5A2CA

Crystal structure of anoxybacillus alpha-amylase provides insights into a new glycosyl hydrolase subclass
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
450
structure length
450
Chain Sequence
b'ERTWQDERIYFIMVDRFNNGNPKNDYEVDVHDPKAYHGGDLQGIIDKLDYIKEMGFTAIWLTPIFANEKGGYHGYWIEDFYKVEEHFGTLDDFKRLVKEAHKRDMKVILDFVVNHTGYNHPWLNDPAKKDWFHEKKDIFNWANQQEVENGWLFGLPDLAQENPEVKTYLFDVAKWWIQETDIDGYRLDTVKHVPKWFWDEFAKEVKSVKQDFFLLGEVWHDDPRYVAEYGKHGIDALIDFPFYKEASTIFSNVDQSLEPLYNVWKRNVAFYERPYLLGTFLDNHDTVRFTRLALQNRINPVTRLKLGLTYLFSAPGIPIMYYGTEIALDGGEDPDNRRLMNFRTDKELIDYVTKLGELRAKLPSLRRGDFELLYEKDGMALFKRTYEKETTVIAINNTSKTQKVTLDGELEQGKELRGLLAGDLVRSKDGKYDIILDRETAEIYVLAPKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE
publication title Crystal Structure of Anoxybacillus Alpha-Amylase Provides Insights Into Maltose Binding of a New Glycosyl Hydrolase Subclass.
pubmed doi rcsb
source organism Anoxybacillus sp.
molecule tags Hydrolase
total genus 169
structure length 450
sequence length 450
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5a2cA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5a2cA01
3ZJ8A 2WVUA 1HJUA 3I3EA 5D8WA 2WMGA 2BY0A 4LQ1A 3AHTA 2OLHA 3SUSA 3AROA 3ZIZA 2ZXAA 1B90A 2ZX7A 3NSNA 4QP0A 2WC3A 3EDDA 5FL1A 5I77A 4J28A 1ITXA 1VJSA 1C7SA 3BH4A 3SCQA 1GJUA 4N0RA 3MU7A 2WC4A 3VKKA 1ZJAA 1E15A 2FGZA 3AMDA 3W0KA 1NARA 1EQPA 1V6YA 1EHAA 4J3UA 2J7DA 5KZ6A 2DSWA 1PZ3A 1XD0A 5AYBA 1DWAM 1IZKA 2YL5A 1XCXA 3SCRA 3ZJ7A 2JF7A 3MUZ1 1CXKA 5HPCA 1E43A 3GXNA 3AS2A 2XSAA 1E0WA 2Y8KA 4BF7A 3ZT5A 1L8NA 3ZSSA 4LYPA 4H8HA 2IXUA 3MMUA 3SCWA 5A6LA 1V3HA 1KR1A 4W93A 2OYKA 4IISA 1TUXA 1SR0A 2CHNA 3WD2A 5IFTA 2XWEA 4MNKA 1FP8A 1QHPA 3RO8A 3MSDA 2GJXA 3BSHA 4FMVA 4DM1A 3W4RA 1UR0A 3U5UA 4KMQA 4LXFA 4AD5A 1OT2A 1VAHA 1OSEA 2YDSA 1DWHM 2ZUMA 2VO5A 3QHOA 3FNDA 4KWUA 1Q6GA 3ARRA 2RGLA 4TVDA 2GSJA 1ODUA 1J01A 3PZGA 4X9YA 2CBUA 4JL1A 4OOUA 2DT3A 1EHNA 3VM7A 4FLOA 3J7HA 2DPEA 2F7QA 3ZR6A 4NI3A 1JZ3A 3T2PA 2GUYA 3VGHA 3WDJA 1MW0A 1UA3A 4IPNB 1GOMA 1D2KA 2DT1A 4UR9A 4M8UA 2XGBA 3HJEA 4AEEA 3CIVA 5E1QA 4PYSA 2BNJA 4AIEA 1TFVA 1FFQA 3AIBA 5CLWA 2WCSA 4NZJA 2CBVA 2WKGA 2FH6A 4FK9A 9CGTA 3WNNA 1GCYA 4TXEA 1TQUA 3CUIA 1E6NA 1OB0A 4YHGA 4B15A 3VO0A 2E3ZA 4CU8A 4HPHA 4ATDA 1LWJA 3UCQA 1PJ9A 3AHXA 4W85A 5ABFA 1JZ8A 3WELA 1ZBKA 4W7UA 2ZX5A 3ZO9A 3TOPA 3FXYA 5JBFA 3LRMA 1MVYA 5JBDA 2YJQA 3K8LA 4K68A 8CGTA 4YN5A 4DO5A 3K4AA 4J3XA 1OD0A 4B3KA 1W2PA 2XVNA 3LPGA 4JCMA 1E5NA 3OG2A 2VMFA 1WPCA 4YHEA 5EBAA 1PS3A 1KGXA 1GNXA 1E72M 2CESA 4JFSA 1RP8A 2OSYA 1E6XM 4J27A 3D51A 2D0GA 1CGWA 2DDXA 1B2YA 4XUYA 2XVKA 3CUHA 1QI3A 4OOZA 4UFKA 2BHZA 2G3IA 3WNLA 3EDFA 3VIHA 1ZB5A 4GQQA 1KR0A 1UH4A 4F8XA 1PIGA 1BHGA 1JZ4A 3K4DA 1H5VA 2WHLA 3OLEA 2GVYA 1BGAA 4W8AA 3RPMA 1CGVA 2B31A 1UYQA 2BVTA 3CGTA 4OGZA 3DX4A 1R87A 2CCRA 4CVUA 1JI1A 2WVVB 2VZOA 4WJXA 2ZUNA 5A8MA 4AZCB 4UOQA 3NDYA 4ATWA 4H2CA 4F9JA 4U2ZA 5M5DA 2DH2A 3SCNA 2CXGA 5A2CA 3PN8A 1FOBA 4MAZA 5A95A 3AICA 2PI6A 3GNOA 4HA4A 4LYRA 2A3BA 1PAMA 1UKSA 4FLRA 1W3HA 1JYNA 2XM1A 3FN9A 3WY2A 1HJQA 2C7FA 3U7BA 2ZX6A 3UETA 1OIMA 4PN2A 3U7VA 1UWIA 3NSXA 2W62A 3VM5A 3ZSTA 3B9EA 4PCTA 1BAGA 3WF1A 2WBKA 1R46A 1E6SM 3ZMRA 4CVWA 5CG0A 3LMYA 1HKIA 2XN2A 3AHVA 3SUTA 4HZ6A 2GJRA 3CBWA 3H53A 5BRQA 2XJ7A 1PZ2A 3VGEA 4GI6A 4PMNA 1IZJA 4URIA 1R75A 4W89A 4XV0A 3HG5A 1C92A 1E4IA 1W1YA 2PWEA 7CGTA 1JFXA 1GQJA 5I3DA 2BY2A 2HISA 5JIPA 1JAKA 2QMJA 3OZOA 4BQ4A 5A2AA 1I1WA 1E4MM 4CN1A 2O9OA 4UQ9A 3N04A 4J3VA 2WSKA 6A3HA 4TVCA 4CN4A 3VMOA 6CGTA 4HOWA 1TA3A 4U31A 3K1DA 4HZ7A 5I2UA 1JD9A 5E0CA 4OBRA 1MWOA 5A94A 4P7NA 4BZYA 5C70A 4PMYA 2VCCA 3WQWA 2CERA 3GH7A 3VMNA 4CD4A 4J3WA 2JF6A 1ISYA 5FL0A 4GINA 2FHCA 4P7OA 2D1ZA 1Z32X 3TTYA 3W25A 1HVQA 1KGWA 1HTYA 2EJ1A 3WH6A 1B9ZA 4M24A 1W1VA 1QOXA 2VZVA 3D3AA 1VB9A 1TMQA 1HL9A 4S3JA 4CCCA 2PBOA 2WXDM 5I6SA 3AS3A 3GXFA 4TX8A 2VRKA 2CHOA 5E0FA 4RE2A 1Q6DA 4P8XA 4FNPA 2HVMA 1ODZA 3MO4A 4GZIA 2YDRA 5D9MA 1XH2A 4ACZA 5A6MA 2OW6A 3RM8A 1EO5A 1GOKA 4PMXA 1DEDA 3WFZA 3CZ8A 2EEXA 4CD8A 4AIOA 2F1BA 3VVGA 3L4TA 5E9AA 1W91A 5HNNA 3D4YA 2ZUSA 4JIEA 3F5JA 2WK2A 1BG4A 5CPQA 1J0HA 1R34A 4U3CA 5FCZA 3DC0A 2PF0A 3T0DA 1OGGA 4FNTA 1XYFA 3VDHA 5DF0A 1EOKA 4M29A 4UFIA 1HJWA 3D52A 4V2XA 1C8XA 3VGGA 1E40A 2VZUA 2PWDA 3VIKA 4W7VA 2X2YA 1C7TA 4MJ4A 2EPOA 1KGUA 3HZ3A 1VEPA 4RL3A 3UR7A 3PHAA 4J3SA 4Z2HA 5CPTA 1G94A 3L4ZA 3WNKA 3AXHA 5BXSA 1Q4NX 1SYTA 1OWQA 4WKHA 1PPIA 4PMDA 1JD7A 1ISVA 2WWCA 4DWSC 2F7PA 2ZWYA 2YL6A 3HG3A 2FE0A 4AD3A 3DDGA 3S5YA 3RMEA 4MADA 4M82A 4X0NA 5BYWA 3UG4A 3AOFA 4S3KA 2EADA 1J0YA 2WYSA 3VD5A 5AY7A 4AD1A 1W32A 4U33A 1D3CA 3N11A 1CLXA 3AYRA 2X2IA 1MQPA 2UY5A 1TG7A 2OWWA 1CGTA 2J74A 1H3GA 4GI9A 1JL8A 3CH9A 3BVUA 1JG9A 3BAXA 3BUDA 2EACA 2CIPA 3W6LA 1UKPA 1VRXA 3L4WA 4TUFA 2ESCA 4J3TA 2XSBA 5KEZA 4FF5A 1S46A 1W9XA 1UKTA 4OJYA 4UCFA 2E0PA 3AIUA 1W1PA 2JEQA 3W28A 2AOSA 2OW7A 1E56A 4D1JA 1KWKA 4MB5A 1PX8A 5I0DA 1ZL1A 4GKLA 4LX4A 1LG2A 4M80A 2YBUA 4DUVA 3LRLA 2F7RA 3LPPA 4IPLA 1U30A 1E6RA 1HL8A 2VJXA 3CUFA 3DX2A 1V0NA 4HU8A 1C90A 2VURA 1M01A 4D6IA 2CKRA 2DSVA 1P6WA 4ZENA 4CU7A 1CENA 2NW0A 5JBEA 2Y5EA 1VEOA 3A3HA 4Z2GA 1ZBCA 3WDQA 4CU6A 3VD7A 4NZFA 3VX1A 5F7UA 5CXPA 1WB0A 1EDTA 4R27A 1BYBA 2VZSA 1UR1A 5ABGA 2IUZA 4NX0A 2J62A 4R5EA 4Z2IA 4CN6A 4KH2A 2D20A 3SUVA 4OUEA 1EDQA 1CPUA 4BQ3A 1V0LA 1H0IA 3PZNA 4QLKA 5AYIA 4OIFA 2F18A 1DWFM 4F79A 5A3HA 4Q22A 1UH2A 2J8GA 3EJSA 3A4XA 1LWHA 5A8QA 3OIHA 2J7EA 1Y7VA 2J79A 4M56A 3QHNA 3WMBA 3PZIA 1V0KA 4PMZA 5EFFA 3H54A 4AZ5A 2WKLA 2E40A 3KLLA 4M1RA 1D7FA 2BXYA 1R8LA 3NIYA 2WHMA 3DX0A 2DSUA 2EPNA 3E1F1 3QOKA 3AFBA 3DHPA 2EO7A 3D5HA 4OKDA 5TD4A 2VTFA 4GO8A 1GOIA 3N18A 3VUPA 5BROA 4UZUA 3PZTA 1ZS2A 1LL4A 4A3YA 4Z2JA 4EANA 3EJRA 3AMKA 3CTTA 3W53A 1W9UA 4PTMA 5D9PA 1VF8A 2F2HA 5A6BA 1DP0A 3WH7A 1EDGA 3PTKA 2XTKA 1W9VA 3ZT7A 2RGMA 3MUIA 4OBSA 2V5DA 2D2OA 3HMCA 2WANA 1U2YA 4PUDA 3N15A 1CIUA 5AC4A 4EE9A 4LGXA 3W24A 5A2BA 3WMCA 3LXCA 3GYCA 2QPUA 1MFVA 1TR1A 4P7LA 1UR4A 2J25A 2WCAA 2JIEA 1RD6A 3VIIA 3M07A 4GPNA 1ITCA 1EXPA 5HXMA 2WBGA 4MJ2A 1G9HA 1XC6A 4AZGA 1E6PA 2MANA 3WD0A 2G41A 2A3EA 3EMQA 2C0HA 1FA2A 1M03A 4E8CA 3I3DA 1BVNP 2CYGA 2A3AA 1UD6A 2YA1A 1OBAA 2V3EA 3ARVA 1FP9A 7A3HA 4H8UA 4BS0A 2XVPA 1WP6A 3ARQA 3RDKA 3BC9A 1J0KA 3A6OA 4TX6A 1I75A 3CZEA 4GZJA 1CGYA 4RE4A 4AWEA 4PRWA 2E4TA 5DO8A 1UWQA 5M17A 3VIJA 1UD3A 1EH9A 2XIBA 4JFUA 1BSIA 1HIZA 2WZIA 4FNRA 1WNOA 3WH9A 3GXIA 3ARYA 3AI0A 4LYQA 5BRPA 1DWJM 3CPUA 1V6WA 2WMIB 1MXGA 1QNQA 5GNYA 2XGIA 4CCDA 3A21A 4JFVA 2EPKX 1J11A 3WL0A 3BAJA 4AISA 3ZQ9A 1EO7A 3OBAA 2XYLA 4PUEA 3EJTA 5D8ZA 1CXFA 1BFNA 2G8ZA 3BXWA 2D0FA 1QI4A 1E4LA 5LYRA 4AMWA 1R86A 1N82A 3MS8A 3BMWA 3WDIA 3QOMA 3OGSA 3BUIA 3AYSA 1XRVA 2VL4A 4JHOA 3OZPA 1FFRA 4DWSB 3SCTA 4FLSA 4HMCA 1PBGA 1K9TA 2EPLX 5A1AA 2VR5A 2ZUUA 1WDPA 3WQ5A 4D6JA 5CPSA 3GXDA 2J7HA 3ECQA 2EAEA 2NSXA 3POHA 2WC7A 3N13A 1J12A 3WF2A 4UFLA 4HZ8A 4MTVA 1BG9A 4PMUA 1UR8A 1KTBA 3BAWA 4BQ2A 4PSPA 1IV8A 4AYGA 3BLPX 2ZOXA 1V0MA 3WF4A 3NSMA 1QVBA 3FHAA 1B31A 3RJYA 2BHUA 1R33A 4JZ5A 3B9DA 2A3CA 2ZUTA 3T0AA 2WMIA 3VSVA 1WDQA 5LA0A 1C93A 4OZOA 3VOCA 3AMGA 3MSGA 1B0IA 3L4XA 1F4HA 2EPMX 3AS0A 1UQYA 3WBEA 3VPLA 3BGAA 3N17A 2YBTA 3THDA 3GNRA 3WD1A 3BCDA 2X09A 4TOQA 5GPRA 2WAGA 2XFYA 1NWUA 1V08A 2IGTA 5A6AA 2WMKA 3N12A 1XD1A 4F9DA 4EKJA 2UY4A 2GJPA 1B3ZA 2JIWA 1CXIA 2WHJA 2F1AA 5EMYA 1UD5A 1H2JA 2OWCA 1GPFA 3VGBA 1TCMA 4UQDA 3GBDA 1DHKA 1PX3A 3UESA 3A5VA 4DWSA 3M46A 4BQ5A 1O7AA 2BS9A 4PMVA 4P8UA 3VDAA 3T2OA 1M53A 1NWRA 5FOOA 2XVLA 2YIHA 1FH9A 4DM2A 4PTVA 1TVNA 1WZMA 4TTUA 4HA3A 2DIEA 2WVVA 2XWDA 1W9PA 5D9NA 1V3MA 2V3FA 3PZOA 1TQVA 3POCA 1J0ZA 1WDSA 4QCFA 1EQCA 4AZCA 2XFFA 2D24A 3TTSA 1E73M 3S5ZA 1TQSA 4DO6A 3A23A 3DX3A 4FNQA 2WVSA 4AEFA 1ZBVA 1M7XA 4HMDA 4W88A 5C71A 3EDJA 2PC8A 2X8RA 2W5FA 2VR4A 3LPOA 1NP2A 2O92A 4AXNA 1KCLA 1C8QA 1QWNA 2VNCA 1UWTA 3SURA 3VINA 1VIWA 3W26A 1JXKA 1QNRA 1GORA 4KRTA 5LA2A 3WF0A 5GQBA 3OA5A 1BLIA 1YHTA 3IAQA 3MKKA 3OLIA 2BY1A 1K6AA 4P7QA 2CPUA 1GZJA 4MNJA 4N42A 4AIUA 2VVSA 1X6LA 5CZKA 4PTXA 4D6EA 5IFPA 2GK1B 1H49A 3EJPA 2DEPA 2JEPA 1JI2A 4GO9A 2ZXDA 1QI2A 3PTMA 2BHYA 4WLCA 2VCBA 2WW5A 4MDOA 1WZLA 1CEOA 1H0GA 4UOZA 4V27A 4U5IA 2XM2A 2J8FA 1E6ZA 3IK2A 2E8YA 1B3YA 1H41A 3W29A 3L2MA 1O7DC 1C91A 1AQHA 4PEEA 4QLLA 3ARSA 3EJQA 3CHEA 2VC9A 1JZ5A 3A47A 3IJ8A 1JF5A 1VFOA 2G3NA 1CTNA 1UA7A 1GOOA 4DUXA 1LLOA 3K8KA 1UZ4A 1NOWA 3AZTA 3AZRA 5EB8A 1O6IA 3ZOAA 1JFHA 3HG4A 4NRRA 1UASA 2BVDA 3FW6A 2D3NA 3WQ6A 2WNWA 2Q8XA 3WY1A 1CZ1A 3O9NA 3W6MA 8A3HA 3SUWA 1JXJA 2BVYA 1B30A 4P7RA 1E4NA 4AZ7A 4AZ6A 2W92A 3K46A 1VBRA 4FLQA 5E6ZA 2VQTA 1J10A 4D6DA 3AHZA 1RP9A 1E6QM 4ZE5A 3MV11 1NH6A 2XPKA 2XUCA 3EDEA 3CHDA 3VIGA 4AMXA 1C3FA 4DO4A 4H7VA 3BVTA 4U3AA 1KXVA 6TAAA 1BGGA 5CJ5A 3UERA 1GW1A 2BY3A 1K9DA 1X1NA 3VNZA 4PBGA 3T09A 1VFMA 4AW7A 2G3MA 3SIMA 4WF7A 4Z2KA 1DWGM 3BAIA 1HWWA 3BVXA 1LQ0A 3AXXA 4ZXOA 2XFRA 4C7FA 1CXEA 1XH1A 2VX7A 4HU0A 3ZJ6A 3FY1A 1OINA 4E4PA 1L0PA 3WNMA 1JAEA 3WEZA 3QGVA 4QAWA 2J75A 2WWDA 3AHYA 3IGUA 2ZICA 5E6YA 3CHFA 2BXZA 1F4AA 4D6CA 1SMAA 1I1XA 3G6MA 4D1IA 3HN3A 4B16A 3UG3A 1JZ7A 1OT1A 5CLTA 1EA9C 3VDCA 1KXHA 2F8QA 5IDIA 3VSTA 2QPSA 3L4UA 3BLKA 1V6XA 2G4FA 1QWUA 3N9KA 4UQCA 4MB3A 3VNYA 1US3A 1G0CA 1Q6FA 3WSUA 1PIFA 2WMJA 5HOSA 5EFDA 1CNVA 2W91A 1V02A 3T2QA 4A3HA 1CYGA 1E5JA 3D50A 1GHSA 1MXDA 1H1NA 4MNLA 4W86A 3WENA 3FAWA 3RJXA 3GTNA 1W9DM 4Y7EA 3MV01 1SZNA 2XIIA 1MFUA 1X6NA 3AJ7A 1NWTA 1BYDA 2YL9A 4D6GA 1E9LA 2CBJA 3GDBA 3SCPA 1JDAA 4NXSA 3WIJA 3PZVA 3CC1A 3BUPA 3WY3A 3NYDA 3RILA 1GQIA 4NXKA 3N1AA 2VZTA 2ALWA 3DX1A 4NSBA 1BYCA 1E3ZA 2Y4SA 3AZSA 4D72A 3WDRA 1JYVA 4GZEA 1QI5A 1ECEA 3ARXA 4AYSA 3WEOA 4AD2A 3I3BA 3VIFA 2Y2WA 3L4VA 4FNUA 2TAAA 3WUGA 1JDCA 3PZQA 5E70A 4UFMA 4PMRA 1AVAA 2FDMA 4EAMA 3KWXA 4B9ZA 1HKJA 1KFWA 3L4YA 3VSUA 1J18A 1XCWA 1E3XA 2GFTA 2QF8A 4JAWA 1GUVA 3A24A 4HP5A 2A3HA 3HU7A 4U2YA 3WY4A 2AAAA 2QHAA 3GZAA 2E9LA 1CWYA 2O9RA 1MW3A 2VOTA 4ATLA 1GQKA 4UQBA 4JKMA 4JCLA 3GH5A 1QBAA 2GJXB 2X0YA 3WN6A 3NDZA 4QDMA 3TA9A 3VIPA 5A69A 4JL2A 3LXAA 4AD4A 4C7DA 2E8ZA 5ECUA 3TTOA 3AIRA 2VCAA 3TV8A 2DIJA 4ML4A 3WD3A 2GDUA 3APGA 3B8SA 1HX0A 1ZJBA 1QBBA 4UFHA 5D9OA 3T08A 1XYZA 2F7OA 4HOZA 5DT5A 5A8OA 5ABHA 1UR2A 3ALGA 3SCVA 3GXMA 1JYWA 3BMVA 1M04A 3BUQA 2FHFA 2QMKA 4WIWA 2FYVA 1HKMA 2C8NA 4QLJA 1HN1A 2VX4A 1W3JA 3WL1A 1LF1A 2CETA 3BVWA 4WSJA 5HDRA 1EIBA 1MQQA 1QX1A 2J77A 1JDDA 1G1YA 1E55A 3T0BA 3CMGA 4W8BA 1ESWA 4HTYA 3SCSA 2YLLA 1V02E 1VFUA 3VMPA 3MMWA 5CGTA 2OYMA 1GHRA 5M03A 2VUYA 2DH3A 3DECA 4H8VA 4D71A 5BXTA 2ZIDA 3H55A 1XHGA 2D0HA 2ZUVA 3WQ8A 2ZUWA 3DYMA 5ABFB 2WMFA 1W9BM 3PBGA 2YA2A 2XN0A 3VGDA 4ZFMA 1GOWA 1AQ0A 5LA1A 3WQ4A 4EK7A 2J47A 3ARZA 3AS1A 1B1YA 5IHRA 1EGZA 2WCGA 5BXPA 3A22A 4U5KA 4ACYA 2EXOA 3KZSA 4IM4A 1VFFA 3MANA 4MB1A 1CXHA 3W27A 3JUGA 3ARWA 1JGIA 3WFLA 3KLKA 3CO4A 1KWGA 4PMQA 5D4YA 4JHZA 4GXPA 3WUEA 2W66A 3WUBA 4AZIA 1W3KA 2PB1A 3S2CA 2F61A 4JKKA 3S6TA 1BVZA 4D6FA 4HOXA 3WBAA 4FNSA 1TZ7A 2CEQA 1UD4A 4TVUA 1KBKA 4AZBA 1KXQA 3QHMA 1CLVA 1CGXA 1KB3A 4Q7NA 1UR9A 2XVGA 1QNPA 3SUUA 1UWUA 3WD4A 3CUJA 5JUVA 3CZGA 1BTCA 3ARPA 3WF3A 2X2JA 1UD2A 2AMGA 2WM0A 4MNMA 4QFUA 4KRUA 1B3VA 1OD8A 1V03A 2ZXBA 1V3KA 2EABA 3ARUA 3MI6A 4AC1X 1XH0A 1HKKA 2PWHA 4HPGA 2ZXQA 3PZMA 1XSJA 1V3JA 1JIBA 2FGLA 5DMYA 2V38A 3GM8A 2J78A 3A4WA 4ZE4A 1NP0A 2OWXA 4QCEA 1HF6A 4AY1A 3CUGA 2GDVA 1GVIA 3CZKA 3UEQA 1GVYA 1UG6A 3AQUA 4ZXLA 2XHYA 1UKQA 1GQLA 4MAVA 1OM0A 3PTQA 5ABEA 3DDFA 3EJUA 1LJYA 3GBEA 1VJZA 3NCOA 1NOFA 3ZR5A 3EDKA 3BSGA 5CSUA 2BV9A 4P8VA 1HXKA 2X2HA 3A4AA 4MPKA 1DTUA 1QI0A 1E1FA 4CGTA 1E70M 1UZ1A 3AXIA 1QNOA 2NT1A 2QLYA 5A8NA 3VDBA 4XX6A 4JFTA 1NQ6A 1ISWA 1FH8A 1QW8A 3LX9A 3OLGA 5I5RA 4YPJA 3TTQA 4W5ZA 2D73A 3U57A 1HJSA 4MB4A 4P8WA 1XSKA 3SCUA 4KGLA 3M6DA 1UHVA 4XB3A 1ISZA 2YLAA 1JZ2A 2ZWZA 1PEZA 2G3JA 2VX5A 1JZ6A 3EMCA 1HT6A 2W63A 2WB5A 4B9YA 1A3HA 5BCAA 2J4GA 2W61A 1KTCA 5A6SA 1J0IA 1GOQA 1HXJA 5AC5A 1TQWA 3WUFA 5IHSA 4RE3A 2V3DA 1UWSA 2DT2A 3W38A 1CGUA 1YQ2A 1ZBWA 4Z2LA 1TA3B 1W3LA 2J7BA 1BPLB 1WE5A 3BVVA 1UD8A 3BLBA 3WQVA 3CZSA 4XZWA 3TONA 5A6JA 2WVTA 2YFOA 1WO2A 3WEMA 1MW1A 1US2A 4PSRA 3RIKA 1RPKA 2BFGA 4M81A 3K8MA 2VRQA 3VIMA 1EOMA 1CBGA 2X0HA 1K9FA 1KQZA 1LG1A 1H4PA 5BXRA 1Q6EA 5BWFA 4V28A 3II1A 3THCA 2VX6A 4CD5A 3U5YA 1PX4A 4HMEA 3CZLA 2OYLA 1TE1A 5FKYA 2ZX9A 5IXEA 1KQYA 4J7RA 1J0JA 1W1TA 1OIFA 3AIEA 3G6LA 1WZKA 4PCSA 1UOKA 4WKFA 3VGFA 1AQMA 4ACZB 1E71M 3WH8A 1B3XA 4JKLA 3CLWA 3AMCA 2FH8A 2QV4A 7TAAA 1NWSA 2PWFA 1V6VA 3SEPA 1J9YA 1AMYA 1QHOA 4W87A 2YFNA 3QR3A 2OSXA 3VX0A 3KL0A 3WKZA 3CZJA 2JE8A 4L4OA 2O9TA 2YL8A 4XZBA 3AISA 4NF7A 4UOJA 1E0XA 3F5LA 1R85A 1WZAA 3RM9A 1SFSA 2Z1SA 3FAXA 4E8DA 2UY2A 4PMOA 4KGJA 3CMJA 3OLDA 2D3LA 2WMHA 5A6BD 1B3WA 3WMSA 4JFWA 2CBIA 4TTGA 3ZJKA 1WDRA 4BA0A 1OCQA 1U33A 1H09A 1UUQA 3UR8A 1OGSA 2X1IA 1BF2A 3AIQA 2ZE0A 4NRSA 1LL7A 4WK9A 1JYXA 3LRKA 4F66A 3FHQA 3UG5A 2UWFA 2NT0A 4GQRA 1ZU8A 4AZHA 2WZHA 2DSZA 1KXTA 3IJ7A 3TP4A 2D23A 4HA1A 1NM9A 4C7GA 3D4ZA 2UY3A 4AD0A 1GONA 3EBVA 5HBFA 3WDHA 1HVXA 4WSKA 1A47A 3BAYA 5I23A 2Y8VA 4D6HA 3VTRA 1WAWA 2EBNA 3ZM8A 5JIWA 2XG9A 3DYPA 1QW9A 3CHCA 1UH3A 5A6KA 1LL6A 3F5KA 4CD6A 1HNYA 2EQDA 4AMCA 4NZCA 2J7FA 1VENA 4GIAA 4A4AA 3CV5A 4BCEA 1FH7A 2CITA 1H11A 3VD3A 3WDPP 1G01A 2WPGA 5FIPA 3KL3A 3W37A 1MYRA 4MDPA 2XN1A 3CZNA 1FHDA 2VQUA 3MMDA 1TQTA 2DQXA 3BCFA 3DYOA 5GNXA 2GK1A 1UQZA 3AIWA 2IXVA 5GNZA 2YA0A 2J7CA 3EYPA 4X0VA 4W84A 3B9AA 4PTWA 4WKAA 3VILA 2E9BA 1JNEA 4UQAA 3MUY1 3PZ9A 2Z1KA 5FD0A 1GJWA 5DFAA 1KCKA 1QNSA 2VVNA 1DWIM 2E9MA 2VT0A 3F4VA 4W7WA 3RCNA 3VIOA 3IJ9A 1JNDA 3IANA 2WLZA 3BUBA 5CSYA 4ZEPA 1IT0A 3ALFA 2CKSA 1FHLA 3MUAA 1NOUA 2WSPA 1R7OA 3BAKA 1HP4A 1K9EA 1XSIA 4DUWA 4H41A 2V5CA 1WKYA 4CD7A 5A8PA 1XGZA 2W67A 3IAPA 2JFEX 2PBGA 3ZT6A 3O6AA 1CDGA 1BQCA 2WZEA 1JF6A 3NJ3A 4UQEA 4GI8A 1ISXA 3M7SA 3O2LA 1HJXA 3GXPA 2YKKA 3W81A 2J7GA 2X05A 3WNOA 3GXTA 3VD9A 1KBBA 3KL5A 3AMLA 1R47A 2Y24A 3AIVA 1E0VA 1HP5A 1UWRA 3LPFA 5C8BB 2OSWA 1G5AA 4UZSA 2VI0A 3GNPA 1T0OA 2YOCA 4UFJA 3VU2A 1TVPA 3OGRA 5I79A 2V3GA 1MW2A 1MQRA 3VD4A 2PWGA 3L2LA 2YDQA 4W5UA 4UNIA 3RM4A 5HPOA 1RH9A 3WH5A 1V3LA 4H04A 3ARTA 1HJVA 5DT7A 3SCOA 2JALA 5DEZA 1R7AA 4L4PA 5M3WA 3WNPA 5CGMA 2ZX8A 1XV8A 2WHKA 4IUGA 4W8LA 2VRJA 2W4XA 3DHUA 3OB8A 1BYAA 5E09A 2CNCA 1QPKA 3OGVA 4CKQA 1SMDA 4LPCA 1E1EA 4DWSD 3EMZA 4CCEA 1CECA 3PZUA 3LXBA 4UTFA 3HG2A 3GH4A 5I78A 2DGAA 4CUCA 3KEHA 5I24A 1VBUA 1V3IA 1V6UA 2D22A 3KE0A 1QHZA 2O9PA 2DSKA 1UKOA 3W82A 1Q6CA 5CQ1A 4B3LA 1WCGA 2DT0A 1VEMA 1C8YA 2WLYA 2FHBA 1W2VA 3NUKA 4E2OA 1OGBA 1CXLA
chains in the Genus database with same CATH superfamily
1TITA 3LNPA 4J39A 1BZ8A 4L61A 5DD6B 3OX8B 5IHWA 4ONHA 4FQXA 3EDDA 4JE4B 1TZGH 4N0RA 3PJUA 4RA0C 4NP9A 3LENA 4DJFD 4RZCA 4RMUA 4NPJA 2VMEA 3PGDB 1X9RA 5A3IC 4NCC1 4H13C 3URNA 3W2JA 3PHSA 3OR7B 5FAGA 4W93A 2OYKA 3FQRB 4BFOA 2WBJD 1TJHH 1Z44A 1OT2A 2AZUA 3IACA 4J2PA 3FNDA 1Q6GA 1BQKA 2CBUA 5CR8A 4OUIA 3J7HA 4K8EA 1AH0A 3RI5F 3MBWA 3WKMH 3U9UB 3L9YA 4Z7QE 1MW0A 3QUZC 2ARJQ 4AQ1B 2WWKO 2KUTA 1DFBH 3RVWD 5F7DB 5CLWA 2J1WA 2JQXA 2Z4QB 3R0DA 2IWGA 5SWZD 5SX5K 3VFVB 2GIYA 3BGFC 3FK3A 3AHXA 5FO7A 1T0PB 4N5UA 5JBFA 1IGMH 2H4EA 4OLWL 4GPVA 2OMWB 1S5HA 1BD2B 3FFOA 1IFHL 2JKIS 5I8CB 4XG1A 4ZFFA 5BOZG 4H2AA 3QORD 1N8OE 3KPMA 1OM9A 1SJAA 2IAMA 1N5AB 1SQ2N 2OVLA 3WUWA 1I3UA 3X14A 2XY1A 3I4KA 4HHPA 1IC4H 5K33A 2J24A 4Z7QF 1BXBA 4MQXD 4XN2A 4MYPA 1UH4A 3CV1A 4NC1C 4HVXA 5LO7A 3T65A 3HZYB 4H20H 1XBXA 2BVTA 5EUOA 1MJJA 3QPXL 4KJYB 4OGZA 3S0PA 1HE7A 4F0HA 1GYCA 3EOBA 2ADIB 3BD3A 2D7TL 3UPRB 4JFXA 5DI8A 2CO6B 4U2ZA 3ELQA 3PP3K 3TN0C 1HNFA 4HA4A 3GHRA 3QY6A 4LSRL 3VOGA 5FA3A 3E12A 3M5VA 3QEGL 3E96A 2XM1A 5I18H 1R3HA 4WI2A 3U7BA 2JJVA 4F15C 4KJPC 3NYZA 4C91A 1TQXA 4JOMA 2BPBA 1JK8A 5CSZA 1CFTB 1ZXQA 3OHMB 4PCYA 1E6SM 5CG0A 4ODTH 2EDTA 4XMWA 2Y7DA 5B7YA 2XN2A 3SUTA 4L4TE 2X4TB 1JPGB 1WH0A 3X3FH 4Z3GA 1IGCH 4YMZA 4OUOA 2NY6D 3PGCB 1RCOB 3QTGA 4NP7A 1UM6L 2BSCA 4CN1A 3ZTDC 3ITYA 5GGRA 4YLBA 4Z7UA 3MBXH 4TVCA 5E2UL 5TE4L 1WKEA 1LD9B 1TETL 4K3DL 1TTIA 1EJ7L 5D8JL 4O4VA 2CWRA 3IF1A 5CN1A 4ANKA 4J3WA 2H32H 4NAMA 1E0OB 4XVJH 3I50H 4FEIA 4ABWA 2EIBA 3MMEB 1K8XA 3M17A 3STGA 3JV5A 4M24A 2X7VA 5DQPA 2YB1A 5FK9A 4LCRA 1FGNL 3CSYB 4ORIA 2GITB 5CGQA 1QSZA 1KF9B 2PEVA 4GZIA 4U3SA 1DEDA 4YSTA 1AGBA 4HJ0C 5HNNA 5AYZA 3I6GA 4P5TC 5D09A 5D7JA 2LU4A 5DURB 1U9KA 2EEDA 3K91A 5F88B 3SGDH 3RUGE 1KGUA 2UYLA 4K3HA 4HBQA 4WFGE 3HMXA 5D2WA 1ZVSA 4HUUA 4Z2HA 3WKQA 2BIIA 5BXSA 5CINL 4EUPG 2VIRB 3QLDA 3UYPA 1EJOH 2C9SA 5KVFH 3P2BA 4K6AA 2F7PA 1Z9AA 1DBAH 4ZO7A 4J1UA 5CIPH 1VFAB 2C3GA 4M5SA 1VPQA 3ALPA 4H1LB 4XNQA 2ZRXA 4OZHF 2DQUL 5KITA 5DZJA 5CKAA 4YDJA 1J0YA 1VP5A 3EGDA 1CDBA 3KBNA 1BFVH 3WLBB 5JPMA 2DUZA 3UCCA 3VW3L 5HDLA 1H3GA 2A4EA 2QJDA 3WTXA 1VRXA 4NQCB 2UXFA 1K8DB 2XSBA 1RHFA 4UCFA 4XIMA 2R56H 5F72S 1EP3A 3UL4A 1FXPA 2Q02A 4QWWD 1P2CB 4GG8B 2W07B 2DLIA 1LG2A 1CDHA 4BSWA 4LEEA 1INDL 3LRLA 2AF2A 2R8SH 5EMMA 4HWZB 4JICA 2C9AA 2E76C 3IARA 2AJSL 5KWYC 1GR7A 2NW0A 4ZS6D 3WDQA 2ITEA 3Q13A 3TFKD 3WLNA 3AGVA 3RWFB 4NGHL 2P5EA 1IAKB 4PREA 1UEYA 1BYBA 2EE0A 5ABGA 1FDLL 1J4EA 3SADA 1W5OA 4R5EA 2PPDA 4CN6A 1E4KC 2NZIA 2AANA 4NUJA 1YDNA 4L7ZA 2BK8A 4OZGB 8XIMA 3EJSA 2FR4B 2BIHA 1Q13A 3W7KA 2Y63A 3Q65A 4CW1B 4HIJA 4BCZA 2H1PL 3C5ZC 4R4NC 1WCBA 1CLOL 1D7FA 4LLUA 3SKJH 2VDIA 1Q6LA 4N0CD 3PG8A 1ADQL 1ZLSH 4CQ8A 4PJAA 3KPLB 1A1OB 1VF8A 4Y5XC 1ZHKA 3PTKA 4DZIA 4KETA 2V5DA 2L3BA 3AXMA 4AXWA 2G9KA 1F6KA 3MRIA 4LBEA 4WY0A 2DWEA 1BVLB 2GPZA 4YFEA 4L1LA 3HBLA 5EKYA 3N1MC 1TJGH 4MG4A 1ORSB 1TWWA 4PE8A 4LCVA 5DUBA 5G4NA 3Q8EA 1E5YA 1SDAB 3VXSB 2GSGA 1UR3M 4QEHA 2I9TB 3GK0A 1NBYA 1RLWA 2QCLA 4D8ZA 4B92A 1YEEL 1AL7A 4LLDA 4XNXH 4WJ8A 1L5GB 1OVDA 1M1SA 5E1HB 1HSAB 3OMNB 3GXIA 3N55A 1OE1A 4MJZA 4JHBA 1N59A 4JFVA 4N6RB 3O3BA 4JKPH 1ZUAX 1NJ9A 5F7FA 2BINA 2YPVL 1GYNA 4YHZL 4QAIA 2OPCA 5DR5H 1T1YA 3VXNA 5D8ZA 1KZQA 1KG0A 1FWSA 3C6SA 3I6SA 4N0YH 4NBZB 1WITA 1A4BA 1SDDB 5L6YL 4DF2A 3VH8G 4S3GA 2ZCHH 3LU2A 3QXBA 2V7HB 1PCSA 1DXFA 1I0DA 5TQLA 1BECA 2YMXL 4F0MA 4K2UL 1IILE 4WW2F 3OZ9H 4WV1C 4LOCA 4MTVA 4X4XA 3NZUA 1KM6A 1D5MB 3FHAA 1AG6A 5IVXB 4GCAA 2EO9A 3AMGA 2BZ7A 2CZDA 5D7HA 1EZWA 3L4XA 3LQAC 2J5LC 5E9XA 3KNBB 3TMLA 1FZJA 2F8OA 2PRLA 5LGKA 4G9PA 4G82A 3QJUB 2VDOB 2Y07H 3FO1B 4Z7NE 2GSHA 2UY4A 5BZWB 4Z17A 3D25B 4DWSA 3QRGH 4HFWB 4R90L 5GSRA 3RZCB 4OIBA 1LTXA 2PGRA 3JV4A 1REQA 4BXSV 1WZMA 4X80H 2W88A 5L8LB 3UO1H 5IJCC 1F4XH 3PFUA 4G6MH 4DO6A 1LDPH 3OKDA 4FI4A 2C9XA 1KCLA 1CR9H 1I8LA 1MFAH 2WOQA 2BVOA 1GORA 4G8EB 1MRCL 4PB3A 1O95A 1EX0A 4F7TB 4YE4L 2BVQB 5LZLA 3LKRB 1Y5VA 3SCMA 2XNAA 4WLCA 5AVTB 1P48A 3LA4A 2BZCA 4UOZA 3PB2A 4Z7NF 2W9EL 1YRKA 4RV3A 2W60B 5C2CA 1S7QB 1ZKAA 2H26A 3ATFA 1G43A 4ZQCA 3EJQA 2VISB 3LHUA 3HHSB 2PURA 15C8H 4X5PA 1LLOA 3WLHA 4F0KA 3AZTA 5AW4B 3N2XA 2VEKA 1CZ1A 4NLAA 3V4LA 3PWLA 1JCVA 4ZW6A 4XO3A 1VBRA 5CNHA 4I5BB 3PJWA 4D6DA 4MWAB 3AB0C 4G3YL 2DYSB 2BH0A 3SOTA 2V67A 1D7CA 3MRHA 4XZMX 5IDZA 3SKOA 4CADB 1P0BA 3PRZA 4AMXA 4Y9CA 4AM0B 4LCSA 3I85A 3U4AA 3K80A 2WZ6A 5KBNC 3PWJB 1AIFB 4F37F 1VFMA 3K3QA 4Z2KA 1UUNA 2Z29A 3V79C 1WGVA 3EWCA 4GUJA 4EI6A 1GKOA 1Z41A 3JR2A 3E9UA 4D9RE 3V0DA 4E5TA 2BIMA 3IGUA 3MRCB 3K4ZA 3FB7B 1DQQA 5I3JA 1JZ7A 2B1HH 1MFEL 1KB9J 3IFPB 2DMGA 4HHLA 1FNSH 1FZKA 3IGLA 4HAKA 4RMRA 1CD9B 5EWIH 2WMJA 1R5VB 2F7FA 1P0NA 1JPFA 1MH5B 4IBSA 3UMTA 3VZYA 4JFHE 4I7ZC 2QZ5A 4YHLH 5C0BE 3HV9A 2GVLA 4DJFC 4R3SA 4L65A 3CM4A 4KTEL 1SBSL 4L9ZA 4N8UA 3AJ7A 4JTGA 1BYDA 2YL9A 1OV8A 1E9LA 2DJMA 4HWBH 2VGBA 2VXQH 2ROXA 2XTJB 3PWGA 4P5RA 1N5YH 5ISZE 1UOVA 3W57A 4FN0A 4FS0A 3L4VA 5F89A 4FNUA 4DXVA 2WTRA 2LV4A 5T8IA 3DTDA 4WTQA 1NCAH 1VGKB 3NZHH 1IC7L 1QFUL 2COVD 2O9RA 3QEHA 3BW4A 1GGTA 1J8RA 5DUMH 4P5KA 1KRMA 2DZBA 4V15A 3RVWC 4PJFE 4LEOA 4S1SL 1QBML 2XH2A 5H37G 4UFHA 1MHEB 2P76A 3I6EA 4KNSA 3T6WA 3HHRB 1HIML 1G6RH 1SJEB 5I1CL 5J6GA 4TRPL 4LPUA 4WOZA 3B2UC 3BDBA 2FYVA 2F19L 2VX4A 1T7YA 3IXAA 2CETA 3KM8A 3BVWA 3NEXA 1XLJA 2ARWA 4MRCA 1XIWA 2G2PA 4J3OG 1ETB1 3QORC 3LLXA 2P53A 1UJ3A 3FYYA 1RZFL 1W9BM 3VGDA 1UB6B 2DLGA 3V0EA 1HHKA 5LA1A 3RF9A 1B1YA 1M7OA 5IG7B 2UY6B 5IHRA 1F8TH 4GAAA 4BXVA 4YHYB 4A6YB 2I24N 3W27A 1JGIA 1A6AB 4I0KA 1UVQA 1C5CL 2VZ3A 4ZAKB 1A65A 1KFEA 2H8PB 3VFOA 3ULUF 3STLB 1Z69A 1NIUA 4IU2A 4JKKA 1XIDA 3P9WB 4M5PA 4JFZH 1FAIH 1SO5A 1UD4A 4TVUA 1HILB 1S3RA 1KXQA 3O0KA 2EDKA 3LH8A 3S3CB 4Q7NA 3TX9A 2A5UA 1IB5A 4X99A 2C15A 4XCCL 1BAWA 3QKEA 5TK4A 4PB9H 2A6KB 2CZ5A 2GBUA 1OD8A 4DIXA 3BPCB 1LM8V 2R2BA 2FGLA 1KN2L 1QNZL 1IM9B 2FIKB 3B3IB 3VE7A 3ARDA 3LHZA 3USZA 4UV7L 1FUNA 3ABRA 4YL9A 5KVMC 1VPYA 5KYYB 3QSKB 2YBRB 2NY6C 1S7RB 4CGTA 1FVCB 1CU4H 2OX4A 4ZZ9A 3FTSA 1I7ZA 2NT1A 4W9CC 5D4HA 4YTSA 1G5GA 1T6BX 4UMCA 4DKFL 3SCUA 1R24B 4GT7A 2G3JA 3APMA 4NSKA 5D70L 4UINH 3H4XA 3A3XA 1F1GA 1Z9LA 2J4GA 2AJ3A 4Z3JA 1A7OH 4GW1B 1AA1B 3NIFE 3O41A 2LAAA 2HKAA 2XN9B 1WBHA 3ARGD 2QR0A 3VFMA 1G7QB 4K3GA 3VUSA 3PPGA 1ASQA 1W3LA 3L17A 1S2AA 4YCOA 4P59H 3WIIH 3PP3H 1M9WA 3DG3A 2YFOA 3HB3D 1FQ0A 1RV6X 5AB9A 1SXCA 1P7KA 3MLZL 4E42B 5I1GH 4GNVA 2AXHA 2KI6A 3NFPA 5CH9A 4DB7A 3HGJA 3THCA 1YEFL 2EEFA 1U22A 3LMJH 1J0JA 3G6LA 4M6AA 1DBJL 1KJMB 3UTSB 3RN6A 3Q01A 4JKLA 4YFLI 5IEKA 1OLLA 1V6VA 2O5NA 3VG9B 3LHTA 3NQFA 4RNJA 3UJFA 2X16A 3CZJA 3DIFA 3NIFF 4BD4A 3HNTL 3FYIB 5B1BB 1WZAA 4JY4B 3ROOA 3HCVB 1P53A 3SY6A 5J1TC 4P2OD 3NQ2A 1W16A 4IBUA 4FXKC 5IB2B 3N1PC 1AQDA 1ZCOA 5JW3L 3K2MC 4JO1H 2C4FU 2NMSA 2K0RA 4LC6A 5MKGB 3V5HB 3RPDA 3W2LA 3NOYA 1NU5A 4M6UA 4JKNA 4JS3A 4EPBC 2ETWA 1URZA 3M44A 3TF4A 3DFOA 2LABA 4O02B 1JQXA 2X89D 3O4OC 1R19A 3L65A 1F3WA 4ZMYA 3RDTA 2BO0A 5FGBC 3W37A 5GNXA 4QWWC 4JUSA 5EBLA 5U7SA 1NF0A 3CVDA 3ARFB 4N4YB 5CUSH 4EF8A 3EYFB 4W7WA 5L2JB 2CUIA 5B3SB 1UQSB 1FHLA 3P2TA 5DZNA 2NDGA 4ZS6C 2CWXA 1XSIA 1IC1A 1FE8H 1E7UA 3EO0A 5I1JL 3TFKC 5LHDA 3ICJA 3UXKA 1GGBL 4LHUA 3HKZA 3DAQA 3X12B 2LE9A 4YHMH 4BCYA 2WZEA 3MV7E 1NMCB 4JTKA 3AQZA 3GXPA 2X2UA 2CO4A 3QDJD 5AC8A 1HP5A 5ALBH 2VMCA 3TBYB 4JBRA 4NZUH 5C08E 2UX6A 3OF6D 3W02A 3BP6A 3VXMA 1DXIA 1A7NH 1BREA 4Y4KC 4CJ1A 3GSRA 1GKEA 4IKJA 1DBTA 4N0CC 4WCYL 3MNWB 3G1XA 4RQQA 3I6LE 2HVJB 4ZX6A 4U0RC 4CKQA 5CR1A 2NX5D 4CCEA 5AKRA 4UTFA 4GAJH 5KSVB 1G7PA 2BDNH 5DVOA 5IVZB 3W0WB 2NLJA 4ZFOB 1VBUA 3FT9A 1AC0A 3TN6A 3ABZA 1UKOA 4NM4L 3LLDA 1D8CA 3GG8A 2V2TA 4K7PX 4Q7DA 5EZLA 4W6XB 1LO0H 1W2VA 3CX2A 1T21A 3SE3C 5AWNH 1OP5H 3ZJ8A 3EHBB 2BP0A 1Y5WA 4PLJD 2KZBA 2OLHA 3ZKQD 5AVWB 3U6WA 1AKJB 3QWOA 2HT4C 4XMKL 1JTTA 4M7ZC 3GHEH 3SCQA 1DLFH 4EZKA 3SBFA 2B0MA 3P3UA 2GFBA 3C08H 4BH8A 4RCXA 1SVCP 4D9PA 3MUZ1 3ITVA 3UXDA 1R17A 4Z3HA 2ICWA 3QBTB 2O7SA 4HV8B 2PW1A 5FEWA 1JQVA 3MMUA 3CIWA 5A6LA 3T3PB 3X1BA 1Y0EA 5JHDE 4LSUH 2DLEA 1D5BB 3HNVL 1DUZB 1PGRB 3NZ1A 2JKWA 2YSSB 2BGQA 4IHOA 1T1XB 4FMVA 1CLZL 4KDVA 3M0KA 2N0MA 1RVFH 1B3IA 3EOAA 4PBWD 4A8LA 5FPIA 3T0CA 4XP9H 4ABQA 2YQ3A 2B1AH 4FX5A 1W72A 3M16A 1JK9A 5TQ2L 1N8WA 4Y19B 4UR9A 4HUXB 4PJ6A 2PC4A 1BXVA 4OD2B 3AQDA 5HJDA 4HCLA 5EF1A 2PR9A 4DBUA 3GX9A 2ID5A 1NDZA 4NN7C 4EI5D 3CC5B 5FF6B 2GJLA 3LQZB 2Y7QA 1N64H 3TNOA 1XIJA 1GTEA 1OAUH 3ZO9A 3TOPA 1ZNNA 1QZNA 4K68A 4QGYA 1HYSD 1HI6B 1Q1JL 3SQOL 2X7LB 3K4AA 5FR3A 4JCMA 1WDWA 1E5NA 3OG2A 3GYEA 4I87A 5ALCL 1JCKA 3RXZA 2OYPA 3QY8A 4G6AC 4QHMA 1BYNA 3VXRE 1NDMB 2BVPA 3M8OL 5C0GA 5ETUA 2DD8L 4HS3B 4AYID 3TYGL 4UFKA 3DK0A 4PCNA 5F0LB 1TEFA 5DMKB 3OLEA 3GJFK 4UUJB 3UVIA 3L5XL 4Y5VB 4BGDA 4LRNH 1JNLH 2EDWA 2J6EH 4CVUA 2BFVH 1F05A 3MGAA 2IDFA 1KT2A 4Y16D 4HK3N 3QQ4B 5KSAB 1SW7A 1W80A 4WI0B 2WJ7A 4NRYA 1XSOA 1OCCB 3LCFA 3W39A 4GQ9L 4LYRA 2A3BA 4FQPA 1ZEAL 4N5ED 3TE9A 2BNQE 3RJQB 1M1XB 3MR9B 4GRLD 4OLZH 3S5LG 4A38A 2YD0A 2FLMA 2Q20A 1A02N 3V0WH 4XAGA 4HWEL 4XX1E 1MEXL 3L16A 5HYQB 5KS9A 5AZEL 2F54A 2GJRA 3W56A 5T26A 5AYYA 4URIA 1R75A 4M3HA 1U8QA 3U2CA 2OR9L 4ABVA 1W1YA 5HVFB 1Q0XL 1ZDSA 2BY2A 1A8JH 2J9YA 4A1RA 1PXGA 4UILH 3H6AA 1CB4A 3HPLA 4UQ9A 3CT2A 5EG6C 1PLGL 2EKJA 4QO1A 3WLJA 7TIMA 4K15A 4R97B 3FB8A 3EOEA 3VMNA 2ZQKA 3MTXA 1U36A 1ZLPA 1BGXL 2AL1A 3EYUH 1AR1C 4WGXA 4TQPA 3UTTE 4JDEA 1G4SA 1D6VH 2GJJA 5EU9A 4NUMA 3BJTA 1AG0A 3BV4A 4GJ1A 3ML8A 1TJIH 2XWRA 4ML9A 2F15A 4HWNA 2WBXA 3IWPA 3TW9A 3C75A 4Y4FA 2EEXA 3BG5A 1ACYL 4ZXBD 1U93B 4FKKA 1LO4L 2DF3A 2CLVB 3TO2B 4EUPH 3PU7A 4HSHA 4YO0B 1AZUA 3EF7A 3L13A 4IRSB 4LUTB 4OI7A 1IKOP 1T4KB 3WNKA 1FG2B 3O2DH 4NZ8A 3F7VA 1GQNA 4QXUL 3G04B 3QUMA 4PY7A 1MRFL 5HYIA 3KG5A 1QVOB 5DA4A 3NJFA 5KTLA 3SPGA 2VN3A 2OMUA 1EJFA 5C8JB 5DMJB 1EEPA 4QHNA 2GJZB 2FD6L 3C6LD 3B8TA 1DANU 1FH5L 3QUXD 3GUGA 3O8XD 1P1XA 4O2EB 2CIIA 1H6TA 5MF5A 3C2FA 2KPWA 4DW2L 5E23A 3NPVA 1L7TH 3CX5J 4YXLL 2EIZB 1UURA 5D71H 2WKOA 3EKCA 1WGOA 4IIEA 4PI0A 4LBAA 4PTUB 1NPJA 1NDGB 4XC3H 5DMMA 5KYWB 3UWEA 3GR4A 2MNRA 3CQ0A 3O3AA 3T1FB 1WXZA 1LMIA 1CMOA 1PHWA 3GBLA 4LQFL 5CLYA 5J11C 3K72B 3S35X 1H0DA 4Z7VA 1KKOA 1TTCA 3S1WA 2XIDA 5JDSB 1ADOA 4G80A 2CFFA 3DDMA 1ZP3A 1NLBH 4JJ5A 3BZFB 3SGUA 3BISA 4XNYH 5KSBA 5F7UA 4G7EB 3KYMB 5D1ZC 1C1EH 4BR1A 4DEFA 4X6CB 4GMTH 5REQB 2GTWA 1NZRA 1IM3B 4UQ3B 1E3FA 4BQ3A 4QYOA 1GC1L 3SB3A 4AKPA 5FJPA 3BZ4A 2EVGA 2JKPA 1RUML 1P1VA 3V5KB 3OIHA 1GEHA 4Z8FH 4R7LA 4UAOC 1QLEL 3H2EA 5EIQA 5GHWH 4ZR8A 1GS6X 1R8LA 3NIYA 1ACXA 1MCCA 2G4GA 5D05A 1OK6A 5JOPD 1LO3L 4JHUA 5EFIB 3ETTA 2YWZA 4YHKL 4OJEH 4XMPL 3W53A 5D9PA 2OB3A 4PJEE 4N6EA 3ZDXB 1HUVA 1HJCA 3MUIA 3PJXA 4LLWB 4HN4A 3RCMA 2DQEL 5F6IB 1TDQA 3QCVH 2B7PA 4K5OA 3TF7C 1IYXA 2JNZA 3OM3B 3SDYH 3L7FA 4P48A 4EDWL 4E68A 3GNMH 1GGCL 4GPNA 4AL8C 1G9HA 1Y1UA 1ADDA 3TDFA 4PG2A 1V93A 5CZRA 1T22B 3ARVA 4HD9A 5LWYL 3MFFA 2WUCL 1U91A 1H50A 5I3FA 5MENB 3SDAD 3ZHKA 5M17A 3WJWA 2XIBA 2CMRH 1HIZA 3CCHB 3QQXA 4DP6X 1V6TA 4L18A 4ONGH 3MJ8B 4QRSB 3MV9E 4JO2L 1Q72L 1R4XA 5CG7A 3HB3C 4M6NH 1XVSA 1X5IA 1FFNA 2PUZA 1W54A 2EZ0D 3NABL 4UANA 5E4IA 3L5WA 1N7MH 4HUMB 1CFNB 5EU6D 4KTGA 1I8IB 4LLMA 1KV8A 4QG9A 4NN6B 3OAZH 4EN3C 3W7PA 4HZ1A 2RHEA 3R0UA 2CKBA 2P28B 3EX3A 2AVGA 1UZDA 3I9GH 1NCNA 4PUBL 2JWYA 1GL4B 1V0MA 3WF4A 3HR5A 1GYMA 3B9DA 1OK8A 4MAYA 1KEGL 3BEWA 3TN4A 3VSVA 3HGRA 5AVYB 3MSGA 4P2OC 3OXSA 3ZU8A 1TIWA 1F4HA 5FUOL 1TZIB 4YNYA 2FATH 3MRPB 2PCYA 3U2OA 1XPGA 5IOKA 1Q9LA 1YNYA 1RZGA 3MRJA 1VR6A 3FT1A 3C4UA 1FCGA 3TFCA 4XP6L 3B9KC 4FZIA 1MNSA 4WDTA 1TYEB 5IWLA 3G1SA 4D9QE 3L0KA 3WTVA 1K5NA 5C6WH 3TNNA 4HALA 3LYRA 1YJDH 1FH9A 3V4PB 1K6QL 4G9DA 5D7IA 1G1KA 1EUUA 3PZOA 1TR7A 4F7PA 5HGDA 2OCCB 2ACUA 2X2GA 3TA3A 2XBZA 4IG2A 4IZGA 4AXNA 1G67A 5A16B 1I1FB 3ZQXA 3K1GA 5TDPB 2YZRA 4QY8B 3L3JA 3DSFH 4TNVK 4Y1AD 3VAEA 2FZBA 4A3QA 2BY1A 1K77A 4I5RA 1GZJA 4MNJA 1F42A 3LZQA 4YZFE 4PWHA 4P05A 3QYMA 2F58L 2XSKA 2JIXB 4U5IA 4D8LA 4LPWA 4XZ4A 4AU0A 4WQOA 2OK0H 3L12A 4R0LA 1SHXA 3ATEA 5F7MC 4DPAX 2GT9A 4DUXA 2C1PB 3PK7A 1ZHBB 2ITCA 4EKXA 1TVHA 1RURL 1GGOA 3FOKA 4NN5B 1DN0A 2DICA 4FLQA 1RP9A 4LCCB 4AVKA 1DJNA 1P4IL 4L3CB 5IFJB 3PNUA 4KEMA 2IANE 4DO4A 4NQEB 1BGGA 4WNQA 6PAZA 2IW0A 5J3HC 4MX7A 3PP7A 2ZOWA 3LH2L 1OAQH 1DWGM 1LO5B 3JWOH 3L8QA 4YZFF 5C0CE 4F0LA 3PE9A 1ZSHA 5LDUA 2H6PA 1TWIA 2BHFA 3KPTA 1L0PA 4HUVB 4O16A 1K8ZA 3L3IB 4HQQH 3P81A 2J8UB 1QRNB 4ERIA 1M2VA 3UG3A 1FP5A 4E2VA 2F8QA 4Z78A 1YMME 2VABA 3T6VA 4A2RA 4NQXA 3BLKA 1HXYA 3WFAA 3BCJA 3GG1A 3KDPB 2DZSA 4M8RA 4N90D 1NBZA 1MFNA 1OY0A 1RH8A 3T2QA 4P46B 1JUFB 1KO0A 1NCIA 3R8GA 2JKSA 4L3EE 3FXIC 4N0FA 5T5FA 4V1DA 2XIIA 3Q8CA 3IFNH 3MNZB 5INCA 3Q2CA 3CDZA 3R8RA 3HPJA 4M4RB 4Z1AA 2ZOOA 1EAOA 3FA5A 3H7LA 2V8ZA 1A1NA 4OCSL 1KPUA 3QWRA 3IJEB 1XR2A 1J8HE 2L7EA 2V2WB 3MU3A 3LD5A 1A5NC 1YDPB 4YBHA 3WDRA 3NZ8B 4JPVH 4R2GB 1G9EA 1DJGA 3I3BA 1IEAA 2LLGA 5EOQL 1CCZA 3BOXA 1AVAA 3MCNA 8FABB 4LEQA 5J5EA 5DRNB 4KC3B 3RWCB 3M5XA 2X9WA 1PJWA 3PDOB 1U8IB 4MDJB 5H37H 2POTA 2BOFX 1CFQB 1AGEB 4J35A 1PKQE 1H15A 3RNKB 4NRZB 4PJBB 3DK2A 2IFFH 4W9LC 2IPFA 1IGJB 1AD4A 3G6DL 3LQMA 1PKLA 1GAFH 4EI5C 4J3OH 4PRID 3LN5B 3CU7A 3FQTA 4Y88A 1JYWA 3UJIH 1VFLA 4B5TA 5EC1A 3NA9H 3UIZA 1DJIA 4DZ8A 3ARBC 4JQ3A 1BCIA 4FTDA 1HYSC 4LAZA 1QX1A 2C4XA 1VFUA 5C07A 3BUYB 3CVHA 5HJXA 4J3BA 3QO0B 1VIZA 3AW5A 4N8VA 3TO4C 3WAJA 5EYWA 4GUPB 3C5QA 1KIPA 2CDFB 2V2DA 3RYMA 2ZCLL 5BXPA 4PRHB 1AS7A 4S23A 2AV1B 3KGSA 1VHNA 2EXOA 4X7TB 2LVEA 4Z0XA 4MB1A 3JUGA 3ARWA 3KLKA 1W6WA 3NSDA 2OP4L 2W66A 1LYQA 3G8EA 3OPZL 1A0DA 2A6IB 5ID0A 3GS0A 1UWYA 4FNSA 1QOQA 5C9XA 3IJQA 4I85A 5E1AA 1HEZB 3T4YB 5LG1A 4Y96A 3B7YA 1QNPA 4Y9MA 4N5EC 2OKTA 1EFQA 1XLHA 2X2JA 1WV2A 1ZCRA 3D0AA 1EYWA 3H0TA 3MRNA 1SEBA 1J5OH 4CMMA 5EA0H 4GRLC 2G5RA 4NOBA 4XPAL 1YAZA 4GSDH 5FYLE 2J78A 3TL5A 3BVNA 4X0KA 4PH6A 3NNTA 4W9IC 5KAQG 1T04A 2HXAA 5IQ7H 4O54A 4BGLA 4FP1A 1PZ5B 4KS0A 3QNYA 4HSQA 3S5NA 4JTLA 4P8VA 3UDWA 3LZFH 3W7CA 5E6IC 1I1AA 4G7YL 3N34A 4XOEA 2PP3A 3DXAA 4NM8H 4A39A 4QS6A 2MNJB 5SWUA 1HHJB 5I5RA 4XCFL 1TQBC 3CVIH 5B80A 4KK6D 5TPWH 4LVOB 1WA2X 2ADJA 4PAZA 4ERSL 3UWZA 3INUL 5D96B 1A3WA 2W63A 3GLCA 2B5IC 4B9YA 2YRPA 1UBSA 3GJFH 1J0IA 1BQHA 4OGXL 2N1KA 3ZKND 2PPEA 3NPUA 1M7DA 4H00A 4Y7OC 2Q3AA 2X1TA 5HGHB 1EEUA 3EYOB 4OU3A 3H4GA 5GS1B 4G6FB 3IXTA 5L9FA 4ZQKA 3R4RA 2WQ8A 5D37A 3SPJA 1US2A 4XBEH 1O5RA 2ZZ2A 4YDZA 1CBGA 4YJZL 1JCTA 3II1A 3QZBA 5DMIL 4ZXBC 2VX6A 5TE6L 4QXTB 3TZNA 4FQ1H 1PDKA 3DO4A 3S2NA 1L9TA 1I53A 3DNKA 5J8OA 4RBPH 3HGOA 1XXDC 3EBIA 2QFPA 4ACZB 1V7ML 4N2GA 1NGZB 1MF2L 3C0SA 1P5UC 4F8QA 3M43A 4ZTYA 3QR3A 4RRPM 4L4OA 2WLHA 3ASOB 1QPOA 4ZUWA 5IJKC 5KYUA 4Q2ZB 5I75B 3VE9A 2ERJB 4GJIA 4W6WB 1TNMA 4YUEH 4LDLB 1WFJA 1IAIH 3QFDB 4KKLD 1IWPA 4MUZA 2KZ1B 3G1RA 4Z95L 1HHIA 4NAEB 4F0SA 2WLLB 3D4ZA 1MHHB 1FWDC 2VMJA 1FL3B 3C6LC 4OZHE 4AENA 2H3NB 4LGRB 3O8XC 1QTSA 4BHUA 1QW9A 3WUZA 3UGEA 4A8RA 5I71B 1IR1A 2J7FA 4KO7A 4CNNA 3B8UA 5I30H 5DQ9B 3IDJA 2O5YH 2R1PA 3HRZC 3IVSA 3UYCA 3TSBA 1S5NA 4E9WA 1GZHA 3GFZA 5F44A 4W84A 2RAMA 1CWVA 3PZ9A 2F84A 3F4VA 1BBDH 1XLFA 4NNCA 1JGVL 4R7NB 4Y2DB 2PR4L 3GS4A 3T6QC 3CK0H 4NZTH 2HZGA 3WLOA 5JW4M 3LAFA 1WKYA 2Y69B 1NKRA 1EHLH 3L9EA 4OU1A 1HS6A 4I2XA 2HS8A 3ZKMD 1F4YL 3NFNB 1E28A 4PVLA 5LCVL 1P43A 3NQ8A 3VXUE 1XGTB 1U95B 4OCRL 5LNSA 2YKKA 4N9GA 4MS8C 3S42A 4FQIH 2FX9H 2TSBA 1Y0LA 4FKHA 3VJ6B 2VI0A 1HZYA 5BVJA 1RJRA 2R23B 4OW6A 1AW5A 2J20A 3ULAB 4JRYE 4KUZL 3RRQA 2F53B 2Z65C 4IS6A 2DIAA 4ONHB 3WH5A 3ARTA 4FQXB 3GDMA 5DT7A 1VKXA 2XQYK 3QO1B 2FECL 1BYOA 1JNHA 4RZCB 2BNRE 3H4WA 4ANWA 1BEYL 4IUGA 3NA4A 2VUKA 4WFGD 5C0JA 2PDIA 4LPCA 2CZVA 3TUUA 5I76A 3BLDA 1IVLA 1LEKA 5T3ZE 1QCWA 3P3YA 1RZJL 3KE0A 1OP5K 1KJVA 2O9PA 4BK9A 1QMUA 3W82A 2IVFC 4PQXA 4L5FH 1RIHL 5F3BA 4AYDC 2DZVA 2AXJA 3NUKA 4RRPG 3THMH 1RLCL 3ZLFA 3WK3A 1AFVL 2W94A 2X38A 5DQJA 4PJDE 4RZ6A 5M7QA 4GBDA 1DZ0A 1OWWA 1C7SA 4PRPD 3BH4A 4P2RA 2Z91A 2QJJA 4BWUA 5EEXA 3DIPA 3GTTA 2G37A 3ZJ7A 2J6XA 1S9KC 4HJUA 2Y8KA 1Q8MA 3ZSSA 1S7VA 2IXUA 3B2DC 1U6AL 4J8RB 3VE0A 4Z0JA 2BNUB 5IOBA 2XWEA 2E7BA 3U2SA 1PYMA 2GJXA 3U5UA 5EC2A 3GRWL 1YX1A 1S5HB 2Z2BA 3EX1A 2ON3A 5GGQH 3DFTA 2Y1ZA 3ARRA 4ZFFB 1UW9A 2ZXWB 4JL1A 1I9RH 1EHNA 3TASA 4TSAH 3VM7A 4KU1A 1NAMA 2IAMB 4CNIB 4K9EH 3WUWB 4S2BA 2W65B 3X14B 2DBLL 3U9PL 1XKJA 4M8UA 4PJDF 1U1HA 2HROA 4XTIA 2NW2A 5CBIA 2Y7EA 3BDKA 4ZTPL 1TFVA 1SXNA 3D46A 2GK0A 1TMCB 2CO7A 4JMXA 3PHOB 4LYKA 5CZVL 5EUOB 3CDGA 4Y8FA 1MJJB 2CM6A 2XA8L 3EWZA 2E56A 4JM2A 5IK3A 3EOBB 1G9NL 2HRPL 4JFXB 5DI8B 4AGQA 8CGTA 2IPTH 4WWKD 4J3XA 5ELIA 2PCXA 4E41E 4JNZA 4NNAA 1MJ8H 2FYYA 2YAMA 5FWQA 1KGXA 3QFGA 1BMZA 5K7JA 1R3HB 2OL3H 4AWSA 3IRZA 5F1SA 3EH5B 2EXSA 1TV7A 2VC2B 2IH3B 1OFAA 2NDFA 1QA9B 5I17A 1JK8B 5CSZB 3STBA 4QISA 5SV3A 3LIUA 4M51A 1Z9SA 4P49A 3CPRA 5D1QA 5EO0B 1H8LA 1ENUA 3R7RA 3MJGX 3UAJC 3ITXA 1J8VA 3ATYA 4F57H 5DXXA 3AICA 3V1HA 4ZW7A 3EH4B 2BOCB 3SDCD 4FLRA 4ZFGH 3IF1B 5HNTA 2C7FA 3CG8A 1XM3A 5BJTA 1JHLL 3QV9A 3S47A 4LSDA 1KTJA 2KBGA 2NQLA 5FK9B 3S37X 4TLSA 4C58B 2HN7A 1UMLA 2XPGA 5BS0E 2WO5A 2Q7AA 1XZ0A 4XO6A 1NLDH 5I0YA 3JVGA 1QU4A 2Z00A 3PF3A 2HKFL 5HJBA 2C9PA 3N5AA 2ZVRA 4B5NA 1AGBB 5FO2A 4BKNA 1QSEE 3P0YH 2OKMA 2R24A 3DKJA 4G2DA 1MCIA 5E0CA 4YXHH 3IGFA 2YPLA 4PMYA 2CERA 1JNNL 4UTBL 5GS2H 2PU1A 4X6FB 3OEXA 1VJIA 2OZTA 3TTYA 2UYLB 2NCMA 4M7JH 1JPIA 1B9ZA 3EOOA 4HUUB 1DBBL 2AHIA 2PYEE 3RVTC 2BS71 3V0AC 4H1LG 4YVXA 2ZNWA 1L6WA 1T1ZB 5SV4A 1KD0A 4J1UB 4OQTL 2IBZX 4NI6A 4M0XA 3VFGL 4AI7A 4XNQB 1OP3K 1FRGH 1TV5A 1S9YA 4TUKH 1ZE3H 2JB5H 5EOTB 4DEUA 1T1WA 1G1OA 4L6DA 4YDJB 4Z7OB 2O6CA 3EGDB 2JTDA 2WK2A 2Z4TA 3GSNA 1R34A 4XCEA 4X2UA 1XF2A 2J21A 4PBEA 1EAJA 2HJFA 1P5BA 4W7VA 5C3IA 2X1QA 2ZCKH 1GJPA 6FABH 4L2LA 4U1IA 4XWGH 1EGJL 1DUYA 3TV3L 4YDKL 4MJIE 1XX9C 1XLKA 2X40A 4XNBA 4AQEA 4ILSA 2WWCA 2ZWYA 3PREA 4BSWB 3CLMA 3BT2H 1KZYA 3NEEA 3CSTA 1A3QA 3DDGA 1ZIBA 1XGQA 2C3HA 4E0RA 3F6JA 1GPWA 4HPNA 1WFOA 1WDAA 3MNMA 5I19L 1YKWA 5IMKA 5DZPA 2RBLA 4JPQA 1J2BA 2P5EB 3THAA 4PREB 5KTEH 5CCHE 1OX6A 4WNJA 1GJIA 3SQRA 2IQAB 4OSUH 1ZFJA 3MQTA 3VWKA 2LLEA 3MC5A 1G1CA 2EKCA 3WAKA 5DZLA 3IJSA 3HE7A 1JJUA 1YYMH 5L0QB 3MLYH 3P61A 4HIJB 4GOSA 4LLVA 3CUFA 4PJ9D 1WCBB 3W2DH 4LLUB 5ERWB 2EE9A 2Q8AH 1U8HA 3Q1SH 3UOAB 5J89A 5AAMC 4XWUA 1VEOA 2WBJC 5E9DA 4D9RD 4CU6A 4PJAB 2JFCA 4IQDA 5GGVY 1PDZA 5IHUH 2PTUA 1ZHKB 4C6PA 3E8UL 1U0QA 4NAFA 4QNWA 3HVDA 4WY0B 2DWEB 3DSNA 4PJHE 5AZ2L 3KPPA 4F79A 2ISFA 3NCJL 2VLRE 5B1CA 3ULUE 3DFYA 5DUBB 1YEIL 5C0BD 1V0KA 2AAMA 1THAA 2WKLA 3PPEA 3N2JA 1V79A 1J5HA 2VWTA 3ULSA 4G7RB 1RJYB 4UT6H 1RIVL 2EPNA 2ITDA 2OTWB 4LLDB 4LIQH 5TD4A 4JXCA 5JHLH 1NGXA 1THCA 1QWGA 1EFXD 3WGUB 1FA4A 5ISZD 2DEWX 4RK8A 4A22A 2PDYA 1KTLA 3O3BB 1NJ9B 3IIOA 5E8EB 3UFIA 1ZLWK 1T1YB 3VXNB 2MPAH 1KG0B 3C6SB 4MQXC 1BW8A 4PJHF 5DA0B 3QFJD 4KK6C 4IMCA 1E6PA 2WUBL 5HDBE 5HYSA 3UVAA 2YA1A 2QGEA 3ZTCC 2DQJH 4FCHA 7A3HA 2WXPA 4GGHA 1R5WB 1BOGA 1IAIM 1M68A 3BC9A 4XAWH 2NV1A 3ZKNC 6ALDA 2MKLC 5DO8A 4X4XB 5C9JA 2WZIA 4G43B 2NR6D 3DX7B 3FS9A 1JGDA 1A3RL 4YSOA 1CI5A 5E7BA 3MTWA 4YHNB 3Q67A 3PQYA 3OAZK 5J7CC 1R86A 3W7JA 4K94H 1NY1A 2I16A 4KMTL 2TMDA 1JUKA 4C6MA 2MWCA 2R69L 1KNOA 3EJZD 2Z8VC 4XC1H 1GVEA 4LUYA 4G8AC 2J43A 4KRLB 1ZPTA 4U1MA 5FYKH 4DWSB 3SCTA 4FLSA 4M7LT 4GH7B 1K9TA 5HDBF 3JV4B 5IB5B 3GXUB 1ED3B 3ECQA 4Z7WA 3IMRA 2QGCA 2R0ZH 1YUKB 5KVFE 4PSPA 5KG9B 1DL7L 4NKCA 3OKDB 3MZGB 4NO2A 1QVBA 4LS2A 4B5WA 3FU7A 5K69A 5AB0A 4EACA 1G7MA 2IWFA 2BVOB 4Q4OA 5JH2A 1F58L 2H0PA 3PUEA 3WTTA 5DMNA 4KKLC 4MA1B 5JHAA 1V08A 2OMZA 2PTYA 1G9MH 4XO5A 3P3RA 4X4KA 3SCMB 4NKOA 3NZRA 1OAYL 1H2JA 1IGTA 4R96A 2ADFL 4L29A 3VGBA 5LXGH 4F2MB 1I3RA 4HHHA 1HZHH 1NWRA 3O9WA 1O5XA 3VFNA 4RJEA 4HEMA 4QXWA 1X5JA 4ZA0A 3EXLA 5FM5M 5HDOA 3W26A 4FYQA 2FEEL 2P45B 1QNVA 3MRHB 4PJCA 3SKOB 4DQAA 1LLWA 3B9VA 5JPNA 5IFHH 1AE6H 4S0SD 1RY7B 1X5FA 3UH8A 1H49A 2BWQA 2VQ1B 4GMSL 4I18A 2GY7B 4YTQA 3OBEA 3EEGA 2J8FA 2VXTH 3ZKMC 2H3DA 1VGEH 1I9JL 4PS4L 1SHWA 3L3DA 4N9BA 4ZTXA 1DQQB 2F38A 5HI4D 3ZOAA 1P7QA 4APQB 3T9WA 3WY1A 2PGWA 1KPVA 2X6UA 2AW2A 2ZWLT 4FFVD 1JV2A 3U83A 1KFJA 4PGBA 2KDYA 1TKKA 1FZKB 3BRGC 1PWMA 2Z31A 2FJSA 2XUCA 2OMVA 1FSKB 3S96A 1JPFB 3X2QB 4D3CH 1YPIA 1MCOH 3BVTA 2OXGB 6TAAA 5CJ5A 3FRUA 3D5OF 3ML9A 1I2NA 2F68X 3I10A 4M8QB 4WDUA 1OABA 1I8UA 4QJ3B 5AYTA 1PKMA 1FNAA 3V4VH 2Y6SD 4C7FA 3NH7H 4L4MA 2I60H 4Y5YC 5CN2A 2J75A 3UP8A 3LB6D 3GZKA 3CQFA 2VDQB 1X5HA 3EGXA 2A74A 5D2NE 5I6NA 3H2QA 4YZWA 3UZ5A 3CDFA 1KEML 5CU5A 3TURA 2AI0H 2OZ8A 5D1XE 1WAAF 3RGVB 3BOFA 1FWAC 1AZ1A 4FI8A 1BFSA 5J56B 2I9LB 4CRPA 2IPGA 3W1NA 1X6NA 4QRPA 4LEOB 1FH2A 5SX4H 4MA7L 2KYIA 4QHKI 1I8MA 4POUB 4HCIA 3L5JA 4KWSA 4ELDA 1FL6B 5CHNB 1XGDA 4G1EB 1ECEA 4NI8A 1NCWH 2W9DH 3IXAB 3TEZA 3H3KA 2TAAA 3JSSA 1WIPA 3OAWA 1XIWB 1HH6A 3RWGB 4GVHA 1XCWA 4J4PA 1UJ3B 4ANVA 4HP5A 1TX2A 3NIGE 1W5MA 2VOTA 2B0SL 5CILL 2EP6A 3QYQA 5HYJE 4MNGA 5D6CB 1YVLA 3MV7D 2XIJA 2DJXA 4DN1A 2GDUA 2YSWA 3QNFA 3RR1A 3OKMA 1UVQB 5A8OA 4IBLT 3ALGA 1AI1L 3BUQA 1D6EA 3V9EA 4IU2B 5C08D 4H01A 2IADA 3N6YA 1KYDA 3OL2A 3B97A 4UBPC 3DIDA 1HN1A 2XWBA 4LMQE 2YLKA 3WD5H 2VGFA 5I1EL 1BPVA 4FQCL 2E27H 3ITLA 1ZLUH 2YLLA 2Q86A 2IDTA 1X5XA 5M03A 4X99B 4D71A 3TC7A 4L9XA 2WMFA 3WKPA 5ADOL 3DG6A 3I6LD 4KKZA 3PBGA 2YA2A 3QIWB 3R8QA 1OF2B 1IXQA 3MO1B 3ARZA 1WQVT 4BEIA 1MCBA 1T20B 3NIGF 4OY9A 4WK2B 3JU2A 4GRWB 1QQDA 4OKVA 5BVPL 3KZSA 3ARDB 3UMNA 3BQ5A 2XVBA 2E5DA 3APFA 4MMZC 3AT9A 1W3KA 2YXFA 3RVXD 5F3FA 1JPTL 3RTQA 2MHAA 3AU1A 3SN0A 1I7ZB 1OGAA 1ZAIA 2XRAL 5C0IB 3GG7A 4ONFL 3T8VA 4NSKB 5E2WH 3CZGA 3D3VE 1ODAA 3RKPA 3H70A 4QRRE 1W0YT 2AJ3B 2P4AB 3Q45A 4GY7A 1HKKA 2KT6A 2YGVA 5H6HA 4PJ7A 4JTEA 1OZQA 3VFMB 2BX5A 4OZFB 1F8IA 2PRMA 5JHDD 1OM0A 3NCOA 3EDKA 2BV9A 2XG4B 1H5YA 5EOCJ 3ILPB 4I89A 1P7KB 1H9VA 5K9JL 5JUEL 3MBDA 1X3DA 3CHXA 5KBKA 3NFPB 5C9KA 4HGKC 1ICQA 2NY1D 4F3FB 1F7BA 2D73A 4TNVF 2NY2D 2XCMC 4NC2B 3G5VA 3WG7B 4EPSA 2X1PA 2UVEA 1XBRA 1Z1WA 2ED8A 3E0WA 2R82A 5J5RA 1DVUA 4QRTA 2CHXA 3EFDL 1YEHH 1NCJA 3SJVA 1E4HA 3SRKA 4GW4A 3S36H 3ROOB 1HHHA 4UT9A 2M83A 4REQA 2CXEA 3UYRH 2H6OA 4DBEA 2PNDA 4A29A 2PZNA 5I1DA 4PSRA 3RIKA 5TJWK 3K8MA 4HMNA 2X0HA 4LH8A 2AITA 3FVDA 1FFOA 1B54A 2IF7A 4RBPK 5CPOA 4Q14A 1TYGA 4OLXL 4JQ1A 3VXRD 4YU1A 1P7HL 1TE1A 2KDGA 2XXGA 4XO4A 5IXEA 2A6JB 2YK1L 1P1MA 5EU5A 1E71M 3FZUD 3PAOA 3NFSL 2YAQA 3TZVD 1XDLA 2NY4D 1LM1A 2QGYA 3BG9A 2D69A 2DW5A 3MLVL 2VB5A 1SFSA 1JWSB 4KI1A 2WZMA 5EBLB 5HGAA 3WJLC 2DJLA 4UDUA 2R1XB 4R7JA 1KB5B 3TJ4A 1OTUD 2OEJA 1KC5L 3CVCA 3OKYA 3MRKA 1TZGL 1LL7A 1PCXA 4JKWA 5EZOL 5F7YC 1CK0L 1M05A 4AZHA 1UB5A 1RBAA 3T8XA 1VLWA 2WIIB 4WO4D 3S4SG 3AREA 1S7TB 4O12A 3FF7A 3MA7A 5I23A 2QULA 5AW5B 2ZUQB 1UH3A 2QW5A 3FDGA 2Y6ZA 4LUJA 1CL7L 3D6GA 1YAIA 2Z7UA 4LS0A 3LTPA 4PHXA 2XZAH 4BCEA 1XBYA 1OP3H 2EDFA 3QR1A 3ROLA 4HAFA 3QT2A 1H8SA 3CBRA 2DDQL 3PBUA 3IJIA 2X88A 5ICXA 1JHTB 3B9AA 4PTWA 2WZPA 2VL5A 5FX3A 3JV0A 4UQAA 2VN6A 4B7LA 3BP6B 5CSYA 3VXMB 2MNWA 1NUNB 3GSRB 4IIQC 1UCTA 5IM7B 4JM4L 3P3BA 3KCWA 1HGWA 35C8L 1GZPA 4CD7A 2PBGA 4ELMB 1XCQA 2NQ5A 3U1SH 3NSCA 3VACA 1GS8A 2UZIH 3VI3F 3JZ7A 5LB1A 3TXVA 1RUSA 1G7PB 4F2TA 2VAAB 3HQ1A 2W1NA 4PJ8D 5HNRA 2NXYD 5K9OA 2X3CA 3P4OB 3IIZA 1ZWIA 1IGML 2DQHH 3EA3A 4ZW8A 1UP2A 1MLBA 1WWBX 2V2TB 3V75A 4C6LA 2CDEA 2OZ4L 1R5IB 3QYSA 2BWIA 5D7LA 1W0VA 1JWMA 1QFHA 1T21B 4OWGA 3LDBC 2MH4A 3VNKA 2O30A 1OCRB 1FLTX 2BP0B 3T42A 3LMZA 3QWOB 4YDMA 2E46A 1VPXA 2XIQA 4JHWL 1JPST 4TV3A 4LCYB 2GFBB 4ETQA 3D85D 5AVXB 4BH8B 2QADB 5C92A 3W7HA 3R79A 4UWQB 4BSJA 4LAKA 3BQUD 1MNUH 3CLFH 1ZK5A 1H3VA 3E9TA 1SM3H 4G9FE 1RUPH 4JIHA 3DROA 2A7RA 1MCDA 3MBEB 2XZQH 4KZDH 2OSLA 5L9DL 4RLDA 3ULUL 5G4OA 4JFEB 1SOXA 2X10A 4JRXA 2DYPD 4HIQA 2SEBA 3VFRB 1W72B 2BSTA 1B90A 4A68A 3DIVA 2R2CA 4UUIA 1P0KA 2HTLD 1ZJAA 3FPXA 1A6VH 3AMDA 4O57A 3BL3A 3BKCH 4L4VE 1DDHA 1GC1C 3BICA 2NR6C 1NFIA 1TPVA 3LIZL 4WTWA 1CXKA 5AALA 5D7SH 2VC5A 3E6FA 1U8LA 3WQCA 2Y7QB 7REQA 1XB6A 3WXWH 4WVXA 2DWYA 1JCJA 3QVQA 4B9IA 3F2LA 3TEUA 3BJLA 4Q4IA 2V5LA 4HKBA 3WKYA 1ZT4A 5ICYB 2HK1A 7ENLA 3DBPA 2UWEA 4LVNC 4N6FA 5I6MA 4HXBL 4QHMB 2CO3A 1GHFH 2GUYA 4DP0X 2BVPB 2N56A 5ETUB 1DJSA 1FLRH 3CIVA 1AAJA 1PTZA 3KS0H 4PR5B 3NG3A 1FFQA 5G5DA 1ZLWH 2FH6A 2Z6FA 3OTTA 3QV8A 1U8PB 4P99A 4DO7A 3CK5A 1YUHB 4FGMA 6XIMA 1E5ZA 3BZJA 4FG2A 1KT2B 3OJ2C 4RGNB 3QGKC 3ARGC 1TO4A 3L3GB 4AGNA 3UGRA 4I4WB 4K3EL 5GISH 3WL9A 4A2MA 3H9ZA 2QQKH 5E5LA 2IH1A 1Z9PA 4YSDA 2XG5A 1PS3A 4X63A 5KSUB 5JXEA 2VFGA 3D39A 1JULA 4NJAL 4JDVA 4OOZA 4B27A 5FYKU 3WNLA 5J04A 1ZB5A 3UPMA 2HT2D 3P80A 3HE6A 4XPHL 1DBAL 3S8GB 2F54B 3OHXC 2DJUA 5K1JA 3VRIA 4IGBD 2B31A 2K9UA 2ZPKL 2ZZUT 5C0RH 3FTVA 2NUTB 5IB3B 1Y6NR 5SWSA 1NIFA 1POJA 3GHBH 3S37L 4NQQA 5AC7A 12E8L 3HPLB 3RWIB 1MVUA 4FXGA 5IOPA 3S3PA 4CAGA 4QO1B 4KZCA 1PAMA 1W3HA 4PLNC 1IE5A 3FN9A 1TYRA 1YQVH 3FB8B 4N22A 3L7EB 5GJMA 4PN2A 4FOJA 4N02A 7PCYA 2F8IA 3MV9D 1GW9A 5HI4C 4DZBA 3EOSA 4C5YA 4JDEB 1JXDA 4PCTA 4RWYH 5IFAH 3ZMRA 3T0EA 4X5WA 1F6YA 4UDTA 3FT0A 3H53A 4PUNA 4B41A 4X4MA 3S6CA 1JFXA 3UEZA 32C2A 1ANUA 1F00I 1GQJA 1JRHH 1B6UA 1SDYA 4LCWA 4DGYL 4Y4FB 3IFLL 3OZOA 1PZDA 4R7WA 5HHNB 4IBYA 1JZGA 1MHCA 3QXDA 4BFAA 3MP3A 4TQTA 2Y6SC 4C4BA 1MWOA 4H1LH 4PULA 3FJTA 3L48A 5LGJB 3LB6C 4JFFA 4GINA 1WZ1H 1T8QA 2NV2A 5G2HA 1SVZA 1KGWA 3Q6FA 2EJ1A 3UR2A 1KCVH 5E08L 3KPSB 4Y9PA 5I6SA 5AKSA 2JKJA 2V68A 2HVKA 3R06B 2ZF9A 3F7VB 3L3OC 3URBA 5IQ9B 1NCGA 1U4EA 5A6MA 3QUKA 2OW6A 3AWEA 3SKNB 3ETBF 2OMUB 1ZLSL 4AIOA 2XH4A 1RZMA 4B6ZA 4QHNB 3D4YA 3QDGE 2ZC8A 3DC0A 2RDWA 2JKTM 5FDYA 3TNBA 2CIIB 5F96L 4BHUI 1E8ZA 2V17L 3EWDA 5IEHA 1JPEA 2EUXA 1Q7MA 3RX4A 1LQ2A 2HNEA 4U1HA 4M5YL 3LRSA 3HURA 4IPPA 4K4KA 3KOYA 3KVQA 2FE0A 1H0DB 2AS5M 4M5TA 4A66A 1GVRA 1EQWA 4Z7VB 3O45A 4B53A 4WD0A 2DZTA 2RAGA 1EFZA 3TT3H 4P06A 2Z7KA 3CN0A 4G80B 5B39A 3JYCA 4JJ5B 2JB6A 2OULB 2WWMD 5H2ZA 3UXIA 5KSBB 4UI2A 2R4SL 3JTSB 3IETA 4J40A 4PLJC 1NANH 3EJJX 1W3NA 1OD7A 1EAPA 1QYGL 1W3IA 3FUHA 1F6FB 5G1MA 4FF9A 5IKCA 3TCTA 4PJGB 1UBPC 5J12C 4HS6B 3UD6A 3QJXA 3LSBA 3QUZA 3D0LA 2H6UA 3ILEA 2KLTA 3BZ4B 5GRUL 1TZHB 2IAND 1TVBB 3KCOA 1ERNA 1TTGA 1EZVY 3BSZA 3B8VA 3GMLB 3T81A 1HL8A 3E6EA 1U92A 4UMSA 3PUGA 3RX2A 5C0CD 5KOMC 5JBEA 2Y5EA 4Z2GA 4CC0A 3IGAA 4XZ9A 1XR8A 5K4ZA 2VDML 4LDOB 1M9SA 4A55A 1IO4C 3IN2A 5EBWA 4PRAB 1EANA 2KERA 1VZIA 5KAQF 1H9DA 4KH2A 3HN8A 2WXNA 3CPLA 1VADA 4QQ3A 2EAWA 1XGRA 3AG4B 3FYEB 1P4BH 4OIFA 3L7FB 4FAMA 5ESVA 3HUJF 2OLSA 2HXTA 1LT7A 1NUGA 3WEBA 1NCCL 4LEBA 5A8QA 1RK1A 3U25A 2OMAA 4L3ED 2DUXA 3ZKSD 3RGHA 3WQEA 2JJTC 2X0UA 4M93C 1CW2A 4PCPA 1EPVA 3B1UA 3TPKA 4UZUA 3PZTA 3MLXH 1NC2D 2VH5L 1J8HD 5DXWA 3CQIA 4Q6XA 1FIGH 4E9SA 3BSMA 3WH7A 4GRMA 2RGMA 4OBSA 2QKFA 2HPIA 2AK4E 2WANA 3E0LA 1CIUA 5FV2A 3OKOA 4LGXA 3V5DA 1EPFA 3L5WB 2JIEA 3HHMA 1IX2A 1RD5A 4KK8D 3UAAA 5AFDA 1KRCC 2NY2C 4N3TA 4LLMB 4HEPG 3X1NA 4TNEA 4G7VH