3T2OA 5A95A 5FL1A 3K8LA 2VVNA 3PN8A 3ZIZA 1QI4A 4F9JA 2FE0A 4EAMA 2V3EA 1N82A 2CXGA 4BZYA 3ARTA 3AS1A 3TA9A 3RILA 3MU7A 3WD1A 4LQ1A 4YHGA 1JF5A 4D1JA 4AYGA 2GFTA 1GHSA 2CESA 2YJQA 4U2ZA 1C90A 2OWWA 3CLWA 1EQPA 2E8YA 3MSGA 1UR4A 1UWTA 3OLIA 1E40A 1VBUA 2E9MA 4FMVA 1JZ2A 2XTKA 1EGZA 3PZIA
chains in the Genus database with same CATH superfamily
1ZS2A 2A4CA 3U1SH 3VDGA 3XIMA 4LFHG 5HGAB 4M7ZC 5FR3A 2O6DA 1OD0A 2JGQA 1XI3A 4DBDA 1ISYA 3EYVB 1D5IL 2BNUB 5ACZA 1CDHA 3T5WA 3IPWA 3MXVH 3ZXWA 1PG7H 3P4MB 3NABL 1DL7H 2H8PB 3NJMA 4MJ2A 1NF7A 2K1MA 4LW7A 3VXUE 3MB9A 4OZGB 4JFYA 3MUUA 4N2KA 4JKWA 1E55A 3W1AA 1HT6A 2VZUA 3L4CA 5ISZB 2K78A 4P2QE 3DX5A 1MIML 5E8EB 2AZAA 2OU4A 2YCEA 3LLFA 3G6JF 4GACA 4TN9A 4Q6XA 3U1PA 4G56A 5DRZB 1OQXA 5IT2H 2BC4B 3KPOB 4KZDH 2VSDA 3M6YA 1LJMA 2DBLH 5AYUH 3SQSA 3ULUL 3N12A 3OGRA 2X7WA 2COVD 5DHVH 3CMFA 4GVHA 3GNMH 3QLDA 4J3OH 2XTSA 3WKMH 2FGZA 4AX6A 4MASA 1PKNA 3PUUA 3H23A 3H70A 1TCMA 1FWJC 4JTLA 4HISA 4RFOH 3SIKA 1A0EA 1M53A 4TSAH 4AM0A 1J9TA 3XISA 1ZHLA 2FWLB 4GKSB 2OM5A 3D0LB 4CSPA 2O92A 1K8YA 1MDLA 1QO2A 1WS7A 1QBML 3EBHA 4W5ZA 3WQ4A 2WWKO 2YYTA 2H26B 4NI6A 4R4ND 43C9B 1RP9A 2WC4A 1NDVA 5D32A 2XKUA 2OWCA 3S35X 3TCSA 2J78A 1NCCH 3NO5A 3DVNA 3EYSL 2AQWA 4HIJA 1LWRA 2CIKA 3CFQA 3V3WA 1SEQL 3KS5A 1R8LA 1U4FA 1F6PA 4B41A 4OZGF 3CWGA 4OLZH 4M6NL 5F9JA 4QR7A 4DYJA 2DN7A 1CL7H 1ZHBA 4GSXA 4HBCL 3U2JA 5JDSB 1E7UA 4LY4A 1WD9A 2JE8A 1Q6FA 4ZZ9A 4JYEA 1AO7B 1RURH 1ODZA 3T40A 3ZDZF 4XXDA 1VJSA 2YXMA 2AQTA 4W81A 2XRAL 4YQXH 1XDJA 2FPVA 5J9PA 2QELA 1S1PA 3EOYG 2A9NL 3LV5A 4GH7B 3V7AG 3MJ8B 4A66A 4LC8A 2CO7A 1G43A 4RESB 4QHPA 3DX3A 5IK3A 5L8LB 3QYQA 4IUGA 1MN4A 5K9QG 2ILLA 1E6RA 1ZQ5A 3U7VA 5IB3A 4C47A 4PA8A 1KNOB 2ENYA 1KFKA 1J8HA 2WSDA 2PWHA 1OCQA 4H88H 1S5WA 1XHGA 4CNIB 3O6CA 1MAKA 3BC9A 3D4ZA 2BLEA 3VIIA 3VFUA 1VAHA 4FZEL 3WXWH 4GYKA 3MRKA 1NM9A 5IBLC 5F1OB 2Y7LA 5CEZE 3HTLX 3ATYA 3B40A 5EPMB 2A74B 3OQEA 4WIQA 1RK0A 2NY4C 4NCDA 3SBRA 4ACTA 1A1NA 1ZA6B 4X6DB 3HZMA 1MEIA 1IAKA 1SHMA 5SWSD 2FGLA 3AIQA 1ZD6A 4XZ4A 5HNNA 4FA3A 3OHXC 3W9DB 1T22A 3KWVA 3SPIA 4D7PA 1TZGL 1CEOA 3IF1B 4PRHB 5CZKA 4XZMX 5DMNA 1K8ZA 5I1KL 2C1PB 3H9HB 3IJDA 5I6MA 1QSFA 3FS9A 5K59E 1U9KA 1FZOA 2UVEA 3HC3H 1OE2A 3KJ6H 3U4AA 4XMLH 2A83B 1ECQA 3CVCA 2Z31A 3W11D 1Q9KB 4XAZA 3QO0B 4NNPH 4H1LA 3SB0A 4KXBA 4OVUA 3WJXA 4C5YA 1QNZH 3WG6A 1Q6QA 1UGNA 4G80B 3UG8A 5JUEL 4F0RA 3S5SA 1ZSHA 2XPKA 3W1XA 1HJBC 2ODOA 1OT2A 3MYJB 2PLTA 3F00A 2J72A 1MNNA 1MKFA 3ECBA 1U2CA 4RGND 1LJYA 1ZVSB 1FBIH 2X4NA 3PQYA 4IU2A 3E9AA 3HIZA 3WFBL 3CSPA 1K7XA 2J44A 3H7UA 2XXFA 5IB5B 3QEZA 3WLMA 3D50A 1TPEA 4KI5F 2WQVA 4MA3B 4F5CE 3NPSB 3QO1B 1AQHA 2B9AA 1N6UA 1QOKA 2CDGA 3EJZD 3GBEA 3GLEA 4QWWC 4U0RC 2JKWA 4TVPD 4YAQA 1DUYA 4FP8H 4FXGC 4KRMB 4OD2A 5EF2A 3NG3A 4DIAA 2B1HH 3O0RL 1GG1A 2IS7A 5F6HI 4DHLA 1C93A 4R33A 4J3SA 4XCCH 5IIEA 4P7RA 2F74A 4KO9A 1TB3A 1AKJA 4ZQRA 3IU3A 1GQIA 1LROA 1IL1B 1DR9A 4TTUA 3BGFC 4I3SL 4JY6B 3RGVB 1J8HD 4EK7A 3F62A 5A3ID 4LCWA 4RX4A 3T6XA 5EF0A 2B1AL 3RYMA 4NZCA 1J1OH 1AG0A 2PWEA 3B2UD 3OG2A 2PO6B 4ZR8A 3B3DA 3FU9A 3QH3A 1H8NA 4E6MA 2Y6SD 3TIDB 3VXQA 2XM1A 3CHRA 1GQKA 2DSZA 3VOCA 4UUJA 4Z7VE 5HR6A 5DQDL 2HP4A 4ZG1A 1EO7A 2CSPA 3RIKA 4KCVA 4G6FD 3KD4A 3TEUA 1HXYB 3R8BB 1ORSA 4HEME 1UD2A 2E6DA 1MREH 5TK4A 5FO9B 4W8BA 4LH8A 2J4WH 4MSWA 5DUPH 1IBGH 2HROA 4PHXA 2WN3A 4KI5E 3SCMD 1H0DB 3ZHLA 2EAWA 1RJZA 1SF3A 4Z7QE 1JCLA 4JNMA 5SX4I 1LWIA 3UETA 4K2SA 1BQHA 4DYKA 5F0PB 5B38B 4N2DA 1TZIA 4UIMA 1XISA 4QDGA 3F5JA 2EE9A 2EACA 3ULSA 4EOWL 5A7BA 1DBTA 5IG7B 4BFBD 3AICA 3D52A 3VD5A 3KYNA 1JZ7A 3SD5A 2EQDA 5IXEA 1IAII 3MPGA 3MJ9L 1IJ9A 1W2KT 3BCFA 7CGTA 4HCRH 2ZCHH 2BOCB 1W8SA 3OVGA 4L4OA 4MVBD 3FB7B 5EOQH 3JT2A 4LGPB 1Z41A 3TNBA 2ZSVB 1LP9B 1KYOK 5I1HL 1DBKL 2PCFA 4IS6B 3L5JA 5L6YL 5DGRA 1DJGA 1G6RL 1GOIA 3SDXA 1YADA 5E95B 3LPGA 4ZFGL 1NPNA 3GO1L 1GYCA 1MHHA 2WO3B 3L5WA 1F4YH 5T5FH 1XFPA 4QCIB 3WNMA 4F7KA 3M7SA 3RITA 4C58B 5JXAH 1L5GA 3WZ0E 1WTGT 4UQEA 4JHZA 2OXNA 3VIOA 1UWAA 4JCLA 2QW5A 4MSSA 1HCFX 5SWZA 1GORA 2WHVA 4W9DC 4XMXA 3F04A 5HD8D 3ITXA 3JR2A 3OQ8A 4UFLA 4XCFH 5GJTH 4C6KA 1PYWA 2VQTA 4C56D 1RZMA 2E9LA 1NICA 4MNQE 1ICPA 4YDZA 1OG6A 4K3HA 4X4ZA 1YNPA 3R8GA 5CPNA 1CTOA 4NFBA 1X7TA 1EBAA 4B97A 1PKOA 4GNJA 2YQBA 1QBLL 1D5RA 1W37A 3QISA 3E6HB 5D1XC 5ABGA 1ZOXA 2X1RA 4DWSB 3L9EA 2HN7A 4A04A 1OAZL 1UA6L 1AYRA 2V8LA 2PF8A 4YK4C 2P80A 5I7GA 4PMXA 2MPAL 4XO7A 3MRHB 2JXMA 2BH0A 3T2NL 4CSZA 5HATA 2NUPA 4H5SB 4LSUL 3STFA 2QVFB 4PJEA 3WGVB 4J27A 4US5D 1KW1A 2BNJA 1JPTH 2SEBA 3B5GA 1M9WA 3GXNA 2W6RA 1BD0A 4K8EA 5ABAA 2VMJA 3LDBC 3GXPA 3Q3GA 4E9RA 5BO0D 1CGUA 1IAIH 5FHAH 1YG9A 4LBEB 4P3WA 2BVPA 5E94B 2GAZB 4BI5A 3NG5A 1B54A 2P8PA 5JH2A 3ALWA 1AA1B 3NBNA 1B3ZA 1EEYA 3CL8A 2CA4A 3REWA 3CL6A 4IMCA 4AYFA 3QNXA 5HMEA 5KJ7E 1EF3A 3BPWA 4D0DA 5DZAA 5CN2A 2TRSA 5INCA 2B59B 5B38G 1M7IB 1NCAH 2DM7A 3MLTB 3O45A 4KK9C 5CEZD 4CD6A 3L54A 1G6RB 2NY6B 2RDXA 3B4YA 1Q9LA 1ADQL 2C3HA 4X4YB 4AT6B 1EVTC 1JFHA 4KROB 5FA4B 2JKRM 4DB7A 1U8CB 3LQZB 5B21A 4AVHA 4TLTA 5J6HB 1XRTA 3W72A 3KVPA 1U8HA 2VLKE 5F9OH 1K8DA 3MACL 1HN1A 1B4KA 1T2JA 1QX1A 3EOAA 3A6CH 5IM7A 5EF1A 3D69A 5DHVA 5GZND 2ESCA 4ISVA 4BHYA 5KINA 3Q6FA 3TBYA 4UTTC 1VFOA 4JRFA 4NCC1 3UZJA 3MNWB 3QQ3A 1ZJBA 4PL1A 2N7AA 2X1OA 5KAQG 1XPGA 3RWEA 2Q8XA 4FA6A 5FACA 5J8LA 4L9LB 1UURA 3ZDYF 4DN3L 3CCHA 4Y4FA 1Y5XA 2VEIA 3QC6X 4RGNB 1L6GA 3X1NA 2D0FA 3T78A 3IGHX 1NMAH 2NY5L 3IJSA 3QIWA 4R4FL 3VFSB 4DO4A 4Z7OB 3DTUB 4HEPA 2FTPA 4WGVB 2VEMA 4I9AA 4XP1H 3EXTA 2OQYA 3T55A 4DBWA 2GGIA 4YSTA 1TCDA 1I2NA 3SQRA 3I6KA 4XZUB 3VJ6A 2IH9A 2ZIDA 3GI8H 3GRWL 1NJ9B 4ZMZA 1JCNA 1EXGA 4UQBA 4NYYA 2DLIA 4B15A 1J8RA 1WT5C 3OEXA 1MWOA 2JB6A 3HLKA 5AD0B 1QTYT 2E4FA 3W38A 4PRHD 2G75A 2Q86A 2JK5A 3QJSB 4H2CA 1BXBA 1QU4A 1TMHA 3VXPB 5DMKB 1YDVA 3HUJA 3GY1A 3CT7A 1XGUB 1L8PA 4P61A 5FW6A 2C9VA 3OR7B 4CQ8A 4QG9A 1KJMA 2P26A 3O6KH 3O0KA 3S1WA 4XX1G 2ZX8A 1A3LH 5B1AB 3GBDA 2AV7A 2IH1A 3HZ3A 2DQDH 4RMUA 2IPKB 5D7IE 1MFVA 3HB3C 2XQYA 1UW9A 2WXNA 2JQXA 3LN4B 4ERAA 4Q8TA 4NFCA 4E2BA 5CHNB 3KVQA 5IHUH 3YPIA 3GXTA 1MJJA 4G7VL 4JDVA 5IREA 3M6DA 4OB5L 3NGJA 4L3CB 3UXIA 4ZOBA 2VDLL 3S2AA 3VOFA 5I1IH 3O4LE 3SBFA 5KVFE 2VOMA 3GHEL 5FM5M 4TR9A 2HH0L 3EJTA 2J7HA 4XSLA 1ZBVA 1KBVA 1NGXA 3WHE1 3CN1A 5SWQA 1T1ZA 5F1KC 3BLIA 1UT9A 3HEIB 4XPGH 3SIMA 2GZXA 5CPOA 3U2OA 1I1RA 4JN1L 4N4PA 1B4LA 1OC7A 2EEXA 1SGJA 2ZUTA 1ZU8A 3IGKA 2IAMB 1FP5A 4LSRH 2QCEA 3GSUB 2YS4A 3KJ4B 2C1IA 3M0ZA 4FS9A 4ZMLA 1AY1H 4H8UA 2G97A 4QG8A 1EF2A 1SOXA 2P24A 3N6HA 5A8QA 3JTTA 1LK3H 5AVZB 3IRSA 4Z1CA 1ZRUA 4NU7A 1PWLA 5AW0B 4JJ5B 2EPKX 5T3ZE 2P5PA 1WFMA 4XODA 4AG4L 4XOEA 1MJUL 1Z9SB 2CO2A 2J3SA 1KKOA 4HYTB 1SYTA 5K9OB 1KFGA 1YEGH 1A50A 4JNYA 1IAOB 2PFHA 1D9KA 4HFWA 4M6AA 1XLEA 1CGXA 3QHNA 5JUEH 4H1LH 2ZYIA 5GPRA 4WY7L 5IW1B 3MSDA 5IDIA 4XBKA 2LU7A 1HJWA 3CB3A 4JFEE 1FIGH 2ODHA 1V79A 3U6RA 3OJGA 2O0TA 5IBTH 2V5TA 1KB5L 5IF0A 4CCEA 1IC4H 3NACL 4G9FD 5TH2B 3ZJ8A 4ES4A 1ADDA 3HFTA 1TX2A 2YLAA 1Z89A 1CWYA 3ITGA 4UT6A 1GS6X 4P5MA 1TNMA 5HHME 3OPSA 3QDJE 2QEJA 2APTA 1NEUA 4RAVB 4X0NA 4HHAB 2EO9A 3ZHFA 1IC5L 4WGWB 4XPFL 3L4VA 3OW1A 3AG4B 3CZJA 5EU3B 2R2EA 3PTMA 4DO6A 2HT3D 1WYJA 5IBLD 5CH9A 5D7SL 4XRCB 2X12A 5J5DA 2CMRL 1NCGA 2HRGA 4DKAA 2A9AA 2DYRB 3EO9H 4MD4B 4R90H 4EI5D 2HRWA 5I16A 3P5YA 3ZKMD 5I3HA 1XIIA 3B3IB 4NC1C 4QBXA 5AC4A 4UWQB 5BOOA 4XB3A 2B4CL 1V7NL 5E56A 4A68A 3WY1A 2F53A 4H8HA 1OP5K 1DBBL 1NH6A 4U1NB 2MNRA 4MZ8A 4WOQA 3PBUA 4I9JA 1CT5A 1PQZA 1QK0A 2VXNA 4MWAB 2XTJD 1B31A 3W2LA 4US5A 3EPNA 1H49A 3DHMA 2ZC1A 3G04A 4MCMA 3DROB 2DMHA 5ALBL 1P84J 1G4RA 4DP5X 1IBGL 2Y7QB 4F2MA 3SUTA 4A22A 5AYYA 4Q0XL 4I5UA 4M6PA 3QRLA 1QLEH 4XMVA 1YMHB 3TBWA 2YXWA 1NC4B 3VI3A 4AYEC 4WZHA 5CJNA 4GZEA 4TS6A 3MNVB 3NFNB 4PU2A 2A9DA 1TR9A 3QI9D 5DMIL 2ATSA 4PRIB 4X5XA 5EN3A 4F2TA 4GO9A 4N5EC 1SHXA 1WRFA 3GS7A 1JZHA 2JMRA 1OD8A 3WQFA 1FZJB 1PVHA 1MHCA 2D03H 4D9LH 2VDPB 4MXVE 2ENPA 2PCEA 5AKQA 5C6MA 3KGSA 1OK6A 3KLHC 1CYXA 3UDWC 4E42A 2BGNE 3VVWA 4XTRC 2PLCA 4FNRA 3CK0L 4AW4A 1XYAA 2GI7A 2YYUA 4EXQA 2NY0D 2ARJA 3I50H 4RMVA 1S39A 1UH2A 1TREA 4IQJA 3T3PF 1A7BA 1SM9A 4CQBA 1W8EA 3MLRL 3T4AB 1W5PA 3BVDB 2OQHA 4KK6C 1EGMA 3B8IA 1SPDA 4P57A 5C0EA 3HQ1A 2B9BA 4IX2A 4I48A 1H62A 4Z0SA 2KL6A 3ARGD 3JVGA 5EO1A 1D3HA 1EC8A 5JMRA 3CZGA 1Q6LA 3H56A 5E70A 1IBDA 1UASA 4FC3E 4B9KC 5FHBL 3MA7B 3FU5A 3MV7E 4F7TB 1E4KA 4PULA 3TJIA 3OF6D 4GWEA 2YD0A 3QIWD 2Y72A 4MD0A 1PTGA 1XTLA 1I7RB 3OF6A 2BVDA 2VN3A 4RKAA 1HOCA 5D7KD 2QXWA 4MLRA 2FGBA 1KD0A 4IP5A 3M1OA 1QBLH 3W07A 1SSGA 1MJ8L 1NGWB 3NRPA 1TWIA 2A2IA 4Y2DD 2PMZA 4K3JH 2DLFH 2VDML 1QI0A 3N9SA 5K9CA 3S5ZA 2FBRA 2VDNL 1S7WA 3K2IA 5I1JH 1FP9A 1YRRA 3NCOA 3PAVA 4C6JA 3D8MA 3NOIA 1T04B 5AVVB 5D7LD 3VNDA 1KIQA 4HWNA 3HNTH 1BIIA 3AAMA 4W6YB 5AOKA 2QLYA 4P06A 3UACA 1PKYA 3MUHL 4AZ8B 1XP3A 4JN6A 5EZIL 4JR5A 2ATKA 3JWNG 4KHTL 5F9DC 2DWDA 4E0RB 5I06A 3A3WA 3WH9A 3SEPA 3GMOB 1A64A 5M7QA 1BD2B 3GG8A 2Y06H 1EXUA 2NXZD 1MRAA 3DGBA 4KEZA 3CDYA 4KPLA 3VXME 1I8LC 3BP4B 3OKMB 4H88L 4JBSA 5HVHB 1XAKA 3N25A 4HTBA 1KIPA 5HYSG 1BW8A 2PPFA 5ESAA 5D2LF 3EO0A 4BUGA 4XBPA 2F8IA 2OYMA 5G1YA 1FWIC 2MCPL 1XBYA 5FL0A 2A5UA 4D6DA 3K13A 2WQWA 1OY3B 2QKIB 3CH1B 3NIDF 4P2OC 4RNRB 2FVNA 1XF4B 4FXKC 2ADIA 4C6QA 4DK6A 1PJWA 3FK3A 1TKWB 2BBFA 3P9LA 5JPMB 5F4SA 3S3GA 1UWGH 5T3XL 3SE9H 1HH9A 4Z95H 4UAHA 1LUCA 5FGCE 1ZLWK 1FZKB 2D31A 5CCKL 2XIDA 2ZP0T 3E7JA 3WFZA 1OWRM 1QOPA 2FQIA 4AD4A 1FJ1B 1JZ3A 4FXGB 3K4WA 3CMOH 1NAL1 4MPKA 5T91A 4IFRA 1KFAH 5KSVB 4UYQA 4NY2A 5ITFB 4WO4B 4XD3A 3MHGA 3AC0A 4OLZL 3M0MA 1J0ZA 4HT1L 3SDYH 5JXEC 1YY8A 3GG1A 1NCAL 4PJ7B 1Q72L 4EXBA 2WLHA 4HKXA 5LGHL 2XYCA 2DQUH 2NVDA 3KVKA 4JX5A 4XC1L 4JE4B 4YXKH 4JJOA 1T5WA 4QKXB 2Z7YA 1Z9NA 3BH8A 1LXMA 3ILPB 3I7SA 3EOBA 4G7QB 2HE5A 1CE1H 5DI8A 5DK2A 2WXGA 4J3WA 2EXYC 4EPKA 2ZWYA 1U30A 2W62A 4OFQA 3UJIH 3DFTA 5AY7A 3UPWA 3EDEA 1AS7A 1CWVA 3BN3B 3BKMH 3I3EA 5IFAL 1RK6A 5JIHA 3THAA 4Z77B 4XC3H 1CB7B 3QW9A 5CCJA 1QT1A 1LDSA 1VFUA 2XUCA 3LKQB 3U4KA 3UZEC 1WBYA 5AB2A 1O6IA 3VDHA 1R9YA 1R3KB 2X4PA 6ALDA 3FJ6A 1NEPA 1NGPH 1RMFL 4XBGA 1Q90A 5E8OB 2CKSA 4BQ5A 1V7YA 3MBEA 5SV4A 3BAEH 1FGVL 3SN0A 3WS3A 4YHYC 1ROWA 3EOTL 2FQFA 5D30A 4CEUC 3P54A 1F07A 5C09A 4ZQKB 5HVFB 4LOUD 4E9XA 4Z7NB 3UEQA 1IF2A 3GBNL 1N67A 1JGEA 4G6JL 3OMIB 4ALAL 1KXTB 1YDPB 1X9RA 3KPMB 4UOW0 4YIQA 5HVGB 3RWGB 4TQIA 3B56A 3M1ZA 1FUNA 3WS6A 4N9CA 3LCIA 2OCFD 3EOOA 4NRXA 1MFEL 4TU1A 5FDWB 4AE1A 3KBWA 4ADSA 1FWHC 4NC0B 1BYPA 5CU9A 2X5PA 1OG0A 2UY2A 1EUAA 5D2YA 1MHEA 1TO5A 2AXGA 4BQ9A 4ZPVB 1QA9A 3EGSA 3IMSA 2GYSA 1HG3A 1PKLA 2PTDA 3G24A 2Q76B 5JIMA 4ACYA 4R5VA 4UANA 4PUBH 1ROCA 1JGDB 3QULA 4JPKL 4TULL 3WXVL 4DKFH 2CLPA 1SOQA 1Z32X 2G3NA 2NCMA 2VE6B 2GK1A 3ME3A 2GW5A 1FZOB 1WXJA 3UNTA 4KK9D 2HJPA 2XV0A 1AGDB 2D7TH 4GT7A 5KBDA 3FNKA 1KBKA 3WBEA 2JCWA 1DQVA 1FNSL 2YK1L 3NJVA 2VDRL 2R9HD 2YL5A 2IGTA 5EU5A 2IMRA 5BROA 2E86A 1OPGL 4FIRA 3P8JA 4X6CB 1T2QL 3WFHA 3GAKA 2YC1A 2EPNA 3FOMB 2BXVA 1VEMA 3TYDA 2AAAA 4LLDA 1ACXA 3TBTB 4D9QE 1J5CA 3COTA 4NERA 4C7FA 1FAKT 4FXFA 3VVGA 3LGEA 3OLGA 4HKJA 4MJ5B 5CZSA 4AY7A 2ZQKA 2W0PA 5DF0A 3I9IA 1PV8A 1GJPA 4EE9A 3KWTA 2R4RH 4JANB 3CIAA 3OOQA 1QZ1A 2OXHB 3U4EB 3BP7A 5DO2D 3OX8A 2XN9D 4M5TA 2Q20A 4OJFL 2QCMA 3HPFA 3O06A 1E3ZA 4IT1A 3UZWA 3KHOA 4KRPC 4UU9A 3H4XA 3NCJL 1B4JH 4PUUA 3OHIA 4YVXA 1J5DA 3EFFB 1G5GA 2P5ED 1A47A 2XDFA 4GRWE 1KQYA 3OJDA 2OODA 2PWVA 4UYPA 5EBWB 4C55A 2PC4A 3BWUF 1JZEA 1ZEAH 2E7DA 4QXGH 3RGVA 1MCDA 3ZHKA 4N9BA 4OUIA 4YVPA 2Z00A 3RR1A 5CS7A 2YD9A 4KRUA 2A79A 5K9XA 3U57A 5TTRA 1WEJL 4JQXC 1PYMA 1UP3A 1BZQK 2Y25A 3THMH 1RIHH 3B05A 5E0KA 3OKDA 3H4WA 5A1AA 2VAAA 4EVNA 5FJIA 2XKSA 5I1AA 5H1WA 1HFBA 4NNPL 2R1YB 2VITB 1QSED 1Q6OA 2RKXA 4ZODA 1YEDA 3ZDWA 3LDVA 4BJHA 4QRPE 3V4VA 1ZENA 1XF3B 5IHLB 4B91A 3C3UA 3FO0H 4G1EB 2IANE 3UZZA 3KPRB 3BKJL 4JR9L 2PTXA 1JNHB 1LT8A 4LS0A 1BRLB 5EO0A 1A0QH 4PVNA 1XUUA 4K36A 3CBKB 2W0UA 4BR1A 4AUJA 3R19A 1RCXB 3VXMB 2J66A 2UZ9A 3HM7A 2FYVA 3KDPB 2FJHB 2NXYD 3EH5B 4XNQB 2IANB 1IX2A 3MREA 1N59B 2F0CA 4LCSA 4ZFMA 1LEIA 3W27A 4K8RL 1ZHAA 4AY1A 1E4XL 1HHHB 2XIIA 2E75C 4I0PA 4Q0XH 3WN5B 4XVTL 3NCJH 4RDQF 3PAYA 5H4YA 4WGHA 5FJRA 4KOCA 3ID7A 5GSVB 1RPXA 2A38A 3GJFB 3UCDA 3H2AA 1DBAL 3NCXA 2W79A 4GYJA 3LB6C 4ZAKA 4DUXA 4WF7A 3P5ZA 3JUGA 4FJ6A 5D7LB 2J74A 3ENLA 2WMFA 2J79A 3NZ8A 2N1TE 1CFNA 1NZRA 3C5ZA 4CGTA 4JVUA 2JNZA 4KS0A 2QFPA 2H0JA 1IBBA 2YPLD 3HPLA 3ZXAC 4X7TA 5K59F 4Y7EA 3MSPA 2AK1L 1B90A 4HAFA 3U2ZA 2IPJA 4KRZA 4YWIA 1P2CB 3LRLA 3FGCA 5E4EB 4I7VA 5LHEA 2BSTB 1UB3A 4GW1A 3U36B 2CE6A 4ODTH 2GJJA 3WG7B 4GSDH 4NKIL 4P5UA 4XGZA 5JUVA 1UWIA 4GSQA 1B9KA 3FQNA 5KYYB 2APXA 1W3JA 1MPAL 2I5QA 4WWPA 1BXCA 1TIUA 4HUVA 5FYJL 2DTML 5JHDB 4HIBA 1WC7A 1L3WA 5DQ9B 5F2IA 1HYRC 1IBYA 3PG8A 1LK2A 3CFTA 1TPXB 1SNRA 1EJOH 3B43A 3U7AA 2OX4A 4QDPA 5LGZA 1XX1A 2QGBA 3QMTA 4QRRB 1U5HA 4D1IA 1G1OA 5LNWA 5FS5A 3CHSA 2ZF8A 1I31A 5IVZB 4JDTH 1H3VA 5K1JA 3VG0L 3WKQA 4AIZB 1T96A 3FJLA 3WKML 3UTZA 1DUYB 4WTZG 1LLWA 4Z7QF 1KY7A 3NSDA 4TQHA 4TTGA 1HTIA 1RIVH 3QR1A 4G8AC 2VXVL 3QY6A 5J3HD 2ZUSA 2W9DH 4NJ9L 4KJPD 5KSUA 2R1LA 3HQNA 1T6VN 3QARA 1YN7B 4IH3A 4DWSD 1FLRL 4Z6AT 2EDDA 1I9CB 2J8TA 1W3LA 1TZOA 4HLEA 3QH2A 5HJXA 5FDYA 1LMIA 1ZAHA 1BOYA 2YFOA 3DUSA 3EGDA 3WY3A 5ITBL 3GSNL 2C5DC 2ZKWA 3O05A 3EF7A 3NH7L 4X8CA 3TBCA 2A1WH 5D96C 2J55A 2BDNH 2MCPH 2ICEB 3QORC 2DQUL 5FX3A 4XNYL 4ENED 1U8HB 2HFEB 1BYNA 5D9SA 1TVHA 3TC3A 4M3JA 1HF6A 4BH7A 2AJZA 4JPIB 2ADGB 4ZQCA 5IJVA 4QRSA 5JPNC 3GNNA 4TVCA 5GGTH 4MX7B 3LBMA 1AQ8A 2WXLA 2XV6B 3MNWA 4X9HA 3RA7H 3FQ2A 4OIAA 3UPAA 1FWGC 2NWRA 3PZMA 4KBXA 3V5DB 5DMGD 2R0KL 4QY8A 5JOFB 1TJIH 3V35A 5CBEA 1I8LA 2A9MH 4M8UA 4Q6KA 5D7JC 1GOQA 1I3VA 1NDMA 3ILQC 1A3WA 1P43A 3L21A 4M6ML 3L0KA 5M2FX 5FLUA 1I3RB 1K6AA 2IOMA 3P40A 4LB8A 3TS8A 1MQRA 1EZVX 3NQ8A 3W86A 1JEZA 1F00I 2AAVA 1E27B 3TO4C 5HHPB 4Q97A 2XXMB 1LL4A 5H2ZA 2GIXA 3KLLA 1F90L 5GGSA 2FR4B 3I6KB 3M0VA 3E6EA 4LKXA 1SO5A 8TIMA 2A3BA 3A9BA 3VWJA 4WOZA 4D9PA 3MRCA 3SDOA 2OR7A 2OXGB 4KY1L 1AO7A 2W1NA 1N19A 4FQ2L 2MEJB 2BJMH 1OK0A 3RB5A 3ABRA 1FFTB 3FU0A 1VRXA 2VC2H 4HPGA 3GZPA 2JK5B 4UDUB 4GY0A 3F5WB 3PANA 1DQDH 4XPBL 4AZCA 4I2XA 3WLRA 2VZ1A 3LIZH 3POCA 1K4HA 2QQLH 3PQYD 3TT1H 1R3JA 4GPVA 5D1XD 5MEQA 1FQ9C 2J12B 1E0XA 2IQTA 3K6FA 2YB4A 3EEGA 4RZ6A 4G7FA 2AV7B 2IH1B 3RKDD 3NSCA 1TG8A 2D3VA 4G1MA 5EZPA 4XBJA 4EOUA 3NQBA 2NR6A 4R9HA 2NPLX 3FB8A 4ZX6A 2RB8A 3CFUA 3RTQD 1DVTA 1M1BA 4LWWA 2A77L 2PO6D 1QEWA 4Q4IA 5DA4A 1CG9B 4AQZA 1J9YA 4GRMA 2MANA 3ZE2B 2OT1A 3UWQA 5KVDE 1SUXA 3UIYA 1X38A 4QOKA 3FJTA 3CZ8A 2YN5A 4A7UA 2P48B 1IZJA 2OMYB 4DFIA 3WLKX 3QUGA 4FQCL 2IALA 4ZMVA 3VOGA 5F7LB 4H20H 1QO5A 3A4JA 1J6OA 3D05A 1F6FB 3L3IB 4PJXA 4QS6A 3K6IA 4C6BA 1NSNH 3DX6B 4MFHA 1WIOA 2BSRA 1X5JA 4HS3A 1Q13A 3PAUA 4P23B 4XPTL 4XBEH 4XX5A 3BZFA 4EKXA 3RX4A 2V9QA 2ED9A 4NNYA 3BIAX 4KTDH 5L6UA 3N43F 4F66A 4A3RA 5CWSA 4RZCA 3TX4A 3KLQA 5I30H 3H9SE 2Y89A 3CQ0A 3UFIA 1BZOA 5D9OA 5FGBA 5AW4B 3CO8A 1OZUA 1P4BL 1AG1O 2JTYA 4CVXA 2A83A 3KVDD 1A66A 1S78C 1Q9KA 2Y62A 4DWDA 1I7TB 3JUZA 2QF8A 4XAPA 2JELH 1KN4H 3D09A 5DJDB 1ZRQA 2NQ5A 1FWEC 1W1B1 2J1ZA 4P59H 1H7NA 2AQNA 3NTYA 3SY0A 3OBAA 2YXXA 4OLYH 5CBJA 5I75C 2NZ9D 2NNAB 2DKMA 2PD5A 2WIIB 3IVTA 1I2RA 2VZOA 5EU6B 1GVEA 3CM4A 1NDZA 1ZMYA 2YHGA 4CRPA 4R4BB 1VCFA 1SXBA 2XWXA 3MBWB 3B2UC 3UY7A 4JZ5A 4HXBH 4JPSA 1DYZA 1CD9B 3ZDZB 2VR7A 5SWSB 1NFDE 2UWEF 1GMIA 3FBKA 1DUZB 3FTWA 4ATWA 1JCJA 1BQKA 1PYFA 4WR3A 2PPEA 3PNRB 3FQRB 4H40A 1O12A 3VXSD 1JF1B 3QNFA 5EB9A 2X8RA 4CN1A 1FH8A 4O0ZA 1O4UA 3O3BB 3KP1A 2X7VA 4KFPA 4XN1A 3QQ3B 2I56A 1GVRA 4HGWB 1OK4A 1P7TB 3WTTA 2ZRZA 1EVUA 3SGDH 1R47A 5F1UA 2IQ9L 4P7QA 3ZZQA 4FFYL 1NUFA 2TSAA 3DFOA 1HWGB 1U8JA 1WGVA 3LV3A 3VXRB 3IMUA 4ACPA 3L5MA 1XSIA 4MNGB 3WIIL 2VXSL 4XNXH 3B8SA 1CD0A 2UXFA 1GL4B 4RA3A 3BV4A 3GNOA 1YJDC 3GUFA 4YMPA 1YYAA 2LFEA 1XTMA 2VW4A 5HMDA 4JGMA 4JM0A 3RPBA 1HL4A 1YQVH 2ZCHL 2HTMA 5K4XA 2E1WA 3LMJL 3QRBA 4Q6IC 1UR9A 3SN1A 3EYQC 3QDMB 3W57A 2V5JA 1K4GA 4Z3FA 3R4DA 3THUA 3APMA 3R8HA 3UR7A 3ABMB 3BGMB 4IMFA 3BT0A 4U7SA 3KRSA 5E8PA 5T1KA 3S1UA 3JU2A 1YMHA 5G2NA 5D02A 3DO3A 1MDRA 4AB4A 4AZ5A 5DN1A 2BPBA 4QQUA 4HBKA 2QSTA 5B7ZA 1YC7A 2EIDA 2OL3H 2MKLC 1GH7A 4GFIA 3IJYB 3F03K 1NEZB 1U8NA 4FL4C 3F4DA 3D51A 5A2FA 3KLAA 2V2WB 3CK0H 2J56A 4MD5A 4ICXA 3T0CA 2GUUA 3NCCB 3TZVB 5JIQA 3A3HA 3MZNA 2WP3O 2ZSVA 3HBZA 5CXPA 3VB8A 4JMNA 3L1FA 1I8IB 1EB3A 3C6LB 1ZXKA 3U7WH 5L9FA 1I7UB 5GGVY 3SCMB 3R25A 5LA1A 4YLWA 2NY2B 4TX6A 4KUZH 1M71B 2P5WD 3BAWA 1Z5HA 3GF8A 5M03A 4UQ9A 3B8DA 4PUNA 5E6IC 1AZRA 1OPOA 1QSFB 3NAAH 3BQUC 3INUL 1POJA 5HJLA 3NQDA 4HPXA 1IGIL 1GZQA 4OF8A 3FVDA 1OCRB 5IMOB 3V6BR 3UZEA 5T1LA 4F7TA 2Y88A 3WF2A 1CFQB 4KV5E 5LBVA 3QO0A 3QXVA 5FKPB 3NURA 5G2HA 3ANYA 1EEPA 2GB2A 1OP4A 3VKCA 3KGRA 4PD4K 3LPOA 4Q6YA 1HL2A 2PDLA 2Z1BA 2VW7A 4G83A 5D33A 2UZYA 2AI0L 5IOPA 2YCJA 1I9IH 1Z9SA 4LAQL 3VX1A 2J7CA 4GQRA 3R6IA 1TTAA 4IM4A 3ECBB 3QORB 2X4NB 3L08A 3R5EA 1BBDH 3PWVB 5F7KC 1PHQA 5C0CE 5EOQL 1KPRB 2WZHA 3QSKB 4PJ5A 4PEKA 1X3DA 5IW1A 2DWYA 5DJ6A 1MFDL 4EN3A 4HNCA 2KLRA 4MY1A 1BVLA 1L7IL 3JQOB 1LLZA 2J8UF 6TIMA 1NKRA 4GMSH 3PZGA 4KDVA 2IKHA 1YN6B 2H32H 3IFPB 3GIZL 3UJJH 2CBMA 2DEYX 3CPLA 4RAUA 1BA9A 1YDYA 1MCBA 1N7MH 2I9UA 1CUOA 4O5LH 3ZR6A 4PLKD 5CMAB 3VQMA 4BFJA 4PWKA 4FQXA 4E68A 1IEAA 4HVBA 3N2TA 3BVNA 1A4KA 4TNVK 4AU0A 4KEUA 3FXGA 2VXVH 4E38A 2WLKA 2Z2BA 5IHZB 4NN6C 1FNGA 1D9EA 1MZRA 3BP4A 1Q94A 3KH4A 2PP0A 4D0DB 4HNOA 3QR0A 1UC6A 2Q8BL 2RBLA 4Y16D 4PLJC 4DCQA 1AZNA 4G8FB 5B8CC 5IROD 1AJZA 4MTMA 3NM3A 3R79A 4R7VA 4NSBA 8A3HA 4FHAA 4DERA 4NAMA 1NPJA 4WDIA 5MEND 3PDOB 1XRSA 4IIDA 4XZWA 3TSDA 1TQSA 3S98A 1A3RH 3FAXA 3MLSL 4KKBC 3F4VA 1RZ8A 1AZVA 4HJFA 5T26A 2HFGH 3TTOA 4I18C 5GGQL 3DLQR 3QAQA 4WKZA 2CH8A 4P2RB 2HT2C 1Q6DA 3RG1C 5C07B 1O7VA 5E9DA 3NMEA 3V4PL 3X17A 4I0CC 2Y9RT 3FT4B 2OTWB 4QHMB 4K15A 2QGHA 3KPSE 3X1GA 1TG7A 3IGSA 1NIDA 3LHZA 4GXWA 2H6UA 1R3HB 3WJMB 4LYQA 2NYZA 2YK1H 3TBWB 1XLCA 3AXKA 5BWAA 1S8DB 3UFYA 2CLVB 4IDLA 2W4XA 3W7NA 3N3MA 3QXAB 4JHAL 4ZNEE 1EJTC 2YDRA 1LM8V 4PJIF 4PJ7A 4UTCA 4FTVB 1WFOA 5GHWH 1EC9A 3LCHA 3TMLA 1YEHL 5AYQA 1WDSA 2WJEA 5BRQA 5A5WA 1JNJA 1R3YA 1JZ6A 5LXGH 2CWXA 1E5UI 4F7PA 4JYDA 1XYMA 1UWXK 4H6QA 1NJ9A 4HT3A 1FYTD 1OB0A 2B3IA 2OJEB 1J0KA 4MA1C 1G9MC 4HJJL 3MMEA 4N5ED 4PSRA 3W76A 2YD2A 2XN1A 3FFOA 1IAKB 1GA2A 3IJ8A 1WBXA 4X80L 3P0VL 3FSVA 1PE1A 4XX1E 1REQB 4M7JL 4E4FA 2DQXA 3BUYB 3T4AA 1F11B 4L4PA 4WU7B 3AWGA 3JWOL 4X6BA 1UCWA 1SJVA 3LRHA 3HN8A 4H7CA 4NRZB 3FA5A 3FEMA 2O6EA 3GBMH 5I71C 2Q8LA 3T08A 1GOKA 4NHCL 1OYBA 1GGUA 2WK2A 2APSA 4HPNA 3OAWA 4W84A 3F2BA 5M3WA 5KSBE 3ABSA 5EUOF 4Z1PA 5AAPA 3H2NA 3IJLA 3NQ7A 5HGBA 4HMEA 4DK3A 1JZ8A 1UWEL 4HJEA 1IM3A 1JGUH 3FTGB 4YHIA 4EACA 1NCTA 4WWNA 3TIEA 4I7WA 3KAAA 4WFGE 4NO3A 5AW7B 1OF2B 3KPMA 5FWRA 5GRJH 2YEZB 3DYPA 1ZTVA 3ASOB 4M5PA 3L68A 1N55A 4FQQB 1IQ8A 4R7JA 2XBTA 5HK4A 4MXQD 4Q3MA 1T1ZB 2C9XA 1E70M 5FOOA 1AGFA 2BJML 1TQJA 4ES9A 2OKOA 4HFUH 4OAWB 3KBSA 3SCPA 3GVQA 4AZBA 2TAAA 3WTUA 3IMRA 1M41A 4GINA 2VM8A 4GKZB 4Z1AA 2KC0A 3L5XL 4OCWH 4A6YL 4FX6M 3TWCL 5BV7B 1JPSL 5CN3A 2XU9A 1XIEA 2D3JA 3ILEA 1GGBH 4JTEA 2H8PA 2WSPA 4KV5F 2DB8A 5D72L 2UY4A 5DGQA 4HGXA 1VFHA 4JX6A 3W0WE 4ZQMA 4K3DH 1NELA 2XZQH 3GKWL 3IDNA 4XXWA 3LY6A 3ZPDA 1UWXH 4KRPB 3KBFA 4NYLB 1Q5MA 4QHRA 1S7SB 2FDBP 2H32A 2MIZA 3MX0A 4HWBH 4R7NA 2DQGL 3T2LA 3WUZA 1JP5A 1FG2A 5AYTA 2ZX9A 2X0SA 4QOKD 2O4QA 1RZQA 5TFSL 4ZXBB 2RHGA 3FUFA 1I8JA 2OQLA 3K5SA 3WUWG 4NHVA 1JWUB 3E6FB 2F1EA 5BXPA 2HISA 2W9EL 2E5CA 4ZFOB 4QX4A 4NKMB 2R4RL 3E02A 1FE8L 3VYOA 4I77H 5TQ2H 4TV6A 3K71B 2Z31C 4US6A 3W02A 1FWWA 1U92A 1NSNL 3QIBC 4FQIL 1XXFC 5DVOA 3MBXH 3RVVD 2WWDA 4KPHL 1V0LA 1IM9A 3NZSA 4PTNA 1MVFA 2OTPA 3MV9A 2XJKA 5DS8A 1EFZA 2DVUA 3RNQB 1M1SA 3FJNA 1DSWA 1CFMA 3TWCH 4M7LL 1Y0LA 2SFPA 2RUSA 3FH8A 3GH7A 1KLZA 1EDQA 4XCYA 5IKCA 1RI8A 1ZTXH 1E0TA 4Q8OA 3FZUD 4Y7MA 4XIMA 3EUUA 3RIAF 5KSVA 3OIXA 4N42A 3ZJKA 1TT6A 3VGHA 4WUIA 3H7BB 3P3SA 3EOLA 3M0LA 3PP7A 4ZPTB 2ZVRA 4X50A 1OL0A 1GOXA 2B4GA 3CAVA 3GUWA 3ZJ6A 3QFJE 3AG2B 2BSDA 3MRPA 1EEZB 4A2LA 1ZY9A 3BMWA 4HGMA 5JVLA 4J8RB 2X9ZA 4BGDA 5HDRA 1SPQA 4G1EA 4YHOL 1CZ8L 2XH2A 3HB9A 4IX0A 3DIPA 5EBLB 2P5WA 4B0MM 4PMUA 1FA4A 2O55A 3K4DA 3ULVL 3VWKA 1UZHA 4QYOA 1OGSA 2QIIA 4U1MB 5ESVA 3MREB 2UBPC 1E0OB 1T0OA 3SJVB 2CO7B 3BEWA 1W1IE 4QF1A 3T2PA 1L9QA 4Y0GA 1WE5A 1YNLL 1BJ1J 3GMLA 5GGUA 1F5ZA 1US2A 3DCPA 2F2HA 3MNVA 2YRLA 3KHJA 1GUVA 4JFDD 3MUIA 2NXZB 2F6AA 3HLAB 4DAGL 3BK0A 5AYBA 4JIEA 4RDBA 1KNOA 1UKSA 2M1KA 1S3HA 2GPZA 2HKFL 2DTSA 2RMNA 4TL5A 2J9YA 1J1PL 3PVFA 1MHCB 3DETD 1QO3B 3QUKA 2A6KA 5I15H 3G6MA 3DNKA 4LKCA 1MXSA 1YIXA 3RVXD 5I1DA 3LN3A 2L3BA 2DZTA 2PDKA 2PE4A 2AXHA 2Q7AA 4CMMA 4W9JC 1HEJC 1ZNNA 2B0SL 3MS8A 4ELMF 5B22A 4J3OG 4G6AC 1H1ZA 1XC6A 4EDXA 2GDUA 4NAEA 1UWYA 1DQTA 2OI9C 5T5NF 2J77A 4PMVA 3B2MA 1X1NA 4PUEA 3U7BA 3G08A 2NX1A 2E46A 1MQKL 1YUKB 1TMCB 4P57B 1XDMA 2WMIB 4XVUD 1CFVH 4NC2B 3V79C 1J1XH 1IFHL 4DJEA 3BRDA 4BK5C 3MCLL 4RW3A 1U8IA 2ZAIA 3TN6A 4LNVA 3QVQA 2I16A 5IQ7L 1IAOA 1NCIA 4XE0A 4KKLD 4Y2NA 3MGOB 4WHBA 3D87B 4CBZA 3ULAB 1XFBA 1RFDH 2GC7C 3M17A 5DQ9A 4U3CA 3HB3B 3R10A 2A0NA 2R8SL 3BUBA 4HV8A 3TF7C 4N2LA 2QADB 5F1IB 2YC1B 2AJSH 5HJDA 2UUDH 4QAIA 5I03A 1ZV9A 5FM5O 4A39A 1GZPA 2FT7A 3C0SA 3EWCA 1DORA 4NNCA 5A8MA 1ILUA 1LQBC 3LQZA 4M1GL 4B3EA 3P4NA 3INOA 3DXIA 4ZFOL 2ZNWA 4O2EA 4JHOA 1G6CA 1FO0H 3MFFA 4DGVH 1C8PA 1C1EH 1IT8A 4PWEA 5JHLH 3LY0A 3D69B 5DHVB 1JMZA 4S1DC 3GIZH 5FF6B 5ICXA 4U0RB 1RZFH 4HC1L 4R84A 1MEWA 1S2TA 3SQOH 3VXUD 3V6OA 1E9PA 5LO7A 3SPHA 3JYCA 5EZIH 5FHBH 1M2VB 4DP2X 3M7WA 2Z25A 3OJDB 4YSEA 3EZJB 3K4ZA 5FGBC 2CYGA 5D38A 3QI9B 5I1EH 4YX2L 4YYFA 1G9HA 3QQDB 3NCMA 1I3UA 1PDKB 1OANA 2ZZUT 4WI6A 3IDUA 1XFCA 4IHCA 3W0WA 5GS1A 5IFHH 1GVYA 1OFRA 3AQUA 5KYXA 1Q3NA 2DQHH 4YBLC 5B1JA 5E1AB 1TTFA 1CGVA 4IPJA 4PUKA 4DZHA 2ADGA 5I3IA 2HFGL 3PPSA 4Q89A 3V4VB 4U1HA 1WGOA 2CDEA 2HG0A 4YSSA 4Z0XB 5EPDA 1RJZB 2G75B 4C6FA 5IJKA 2BVOB 3LZFL 1UKPA 4HU8A 3DMMD 3V0HA 1WUNT 3W84A 3R12A 3R0KA 4NUGH 4G6KL 4DQAA 3HS0C 4M3PA 3C5JA 1SYVB 5J8OA 1UM4L 2J75A 4GIAA 2A3TA 3VXTB 4AG4H 2IPKA 2O1AA 5H37G 3TONA 3USZA 1DJHA 4IM8A 4YHLL 1PZ5B 3W7LA 3KHQA 2Y5EA 4FULA 1T3FA 3BUVA 3CUGA 4UTTA 2PW2B 4JO4L 5EWIL 2DV0A 2R91A 2ZA1A 4PJDF 4RLIA 4JDVB 4RWYH 2A5HA 2WMGA 4HSHA 3WK0A 4MVBC 3EDKA 2PYFA 2OZ4A 4K3ZA 4P7NA 4DJFA 1SVZA 1JI1A 2AXFA 1IU1A 2DMGA 2R69L 4W9FC 5EZOH 3V95A 5ID1A 2BVUA 5IBTL 5HHOE 4E9QA 2Q10A 2R6OA 2VR4A 4UDUA 3RTQC 2DQMA 3L9CA 3KPQB 3EMZA 3V6FB 4FN0A 3T77B 2VENA 1DCLA 1JUFB 1O6TA 4EUPH 2VDQB 3HU7A 4FCAA 2EADA 2P5EE 4RMTA 5EEUA 3U4BH 4QTIH 4KTEL 2Z35B 1FHGA 4YDKL 4FQPA 1EC7A 2EH7L 2FK9A 3BZ4A 2VX4A 3IDMB 2C1PA 2A9NH 2VSKB 4IGBB 5C09E 5DC2A 4Y16B 4RZBA 4AF0B 4BM7A 4XBGB 1VEPA 2HPOA 4YXGA 3ZLHA 5C9UA 1B0GB 2IFGA 3QJHA 4O4YH 3CLEL 1K3ZA 3FQNB 4MFDA 3GNXA 4IBUA 5HHMB 5HI5D 4YN3A 2B1OA 2E9BA 1Z48A 4S3KA 3T44A 1AR2A 1EJ6A 2WWNA 1JERA 3N9GL 4A7QA 3IUIA 3WDPP 1D2KA 3IFNL 1IBFA 4DVRH 8PAZA 4ZXBC 1IC4L 1NIBA 1BF8A 3K6SB 1E9LA 1QTWA 2X3BA 2RAMA 3H6AA 5AOMA 3NP3A 3P2VA 2HLEB 5ABDE 5BZWA 1I9JH 4NO2A 4ANXA 4M62L 3FHQA 3EBAA 2OMVA 5KOVC 3LI0A 5KVGL 3TA4D 3PL6A 1X7SA 3FQXA 2R4SH 2ARWA 1BHGA 4F92B 4PMYA 4AD3A 1WDQA 3CH9A 4YL2A 3FCSB 5I07A 3BUIA 3DEQA 2GSIA 3W23A 2DS4A 3ARYA 1EUTA 3O6LL 2PP9A 3QORD 3V7AE 5LKYA 1KACB 1EXUB 1RMFH 3WLLA 3AADB 4OCMC 4WEBL 3KYMB 5D55A 3ZVIA 3LEYH 1ZKAA 2J88A 4HP5A 4Y5XA 4N02A 3TLLA 2WBWB 4U6TA 4PYGA 4FD0A 4LIQH 3GNRA 4L9ZA 4QM1A 2PLJA 3L9RB 4FFZA 5HDBF 1ICTA 5FCUH 4N0UA 4RGNC 3C2AL 3SDAB 2MNJB 2Y8KA 4GO8A 4CEXC 2VFFA 1PKQB 3TBTA 1XLHA 1UFUA 2X2YA 1AFVH 4KJPC 3PJSB 5BRZD 5HD8C 3PZ9A 3DOHA 1G84A 3L9YA 5F6IC 2UV3A 1EZ2A 4HUKB 1UENA 1L2QA 2RGLA 3QEQD 4I0KA 4NJAH 3TBYB 4JFFA 1SLVA 4ICCX 2VRKA 1ZAGA 3I85A 4UMGA 5JIPA 5K1NA 5HHQA 1VJZA 2CLKA 3RO6A 1SDDA 3O3BA 5J13B 2ZWLT 1RPQA 1ISZA 4P3CH 1UEYA 2BFVH 4H8WH 1BBJB 1K72A 4JFQB 4D0CB 2XZ9A 1FCCA 3DETC 2QUMA 2REQA 3TQ0A 5DBTA 4MHHI 3TP4A 5H35B 4TMPA 1RL1A 4Z7VB 5TFSH 3RAOA 3TTEA 3HFML 4DELA 4GIOA 3HAEA 3UTSD 3V10A 3V0EA 2L04A 5JR1L 3KYNB 2EDEA 1T0NB 1MUWA 2WKJA 4N6QA 4N22A 1NAKL 1SBSL 1UWFA 2XY1A 4PHZA 3TV8A 4AD2A 4J9JA 3T9WA 4NF7A 4IRZH 3SDCC 4XD6A 3PBGA 1QSFD 3VXUB 3ASNB 3C2AH 4LKXB 5LXEA 4LSDA 2PCFB 4IS6A 3GC2A 5G4MA 3GTFA 1HTYA 4WJEA 4X9SA 1HWWA 5FC9A 3MROB 4JRXD 2MKWA 3RDTA 3SCMC 1XBVA 2O26U 4NNAA 1W0WB 3A4XA 2A6JA 2J7GA 5TJWK 2Y1YA 2P0OA 3BJFA 1JCMP 4AF0A 2WC7A 1L5GB 4DO5A 1Z66A 3AUVA 3HRZA 4K07A 3NK3A 2QHRL 5JW4R 5D8ZA 1FH7A 1Z69A 4Q4KA 1ZHNA 3L2LA 4TUUA 4BYHA 4BBWA 1SJMA 4JPQA 4FLRA 3A13A 3PWLA 1S7QB 3NQAA 4MNJA 3QHTC 1LG2A 4Y5YA 4GJTB 4M4RB 3FO1B 1U2YA 5GGVL 3T71A 4GG6B 3I4EA 2YPIA 4FS0A 5FYKD 1YEFL 2VIRA 3PGDB 1A4LA 1A9BB 1XC4A 2CQVA 4OF7A 1P1ZB 4MZRA 2AKRA 3C6LA 1RZJC 3LQLA 3PHQA 4FB7A 4KETA 2YPVA 1OWQA 3QEQA 3M7FB 2MOQA 1QA9B 3EGSB 4N0CC 8RUCA 2FPYA 1Z3GH 5GGQH 1OP5H 4L2LA 2LTQC 5BXSA 3N3TA 2QQKH 1K8IB 2H9GB 4MJIB 5I8KH 4FTDA 3JS3A 4BZ1L 4Z76A 3TYEA 1IAMA 3KLSA 1QI3A 1BV8A 3Q9PA 4JO2L 2A74C 1CN4A 1XCTB 2BNQA 4G6FB 4AENA 5T1LB 2R1MA 3GFZA 3EG9B 1X5AA 5G2IA 3L3JB 4C56E 1RUMH 1PLGH 2ZBTA 3PZUA 1WFUA 3CSYA 2C16A 1HYSC 4KI1A 5GJTL 1GPFA 5REQB 7ENLA 5L8KB 1IM3D 2F7QA 4NZTL 3S34L 4C56B 4AD1A 2DRUA 3L7EA 1I7TA 1X9LA 5L2KE 2YAFA 4JB9L 4PRBB 4RDYA 1YJDH 4QHKJ 1OSZB 5IQ9A 2WYZA 1XCFA 1WA2X 1CXEA 4I5BB 4NZUH 1JPIA 1RCYA 4Z2HA 3D5OF 2B08A 2P49B 2WYTA 3R0UA 4K8RC 3U4EA 3CFEA 2E67A 2QDGA 4QRRA 1WZ1H 3FTUA 4KKPA 2Z7KA 1L0XA 3OBEA 1P5UA 4UTUA 1PEWA 4P5MB 4JQIH 1HXMA 4FAAB 1TYJA 1UZGA 1QWNA 3FAWA 3LSBA 1WSST 5BRZB 3ZGHA 1C5DA 2I5GA 3FB6A 1A4KB 2XZAL 5AN7A 1GAFL 1Q8MA 4HSQA 4F58H 1M9HA 2X05A 1LE5B 1CXIA 5CSZA 3OZPA 4IEFB 4GRWH 3DGDA 4L9LA 1EFXD 2BIIA 2AJYL 1KV5A 1O60A 5AUMB 3MRLB 3VCRA 4Y9CA 5KVDH 2Q5BA 2RH0A 1YPZE 5AB9A 5E08L 1HK6A 3D3AA 3H3KA 3ZKNC 5EMJA 4Y9GA 2P0IA 3URQA 2B7DT 3VI4A 1NWPA 5LA2A 3L5AA 2IDQA 4PWGA 1XX9C 1R30A 3LS9A 3QB7C 3TYAA 2DQHL 1KFWA 4UIOA 1ZV2A 2DQTL 3KYKH 5D1XB 1FZMA 1KRCC 4JZJC 3LMZA 2MPAH 2J27A 2DDQH 5FO2A 1A0CA 4D6JA 3RFAA 4CGUB 4PTUA 4WHTA 3MC5A 4UR7A 2CCVA 1U3HC 1O9WA 4NWUL 5L2JB 4NP7A 3I2CH 1A5SA 2Z7UA 3W7CA 3E0WA 4WGKA 1OGTB 4YUEL 5DVMA 5C7XL 1NVMA 1DZBA 1QK2A 3E2SA 2GQAA 3IGLA 3OR7A 3TUUA 4NQVB 4ZMQA 5AC8A 4ZE5A 1JK9A 2VKXA 2G3JA 3T2QA 2V4LA 4PJAB 5K93A 2ALDA 3IPFA 2SODB 1WAWA 3SUSA 2GL5A 1EERB 3HC3L 4WFHE 4DP9X 3QY8A 4LSPH 4Q8NA 4QSHA 5HMFA 3LEVH 5B39G 6CGTA 1X9QA 4G8GD 1HHJA 4TVPH 4U1IA 4TOQA 5H37H 2A3HA 1GYMA 1UTDA 4H41A 1TSIA 4MZ1A 1KXTA 1YDPA 2W9MA 5F3FA 1IEVA 1Y65A 2POZA 3UMNA 2E9JA 1I9EA 2OJEA 1UQZA 1EAPB 4GISA 1T20A 3IRPX 5F89A 4TQEH 4ZMGA 5SWQB 5DTFB 3WFBH 4PJBA 4CCZA 3WF3A 2XSAA 4RMWA 2HH0H 4F0LA 4GUGA 1G4SA 3O6MH 2MFNA 2FGWH 2R56L 1QPOA 3NSYA 2YPVH 3D0VA 1F0LA 1OK8A 2GG1A 2XETA 5DO2C 1IIGA 1PBYA 5FO7A 2VOTA 3HAEH 4QOKE 4XMLL 1LEGB 1CK0L 1BVNT 2VXSH 2A0LC 4XNXL 4R7DA 3RL1B 1T99A 4MD0B 1Q9OB 1I7RA 4H2HA 1ZA3A 3ABXA 1DSYA 6ENLA 4N68A 4RWYL 4PY8I 3MLUH 5GS0D 4PW4A 1S9VA 2J8UE 3FQWB 1NGWA 4PP1C 2YD6A 3AZSA 3IJIA 4AK2A 2WCPA 1QOQA 3CLFH 1DVQA 5FGRA 3O41A 2OLHA 1X44A 3ORJA 5KVGE 3ZHDA 3HNVH 1TSRA 4E9SA 1RJCA 1WV7T 2NSMA 3MNMA 3NJJA 4OAWA 3ZU8A 3IDJB 4C5ZA 5DQDH 1UJ3B 2PP7