5A2IH

Crystal structure of scfv-sm3 in complex with apd-sgalnac-rp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
244
structure length
224
Chain Sequence
QVQLQESGGGLVQPGGSMKLSCVASGFTFSNYWMNWVRQSPEKGLEWVAEIRLKSNNYATHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCTGVGQFAYWGQGTTVTVSVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IG LAMBDA-1 CHAIN V REGION S43
publication title Deciphering the Non-Equivalence of Serine and Threonine O-Glycosylation Points: Implications for Molecular Recognition of the Tn Antigen by an Anti-Muc1 Antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 55
structure length 224
sequence length 244
ec nomenclature
pdb deposition date 2015-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
H PF07686 V-set Immunoglobulin V-set domain
H PF07686 V-set Immunoglobulin V-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5a2iH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5a2iH01
3O11B 4P2RD 4R4NC 1YZZA 2HT3C 2V7HB 4TVPH 4HJJL 1D5BA 1FN4B 5FHAL 3IF1B 4UQ3B 3FRPG 1OGTB 4PJ5B 1T6VN 1TVHB 3ARXA 3ZE0F 5JIHA 1U42A 3RFZC 5I1LA 1H3VA 4GAGL 4LCCA 4PR5A 4S1DD 3T0AA 4HK3J 3MV9A 3KLHC 3PWLB 1RQ5A 3V0AC 3RWCA 1UQSA 2E27L 1ACYH 3AAZB 4J1UB 1AI1L 4LVNC 5GJTH 3FCTB 1QFOA 1MHCA 5EU6B 3UJJH 4M7LH 5K9JH 4MXQD 3T77B 4HK0A 1GGBH 3RWIB 1G84A 3U9UA 4N9GA 1RUKH 4R2GB 1RHFA 1KBGH 5FCUH 4BQ9A 4NZTL 2EZ0C 5IW6B 4FQHA 3DYPA 3H42L 1K5NB 5IVXE 4C4KO 1OAXL 1Q9KB 1LO5A 4DCQB 4X5LA 5CD3B 4KRLB 4E41A 4M1GH 5HI5C 3I85A 2H6PB 5E5RB 3S7GA 1XR8B 5CJBA 3L3HB 3MYJB 1X9QA 1ZSDB 3R1GH 2CKBA 3UZVB 4BQCA 3RRQA 3GMRA 5D5ME 3WJJC 4Z7OF 3VXSD 4CDGC 2Q76A 3L95B 3GJFB 4Q9BA 2FB4L 2E6QA 5DQ9A 1IEAB 4BZ1L 5EZJB 1F3JA 2GAZA 4UUJB 4OQ1A 5E1AA 1MREL 3ARUA 3C60C 4HKXA 5H2BA 4H26A 3TVMB 5DEGA 3BPCA 2EXYD 2HJKA 1AQKL 4H8WL 1ULVA 5HGGS 1NFDF 3HAEB 4Y4HB 2AXGB 4LHUG 2YPKB 5JHDA 1CU4H 3PDOB 2WINB 4Y4KD 5JNYB 3H7BB 4RFNC 3S96B 2HT2C 2ADJA 5DR5H 4GRLA 4MQXC 1S7RA 3SCMA 4LSPL 2EDLA 5IEKA 1ZTXH 2PR4L 4X7SH 2BXZA 2HMIC 4JDZA 4R7NA 2Z8SA 4IS6B 2R2EB 2UWEF 1OSPH 3HS0A 1KCLA 4GW1B 4U6HA 2BX5A 3JV5A 3A6BL 3PG2A 4XPBL 3MCKB 4U1MA 4J4PA 5B3JE 3QDGD 1A7RH 1IAIL 1TZGL 3BSZH 1MPAH 3KPPA 1CLYL 1S7SB 2DIBA 4MA3B 2GFBB 5T1KB 4X99A 4FFYL 1B90A 2Z4QA 4OF6A 3WIFA 3QNXA 5KSBA 2A74A 3VFUA 5IIEA 3QWOA 3JVGC 1AD9B 1FNHA 4ESKA 2K3TA 5FK9B 4D0CA 3HKFA 4UTAL 4KFZC 5EN2B 4U6VH 1MVUB 4XVJL 3SGKC 3QDJB 3ZL4L 1HKFA 4DKEH 3NZHL 1KB9J 5E8OA 2OL3L 2JCCE 1QFUH 3DUUA 5FO8A 2VLJB 4JVUA 1RZ7L 3U1SH 4MAYB 1WFUA 5FV1L 5KVGL 4JHWH 3SOBL 1BQHB 3ALPA 2UZIL 4AT6A 1NC4A 4HUVA 4L1HA 5FYJU 2IJ0C 3DXAD 1GH7A 1QO3A 5C0EB 1JUFA 4PY7A 4UB0H 4QHUA 3GSNA 3ILPB 1XCTB 2ICEB 2GSIA 4Z0BH 4GG6E 4O51B 3TT3L 2Y36H 3BRFA 3UAJD 2B20A 4LSQL 4EUPG 3O3EB 5T3ZD 5T5NG 3KLAB 3HNVL 4XNZB 1AY1H 4M62H 1MCDA 4P5TD 4N1HB 1F4AA 4L8CA 5I19H 2Q3ZA 4HIHB 3PWVA 3SGEI 2NY5L 3SO3C 3H9HA 3HUJA 3NFSL 1A0QL 4HSQA 1CI5A 2X2YA 2PXYC 1OW0C 4KDTC 5TDPA 3CLFH 3SDDC 1GOHA 4IHOA 1KJ2L 4LCIH 4BZ2H 3B3IA 1AXSB 4N90E 5CILL 3O0RH 3MRFB 5F7NC 3SGJC 5DO2C 5SWSB 2QLVB 2C5DC 3ROOB 3ZKXC 1TVBB 3ZHKA 2PYEA 3GRWH 2ESVD 4Z9KB 2WBKA 4WI2A 3G6JA 1JHKL 4HH9B 4R8WL 2IQAA 3DTXB 1P6AB 5ERWB 5HYSA 1X5JA 3V4PH 2QR0A 4OBRA 4LU5L 3SY0B 4KVCL 3AU1B 2G2RB 3X12B 3QHZL 4PJFF 3I6LE 4NPYB 4IMLA 1O0VA 5CP7A 4YAQB 2H32A 5ADOL 2XV6B 3V0VA 2V9RA 1RU9H 4A2LA 1YY9D 2WUCL 1EFXD 1DBKH 4XB7A 4YWGH 4DN4H 5F7YC 1S7WB 3CMOL 5IT2L 3MRGA 3BZEB 2DQGH 1DJSA 3C9NB 3MRRB 1NGQH 1KOAA 2VLLB 5CAYB 1IGJA 2JJTC 2XTJB 3IDJA 4KTDL 1FE8L 5BZDA 2XXMB 3SQBA 5C08A 4K9EH 2A9ML 1U8IB 4G5ZL 2YPLE 4ZAKD 3RDTC 5C9JA 3OR7B 1EX0A 5CJOH 1KCRL 4H8WC 2R56H 3GO1H 3MBEB 3Q3GB 3FTGA 1FCGA 2I07A 1NDMB 5JR1L 5CWSB 4HCRH 5HVHC 3D6GA 2BNQB 2IBZX 4JCLA 5EO0B 5D2NA 1OAUL 3H3KA 4AMKH 4RBPK 1NMAH 2NMSA 5F6IC 5B39A 4RIRA 3F6LA 4Z7UF 4EBQH 4QY8A 4NKOB 4Y19B 2X42A 3RKPA 4KKNA 5KVDL 1MI5E 5F7WC 4OFYA 4LCWA 3UTQB 2OMNA 1JWSB 4LDLB 2GK2A 1X6LA 4U3XA 1QSFE 3QEQE 5C0CA 2AJZA 3MZGB 5HHOA 1BFSA 1CVSC 1F3DH 5C0BB 1KGCD 1M6OB 1RZ8A 3C6LD 5TDNA 1KTRL 2MJWA 4KDVA 3CXDL 4LHUB 4CVWA 5D72H 4X6BA 3MXWH 3VD5A 2ERJC 1BX2B 2OZ4L 3D0LB 4IIQA 3AXLB 3MMEA 1C8PA 3BT2H 1ZT7B 3KXFA 4B53A 5F9OL 4X6DF 1IAOA 3VI3E 5IHZA 3QJHB 3UZEA 5JPNA 4XZUB 4JREB 1Q9WB 1NCTA 3CFCL 5HPOA 3WS3B 3MRIB 1G9NL 1MCJA 5FKPB 1Z6JT 4PLJD 5ETUA 1RZGB 4Y1AB 3VXRE 2AKRA 4P2QD 4IOSD 4K3JL 1EK3A 2FX8H 1HIMH 4OZFH 1SJHA 1HQRB 5SX5K 4LDOB 3QQ3B 3EO1A 3EO0A 3GNMH 3O45A 2XNAA 4KJYB 3R8QA 4PUBL 4R4FH 2X9YA 3RVXD 4JZJA 2EDJA 5GGVY 2YSSA 3WXWL 2R39A 1ORQA 5I75B 1OHQA 3H7LA 3B2UC 3VD3A 1UWGL 3WFZA 4F33A 4RMSA 1H3XA 1MWAB 4HIJB 1KPRB 3P0VL 1R5VB 3MLPA 1NEZG 4U33A 4GRMA 5JA9A 3WJLC 4UNUA 2V5TA 5J7CC 2NY5C 4XXDB 4MD4A 2FEDD 1C5BL 2AJVH 1IGYA 1BM3L 3KLDA 5CFHA 4PRID 1FO0L 4Y7MA 4Y16B 1A02N 5FO7B 2FGWH 4L4VD 1CIDA 4OKVA 1LE9A 1KJMA 5I17A 5DMYA 2OTPA 1S7QB 1BEYL 1A14L 3GMQA 4RQQA 5CBEB 3QEHB 3DSFH 1PZ5B 3DURA 4PGEA 1Q0XL 1HHKA 1IMHC 1CF8L 2NTSP 4POZD 5C0AB 3O6FB 2AK4A 4KH2A 4I2XB 4NYLA 4PJBF 4JFDA 5INDA 3T65B 4ERSL 3EFFB 1JE6A 1YYMH 2WUBH 4IJ3C 2AAVA 4M6OH 4WWKC 5IJKC 1KLGA 4P23D 5D1QB 2I9LB 3EIFA 4Q2ZB 3QPQC 5EIIA 4W6XB 5TGBB 4FQCH 4KK5C 1HZHH 4HUXA 3DHMA 4GRWH 4CVUA 2CLRB 1QFWM 3NVQA 1AO7D 4WI5A 4YDIL 1QRNA 2RFXA 3O3DA 3SKUD 1ZT4B 2QL1A 1SHMA 4PGBA 4HJGB 4V2CB 5IMKB 1ZA3A 4KQ4L 5KJRL 5CJQH 1FP5A 2Y72A 4LKXA 4RSVA 3WUZA 3TT1H 1J0KA 5GRJL 5D2LF 4YHPA 5D7IE 1CGXA 3KYOB 4UILH 4WW1A 4R26L 4HIXL 1OTSC 4YFLF 2C7UB 3BH8A 4IRSA 2ATKA 1ACZA 2W65B 4M4RA 4PJGF 1AGFB 3VDCA 4QRUA 4MNGE 3WO3B 2D7TL 1U8LA 3GMMB 3LQMA 2EDKA 2VZTA 2M26A 4J3TA 5H94A 1LP9B 4GXUN 4LRIA 4RDQG 1F11B 1HOCA 2EYRB 3JV6B 1G7LA 4DGYL 4NQCE 4PJDB 5I1KH 1GPOL 4EI5C 1OAQH 2OTUB 2IAND 4Y5YC 2ZCHL 2F8XC 5E7BA 4UOW1 3RIAK 5CJ8A 4PLNC 3KYKL 5CCKL 3EO9H 1KEMH 3QIWA 3BRDA 2WP3T 3T1FA 1T1YB 2X4NB 3IJHA 4R0LA 2YD5A 1NGXA 3PWJA 1I85A 4OLZH 5CIPA 1IGIH 2APBA 4JM2C 3FQUA 5LWYL 2B4CC 1Z5LA 1EERB 1D5IL 4L4JA 1F2XK 5FB8A 4CN6A 2X4TA 2VE6B 3ZYJA 1DQLH 2VDPL 2BOCB 3WN5C 4PJFE 1RJYA 1T4KB 2GEEA 1L9NA 3ARVA 5IUSA 1FSKC 1UJ3A 3BE1H 3MCG1 2VDRH 1LK2A 4ODUB 1RJLB 1GGIL 2FD6L 3THML 4U1SA 3ZE1E 3F58H 1CDBA 4QWWC 2SEBA 5C9KA 1A7OH 1MFCL 3JXAA 4S2SB 3GBLA 4YXLH 4R7DA 1G9NC 3MV7A 3LPWA 4XCYB 2Z8WC 1BVKB 3T09A 1BJ1J 4GG8B 5E8NA 1BREA 1AGEB 4D0BA 5HDLA 3C60B 4G7VL 1CGUA 1U8NB 4KGLA 3V6ZB 3MROA 1BGXL 4Q6IC 1JGEB 1NAMB 5T1LA 3MOAL 3I9GL 3MRKB 2FIRT 1I9EA 2ZPKL 1J8HA 1E6OH 4X6CF 1W72A 3MNVA 7FABL 4OD2A 1T21B 4L9LA 4RFNB 4MLSA 3TPUA 5GGSB 5C07A 4C83B 1WT5C 3VWKC 3HNSH 2FLRT 3CJJA 1AD0A 3QCVL 3VCLA 4I1NB 1YC8A 4OLWH 1IAMA 4XVTL 4GKZA 3N1FC 5GS2H 1NH6A 3QCUH 3LOWA 4G9DA 1UM5L 4ZYKB 5KAQG 3FFCA 5BVJA 5L2KE 2NNAB 1HSBB 1NCWH 4UU9B 3L3OA 4XC3H 5IVXB 1HKLL 1JNHB 4FQXA 3BP7A 4PB9L 4JKKA 3BWAB 3CVHB 5B38A 2E9JA 2G60H 4LRNH 3BRGC 1LNUB 5JOEA 2XY2A 3C2AL 5D5MB 4IEFB 3EOAB 4OM0H 2XA3A 4ZUWB 4ZSOA 5FUCE 2FWOB 4OCWL 3CFEA 2EIBA 1J12A 3HMXH 4B7IA 1D5XB 3UBXG 3FONB 4PREB 4ZTPH 1NSNH 5DVKA 3S34L 4CUCA 4X83A 4Z78B 3OR6A 1QBBA 3UPAA 3N0PB 3N85H 5DJZA 5FA4B 4JFZL 2NY1C 4UIMB 5INCB 3I02A 3MUZ1 3MOBL 4LEXH 3OKNA 4K7PY 4WFED 1EZVY 3Q5YA 2V7NB 1F4WL 3OF6D 3SKOB 2YD4A 3DROB 1BVLA 5IGXL 1EXUA 4E0RB 3V5KB 1UACL 4KMTH 3UZQA 5DVOA 4WI7A 3QQNA 1CDUA 1HWGB 3DYOA 5TE7L 3VXNA 3SO3B 1JN6B 2N4IA 1FN4A 3QG6B 1PLGL 5IV2B 3IF1A 2PXYB 4UQ3A 1OGTA 4PJ5A 3F5WB 3HG1E 1TVHA 4MB5A 3HZKB 4W70A 1WBZB 1JNLH 2Y5TB 4RAVB 4DZBB 3PWLA 4ZD3L 3MA7B 1YA5A 1P7QD 4XPGL 1OLZA 1QBML 3KR3L 4G43B 5ECJE 3RVUC 1DBMH 2BC4A 4PRHE 3ZKXB 2BRRH 4OD3H 3AAZA 3MLUL 3FCTA 4NRZB 2YZ1A 5J11C 2X10A 5EU6A 1WCBB 1CQKA 2FHFA 5FUCC 1VFOA 5EU4B 4LSSH 3T77A 3V52H 1NAKL 3RWIA 4P46C 2CPCA 2PO6D 2JCCB 4PJBE 3DXAE 3JZ7A 4M6MH 1Q0YH 4G6FB 4PV9B 1QLEL 4XNYH 2G75B 5IW6A 1K5NA 3ARDD 1Q9KA 3UTTD 4DCQA 2W60B 5CD3A 5GRVK 3HC3L 2H6PA 4WUUD 1XR8A 3OMZA 3L3HA 3MYJA 1ZSDA 4GG6B 5GJSH 3S36L 5DT1L 3OAUL 3IVKB 4CADB 1JPST 4KDWA 1HHHB 3O41A 1DDHB 3PXJA 4YFEA 4Z76A 4X80H 1V3JA 3DJ9A 2VLKD 3VDBA 1ZGLB 4ZOCA 4BJLA 2YEZB 3E3QC 3L95A 3ZKSD 3GJFA 4KGJA 3U4AA 4MZ2A 1IEAA 3O9WD 2DWEB 5EZJA 4HKBB 2P49B 4PJCF 4RWHA 4XAWL 1RIHL 4UUJA 2ZUXA 2VKXA 4OZHF 5GISH 3D2UB 4NKDB 3TVMA 3RDTB 3QUYB 1L7IL 1DZBA 5EIQA 2AXHA 2CDGA 3HAEA 5HVHB 2AXGA 4N0UB 5C0FB 4M02A 2YPKA 3S4SB 3PDOA 2WINA 5JNYA 5F6IB 3B83A 4NO0B 3H7BA 4ETQB 3S96A 3VFPB 3TWCL 5ACMA 4I3GA 1ND0B 1RZFH 5ICXA 1Z9LA 3ZTJG 5J12C 4P2OD 4ODVH 3GSVB 2V9TA 2Y6SD 3FHQA 5DJCB 2P43B 4PRDB 4WY7L 5JQ6L 3NCJH 5C92A 3PQYD 4IS6A 2R2EA 3T08A 3P77B 2R0ZL 1YEGH 4GW1A 1CCZA 3SE4A 1J1PL 3MCKA 3UAJC 2DLHA 4EN3D 1WK0A 5EOCJ 5EWIL 3NABH 5C0ND 4MA3A 1S7SA 2GFBA 2ERJB 4OZ4A 4P5TC 1S9WB 5T1KA 3VRIB 1AR2A 3RHWF 2NZIA 4CAGA 5DK3A 4KI5E 2VERN 1AD9A 3MOQA 4ELME 25C8H 3DMMA 2PCPB 3MA9L 1MVUA 1YMME 3EYOB 2YPVH 3QDJA 1WWCA 1UGNA 4LPCA 1MFBH 2OL3B 2VLJA 1TDQA 4MAYA 2GSGA 3K2UL 2YPLB 3RZWA 4AM0B 2ADFH 1LVEA 1BQHA 4NGHH 3NACH 5C0EA 4RFEB 1J05B 2XT1B 3ILPA 3FOLB 4OSUL 1XCTA 1YEHH 1YEJH 2ICEA 2CLVB 4O51A 1QBLL 2AGJH 1U3ZA 2F19L 4HV8B 1V5JA 1SJXA 4CMMB 5EPMB 3O3EA 1HINL 3ARBD 3MXVL 5B21A 3KLAA 2GIYA 4IRZL 1LWRA 2VDLH 4K8RD 4LSDA 1I7TB 3IU3B 5I8KH 2IEPA 1MI5B 4HIHA 1U92A 1HSAB 1UADC 5E95B 3TCLB 3QNYB 1O5DT 3UBXB 5EUOE 1QSFB 3QEQB 3WCYA 2VUYA 1YYLH 4KJWC 3S88L 1MJ8L 1KJ2B 4HW6A 3Q6GL 2DIJA 3LV3B 4KZDH 4F2MB 2BVOB 4YDKL 3OGCA 3DSNA 4IBLT 5AWNL 2HT4D 3MRFA 2ICES 4QHKJ 5EORH 1FHGA 3JWOL 5SWSA 3WD5H 1R0AH 2BVTA 4KI5C 3UTSD 3ROOA 2YRPA 1TVBA 1P4IH 3MLWH 1NUNB 4JO3L 1CL7L 4ZAKC 4HH9A 3BPOC 5JHLH 2D0GA 3DTXA 4KKAD 4C4KT 1ZVHA 3VXRB 5D8JH 5ERWA 2A6JB 4IJ3B 2OTWB 3E6FB 4WWKB 4Z0XB 3SY0A 2QSCL 2CKBH 3AU1A 2G2RA 4XCCL 3X12A 3FRPA 2J88H 3TV3L 1I9IH 2IFFH 3HRPA 1OAYL 2R4SL 4NPYA 3WFBH 1MLBB 2Y7QB 4YAQA 3EYUH 4HPYH 5EA0H 1BQLH 2P47B 5JZ7D 4HQQL 4P9HL 1W8NA 1ADQH 4JM4H 1S7WA 3INUL 2N7BA 4RMVA 1MRDH 3BZEA 2NYYC 3NZ8B 3MRRA 3M8OH 3ZDYF 2VLLA 3NAAH 1PDKA 4RMQA 1M7IB 1B9ZA 2DKUA 4NOFA 4I0PB 2WIIB 3C6LC 2P5EA 1INDH 1U8IA 5E2VL 1GOGA 1U8OB 4MD5B 3OR7A 2OR7A 3MBEA 3Q3GA 1TZHB 1NDMA 4F8TA 2DD8L 3N50A 4TSCL 5K9KB 4PV8B 5CWSA 5F6HJ 4V1DE 2CK0L 3VWJD 2XRAL 4LMQE 5F93C 5GGVH 3BN9C 2FEEL 3QUKB 3NGBC 4PLJC 4EI5B 4FP8L 2HVJB 4OUUA 4Y5YB 3WL9B 3OBAA 1T5XB 4NKOA 4Y19A 3T3PE 4DAGL 1T89C 5ADPH 1FJ1B 2CXGA 4MAUL 4PGJA 4M43H 3CU1A 3A0OA 3UTQA 3BO8B 1JWSA 2H45A 2IG2L 4JM2B 3T0BA 1H3UA 1AO7E 2ED9A 1NUGA 4NP4H 5C0BA 1I3RB 4JJHA 3ZZ1A 1CR9L 2FATH 2LVEA 5JW4R 1SEQL 3WN5B 2KKQA 4K7PX 1EZVX 5CZVH 2MHAB 1BX2A 1FSKB 3D0LA 3AXLA 1Z0NA 5HD8C 1ZT7A 3OB0H 1ZLSH 3HLAB 4Y2DC 3VXPB 4XZUA 1Q9WA 5EU7C 1L7TH 3MV9D 3WS3A 1ZOXA 3MRIA 4OQTL 3QUML 5FKPA 5D7IB 4XXCA 1RZGA 4Y1AA 5I0DA 1J0IA 2A1WH 3GSNH 4GH7B 4MNGB 2ZUQC 4XCFL 4JR9H 1HQRA 2OXGA 3QQ3A 4Q6IB 4EOWH 3DGCR 4KJYA 4XP6H 2XZCH 4Z7NE 3QI9D 1MNUL 3FT3B 3L3IB 4WUKL 1A7QL 2YUVA 4NQCB 1KENL 5CGTA 15C8H 1N26A 4JPWL 1INEH 1H3GA 3K0WA 1MWAA 2F5BL 4HIJA 1MCOH 4YHNB 2YMXH 4J23A 1KPRA 3IDUA 1R5VA 3T2NH 4OI8A 4E41D 3VWKB 5DD3L 5DF0A 4P23C 5F96L 4ZFZB 1NDGB 4BZYA 3TBYB 5TQ0H 3ZKQD 2DQCL 2V17L 4XXDA 2NX5E 1IFHH 2JJWA 4X6FB 2A6KB 3B8SA 1QLRB 4CRPA 4XMKH 1EGJL 1FO0B 5ISZB 1BAFH 5EO1B 1KJ3L 4Y16A 5FO7A 3N1MC 5E9DD 4DFHA 3VFWB 4Y8DC 3DX8A 5CBEA 5EULV 3ULVF 3JWOC 3QEHA 1PZ5A 4PJAE 5CMAB 3WUWG 5C0AA 1OM3L 5JHDD 2VWEE 3RGVD 5IESL 1QRKA 5ILTL 5ANME 2P1YA 2YUZA 3QISA 3U2SB 3T65A 5E8DL 3EFFA 3P30L 3H3PH 5TQ2L 1U91B 3QRGH 3N06B 1ZLWH 2FJFB 1FNSL 5AEAA 3SCMD 5ICZB 1EV2E 2ZKHL 1E4JA 2H32H 5D1QA 3GHBH 2I9LA 1LK3H 4Q2ZA 5TGBA 4JHAL 2NY1B 4ODTH 2AJ3B 5HVFB 2CLRA 2NPLX 4IDJL 2ZCLH 3GSOB 4TSAH 1N6UA 3GHEH 4LSRL 4U1KB 4M03A 2YK1L 4P9HC 1ZT4A 5DJYB 4Z7QE 1JGUH 4HJGA 4N0YH 5IMKA 4J4PD 5J1SC 2AJSL 2IADB 4LPYA 4DK3A 4FQPA 3SDAD 5FEBA 3Q2CA 4YNYB 5FCSH 2FX9L 1RMFH 2C7UA 1A6UL 2W65A 2XKNB 1AGFA 2YRZA 1RUPL 3X3GL 1A1MA 5L2KB 3QXDB 1DN0B 3GMMA 4U1JA 4WGWB 1FL5B 4N9OB 4YHML 5L0QC 3AS2A 1WZ1H 5CEYA 1LP9A 2QQLL 5F7KC 1F11A 2EYRA 2GCYB 3JV6A 3OXRB 4NFDA 1NBVL 2IPKA 4PJDA 1EVUA 2OTUA 1NC4D 1I9RH 5M7QA 3K8MA 2YR3A 1MF2L 1OGAE 3RNKB 5A2KH 1N4XL 4GQ9H 4F9PC 2XIDA 2VWEC 4C59B 5J11B 5DZNA 5TF1L 3FZUC 2L7UA 5T33H 1T1YA 2X4NA 2XPGB 1NGYB 3BPNC 4P46B 4OZIF 2GJ6E 1B0GA 4ZOBA 1NMCC 5L6YH 2XA8H 1Z3GL 3BHBB 4LARH 3Q5TA 4MS8D 4CVXB 5T1DL 4MZ3A 4WFEE 2VE6A 1CVRA 4K94H 1MFAH 2BOCA 1T4KA 3VMPA 4ODUA 1RJLA 4KRPD 3KS0H 3HI5H 1UFUA 1G7PB 5EB9A 1RUQL 4OUOA 4NBXB 3WJJA 3ZYOA 4S2SA 3T1WA 4OT1H 4ALAL 4AG4L 4FQ2H 1F6LL 2BY3A 4XCYA 1BVKA 4N1EA 4LDEB 1AGEA 5TE6L 3C60A 2PYED 4JO2L 5E70A 1U8NA 3V6ZA 3L3KB 1DANU 1MRCH 5F3HB 2DQDH 3ARQA 3HG1B 3TIDB 3CMGA 2OR8A 1NAMA 4P0DA 3MRKA 5IFHL 3WFDH 5EZIL 4W4NA 1YJDL 3RTQC 4IM8A 3W9DB 4OLYH 5I1AB 4ZMAT 2GY7B 2O26U 2X4PB 3I75B 5IVNA 1T21A 2J4WL 3O8XA 2IAMC 1V3KA 3WIHL 5GGSA 4PRHB 2EH8H 5GGQH 5HJ3B 4F7EB 4C83A 2COQA 5J12B 3QDME 4TUKL 3O81A 3DECA 4XHJD 5EUKB 2EDOA 1I3GL 1ZK9A 3UPRB 3HZYA 3L1OH 2OP4H 4OFIA 4ONFH 5KSVB 4H25B 2WW8A 3DXAB 3EJZD 4O4YH 4ZYKA 1D6VH 2VDOL 3V8OA 3W0WE 3WKML 2E5EA 1T1XB 1T03H 2NNAA 1HSBA 3WLBB 4UU9A 4K3EL 1JNHA 4ODHH 5C08D 3O6KH 4XMLH 3GBNL 3MFFB 1QOKA 4OI7A 4P5TB 4X9IA 1QHOA 1WC7B 3VFVB 2YD6A 1LNUA 2R8SH 5D5MA 2R2BB 3JVGA 2Q6WB 3WS6C 3DVGB 1PW3A 3CXHJ 4BQ6A 5GS1A 4ZUWA 3BWUC 4CN4A 5ESQB 4D3CL 4P4KD 5CUSL 2FWOA 5BZWB 4HUMB 5MENE 2DI8A 2B1AL 1QD0A 1N7ML 1ETZB 1D5XA 1N5AA 3FONA 1IGCH 1PQZA 3Q6FB 4PREA 5DJ2B 3P40A 2ZOLB 3QIBC 4MD0B 3GSXB 4RGOH 5J56B 4Z78A 3TFKD 2CH8A 4RMUA 4U0RB 4A6YL 5FA4A 4YHZH 2EDTA 2E7BA 4UIMA 4OFYD 5DJAB 2AS5M 4LCWD 4TNWF 4RGND 1R5IA 4XPFH 5CD5C 5HHOD 4LLUA 3IT8D 3QDAA 4E42B 1YQVH 2OMBA 5IEHB 2V7NA 2PO6C 4XNXH 3WUWB 3SKOA 2NY7L 3DROA 1KC5H 3F65A 4E0RA 3V5KA 3KYNB 3ZT7A 2UYLB 1J9CT 4X9HA 2XKSA 3ARDC 5BJTB 3IFPB 1JN6A 3QG6A 5IV2A 2PXYA 1OW0A 4KDTA 2DB8A 3F5WA 2R69H 3HZKA 3PABB 3HNTL 4OGZA 1IAII 2Y5TA 4RAVA 4DZBA 3SKJH 4YPGB 2V2XA 3EZJB 2EDYA 3MA7A 2XZAL 5H8DA 1T7YA 4G43A 1NBQA 3O9WC 4ELMB 4ODSL 3U36B 4NRZA 5DUPL 3O3BB 3PGFH 5DLMH 4AZ8A 2ICWB 4ZAKB 1WCBA 1YMMB 4KXZI 4YHLH 5EU4A 4NQSB 2XQBH 2NR6D 3BPOB 5D9SB 1PY9A 1Q1JL 2JCCA 2APXA 4PV9A 1V3LA 3RIFF 4N5UA 2EYSB 2VZ3A 1H15B 4MXWL 5JA8B 2G75A 1UH4A 3STLB 4G8EB 5JUEH 1YEDB 3PGCB 2W60A 1LE5B 1V3MA 4P2OC 1LO4H 3FO1B 4D0DB 4HS3A 2V2WB 4GG6A 5A2IH 2HWZL 5J57B 1IL1B 3IVKA 4CADA 4UV7H 1HHHA 1DDHA 1EBPA 3IGAB 1OOAA 2YEZA 3LKSB 5E99H 4HKZB 2JJTA 2MSPA 2DWEA 4HKBA 1UH3A 5HGBB 4EN3C 2GYSA 3C6LB 5EUOB 5CSBA 3D2UA 4NKDA 2P8PB 1W72H 5C0NC 4R4BB 4DKAA 3RDTA 3QUYA 2X7LB 1DR9A 2WAHA 4XHQA 5HDQL 3AROA 4HX1B 3H0TB 3EOYG 5IFJB 3UTSE 4WNQB 5F7DA 5C0FA 4AEHH 1YJDC 35C8H 4E5XB 4H1LB 3UJIL 3S4SA 2HFFB 4NO0A 3NGBB 4ETQA 4CDHA 3VFPA 5DMGD 3U4BL 1ZT1B 3AS1A 1RZKC 1U3YA 3GSVA 1I9JL 1TJIH 1QRND 4LHJB 1EO7A 1MCPL 3H9SE 5DJCA 1CGYA 5KVEH 4PJHF 5DD0L 5J9PB 3GI8L 3P77A 3L5WA 5FYJD 4KPHL 5FF6B 2AQ3A 4XCNB 5FM8A 4WI8A 3DARA 3VXTB 3TO4C 3ARBC 2J6EH 1P4BL 4IRSD 2ED8A 2NY0D 1RIUL 4YQXL 1S9WA 3VRIA 1K85A 3GMOB 2V5RA 3IFOB 3PHQB 2FJHB 3ZYIA 4WIQA 4Y2DB 5TH2B 5DMIL 1XF3B 2F8VA 2IGFL 2PCPA 1UXSB 3GSUB 4YXKL 3EYOA 4XBGB 3WNLA 4OCYH 5E5UB 2K7PA 2JELH 2OL3A 1A6VL 4TRPL 2Z35B 4NOBA 1DBAL 1O7VA 2I27N 2YPLA 4AM0A 2ZUQB 5KVFH 3FQXB 3QIWD 5GGSY 2LAAA 3I50L 2AXFA 1P4LB 4RFEA 1IC1A 1D9KC 1XGYL 5LXGH 1EUTA 3FOLA 3KHOA 1QKZH 1JPTH 4KQ3H 2CLVA 3W2DL 4JN1L 4WCYL 3RWHB 4HV8A 5EIVA 4KKAC 4CMMA 5EPMA 3FO9B 4GJTB 2R29H 4X8JB 5LCVL 1NFIB 4X9FA 4P23B 2ZJSH 3C5JB 4LQ1A 3WJLA 4UAOC 1X5GA 1I7TA 3IU3A 1AH1A 1MI5A 1DLHB 3MLTB 1HSAA 4MQTB 3TCLA 1NUFA 1TQBC 3W5NA 2Q8BH 3UBXA 1QSFA 3QEQA 1SJEB 1AO7B 5K9QG 2XFXB 4JEGB 1J1OL 5FA3B 1E27A 5GRWA 3T3ME 2XACC 4XC1L 1MCBA 3HC4H 4JFYB 1QNZH 2Q3AA 4LIQH 1KJ2A 3LV3A 1FBIL 4F2MA 3ZDZF 2AABH 2BVOA 4X7DC 2NY2D 1ZLVK 1Q94B 3FO0H 4CKVX 5GZOD 2JJSC 4HT1H 1CQYA 1EEQA 5T1LD 5E94A 3QUXC 4AEIH 1J8HD 2I60H 1JPGB 1SY6L 4NHCH 2WBJC 4DTGH 2Y4SA 1OD7A 3VXRA 5C07D 2BNRE 3V0WL 1KXQE 2A6JA 1QYGL 5I18H 2OTWA 3E6FA 1KCSL 4HF5L 4WWKA 4Z0XA 5IJKA 1P1ZB 4LLYA 4ZUUA 4JPVL 2YD3A 2O5XL 4AEFA 1WFOA 2WANA 1AIFB 4S0SD 5HHPB 1CFQB 3W39A 3NA4A 1MLBA 1FZKB 2Y7QA 3FFCD 1H3PH 2BOBB 4LLWB 4PBXA 3MBXH 1MAKA 3QG7L 3MCLL 4DUWA 4HMCA 5EO9B 3VFSA 2DF3A 1JYNA 3NZ8A 1DLFH 3C09C 3C08H 4WI3A 3S35X 3WDIA 1SMAA 4I0PA 1QFPA 4YXHL 3C8HA 3HAEH 2D03H 5JO5B 1QFWL 2ZCKH 2NX5B 2O5ZH 5KOVC 4TVSa 1ZE3C 2R9HD 5E9DE 4FQQB 1WWWX 1IKNC 4MDIB 5IB2B 4LPTA 1TZHA 3ZO0A 5I1HL 3DLQR 5L0QB 1BJMA 5K9KA 4PV8A 4K2UH 1RVFL 2Y23A 2VLRD 3IDIB 3BW9B 3T0WA 5I76B 2DS4A 3QUKA 4EI5A 5JPMB 4PJAB 2HVJA 4QXUH 1F2QA 4Y5YA 3WL9A 1KIUA 1T5XA 3HMWH 4LCYB 1Q72H 1F13A 1T5WB 2JB6B 2NCMA 1MJUL 5ANMB 1FJ1A 4UT6L 3BPNB 3KLSA 3QFDB 1PY4A 2ATPB 3QI9C 4JM2A 5TFSH 1NMCB 1CFVH 1U8MB 2GW5A 1VB9A 5IHLB 1JL8A 5CHNB 5D1ZC 5CEZH 1I3RA 3NIGE 2QQNH 3W9EB 3WN5A 1KT2B 4NC1E 1XF2B 2MHAA 4KROC 5IBTH 2OZ4A 4PJ5D 2QQQA 1YN6B 2CJUH 3HLAA 3VXPA 3CU7A 3UJJL 3V4VL 2R2HB 4M7LL 4CW1A 5K9JL 5D7IA 3QUMB 3OSKA 2C9AA 1UM4H 4HHAB 3OKOB 3BZDA 2W9EH 3BZ4A 3IAGC 1IM9B 1RUKL 1HXYB 3MACL 1KBGL 4MNGA 5FCUL 2FECL 5BO1H 3QSKB 3RA7H 4LNVA 2DDQH 3CK0H 1VENA 5B4MD 3B9AA 5KANG 3NFPB 3FT3A 4TOYH 1NCAH 1UZ6F 5CZXD 2VZUA 3L3IA 3RTQB 5DJ8B 3CFIC 4LSTH 4R2GD 1T3FB 3R1GL 3ME0A 4NQCA 4F15C 3RGVC 3EDFA 4LSVH 3O6LH 4OIBA 4XP4H 2IAMB 4YHNA 1OGAB 3T0XA 4P2YA 4LLQA 4UINH 1RIVL 3SCMC 1WT5A 3VWKA 4I3SH 4ZFZA 1FORL 1NDGA 1MFEH 5CINH 1KCUH 4XVUD 3IS0X 1OQXA 1PEZA 4WDIB 3TBYA 2VXSH 5ID0B 4IOFD 2GJ6B 4JFPB 4MA8H 5SV4A 4X6FA 5F21B 3HZMA 2MPAH 4TUJB 1K8DB 1QLRA 5HSFA 2P45B 4D9QD 1FO0A 4I3RH 5GS0D 3EJYD 1H8SA 4K23H 5L8KB 3CFJB 3VG9C 3QRFM 1WGOA 4PJFA 2OSLB 3VFWA 3GSRB 1CU4L 3TVMD 3MJ7B 4G6MH 3L7EB 3QXAB 2MKLC 1D6EB 3JWNC 3SDAC 2F15A 4JO4H 2A9NH 3MLXH 1CWVA 2YN3A 1ZTXL 1MIMH 1RPQA 4X7SL 3U2SA 1U91A 2Q86A 4DKFH 1C12B 2FJFA 3OXSB 5ICZA 1MCRA 3GZKA 3RPIB 1T20B 3KJ4C 3QIBB 3FQWB 5GQBA 4JG1H 1P7QB 3MQIA 3VH8B 2E8ZA 3Q1SH 3MJ9L 4QF1B 1GVIA 3R4DA 2AJ3A 4J12A 3GSOA 3BSZL 5JTWA 1MPAL 3EHBC 4Q6YA 5IKCB 1I7ZB 5CLWA 4Q9RL 4PJIF 4U1KA 4I77H 3RJQB 4QRRE 3UYOD 4Z7UA 2IADA 2PO6B 4AK1A 3QDMB 4CU6A 6FABH 1JGLH 4TTDC 1PG7L 5T1KD 4Z7WE 2IBGA 1WIPA 4DKEL 5I0ZA 1OAKH 4YNYA 5AZ2H 1KPUB 4KUZH 3UTTB 4HWEH 2XKNA 3B8YA 3EDKA 1FVDB 3DMMD 3W0WB 5L2KA 4JHWL 3A6CH 3QXDA 5EFIB 4BFGA 1T0PB 1Q8MA 3QXVA 1FL5A 3QDJD 4NBYB 4XP1H 2VLJD 1WF5A 3P11H 3U48A 4WHYH 2GCYA 4Z0BL 3OXRA 1PKOA 4UBDC 1PVHA 2Y36L 5LG1A 1I8KB 3O9WB 1RULH 5GRVL 4KZEH 4XI5D 3RNKA 1AY1L 5E2WL 4S11A 1QA9B 43C9B 2MMXA 1CGSL 2IBBA 4JDTH 5I19L 3P4MB 5MENB 4OZGE 2XPGA 2HYMA 4JFOB 5DD6B 2VXUH 1JZ3A 4P46A 5K59E 1G7IB 2WM0A 4M8VA 4UIKL 3S35H 4G6AD 1CE6B 1XR9B 2RIKA 1UKQA 3BHBA 4CVXA 4LCIL 4MJ6B 1MHEB 3LB6D 3BYTA 4XP5H 5IW1B 1V7NH 2C26A 5I1DB 2GJZB 4P2OB 3V95A 5E0QA 4J3SA 4LP5A 3FB7B 3ARRA 2AJXH 5LGKA 2WNGA 4HFWB 1UWEH 1NQBA 2P7TB 1B2WL 3GRWL 1J8KA 4ZNEE 4XTRD 4NWUL 1C1EH 5SWSD 1H8NA 2XQYK 3D69B 4EN3B 4GO6B 3WDJA 1PSKL 2Y06L 3L3KA 4UOJA 1JV5B 5F3HA 3LH2H 1YC7A 5ITBL 4TSBH 1YPZE 3HG1A 3TIDA 2N7AA 1MWAH 5E5MB 4KJQC 2EDXA 4BYHA 1MCWM 1MCQA 1EA9C 2VO5A 4GKOA 4UI2A 1AKJB 3W9DA 4NHUB 5I1AA 2X4PA 3I75A 4P4KC 1DBKL 4YWGL 4U31A 4DN4L 2VMFA 4KRNA 4PRHA 5HJ3A 4F7EA 4D9LH 2DQGL 3MV11 4G6JH 1F6FB 1ZHKB 3UTOA 5EUKA 3UPRA 3TFKC 1JZ6A 4PJBA 2CGRH 3VGBA 4H25A 3DXAA 2B1HL 2D4DA 4M48H 5DD5H 3BKYH 1N5YH 4MYWB 3OAYK 3PUCA 4FS0A 1CE1L 3CSGA 2KH2B 4JZOB 1T1XA 5CJOL 2R56L 3GO1L 5SWQA 1KN2L 3WLBA 3DUSB 2XTJD 1G7HB 5LBSH 1E4WH 4EUPH 3DVFA 5GXBB 3LEYH 4BSJA 2P5ED 3ARBB 3TO4B 2VL5A 3MFFA 5CJXC 4AMKL 1NMAL 2XN9E 4P5TA 2FH8A 2ZZUT 3MBED 1WC7A 1S7UB 3VFVA 4EBQL 4OTXL 3UYRH 1X3DA 4GMTH 2XWBB 3OZ9L 2R2BA 2Q6WA 3DVGA 3O3AB 4YZFE 3ULSB 4P9MH 3X3FL 2BXYA 1UT9A 2HN7B 5BZWA 1EUUA 1ETZA 3Q6FA 2CRZA 4Y19D 2ZOLA 3BD3A 3CVIH 1JWMB 3GSXA 3TBVB 3TYFB 3REWB 2AI0H 4A6YB 3BKCL 5TPWL 4X6EB 3NTCH 1EJOL 2XICA 3UTSB 3IETB 3AVEA 5DJAA 4HULB 1D9KB 5IM7B 5D72L 1FLTX 5IW3A 5BV7H 3G5VB 4FG6D 4NQEE 2D3VA 4G8GE 5IEHA 3WUWA 4PJ7F 1S5HB 1B4RA 1N0XL 1JPFB 1MJ7L 5DDHA 3KYNA 2R2CA 2UYLA 3H9SB 5GRZA 5JOPD 4UAOB 1RJCA 5E00B 5BJTA 4Y5VC 3NIFF 3IFPA 5IQ9B 1TQBB 1A7BA 3IXAB 3VW3L 3UO1H 4FFVD 1NGZB 3TCXA 2Z31A 2GHWB 1JRHH 4LCUB 3GNML 3FMGH 2UV3A 4Y1AD 1ORSB 1WITA 5SX4I 3PABA 1DEEB 3DGGB 4YPGA 4OFPA 5GZND 1BBJB 3MX0A 3ZE2F 4GXVL 2YD1A 1HCFX 4NO3B 2XWJB 3QUXB 4ELMA 3U36A 4DZ8B 3LMJL 4NNXB 3O3BA 4PG2A 2ICWA 4ZAKA 3EOBB 4L8SC 1YMMA 3BOVA 3H9ZA 2WBJB 4NQSA 5D9SA 3RY4A 2D2OA 3GEWB 1CD9B 1Y0LB 5DJ6B 4R96B 4RFOH 1AE6L 1DBJH 3OB8A 2AJVL 2IQ9H 2EYSA 2F9BT 4GBXC 3STLA 2KQMA 4PP1C 4PGZA 5JORB 1BIHA 4G8EA 2P8LB 4LMQI 2FGWL 1YEDA 3PGCA 1LE5A 4AH2B 4X0KB 3FO1A 4TPRH 4D0DA 4JY5H 2BSRB 4NM8H 1QQDB 1IL1A 3KYMB 4Y16D 2MCG1 3IGAA 3LKSA 3C09B 4HKZA 4CU8A 1NAMH 1YYML 5HGBA 2WUBL 1N6QH 3AB0C 2WLYA 4M6OL 4U49A 3SGDH 3C6LA 5EUOA 3AFLA 4R4BA 2NY0C 5B22A 2X7LA 2EC8A 4FQCL 5IROC 2H2PD 5EC1B 1M71B 4HX1A 3H0TA 5IFJA 1ZHBA 4WNQA 4PY8I 5I1LB 3OQ3B 2DLEA 4E5XA 4H1LA 5D1QD 4PR5B 2HFFA 4JDVB 2WWKT 4MSWB 4N0CC 4JFEE 2RR3A 2RAMA 3TYGL 2FHCA 4I8DA 2Y5EA 1X5LA 1ZT1A 5BS0E 4ONGH 1C08A 5JIKA 4WJ5A 4UILL 1T89A 4S1RH 3RKDC 2BNRB 1ZHLA 3QZWG 4MCYB 5J9PA 5E2TH 3BP6B 3QI9B 1J18A 2Z92B 3CVHH 1SVCP 5FYLD 1UC6A 5FF6A 4R4ND 4XCNA 3WFHA 4F7CB 1K6QL 5D1ZB 5IHUH 3VXTA 3M07A 4MLIA 4WW2C 3WV0A 4FXLA 3ARGC 1M7XA 4IRJC 4KROB 1OAQL 2A77H 3GMOA 5E4EC 3PHQA 1S5IH 2FJHA 5BMFH 1F4YH 4Y2DA 4HS6B 2VR9A 4WO4C 1XF3A 2Q7NA 1OARH 2Y07H 3EO9L 1KEML 1UXSA 3GSUA 1WZMA 3UYPA 4XBGA 4PD4K 3IDGB 1IGMH 4JHZA 4OLZL 1A3LH 3S8WA 2Z35A 3R8BB 1CLZL 2X4UB 5E9DB 2CDFB 4HKXB 4S1SH 3BPCB 3QEGH 2VLRE 3FQXA 4OJFH 1KPVB 5I16B 2R0WL 1MCEA 1FRGL 1EO8L 5GZOC 1P4LA 4V1DA 4H0HB 4PJEE 2I5YH 2J12B 3BVNA 2VKWA 2DLIA 2FEEI 3BE1L 3ET9F 2X4QB 4F15B 2C4FU 3RGVB 5F1NB 4GMSH 3RWHA 4ZTOL 4NDMB 2JIXB 4XPAH 4X8JA 4JGMA 2BY2A 1NFIA 5HI5D 2BVUA 4YXLL 4P23A 4G8FB 3TIEB 4TULH 2QKIB 1BP3B 3D18B 4PJXF 1DLHA 3MLTA 4FN0A 2VOTA 4JDZB 5F9WC 4OLVL 4JCMA 1OLLA 1SBSL 1SJEA 1AO7A 2Y1VA 2XFXA 4KY1H 3GK8H 4W81A 5FA3A 3RU8L 1XF5B 3HC0B 4JFYA 1U93B 3LRSB 1DL7H 4GKNB 1DP0A 4O2EB 4GRWE 3OG4B 4HC1H 3LD8C 3VG9B 1E6OL 2X1QA 1Q94A 2BNUB 4X8XA 3TJEL 3SDAB 4X99B 2HTLD 4EI6B 4ISVB 5IIEB 2YN5A 5IFAL 4NZTH 1JPGA 1A47A 3K8KA 2WQRA 3O8XD 2FJGB 2APWA 4MQXD 4R90L 2EC9U 4OD1H 5FO8B 1P1ZA 4OZHA 4EEEA 3KJ4B 3L6FB 1GIGL 1NCWL 2BSTB 4XC3L 2YUXA 2YA0A 4HLZG 4AT6B 4HUVB 1EEUA 1AIFA 5HHPA 1CFQA 4WWID 5F7LB 1FZKA 3MFGB 1WZKA 2BOBA 5EH1A 1BZ7B 1WAAE 4LRNL 4O9HH 1ZLUK 5EO9A 2J8UF 4OM0L 3JV0A 2IPUK 1AQKH 4H8WH 3ALXA 1HH9A 3R0MA 2VQTA 4OGYL 4TUOB 2ZUWA 3BPLC 5JO5A 4RA0C 5M95B 3QO1A 4QXTB 2NX5A 1NSNL 4ZTPL 1U3JA 3H9HB 4FQQA 2EDDA 4JG0H 4PGDB 4MDIA 3JWDL 1D7FA 3LS4L 1BFTA 1U8PB 1LO2H 3KPSE 3B3IB 1FNLA 4Z77B 1GXEA 1A2YB 1ZVSB 3IDIA 4LEXL 3BW9A 5I76A 1M7DB 4KK6C 2PR4H 2PTUA 1A3RH 5FKAB 2VN7A 3P0YL 5JPMA 4PJAA 1BZQK 4YBQC 3RPKA 2IPTL 3MRLB 4F9PA 1EIBA 1YEEL 4LCYA 2JB6A 1T5WA 2AJUH 4KMTL 5ANMA 4QTIL 2IMMA 3VD9A 2YRLA 3QFDA 4MA7L 4YH6A 4ZO9A 2ATPA 3FQNB 5GSRB 1CXIA 1TZGH 4QRPD 1CLYH 2QR0B 1C7SA 5I1GL 3QA3B 2VXVL 5HHXH 1U8MA 2H3NB 1FG9C 5CHNA 3VGGA 1ZKAA 5D1XD 1JNLL 3W9EA 1KT2A 2WV3A 1XF2A 3FQTB 2PXYD 5A2FA 4BFIB 1DBML 4YX2L 1YN6A 1JJUA 4QRRB 2MQ3A 4IOFC 1UCTA 2CUMA 2R2HA 5KVGH 1RFDL 1HDMB 4L29B 3SOBH 4Z7WB 3VDAA 4OQTA 3QUMA 4LSSL 1JPSH 3MJ8B 3HE6D 4HHAA 2CO6B 2YD2A 5BZDB 3QZWB 3FN0H 1IM9A 1Q0YL 3NIDF 1HXYA 4J7RA 2Q7YB 5KW9L 4R6UA 5ENWB 1FIEA 1P84K 2VDKH 4XNYL 5E6ZA 4U6XB 4NJ9L 3DV6B 3IFNL 5EZLB 5KVMC 3FTGB 2Z8RA 3RWDB 4LSQH 3NFPA 3F7YB 5DQDL 3F7RA 3RTQA 1T3FA 1KYOK 5GJSL 4CJ1A 2VDQH 4OCMC 2PN5A 4P4KB 2WBWB 3ULUD 2IAMA 5K33A 1F4XH 1I1FB 1U9KA 1OGAA 4X80L 3NFSH 1C5CH 1I1YB 5DHVH 1VFBA 4OZGB 4WDIA 5ID0A 1RZJH 2GJ6A 1F58H 3IYLW 3LSOB 5CS7A 5GISL 2NY3D 4JFPA 1X5IA 3EOTH 4TUJA 1K8DA 1JZ7A 3SE4C 1EGJA 3OG6B 1DQML 4YJZL 1J0YA 1I3VA 3CFJA 5C0JB 2OSLA 2HTKC 5F7EL 3GSRA 3D2UD 4N5EC 3MJ7A 1IE5A 3L7EA 3RDTD 3QUYD 3QXAA 1JHKH 1D6EA 4R8WH 3MLSH 4N90D 3WS6A 4ODVL 5IHZB 1U36A 2KQNA 1CD1A 2L0DA 5I15L 3DMMC 4KVCH 1NCDH 4NO0D 4M5YL 3OXSA 3NCJL 3VXUD 3MLRL 3G9VA 4OZFG 3RPIA 3QIBA 3FQWA 4M7JL 1YPZB 3EYSL 3VH8A 3OWEA 1KIPB 4QF1A 1OT2A 3CMOH 3O45B 1V7MH 3NABL 3SPVA 4XI5C 5IKCA 1UH2A 1I7ZA 5HHNB 3WDHA 1ORQB 1OP5K 5B38G 1H3WM 4KTDH 5H35B 2PO6A 4L3EE 1FFQA 3QDMA 1IC5H 4G5ZH 3D0VB 1KCRH 1RAMA 2YPVL 4NM4L 5JR1H 1FLRL 5IB5B 4Y5VB 1KPUA 3LB6C 3BUTA 4YEEA 1FVDA 4GUPB 3W0WA 2ADFL 1OAUH 1TZIB 5EFIA 1IGYB 5KSBF 2F74B 2P46B 4NGHL 3JWDC 5J3HD 4LGSB 2AQ2A 4GSDH 5KANI 3WBDA 3MRQB 4FQIL 5EC2B 3LKQB 4BK5A 2XN9B 2AGJL 1OCWH 1I8KA 4KJPC 3EYVB 3O9WA 4ZFGH 3REVB 2B4CH 5FDWB 1QA9A 43C9A 1KJVB 4L8SB 3P4MA 5MENA 3B2UD 4JFOA 4NYLB 5DD6A 4OV6F 3GB7B 1AQDB 1G7IA 1BJ1H 1CE6A 3RL2B 1XR9A 2FIKB 3BD5A 1YYLL 3Q48A 4GBXB 5L7XL 1LEGB 3V2AR 3TH4T 4MJ6A 5I1JH 2I24N 3PXHA 5TDOB 5IW1A 3ZTJH 1MH5B 1NPUA 5I1DA 4U1LA 3QEQD 2GJZA 4XWOD 2QHRH 1HE7A 1G9NH 4NQEB 4DGVH 1R0AL 4JE4B 4NIKB 3FB7A 3HUJF 5EOTB 4G8GB 4HFWA 1P4IL 2P7TA 3MLWL 3Q0HA 4L3AA 4HAFA 2PW2B 5FYLL 1AHWC 2J8UE 2Z93B 4YUEH 5DQJB 3CDCA 5D8JL 4NQDE 3D69A 4EN3A 4M5ZL 4LLAA 2EYTB 3WXWH 1J0ZA 4RCAA 4RAUB 4DK6A 4X4YB 3TBTB 1JV5A 4QNPF 5DJXB 1UWGH 2J88L 5E5MA 3P0VH 2MTPA 3G6JF 1AKJA 3EYUL 1AJ7H 4NHUA 3QPQD 1WJ3A 1ADQL 2O5YH 1HN1A 2D7PA 3WIHA 3KHQA 1MRDL 4GAYB 4OCRL 3UTPE 1ZHKA 2DM2A 3M8OL 2BHZA 4NC2B 1MCHA 1BM3H 1HYRC 1IQWH 4W4OC 3RVTD 1EMTH 4KK8C 1ITBB 4JZOA 1BEYH 2BVQB 5ALBH 3FT4B 2LAGB 3DUSA 1CXKA 3V5DA 1G7HA 1ZAGA 4LL9A 5D7LE 4I0PD 1Q0XH 5HHQB 3I3EA 1CF8H 3TO4A 4XX1E 4WW2B 3RHWK 3ARGB 4KV5F 3WFCL 4IRJB 3PV6B 4ERSH 1S7UA 4MJIE 3MO1B 1BMGA 5DJ0B 2XWBA 1RUMH 3QHTC 4WO4B 4CMHC 3O3AA 4FFVC 3SN6N 2DM7A 3ULSA 2HN7A 4UOW0 4EI5D 3MODH 3A6OA 1UYWH 4M43L 3E2HC 1VHPA 4Y0GA 3N1GC 3TN0B 1JWMA 3TBVA 3BIAX 3TYFA 3REWA 4A6YA 4NP4L 4X6EA 4HUKB 2PNDA 5D70H 3SO5A 3UTSA 3IETA 5DWUH 1D9KA 5IM7A 1GYAA 3A67L 3LRGA 5CZVL 4JM2D 1KXTB 3MNVB 4UZGA 4X5XB 4JFEB 4R26H 4HIXH 2DQFB 1ODAA 4XPTL 3FN3A 5BS0B 3NA9H 3BJ91 4HZLB 1L7TL 1S5HA 3ZTNH 3OKEB 1YNTB 4MXVF 3X14A 1U6AH 1JPFA 2ID5A 5FYLE 3H9SA 5E8EB 4XNMB 2HRLA 1CXFA 5E00A 4S0TD 2XOTA 4U3CA 3MRPB 5IQ9A 4JY6B 3S36X 1H8OA 5F9WB 3IXAA 5DRNB 1NGZA 4JR9L 4OZFB 4NFCA 3RAJH 3KVQA 4LCUA 1GPOH 1BQHG 4EOWL 4XP6L 1ORSA 1OP3H 3LD8B 4QHMB 3T8XB 1DEEA 3DGGA 3KYKH 4OF5A 1BBJA 2MNUA 3ZLQC 1INEL 2JJSA 2KL6A 1MCOL 5HYQB 4O2FB 4NO3A 3T2NL 2XWJA 3QUXA 4DZ8A 4MJ2A 4NNXA 5LWYH 1IC4L 3QIUC 4NQCD 3EOBA 1A5FL 1D5IH 4HWBH 2WBJA 4MCZB 4M1DL 5TQ0L 5DHXB 1Y0LA 4R96A 4LFHD 1IFHL 2KDGA 1KSRA 3VI4F 2ZUVA 1DQTA 1E6JH 3CSBA 2VLRB 1JFQL 2EEBA 3C8KB 2JK5A 2FD6H 3THMH 3SJVE 3VGAC 1WCQA 5JORA 1BAFL 4PJEB 2P8LA 3H8NA 1PAMA 2B7DT 4TYUA 1YEFL 4AH2A 4X0KA 3RUGE 3I02B 4UT9H 2AEPL 3G04B 5I1CH 2BSRA 1QQDA 4PTUB 1NANI 3KYMA 4ZFFB 4G7VH 4FMFA 1ZGLM 4Z18A 2DTML 2GKIA 3HA0A 2D9CA 3H3PL 3NPZB 2R1XB 3MOAH 3BPLB 4WTWA 4OB5H 1OB1B 2BVEA 3VXNB 1FCCA 1L4IA 1R3IL 3GHBL 4GLRI 1LK3L 1IC7H 3ETBF 1IKNA 7FABH 5EC1A 3SE9L 4ODTL 5JMRA 1M71A 3ARTA 1TLKA 4GRWB 2V5SA 5EOCH 4JDVA 3QCVH 4MSWA 4NUGL 5ID1B 2D31B 2NY1D 1J0JA 5C0IB 2VAAB 2A73B 2BC4B 1UM5H 4JPIB 3B2VL 4E9LA 3CSPA 4FZEH 2CUHA 1MVFA 2BNRA 4PB9H 1RMFL 4MCYA 5T3ZH 3BP6A 3QI9A 2Z92A 3HR6A 3SKMB 2ZOKB 3B9KC 5EBWB 2VC2H 4H88H 1FVCB 1XFPA 3ULUL 4F7CA 5D1ZA 3BXNB 2QSTA 1QACA 2CXKA 3AM8A 1NBZB 2FRGP 1T22B 4HXBL 3BH9B 4YDJB 2AJYL 4JLRA 1JYXA 5L2KD 1FDLL 4D8PB 3O2DL 1I9RL 3AMLA 4JRWA 3SDCC 1IARB 3O41B 4HS6A 3WXVH 1YY8B 3PGDB 2VH5H 1ES0B 4Z76B 3S34H 2VUOA 4W6YB 2BDNL 4O2CB 3G6DH 2VR5A 5T33L 3JTTB 2HFEB 3IDGA 2C1PB 3RVUD 1QFWI 4C58B 2X4UA 4OM1H 5E9DA 2CDFA 3MOBH 5L6YL 2XA8L 4WTZA 4RNRB 5KBNC 5EG6C 1KPVA 5I16A 4ORGB 4NC0B 3C87A 3KPSB 4P46D 2HTLC 3BIBX 1MFAL 5C7XL 2CDGB 2VSCA 5IGXH 4S1QL 2W9DH 2X4QA 1UACH 3RGVA 2BCKB 5F1NA 4NDMA 3HI5L 3SDXE 2JIXA 3O8XC 1QG3A 1F8TH 2FHBA 3BKML 3KPLB 3JSSA 1JMZA 5ICXB 3QQ9C 2IF7A 1G6VK 1FGVH 3BUYB 4G8FA 3K2MC 4QRPE 4Y89A 3S37L 3TIEA 1PYWB 2QKIA 3D18A 5HDBE 3RNQB 4F7MA 4EDXB 1CIUA 4L8DB 2VXQL 1B6UA 1CBVH 4ZD3H 1MRCL 1QBMH 1JI1A 4ZUVB 1XF5A 3HC0A 1GRWA 3KR3H 3RX5A 1U93A 4OFVA 3LRSA 4GKNA 4O2EA 1VKXB 4UTBL 1QPPA 3D39E 3MLUH 4OLYL 4N1CA 2OJEB 2BNUA 4OZ4B 1CFTB 4PRPE 3HG1D 3SDAA 5DURB 8CGTA 2EH8L 5GGQL 2C3VB 4EI6A 3C5ZA 4KHXL 4ISVA 2FO4B 2R0KH 2YZ8A 2OI9B 5GS1C 1F4HA 3DMMB 2DQJL 1SY6A 1T6WA 1ZGLP 2OP4L 2DRUA 2FJGA 1IZJA 4PRHD 1H9VA 3NH7H 1AFVH 4YBHA 1D6VL 2FECI 1CK0H 2GSGB 1KN4L 3L6FA 3S36H 2BSTA 3QR2A 3ULUE 4ODHL 1R3KB 3VMNA 5E56A 4PRBB 5C09D 1IKFH 2IFGA 3O6KL 1BZ7A 4OIIL 2A38A 3LCYA 2J2ZA 2NZ9C 4PTTB 4BSWB 2HAZA 2R8SL 5DFWH 3DRTA 3ROLB 4NZJA 1A9EB 1L7IH 4M7ZC 4TUOA 2M1KA 1MCIA 4M9OA 1P53A 2HJFB 1NCCH 1U92B 2GTWB 4QYOA 4QXTA 5D1XC 5SWZD 4RGOL 4LLMB 4PGDA 2I9TB 3TWCH 4YHZL 3J8F7 4P3DB 1T2JA 1U8PA 4QGYA 4EVNB 3AS3A 5I1IL 4OCNC 4XPFL 4HBQA 4Z77A 1A2YA 1ZVSA 3OGCB 1AP2B 1B4JL 3BKJL 1M7DA 2XZQL 5FKAA 2EIDA 3HE6C 4XNXL 1MAML 2HKFL 3G9AB 3MRLA 3FN9A 1KC5L 3VXUE 2R0ZH 3JTSB 3GUTB 1BD2E 1J1PH 4FOMA 1J87A 1VESA 3OJDB 5EWIH 3FQNA 5GSRA 1H5BC 5DUBB 2FLBT 3QA3A 1H3TA 2BJMH 2H3NA 1KCVL 1EDQA 4Y5XC 1AXTH 4L4TD 3ULUC 1P69B 4DVRH 1TTFA 4LK4A 5JMOC 2X4RB 3HPLB 3GMNA 3VRLF 4M3KB 3SKJL 3FQTA 1ZVYA 2Z31D 5CLTA 1FFPA 1R6VA 4HEPG 4XT1C 3JUZA 4KJWD 4BFIA 4GW5A 3PWPD 3MREB 2VQUA 1QHPA 4QRRA 1E4XH 1I1CA 1KEGH 1IBGL 3PGFL 2NY3C 5DLML 3TBSB 1AHWB 4L29A 1HDMA 4Z7WA 5HBBA 2XQBL 1Y6NR 3MJ8A 4KI5D 4OGAD 2HFGL 3QZWA 4MMZC 4LOUC 3ZT5A 2Q7YA 2P5EB 4OSUH 5ENWA 5DMJB 1AC0A 1YMMD 1CFBA 3QUYC 4U6XA 3DV6A 5EZLA 5JUEL 3RWDA 2H41A 1HINH 3F7YA 3EYQD 4OLUL 4JKWA 1Y18B 4JFFE 3BMWA 3ZE0E 1TTGA 2V9QA 1QP1A 4P4KA 3QXWA 3W81A 3WLWC 5IG7B 2C3GA 4UV7L 1FFNB 1I1FA 1ROWA 2FBJL 1JK8B 4XGZB 4OUUB 1M05B 2VJXA 3KPMB 1I8MB 1S7TB 1I1YA 1OQOA 1C16B 2LU7A 4OZGA 3CX5J 3GSWB 3Q6GH 5DUMH 3OTTA 3LSOA 1AR1D 4YDKH 2NYYD 5JXAL 4XPHH 4TNVF 3PHSA 3S9DB 4JFQB 4AEHL 5C0JA 35C8L 4JO3H 1IT9L 4XNUH 1CL7H 1T2QL 5CJXA 3G6AB 1LGVA 4HBCH 4XMPL 4KKLC 2A6IB 4D9RE 4F9LC 3GKWH 5F72S 4XB8A 4ZNEA 4LNRB 4CMHB 3U7WL 3BN9D 5MHSD 4Z7OE 2EXWC 4NQDB 5J3HC 4P57B 3E2HB 1PGRB 1CGVA 3CDFA 1YPZA 3FT2B 1KIPA 3MJ9A 2JB5H 3AMKA 2J6EL 2AV7B 1MHHB 3RVWD 1NFDE 3CNKA 5HHNA 4B7LA 4PLKC 1KB5L 3BAEH 5M94B 3O4LD 1GOFA 5H35A 3TJHC 1F3RB 1WSST 1CGWA 3D0VA 1J1XH 3LQAL 2VN4A 1HCVA 3MV8D 4WEBH 5HD8D 4OCYL 5DJDB 5IB5A 1WICA 4Y5VA 4LP4A 2QSQA 4Y2DD 4MGXA 3LZFL 1TETL 4GUPA 2ITDB 1VADB 1TZIA 4XWOC 5KVFL 3KPNB 2F74A 2ZUTA 4WFHE 2B2XH 2UWEE 4RZCB 5D7LB 5I74C 3QAZC 1FZJB 3MRQA 3NPSC 5EC2A 3LKQA 5K9OB 4LVEA 1QKZL 3HFMH 1R3HB 2XN9A 2C1OB 2JJVA 3DX8B 3CFBB 4ZXBC 5ICYB 4MJIB 1QSZA 4ZS6D 1CDCA 1GC1H 3EYVA 4V1DD 2R29L 4LPXA 3RY6A 2IG2H 3REVA 2ZJSL 5FDWA 1KJVA 3QIUB 4L8SA 3MLZH 4KKBC 4B5EA 3BJLA 5D71H 4F37F 3DIFB 3GB7A 3RIFK 1AQDA 1SEQH 3RL2A 3SE3C 2FIKA 3B5HA 4GBXA 5HY9B 1LEGA 4LIQL 3VGAB 3R0NA 1KG0B 4NCDA 3QH3A 4FFWD 5TDOA 3SE8L 5I9QC 4HUWB 1MH5A 4Q97A 2ARJQ 4OCSH 3FO0L 1J5OL 4NQEA 3PNWB 2X9XA 2XG5A 2UVFA 5EOTA 4G8GA 4HT1L 2HH0H 3RVTC 1JGVH 3MRMB 4OCLC 4GFTB 3GRWA 4XCFH 2PW2A 3MR9B 3TZVC 1A4KB 4JKMA 4J6RH 5GHWH 4DTGL 2Z93A 3IXTB 3MRJB 5DQJA 1NLBL 3GDBA 4I0PC 4HK3N 4CJ0A 2EYTA 3RWJA 4RAUA 1A7QH 4X4YA 3TBTA 5AYUL 3U7YL 1A1MB 1HHIB 5DJXA 2R4RH 5IROA 4XH2B 4U1JB 5CEYB 3K8LA 3FQRB 4I4WB 12E8H 5DD3H 1H3PL 5A40E 2AK1H 5FGRA 1WLHA 4DUVA 2IPKB 1R3JB 2DQCH 3HR5B 4GAYA 1A6AB 1X5HA 4DUXA 5C6PB 3C08L 1MELA 1X5YA 1EGJH 2EO9A 2VQ1B 1QEWB 4U4BA 5F97E 4FA8A 1JYVA 1NKOA 4JAMB 5EZOH 1FAIH 3GIZL 4NWTL 4RMWA 1B0GB 2BVQA 3B9KB 1JWUB 3FT4A 4ZFOA 3SJVB 4JRYE 4NRXB 5HHQA 1GAFL 4KKCC 4K2UL 2NX5D 3MRCB 4HAGA 1OM3H 5HGAB 3RUGB 3KNBB 4WW2A 1RD6A 3ARGA 3S4SG 5IESH 1CTOA 1JHLL 3ARED 4IRJA 4JGJA 5K93A 2DLFH 3PV6A 5E8DH 5TQ2H 3MO1A 2AXJA 3SDCB 5DJ0A 1FNSH 3L5XL 4MJ5B 1BQSA 4WO4A 4FZ8L 3GJEB 1Q72L 4ZS7H 2LTQC 2ORBH 4H20L 5FXCH 4JHAH 2XG4A 1LMKA 1U8HB 1JIBA 1JGDB 1SYSB 3IAPA 5L9DH 5TFSL 3TN0A 1WVZA 4TN9A 3FZUD 5CEZL 4ZG1A 4LIQE 2Y9RT 2VITB 3MLYL 3SDYL 4OF3A 2JF1A 1FL6B 4FMKA 1ITCA 1NCUA 3FAWA 4QEGA 4OFDA 3LHPH 5C71A 5IBTL 4F80A 4X5XA 4JFEA 3D85B 2DQFA 1J11A 3O8XB 3V7AE 5JW3L 1F02I 1A6UH 5BS0A 5I1EH 4HZLA 4Z7UE 3OKEA 1YNTA 2CMRL 3LQAC 3UC0L 5E8EA 1RK1A 4XNMA 3P4NA 3HZYB 1X5ZA 2O93L 3MRPA 4NZUL 4JY6A 2W9EL 4ELKB 4UQ2B 5DRNA 9CGTA 4OZFA 2DWDA 3RA7L 3CK0L 1NBVH 1A7NL 4LEOB 5I71C 4TOYL 1MF2H 1NCAL 2HLAB 3MYZA 1IQDB 4QXGH 5CGYD 4QHMA 1IM9D 3T8XA 3RVVC 4I9WE 4LSVL 1I75A 4QRQB 4MB4A 4C56E 3K1KC 5HYQA 4O2FA 4UINL 1I8IB 2VB5A 5C2BL 1CDGA 2PKDA 1A21A 4I3SL 3RTQD 4X6DE 5GS1B 5CINL 4U7SA 4OV5B 3TNNB 4MCZA 2AEIT 4IMKA 2VXSL 5T1DH 1UVQB 2IAMD 1OGAD 4AIOA 4MA8L 1N5AB 1PQZB 3DV4B 2XWTB 1U8JB 2MPAL 5JQHC 2VLRA 3C8KA 3BESR 4I3RL 5IMOB 3RWEB 4K23L 1WISA 4PJEA 1RUQH 1HI6B 2GJ6D 1BWWA 4FHBD 4FQLH 4X4ME 1R5IB 3G04A 3ZDXF 1YEKH 4LLUB 3SDXB 4PTUA 4NKMB 4LQFL 1DEDA 2A9NL 4ZFFA 1G7JB 3K4AA 1U0QA 4QRPB 5JW5A 2NY6C 2AEQL 4M7ZB 3IDXL 2R1XA 1DSFL 4LASL 6CGTA 1OB1A 5IFHH 5EZIH 1YJDH 5D1XB 4HEME 4PPTA 4JG1L 2XQYG 1X4ZA 2J4WH 3Q1SL 1G6RL 3ZHDA 5T5NF 5CEZE 1WUNT 4N8CH 3D39B 4TUKH 1I4FB 1RZKH 1XCQB 3QIBD 2DI9A 2V2XB 5ID1A 4I77L 4AL8H 2D31A 3HE6B 5C0IA 1SMOA 2VAAA 4FFZH 2A73A 3BISA 3MUY1 6FABL 4JPIA 3K4DA 1JGLL 3NMEA 2VDOH 4QXWA 3WKMH 5C6TH 4X4XA 5CD5D 5L2JB 4K3EH 3E0GA 4QTHB 3KWWB 4G8IB 3O6MH 4LSUH 5IMMB 4HWEL 3U7AA 3U9PH 1H5BB 3QDMD 3GBNH 5C09E 5I30L 1L6ZA 4UMGA 3SKMA 2JLLA 2J1KA 2ZOKA 5EBWA 3T0EE 4K8RH 1K3ZA 1FVCA 4Y5XB 5HI4C 3TO2B 3KGRA 4ZO7A 3WFEH 3BXNA 2G5BB 1KELH 1NBYB 3BP5B 1NBZA 1N64H 4RRPG 1BJ8A 1T22A 4KTYA 3BH9A 4YDJA 1HXMB 3W0WD 4D3CH 1WAAA 4D8PA 4HS3B 5CUSH 2C3XA 2B1AH 5HTSA 5TJWK 2OM5A 4KZEL 2VYRE 1YY8A 3PGDA 1ES0A 4RWYL 4PD4J 2NY3B 4BK4A 1GZQB 5SWZE 5DA4A 3P9LB 4O2CA 1LO3L 2VL4A 7CGTA 4KMQA 1LP9F 2VXUL 3JTTA 2HFEA 2C1PA 1FNGB 5E2UL 5D2LE 2FSEB 4NCC1 4PJDF 1DANT 1TQCC 4HXAH 1REIA 5BW7C 1QVOB 1BIIB 4RNRA 3EFDL 5MEND 4ORGA 5JDSB 4PJGE 1TIUA 4LLVB 3KPSA 1V7NL 3FKUS 2NY7H 4U1GC 5F7DB 4OCXL 1QR1B 5FUZL 5GRXG 5A2JH 2BCKA 4JQIL 2AJXL 2QTEA 4PIRF 1UWEL 3KPLA 4XAKD 4GT7A 3VXUB 3OJMB 3BUYA 1J7VR 1BD2B 1C1EL 3WHE1 3OPZL 4QO1A 43CAB 1PYWA 3RNQA 1HYSC 1JHTB 5GSVB 4EDXA 4NN5C 4L4TE 4L8DA 5A1AA 2AQ1A 3HNTH 3EUUA 2D0HA 3KJ6L 3H9YA 1Z9MA 4TQEH 4OLXL 3T0EC 3L5WB 3LH2L 4ZUVA 3K81A 3QXTA 1CDJA 3KPTA 1TPXC 4P5KB 1VKXA 1CICC 3PWPE 3VFGH 4BA8A 3E6HB 4ODSH 2HP4A 2OJEA 2NQCA 4DQOH 1CFTA 2LV4A 1Q1JH 1D3CA 2C3VA 4CU7A 3L9RB 4WRLA 3VFTB 8FABB 2FO4A 4LFHG 1TNNA 1AKJD 1HILB 2NXZC 5D6CB 2N1KA 4NKQB 1KIRB 4DW2L 2EDWA 2RCSL 2CGRL 3H6JA 2BNQE 5DD5L 1N5YL 2ARWA 3O2VL 1T1ZB 4LBEB 4U7KA 3MRBB 3OKLB 3VG0H 2HWZH 3F12B 4HFUH 3RBSA 4U0RC 3OGOE 4Q9QL 3LEVH 2AXFB 1R3KA 2EO1A 4PRBA 3QUZB 1L0XA 1T7XA 3D5OF 4RBPH 2EH7L 4JFFB 1T04A 1ZEAL 1GHFL 3LEXB 1UZ8A 4KHTH 4X6CE 4PTTA 4BSWA 1T7VA 2P42B 3TO4D 2LE9A 3ROLA 5IVXF 1A9EA 2CIKB 1LDPL 4HGKC 5MP6H 2HJFA 4OLEA 2IC2A 2OCFD 2GTWA 2NTFB 4KVNH 3B5TA 1UKSA 3UJIH 2W07A 2X44D 3SQOH 2EEDA 4LLMA 2I9TA 2Z31C 4I5BB 4PS4H 1E27B 1PFCA 3F62A 3OV6A 4P3DA 5D5MF 4DJMA 5I74B 5KG9B 4JFXA 3QAZB 4EVNA 3NPSB 2DQIL 2X41A 4AJ0A 1I9JH 1AP2A 5BV7L 1MCPH 3ALWA 1A6PA 5MHSE 4ZXBB 3V7AG 5DD0H 2UZYB 3ZKND 4OGAC 4GOSA 1D9KD 5E94B 1FGNH 3JTSA 2AW2A 4KPHH 4R97C 1EHLL 3GUTA 4PG2C 4JRXE 1A6ZA 2HLFD 3OJDA 3STBA 4Q58C 1P4BH 5SX5H 3EYQC 5DUBA 5AYQA 1RIUH 2KZ1B 4MWFB 3H9SD 4LLYB 1G9MH 3V79C 3FMGL 2AV1B 4ZUUB 2HG5A 2R0LL 4QRTB 3O4LE 2X4RA 3HPLA 5I9QB 1X7QB 5HVWA 3W39B 1NFDB 3VXQB 3L3JB 3HCVA 2ICWJ 1OSZA 2YKLH 4JB9L 4ZUTB 5DFTA 3MV8E 3MREA 5TE4L 4L3EA 1A6VH 1LO0L 1I1AC 3VFSB 1AR1C 3TZVB 3M1BB 3TBSA 1AHWA 5B3JF 1CN4A 1LILA 4WI4A 1E0OB 4URTB 4WEUD 4RFOL 1P84J 1DBJL 3QUXD 4FABH 1A7PH 1N8ZB 4JN1H 4BUHA 4R3SA 1G0YR 2UWEB 2WBJD 4KI1A 2ED7A 1NL0H 3MUHL 1Y18A 1TCRB 3BGFC 3HPJB 1Z0MA 3HI6L 4PB0H 3V4UL 1XGQB 4X9GA 2JCCF 3DETC 1YNLL 4NQTA 5IG7A 1FFNA 4IOIB 1JK8A 3V8CA 4M9PA 4XGZA 5IOPB 5GPRA 1M05A 4A2MA 3KPMA 2G5RA 1I8MA 1S7TA 4GLRH 4NJAH 1MQKL 5DTFB 1J1OH 1C16A 1DQDH 4XC1H 4HWNA 4W4OA 1D5ZB 4RDQF 3GSWA 1N6QL 3PL6D 4GG6F 1DFBL 1QSEE 3RVWC 4L5FH 4H5SB 4PJ8C 2NXYD 1PG7X 4JFQA 4UV4H 1K4DB 4GS7B 4MHHI 4Q7DA 3G6AA 1T2XA 1FPTL 4FQJL 3TA3C 4ODBD 2A6IA 3V0WH 1QYGH 4ONGL 1KCSH 1V8HA 4HF5H 4LNRA 5ITFB 1GJIA 2IALB 2J8UA 1CLOL 1A6WH 2LTQB 5J8OA 1NCNA 4CW1B 1TJHH 5D7KE 3SHSA 4JPKH 5F9DC 4NQDA 4F57H 2OJZH 4P57A 5E2TL 5KS9F 5DD1L 1UEYA 3CVHL 1NJ9B 3BZ4B 5ACZB 4Q0XH 4PJCE 2IBZY 4OZHE 3AGVA 3FT2A 3NCMA 5IHUL 4ZS6C 3G08B 1OAZH 3MCLH 2BNRD 4XVSH 5KTEL 1OWRM 3KDMB 2AV7A 4YR6B 1MHHA 2B8OT 5DZOA 3CXHK 1KB5B 3DVIA 2ENSA 5I73C 5D1ZD 5BMFL 1F4YL 4WENB 1CXHA 5F8QC 2E9WA 1EPFA 2Y07L 4LLQB 2Q87A 4HWZB 3ECBB 1YEIL 4F7TB 1JNJA 4KROD 1QBAA 1NGPL 5DJDA 4LF3B 1SYVB 1A3LL 2BVPB 4FFWC 2IPUG 1U2CA 5F88B 1WQVT 4S1SL 5D7JB 2ITDA 1VADA 4NQVA 3QEGL 3KPNA 4OJFL 4B41A 3HZMB 3JUYA 3VFOB 4JRYB 1OPGH 4RZCA 5D7LA 5I71B 2I5YL 1FZJA 2VISB 3T4AB 5K9OA 1FG2B 4PJFB 4QGTA 1R3HA 1MJUH 2C1OA 5BV7C 4GMSL 5T5FH 3CFBA 5ICYA 1IM3B 4MJIA 2H8PB 4UT6H 2HKHH 4YIQA 4Z5RB 3AC0A 4XPAL 5KAQF 5HGDB 3CFKB 3EDEA 3VRJB 1U95B 5F1IB 3QIUA 4TULL 5GGUA 5KZCB 3DIFA 3KPRE 2YXMA 2JIXD 2Q86B 1W0WB 2YD9A 4PY8J 4KY1L 3GK8L 1S3KH 5HY9A 2H1PL 4AYFA 1DL7L 4X98B 1KG0A 4X7TA 4HC1L 2EIZB 4HUWA 2W0PA 3D3VE 4FXKA 1OVZA 3ARFC 5E08H 2HRPH 3V4VH 2IWGA 3PNWA 2NY4D 5C0RH 5BRZE 3ZSSA 4P48A 4RISL 5T3XD 2J5LC 1B88A 2AERT 3MRMA 1JF5A 1E28B 4Z7UB 3MACH 3MR9A 1DVFD 1A4KA 2NY6B 1A3QA 3IXTA 3MRJA 5J13C 1GSMA 2BFVH 1P7HL 3C5ZD 4OD1L 3GI9L 1FH5H 5FIEA 1HHIA 3AREC 3VI3F 3CLEL 4XH2A 3U46B 2BRQA 4FTVE 3P9WB 4WHYG 1IGTB 3FQRA 1RIVH 4I4WA 3T2OA 4YHKL 5FUOH 1FORH 5GRUL 5E6IC 1R3JA 1ADQA 4C56B 4O9HL 3TLRA 3HR5A 3SGEH 4QHLB 4MNQD 1A6AA 1BOGB 3EHBD 4X6DB 3TH3T 4ZPVA 5C1MB 5AG8A 4UDUB 4HS8L 1S9XB 4Z95L 1BF2A 2PYFB 4YDLC 2DM3A 1QEWA 2GK0A 2VQ1A 3WIIL 3GBML 3NCBB 4JAMA 1MCLA 4JG0L 4TTDD 1UCBH 3B9KA 1L9MA 1JWUA 4Z7VF 3SJVA 3IRPX 4NRXA 1LO2L 2F8OA 3MRCA 4JFHE 5HGAA 2H26B 2X89A 3KNBA 3RUGA 3WO4B 4H1LG 5B8CC 5MERA 4EDWH 1A3RL 3OX8B 2YUWA 3SDCA 4MJ5A 3NFNB 5EBLB 2BERA 3GJEA 2AJUL 3G5ZB 3OKMB 2F58H 4LAJH 4UBDD 1DE4B 4HGWB 5DFVD 3MJ9H 2EDNA 2UY7A 1U8HA 3ZDYE 2OK0H 1JGDA 1AXIB 1SYSA 1XGPB 5IP4A 3PV7A 5CGYC 3VFRB 4YO0B 4KAQL 1XZ0A 1TQCB 5HHXL 4Q9RH 3G5YB 4M6NL 2C3WA 3CDGA 2VITA 4TVPD 4DN3L 5FAAA 1FL6A 4U1GB 2F5AL 4NZRH 1PG7H 3K4ZA 4PBWD 1SQ2N 2WLZA 2DYPD 2DJ4A 3EDDA 3D85A 5DXWA 3ULVL 5HYJE 4K7PH 4JM2F 1LEKB 4U6YB 1U8QB 1XGTB 5GGTL 3LRHA 1QTYT 4M61B 1DQJB 3QULA 2WWKO 1JPSL 4NKIH 2EDQA 4HLZH 4NN5B 4QRRD 4ELKA 3FN0L 3QYCA 4UQ2A 3G5XB 4PJBB 2G9HA 3GGWB 4K3DH 5C09B 4AQOA 2VDKL 3RI5F 3T0EB 3FB5B 3ARPA 3BDBA 4PBVC 5SWQB 4YLQT 1D5MB 1CYGA 2FCBA 2R15A 4LEOA 1TPXB 1CICB 2HLAA 1IQDA 1W2KT 5D7SL 1XGUB 4QRSB 5E2WH 5D7IF 4UT7H 5CEXB 5I6XC 2VL5B 5FOJA 3H2WA 1CGSH 2VDQL 3QDHA 4ZOAA 4QRQA 5HHME 1F4XL 4DGIH 4WI9A 1C5CL 4QOKE 4UIKH 3QB7C 4KJQD 1I8IA 4JZNB 5C3LD 5SWZB 1HHGA 2NXZB 1BPVA 1XIWA 4G9FD 4OV5A 1IGFH 3TNNA 2Q20A 1FYTE 5F7HA 1UVQA 1RZJL 1F58L 5D2LB 4N0UE 4BH8B 2EE2A 1U3HD 3DV4A 2XWTA 5KS9E 1U8JA 2KUTA 2P44B 3EOTL 4PJGB 5IMOA 3RWEA 1SVZA 1ZHNA 1HI6A 4L8BA 1B2WH 4R9HA 2P5WE 1A4JA 4XAKE 5FYJH 4NWUH 1KXVC 1KTLB 1Z2KA 4OIAA 3MLSL 4LGPB 3SDXA 2YWZA 3D9AL 3K1DA 4NKMA 5JXEC 3CUPB 3QHFH 3DI3B 1G7JA 3I3DA 3O2WL 4FQ1L 1UWXH 3IU4H 4F7PB 3CFDB 3VD7A 1PSKH 2Y06H 4QRPA 1NCDL 4X5WB 5DDHB 5ITBH 2B39A 4L4TB 2DQHH 1G0XA 3W5MA 4YHOL 2P8MB 5D1XA 3UEZA 4OFKA 3ZE1F 2Z31B 4OGXL 1VA9A 1G6RB 5BVPL 5FYKL 3UDWA 3PIQB 3PWPB 5KSAC 1V7ML 2EDHA 3D39A 1I4FA 2RHEA 1XCQA 3AY4C 2YA2A 2J8OA 4PRPA 1SM3H 5A3ID 3U4EB 3HE6A 3ARSA 2DQEH 3ULVE 2B1HH 1IC5L 5CIPH 1WEJH 2BMKB 2FL5B 3IKCB 5DS8B 1CE1H 4LAQL 2ZG1A 3B6SA 1MHPL 3BDYH 4R97B 4XBPB 1KN2H 5L2JA 1VCAA 1Z9OA 4QTHA 1ZANL 3KWWA 5HHVH 3VGFA 4G8IA 4HPOH 4APQC 1NUDA 3LS5L 5I8EB 4ODWB 5IMMA 3CDYA 2LU4A 4KMLB 1H5BA 4U1HB 5JLZA 4Y5XA 3TO2A 4OTXH 4GSDL 1VEMA 2G5BA 1NBYA 3BP5A 3BZFB 32C2B 3OZ9H 1HXMA 3D25B 3LIZL 4M93C 1A64A 4Y4FC 3X3FH 1OCWL 4X6CB 1EHXA 1T66D 3O2DA 4JO1L 1KFAL 2LU3A 4ZFGL 4BH7B 4XBEL 1I1AB 3AS0A 1DTUA 2NW2B 4KTEH 1HEZB 2B4CL 1GZQA 2XN9D 3HN3A 4PFEA 1ZS8B 3P9LA 3BKCH 5TPWH 4C57C 1EJOH 1FNGA 1S7VB 2EECA 2FSEA 5CSGA 4PJ9B 1QVOA 1BIIA 4RMRA 2X09A 5DC4B 5JDSA 5ACLA 2EDEA 5I1JL 4LLVA 2D7OA 1JTOA 2FBOJ 2I26N 1ZHBB 1N0XH 5FGBC 2OQJB 2QHRL 1QR1A 1GGCL 5L88H 1MJ7H 3BGFB 2BY0A 3CC5B 4DGVL 3W11D 4GBXD 4OKDA 1NMBH 4PP1D 2DOCA 2OR9H 3MLVH 1MFNA 3ULVC 3VW3H 1FVEB 4LVOC 5J6HB 3VXUA 4HJ0C 3B9DA 1QFHA 1C08B 2HJLB 3U0PB 1F90H 1BD2A 1MSPA 4NQED 3VA6A 4YUEL 4DFIA 43CAA 3DOSA 4JRXB 1JHTA 4WJ5B 5GSVA 4G8GD 1XT5A 1ZHLB 2R23B 1JCKA 4WI6A 1P7KB 4OZIE 2DQUH 4GXVH 3MZTA 4PJ8B 4Z7VE 4YC2C 3O4LB 3WFHB 5FYKE 4P5KA 2BSSB 2A0LC 3E6HA 4PRAA 1ERNA 2F54E 3LMJH 1AJ7L 3I2CL 3TA3B 2X70B 2O5YL 3MV8B 2FO1A 4F9LA 3L9RA 3T2PA 3VFTA 8FABA 2QSVA 5D4QA 1AE6H 1DUZB 1HILA 5D6CA 5LGJB 2YOCA 1OTTD 2F53E 4N0CD 1KIRA 1HQ4B 1IQWL 3B9VA 4ZDHB 4NO2B 3RP1A 4MQ7B 1EMTL 1RZJC 3DPBA 1FC2D 5EOQL 1T1ZA 2A83B 4LBEA 5ALCH 3MRBA 3OKLA 5ALBL 1MEXH 5JW4M 3F12A 4G80B 3RKDD 3BQUB 4EUPB 2VDML 2J3SA 2V6HA 3ZKNC 4V1DB 3QUZA 3IFLH 4JFFA 1ZMYA 4MDJB 3BVNB 1VGEH 4ENEC 4PRNB 3DX7A 3LEXA 5I73B 3E8UL 1PJ9A 3GMLA 2HLFC 5F3BB 1RUML 1G7QB 1JZ8A 3ARGD 4Y8AA 2CIKA 4IRJD 1UXWB 3MODL 2H9GB 1S9YB 1UYWL 1JF6A 3SBWC 2NTFA 1UM6H 4WO4D 1QSEB 5F9JB 3HE7C 4I5BA 2E9BA 5FHBL 3T4YB 3VH8G 5IMLB 3TYGH 5T3XL 5D70L 2E7CA 2WWMD 5DWUL 5KG9A 1BFVL 3VGHA 2DAVA 3ELAT 3OB0K 3TN0D 5BV7B 2DQTL 4ZXBA 2EICA 1NLDH 4K7FB 3NA9L 3ZSTA 1DBBL 3ZTNL 1U6AL 4FNLL 1YNKL 3K74B 4EZMA 2VDNH 4JFED 1K6QH 4WFFE 5E4IA 5AD0B 1C7TA 5BS0D 1JMXA 4PJCB 4H0IA 1A9BB 3RAJL 3SE3A 2E8YA 2P24B 4MWFA 4OZHB 4NRYA 2GUOA 4NQXB 2AV1A 3BI9X 4QRTA 1X6NA 3N9GH 4LVNB 1PX4A 1X7QA 1CTNA 3ARFB 1NFDA 3VXQA 3L3JA 4DVBB 5I8OL