5A2IH

Crystal structure of scfv-sm3 in complex with apd-sgalnac-rp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
244
structure length
224
Chain Sequence
QVQLQESGGGLVQPGGSMKLSCVASGFTFSNYWMNWVRQSPEKGLEWVAEIRLKSNNYATHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCTGVGQFAYWGQGTTVTVSVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Deciphering the Non-Equivalence of Serine and Threonine O-Glycosylation Points: Implications for Molecular Recognition of the Tn Antigen by an Anti-Muc1 Antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords IG LAMBDA-1 CHAIN V REGION S43
total genus 55
structure length 224
sequence length 244
ec nomenclature
pdb deposition date 2015-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
H PF07686 V-set Immunoglobulin V-set domain
H PF07686 V-set Immunoglobulin V-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5a2iH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5a2iH01
3OG6B 4I18C 4FZ8H 2OXGA 3WHXA 3S4SA 3IYLW 4PJGB 4ZS6D 2NY1C 3JVGC 4DN3L 4M7JL 5JPNB 2VDOL 5GS0H 4GKZB 5C0EA 3F12B 2CLRA 3C60C 3H3KA 4GS7C 4EDXB 2X4QA 1N2RA 2I9LA 5GS1B 5FYJU 3MLSH 5D7JA 3B9KA 4U6VH 1IAKA 1I8IA 2Q8BL 1HNGA 4NNXA 3W82A 1SBBA 2ZJSL 4X98A 2PW2B 1FFQA 1PEZA 3GBLA 3RVTC 5MP6L 1MCSA 2HT4C 1FVEB 3FL7A 5JDSA 4F2MA 3M8OL 5KTEL 3ARDA 3AY4C 3RU8H 2PXYD 5IVXE 3FB6A 3DGGA 2NY4D 1I1YA 3TYGL 1KPRA 4K3HA 1NMBH 4PRHB 4M1GL 4YDLC 3VD7A 4QRSA 3C2AL 4LQ1A 1EHNA 1YECH 3ECBA 3OKMA 4XP6H 2EE3A 5BS0D 4BZ2H 4ZYKA 2JCCF 3S4SB 5T1LD 3WHXB 1R5WA 3BN9D 5JPMB 4DKEH 1XF4A 3HG1D 5LQBH 3BP7B 1AHWB 2X89A 3H3PH 3LH2L 5KZCB 5F88A 3LN4A 1A6VL 3AAZB 3QWRD 3PABA 4J3TA 4YBQD 5CWSA 5F7FA 3OGCA 3RNKA 1PG7X 3W0WA 1TQCB 2DQTL 3O2WH 1N5AA 4C56E 1RHFA 3AS2A 5KVDL 4R2GD 2R69H 3KPRE 3MR9B 5D7SL 5FYLD 3R0NA 5EC2B 4UDUB 3CVHA 5HYJB 4TULH 5I6XB 1RUAL 1N6VA 5DMJB 1U2HA 2VISB 3WSQH 4JO3L 5CILL 4XVSL 1X4ZA 3TJHD 2BMKA 1JZ6A 3MGOA 1BZ9A 1MRFH 1BREA 5TDOA 4M02A 5CP3A 2AK1H 1UCBL 2CRMA 5DA0B 1LEKA 1A4KB 1JGLH 3CDFA 4MAYD 3FOLB 3VFVA 3NCEB 5DO2D 3PF2A 1NUGA 3PWJB 3WKMH 4R4FL 3QUZD 4AT6B 1MH5A 1P4IL 3R8BB 3RA7L 3S35X 1LDSA 4WDIB 1ZANL 2GJ6D 4MQSB 4YPGA 4HUWA 4MA1B 1CD8A 2NR6D 1I3UA 1UXSA 1A6TA 4LLVA 1WK0A 3I3EA 1QSZA 3QUYC 3W0WE 3D25A 2JK5B 2XZCH 2IAND 1FG2A 3WIFA 1M71B 4JCMA 4WW2A 3RY6C 5E8PB 2OTWB 4MJ6B 1SVCP 1R5IA 4PJFF 5E4EB 5IBUB 4ZUWB 5JOPE 4OF0A 3TZVD 1XGRA 4PY7A 5EU6B 4K9EH 5L7XH 3G5ZB 4K9EL 5L7XL 1U8JA 3RJQB 2ZOLA 5GJSL 4JFEE 4XGZB 4M48H 2YKLL 5ERWB 3L5WB 4U6TA 5TH2A 5KANI 3G5XA 5ISZA 3BE1L 3HE6D 4WO4A 3P73A 4U1HB 1FSKC 3GBMH 3LDBB 2AJXH 3EYUH 3LKOB 4BH8B 1S7XA 1XR8A 5D7IF 4JFEB 2FATH 1IGML 1U8HA 4JM2D 4NP4H 3L5XH 3HR5A 4AG4H 1HOCA 3MFFA 2NNAB 2IAMC 1DLHB 4FRWA 3JV0A 3LQAL 1IM3B 2B4CL 4KK8C 5KAQF 4H1LH 3QA3A 1TJIH 1FORH 1FDLL 1G6RB 1Z3GL 3VI4E 8CGTA 2ZCKL 1YNTB 1CTOA 5DMKB 1Y6KR 1ZKAA 1ND0A 1IQWL 3EFFB 3QP3A 4HBCH 3MRGA 4PJAA 1MJUH 3NACL 2VXUL 4N0FB 3T1FA 4LCCC 1EJOH 1BVKA 1F3RB 5T1MB 3C6LC 1S5IH 4LFHD 4S2SA 1T1WA 5D2NC 1S7XB 4X6CB 1FZJA 2DJUA 1MF2L 4G9FA 3TZVC 1Z9MA 2H26B 3O2WL 4D9QE 1C7SA 3L6FB 2IQAB 2X1WL 3BSZH 1I9RH 1BIIB 2ADFH 5HD8C 1CGUA 4Y5VA 2MOVA 4JO1L 3CSPA 2A9ML 3WV0A 2VQUA 3QI9B 5CJ5A 5KS9F 3IFNL 4OIIH 1XGTB 2OQJB 1QBLH 4DQOH 2Y5TB 3S96B 1ZEAL 2GSIB 2YN3A 5A3IC 3I85A 4YGAB 2MCPH 2CXGA 3WJLA 3RGVB 5TDNA 1CFVH 3EYVB 5IESH 1HSBA 2ZSVA 4DZ8A 3TJEL 1KXTB 4MD0B 2X70A 4Y16B 4O4YL 2IPUK 3TA3B 1BQLH 3TBTB 3V6ZB 1G7HB 1WC7B 2R9HC 3OQ3B 5KSAB 1RUQH 1FFRA 1NJ9B 5K33A 4W6WB 2VMFA 4Z7NF 3T2OA 2OX5A 5ALBH 1U93A 1FO0H 4Y2DA 1NDMA 5DJZB 3BP5A 3GNML 4YBLB 5F8QC 1BF2A 1E4KA 1IC4L 3MLZH 1T1ZB 4WTXA 5CIPH 5FO9A 1MCBA 5HBBA 2NX5B 2CIIB 5T3XD 3FN0H 2J8OA 3NPSB 3DMMC 1EZVX 4NHCH 2OR8A 4XXDA 1AR1D 4JY4B 1VFBB 3CMOH 3SOBH 2JE8A 2R29L 3RWGA 1VCAA 3A67L 5HD8D 2GEEA 3MV7D 4YAQB 1YYMH 4KRPB 4QRQB 1QA9B 5DEGA 4DW2L 5E2UH 3VI3F 1CFQA 3V4UL 5E2UL 3HN3A 3K1KC 3QI9A 1EX0A 1R5WB 4LMQI 5J11C 3WXWL 3TBSA 1IARB 4N5UA 4NWUH 4WUUB 1U42A 3A0OA 1PX3A 4GXVL 1TPXC 2F19L 4FXLA 4GRLC 5HGHB 4ENED 3PV6B 3C09C 3MOQA 1UQSB 4JHWL 3Q6GL 3U0WL 2BFVL 3RIFK 1JNLH 3UDWC 4HS8H 1OP9A 4KXZI 3JBG7 3QEQA 3FZUC 1FG9C 4X6EB 1U8MA 2QSVA 3WKNA 4YWGL 3DYMA 3T0EE 3VWKB 4UDUA 1DANU 4EI6B 1R3KB 3RNQB 4WEBL 1MHPL 2W65B 4P4KB 1M05A 4X8JA 3RZCB 4FQXB 1NUFA 1QNZL 5DVLA 1RUML 5GJTH 5JPNA 3NCBB 3QIBA 4KV5E 4JPIB 4S2SB 4H20H 2J6EL 5EORL 3VFSA 4HWNA 1Y18A 2I5YL 5IW6B 4P2RA 4ZD3L 1JZ8A 1N0LA 4QOKB 1V3MA 4JG0L 4FABH 2R4RL 4U3CA 1OAXL 3G08B 1JTOA 4QLRA 2AJUH 3UTSB 1ZLSH 4FQHA 4JE4B 5KANG 3PDGA 1D9KA 1F45A 1WZLA 4P99A 1NGYB 1RJCA 4PP1D 5HTSA 3G5VB 1GGBH 4LNRB 3O8XD 1I9EA 1DANT 3P73B 4MNHA 4U1HA 3VGAC 4H1LA 2FZ3B 5ISZB 1WBYB 3MFFB 4NOBA 1WAAF 4U0QB 1U95B 3PGCA 4QTHB 3M07A 3X11B 4O2EB 3GSVA 4XGZA 1CN4A 3MJ6A 2X4RA 5GXBB 4N5EC 4KU1A 3VWJC 5KSBA 4NRZA 1KFAH 1CE1H 4L4TB 3QXVA 4PY7B 2VXSH 5EU6A 4ENEC 5LXGL 4ETQA 2APXA 1BJ1J 2VYRE 1SY6H 1J86A 1F8TL 5DZOA 3MBEC 4KHTH 3G6JA 4YZFF 3WUWA 1MFEL 5D6CA 3J8F7 1TNNA 1AGDB 3LKPB 3VXTA 5E94A 1D5MB 1AGCB 1RUAH 3FHAA 1KUMA 1OVZA 2VLKB 1ZAGA 4MVBC 4DWHA 2DWEA 1OAYH 3T77A 4YIQB 4CMHC 3DJ9A 1EXUA 4K94L 4QXUL 1OAQL 1OF2A 2E7LC 1I1CA 1T3FA 3IRPX 1CE1L 1KFAL 3GSNH 1MWAB 2R1WA 5MERB 4HSQA 2H2PC 1PG7H 3QDJB 3SCMB 4UV7L 5D7KD 4EOWH 2YA2A 2IJ0C 3WO4C 3UCRA 5C6PB 3RL2B 2IPKB 2P5ED 3PE9A 3VXQA 5JQHC 5F89A 1UM5L 1FYTB 1BD2A 3IB4A 5DDHA 1WBZB 3R0MA 1W72H 5J13B 4WFEE 5DLML 3RGVC 3H9YA 3WHE1 4M7LL 1IRAY 3WN5C 3DBXA 4JZOA 5A2IH 5T3XL 4OM1L 3KPSD 4ODVH 4PB0L 2FH6A 2LU7A 5JHDD 2OS7A 1VFAB 4HULB 2EIEA 2HKHH 2C26A 2YEZB 5I1JL 2NXZC 5L6YH 1P7HL 3ORJA 3CXHJ 4XCNB 4AQOA 3DRTA 2HVJB 3REWB 1L0XA 1RQ5A 3VGDA 1ORSB 4XP4H 1GIGL 4JJ5A 2UY6A 2NW2B 3IDMA 2VR4A 1RUMH 5FA3A 4WI7A 3RWHA 1DQTA 5JOPD 1TDQA 5TE7L 3DRTB 1K2DA 4JO1H 4BM7A 4U1NA 3OJDB 1MCJA 5DD3L 3RHWK 5HHMB 4Q0XH 3BYYA 3JV5A 3C5ZC 1MUJB 1EMTL 3QDGD 4NNPL 5DURB 4DK3A 2O5XL 5DFVC 3VH8A 1R24B 2DLFL 3F7YB 1LE5B 1QPPA 5HVFB 3VRIB 4JHWH 4DFHA 2VQ1B 1I9JH 5I1EH 4KKCC 5IFAL 4ZXBC 4M93B 4F57L 1BAFH 4Z95L 3S3JA 3LOWA 4MWFA 4DZBA 4RZCB 3O3DA 4DOHB 4PY8J 5EU5A 1QR1A 2CDFA 3QNXA 2EYTA 1IL1B 2X4QB 5FDWB 2B20A 1JGVL 5C0EB 4XPTL 3FFDA 5IMOA 4L8DB 1FL3A 2FD6H 2XA8H 1JF6A 4NNXB 1X5FA 2A6IA 5D1QC 4JO3H 4N9GB 1LP9E 3DI3B 1I3RB 4G9FD 3U1SL 4CNIB 4Z7NE 5D7SH 5JXED 3BKMH 4Q74A 4NDMA 1E28A 1JRHH 5B21A 4CL7A 3WO3B 1XGQA 3HNTL 1MQKH 4ZS6C 1OB1A 4RAVB 4X9BA 3SOBL 1OCWH 3BKJH 1AGBA 1KLGA 3GM8A 1F58H 1OLZA 2MSPA 5SWSB 5AD0A 2YXMA 4NHCL 4V2CB 3U30C 2VL5A 4G6AC 5E7BA 2V5YA 1VADA 3VDCA 2NY6B 2CGRL 4KGLA 3UROR 1E27B 2YRLA 2O26U 3V9FA 3VMNA 4LKCA 3IXTB 3MLYL 5ADOH 1BX2A 1DUYA 5T33L 4IRJD 5ALBL 3UTPE 2EDLA 2J8UB 4PV8A 3V6OC 2ATPA 2XPGB 3WDIA 4OD1L 5FGBA 3V6FA 1ULVA 2KDGA 1MJJA 5LG1A 3BZEB 2NY1B 5FYKL 3QDJE 3SGEI 2MPAH 1GSMA 2VABA 5ID1B 4YDJA 1U8LA 1JP5A 4XCEB 2CK0H 3RWEA 3S88H 3ULVE 3BPNC 3RTQA 1G7JA 2NZIA 2ENYA 4FQHB 3VGAB 1MIML 2XWBA 5HHME 1ONQB 2O61A 3QUMA 5IB1A 1P4IH 3RA7H 2IGFL 1KCUL 1BQHA 4OLZL 5I16B 1FVDB 3MNWA 2WUBL 1SM3L 4YUEH 3MZTA 5ETUB 1D9KD 1TVBB 4LLMA 4KKLC 1EGJA 1NFDE 5I0DA 2ZG1A 3GMQB 3QPQC 2DKMA 5GGTH 1AP2A 3PQYE 4PJ5B 4PJ9C 2DLIA 2HAZA 4YBQC 3VI3E 3KPPA 3HZVB 4POUB 3GSUA 5FFLA 3RVUD 3NFNB 3DTXA 1H5BB 4ZFGH 1S9WB 2JELL 2NYYD 5J0BA 3KYKH 4JM2B 5EU4A 5F7EH 5FK9B 1X5KA 1T89C 4LAQH 4OGAD 5ABDE 3AGVA 4D9QD 1CCZA 3MCKB 4PIRF 1FZKA 1MWAL 2EDQA 3VXME 3WEXA 3O81A 2BK8A 2Z93A 4Y19A 1LK3L 4LOUD 2EECA 4RFOL 1GZPB 2EZ0C 3G6JE 4QGTA 5IUSA 1CFQB 4G3YH 1U8IB 3D69A 3MACL 4UUJB 5FHAL 3EHBC 1MCEA 2CK0L 1HHIB 5DI8A 1BQHG 3JWNC 5DEFB 4UIMB 3STZA 4NQEA 5LBSL 3CAFA 1IEHA 3SQBA 4G42A 1CDCA 2NLJA 1VEMA 2R0KH 4EKXA 1WZ1L 2R0ZH 3NABH 3QIUD 3MROB 4KI5C 1DBBL 3WE6B 1TITA 2C4FU 2V17L 4X80H 2I60L 1Q9WA 4HPYH 3MRRA 3QPQD 4MAUH 3LEXB 4OCXH 4HK3N 3QUYB 1R0AL 2CGRH 4Q6IA 5C86A 5IFHL 2F53A 3O41A 1J05B 2HFGL 3W9DA 2JCCE 4OCLC 5BRZD 3CU1A 5H2BA 4ZAKD 3T0VA 4OZIA 4JRYB 1U93B 3A6CH 2JB6A 5GGVY 3NAAL 1ZLWK 2C3VB 1VACB 2A1WH 2CKBL 2ORBH 4LARL 4M9PA 3VXSE 5I1KL 4NO3A 1B4RA 3DUUA 1D3CA 1RU9H 5D96C 4XP1H 3MA9L 1KYOK 5DK0B 4KJPC 4PJ9B 3HI6H 4TRPH 4UB0H 2COQA 2X4NA 3RQ3A 2ZUYA 4Y2DD 3O11A 5CEZE 3RL1B 1LO3H 1A64A 5D2LA 4NZRL 5J9PB 5IB2B 2C7UB 1NC4D 3QIWB 5IB2A 1X6LA 5DUBB 4UTAH 3EHBD 6FABH 4R0LC 4QOKE 4M3JA 2BOCB 3GSXA 5FGCB 4QEGA 2C1OB 2Z35A 4UOW1 4U49A 5HY9A 2NZ9C 4YC2B 3IF1B 3HFMH 4OAWA 1KSRA 4UB0L 1Q94B 4TULL 2B1AH 3K8LA 3BIKB 1V7NL 3PIQB 4CUCA 2C3VA 3V0WL 3LEYL 3UYRL 2X6MA 2R8SL 1KOAA 2EDWA 3HUJA 3GI8H 1INDH 4WFHD 5HSFA 3SKMA 3O3DB 5A40E 3ARGC 4ZQKB 4M5YL 5KSUA 1VSCA 3MUJA 3LSOB 4B7IA 5FCUL 5CP7B 3BQUA 2HN7B 5EUOB 1UWXH 1LD9B 4P5TB 3RPKA 2Y72A 5JR1L 4XAWH 1HSAA 2HLAA 4GKSB 5IFHH 3P9WB 4P9ML 3LH2H 4YX2H 5FYKE 4YFLI 3BO8A 4G8IB 4K9EC 3P77B 3CCHA 3I50L 2GCYB 1ND0B 4JKMA 2SEBA 2BVOB 1YEJL 4WHYG 2A6DA 1HILB 3TN0C 3VCLB 1WUNT 4WW1A 3BPOC 1G6RA 2QADD 3NA4A 4IDJH 1RIHH 3WHE0 2JJWA 2NY0C 5DEFA 5E0QA 4XP9L 2HT2C 4P2OD 4L3EB 5BOPA 2Y25A 3O6KL 4XNYH 1AO7B 2E8ZA 5BOZG 4GW5A 3P9MB 3BP6B 3J7HA 1H3PH 3HE7D 1I3GL 2CSPA 2HLFD 3QJFB 2B2XH 1JN6A 5E5MB 1BBJB 1IGYB 4ZTOL 4G3YL 5K9QI 2P8LB 5I8CA 2CLVA 4MJIA 3DVFA 2W9LA 5AUMB 4D9RE 1PQZA 2YMXL 3BRFA 5DHVA 2KQNA 2Y7QB 3O3BA 4OKVB 2H2PD 4JHBA 4X6CE 4BSWA 4OFYA 2DQJH 1K6QL 1RVFL 4B5EA 4G5ZL 4MXVF 5GZOD 4DKFH 3OKDB 5FOBB 2E7HA 3TM6A 4JO2L 4K7PL 4OKDA 3D3VB 4QRTA 1NL0H 1XZ0B 4K8RH 4G8EB 2X4OB 5GGSY 5BV7C 2BOBB 5B8CC 3GO1H 1CE6B 1CLYH 1U8OA 5I16A 3N50A 1NAMA 3WLBB 1HXMA 2VLJB 3WNKA 4HH8A 4FG6C 1K3IA 5MEQB 1EXUB 5TFSL 4PP2A 1CD1B 4Z0XB 3K80A 2NY7H 5TGBA 2N7BA 3GSRB 5C1MB 2BNQD 3AS1A 1AGDA 2AQ3A 2ICWB 3VXTB 3MV9D 4PJ8D 1DSFL 2O61B 2Q8AL 1Q8MA 1JWMB 4K7FB 3E8UH 3MNVA 4PJXA 3C5JA 4HMCA 3PDOB 2IBZY 2K7QA 1J8HB 4XNMB 2Q7YB 4NZTH 3LRHA 4PJHA 3MV8E 1RK0B 3K2UL 3MLXH 5T1KB 4OGYH 1G7IA 2Z91A 3DLQR 4LSPL 3WIHL 3CIQA 3HMXH 5KS9E 4MJ4A 2GJ6B 1FN4A 1XT5A 2LU3A 3HC0A 5EH1A 4Y5XA 4HCRA 2RAMA 1WBYA 1XGYH 5IM7B 2X09A 5C6TL 5DJDA 4QRPB 4TQEL 2QV2A 1ADQH 1JPTH 4C83A 1INEL 4O51A 4EZMA 1YEJH 1DLFH 1BECA 2R8SH 3DVGA 2GKIA 5IMMB 4PRIB 5C08A 4TSAL 5F88B 2GFBB 2FHCA 3VWJA 4UT9L 2VLRE 1XIWC 4KTDH 4QXGH 5ID0A 5IBLC 4FQXC 4ORZC 5CEZL 2M26A 4PRPD 3LD8B 1HQ4A 3S98A 1RIUL 4ALAL 1HYRC 1EHLL 3ZHLA 2ICEB 1CR9H 3Q6GH 4HJ0C 1DQLH 3NFPB 5C0AD 1SMAA 3KGRA 4L8BA 2DLHA 3MOBH 1BVLA 1QFWM 4XPGH 1EBAA 4E41D 4G6JH 1LO2L 4LSTL 3HNSL 4OV5B 1C16A 3WDJA 4I0KA 2YUVA 2A6JB 5GGRB 4HIHA 4DZBB 1NFDF 3U4BL 5ICXB 3E8UL 5EBGA 2OJEA 3NGBB 1TZHA 4NO2B 3T8XB 4NQED 2AAVA 3PWLB 2C4FT 2E6JA 2QQKL 3VRIA 3BH9A 4L9LA 4ZAKA 2V5TA 1MI5E 4ZTPH 5KW9L 4O58L 3U7WL 4C56B 4G7VL 2VKWA 2Y36L 5IG7B 4Q7DA 2Z8SA 1H3WM 2P5WD 5DHVH 4BQBA 1WT5C 1IKFH 1JV5B 1OLLA 2PF6A 3MMEA 4HGWB 5EU6E 3L1OL 3QXAA 1GH7A 5HPMA 1QQDA 3KPRD 3BDYL 1V5JA 4GXUN 3V5HB 3FT3A 4YHNA 1KCVH 5GS2H 5MEPA 1A3RL 4WIQA 1HQRB 3Q5YA 1P84J 1XR9B 4TVPH 2WBJA 4POZC 1VFMA 3RX5A 3JWOC 3B2VH 4M6OH 1ORSA 2VZVA 3ARPA 1G9MH 3GNMH 2IC2A 2HFGH 3DUSA 4W4NA 3OG4B 2J4WH 3CLEL 3T4AB 4ZTOH 2QSCH 2VWEE 4I1NB 1FN4B 2ZUQB 4PUBH 1U58B 4URTB 4H25A 4LLUA 1OP5H 4QRRB 3FB8A 5CEXB 1FO0A 4Y5YC 4NQXA 5FHBH 1BD2E 3FQUB 3T0BA 3VXQB 4PJGE 2FWOB 5C09D 1ZGLA 5ESAA 2WBJB 3VG0L 1FP5A 3IFNH 5BVPH 3GBNL 3I2CH 4P2CG 1PY4A 3I9GL 4LFHG 5D6DA 1ZS8B 3ZKNC 3RUGE 4P23A 2AEQH 4K3EH 3GSNL 4YXKH 2WP3O 3JV6A 2VDKH 1A9EB 3KYOA 1WFOA 2OSLB 3WIHA 1HYSD 3QG7L 4DUWA 4PJDA 3TT3L 2Y5EA 3GI8L 1N4XH 1MIEH 1A9BA 3SDYL 1MF2H 5EUOE 3UMTA 5LGHH 1MSPA 2UWEB 4R26L 4POZD 2X1PA 5D6CB 4I18A 2JCCA 4M4RA 1KCLA 4JLRA 4Y4HD 1F90L 2CDEB 3G04A 1A7NH 3PUCA 4PP1C 3D85D 4J6RH 5BS0A 1YEFH 3FAWA 2OTPA 1U95A 1TIUA 3TP4A 1JWUA 5L88L 2A77L 4PLKC 4OKVA 1IQWH 3WMSA 2OP4H 2FH8A 3P0GB 4KDWA 4YK4B 1DEEB 1JGDB 4NO5B 3OPZH 5INCA 3U9PH 1SYSB 3DROA 3EZ8A 3ZT7A 3G5VA 5KSBE 1ZHLB 1YN6B 3SDCB 1X5LA 4OZGF 3QIBC 4UINH 1QEWA 1DVFD 3QULA 1A7RL 1CDJA 1XH3B 3EKCA 3VXSD 1MIMH 4MQTB 3MCG1 4A2MA 1A6UL 3QEHB 2ZWLT 1NLBH 2LU4A 3B5TA 1YPZA 3PWUA 4P2QD 2I07A 3QQ3A 3MYZA 4KY1L 3S8WA 1EV2E 4HEPG 5EU6D 1IILE 4PJEE 1GCFA 3KAAA 4MNGA 4X8JB 4Y7MA 4PJ8A 2FBJH 2YZ1A 3NBNA 1MI5D 3CVHL 3KR3H 2Q3AA 4JM2F 1ZT4B 4YDKH 3TH4T 5DK3A 1NEZG 1EEUA 3LKRA 3QI9C 2MWCA 3KHOA 4RMSA 5SX4H 3OAUL 3SKMB 1IZKA 5LCVH 3PGDA 4DN4H 3MRCA 1R6VA 4UOW0 1S7TA 1TCRB 1U41A 3T0AA 4AL8L 4JQIL 4KROC 4BK5A 3KPTA 3R06A 4OZHB 3KS0H 3T2NL 5JXAH 3U4EB 3X3FH 1JNHB 2X7LA 4HAGA 1LK3H 4GXVH 4Z7UF 3EYOB 5DWUL 4M7ZB 5D2LB 4Z7OE 3SDXB 1NFIA 3DGCR 1BMGA 1I8MB 4GAYA 1Q0XL 2AK1L 2EYSA 3EW3B 1MFCH 3TH2T 5L8LB 4RMVA 3VMOA 3EGSB 4Q0XL 1NCAH 5GQBA 2VZTA 3UBXI 5KJRL 5J1SC 5F9JA 4NQSA 4WGVB 5BV7H 3WFCH 3NMEA 4PG9A 3E6FA 2Q7NA 3U46A 1P6AB 1FH5L 1H15B 3QUKB 3U48A 3GHEH 2GIYA 2VDPL 3IFOB 3BPOB 3CMOL 3QJHB 3U4AA 1W72A 3ELAT 3C2SA 5HYJA 1P4LB 4OZFA 3L95A 5DRZA 3EOTL 1TVHB 2DRUA 2D03H 4MJ2A 3TBTA 3V6ZA 3LD8C 1FRGL 4QCIB 1L9MA 5F3HA 4HZAA 4Y4FC 5DLMH 5GZOC 4JHAL 5HI4D 1GGIH 4G42B 3V95A 2L7JA 5ANMB 4XRCA 2CR6A 4HF5H 2JB5L 3C08L 1G7HA 1WC7A 3OAYH 3PWVB 5ESVB 3TA3A 1BJ1H 5F7NC 1CICB 5DI8B 4OM0H 2FSEB 3CFDA 5AAWA 5E6IB 1YEGL 3BDBA 4GAYB 4LASL 4OLWL 1S9XA 2D31A 2OI9B 5LWYH 1FYTD 5GGSB 5I71C 3TJEH 5F70A 2LE9A 4F7CA 1LD9A 3U0PB 3O4LA 1A14L 4L4VE 4U6VL 3CXDL 5DJXB 3ME0A 2DMKA 1ACZA 1FZKB 1KPRB 1GOFA 3VGHA 1CZ8L 3OHXA 4CMMA 3UAJD 4Z76A 4KUCF 1ETZA 1HHKB 4R8WL 2XFXA 4F7MA 5F3BB 4RBPK 4KGJA 5DJAA 2D2OA 4P5MB 5F3BA 4V1DE 1NKRA 3DXAA 4K2UH 4JVUA 1H5BA 1J11A 1MCPH 2P48B 1NCNA 2XZAL 5F7HA 5HY9B 3B9KB 1WFTA 1OAZH 5C0BE 1OTTC 2X41A 2DQFB 1INQB 2VZOA 2UVFA 4OZ4A 4TTDD 1ZGLP 1G7LB 4PJ5A 3LQMA 4R97B 3ZDYF 5TE6L 4JZNB 2XTJD 2CK2A 3QNYB 12E8L 5BRZA 5DMKA 1RD6A 2E7BA 4PJBB 5CJQH 4XBEH 3QWOB 1QP1A 3QEUA 1VGEH 5K9JL 1UM6L 5HYQA 2AGJL 1MFEH 2ADIB 4NZUH 3GK8L 1CICA 5I30L 3QUMB 3Q5OA 5IB1B 4HBCL 4DVBA 1OGAA 4LVNB 2F74A 3ULUH 4KZDL 2BSSA 2NZ9D 4TSBH 5I1LA 1A7OH 3MFGB 1J0IA 5F6HI 4E5XB 5KAQG 3U36A 1MNUH 3A6OA 3LZFH 3BMWA 3KXFB 4XCEA 4LBEB 4PRPE 4CRPA 1UB5A 3OR6B 5JXAL 2EDKA 5IFAH 2VLRD 3T2NH 3L95B 5DRZB 2XWJA 4Y4HA 3MRDB 1V05A 5BS0B 3DSFH 4JN1L 5I1AA 5E2JA 1HCVA 4PB9L 2ZOLB 4WI6A 1IFHL 3D3VD 3T0EA 1ZVYA 4NKMB 5T1LB 1T7XA 1YZZA 2FATL 3BH8B 2RR3A 4I18B 3KPOA 1H15A 5HHOD 3U0TA 3SGEH 1H3XA 4PTUA 3OKOB 1KLFA 3IU3B 2OR9L 4EVNB 4RCAA 5FO8A 2NXYD 1A5FL 1QFWI 1J1PL 4PG2C 2P5WE 4M7KH 1A6TB 1KJ3L 3UX9B 2X10A 2VWEC 2BVYA 5I8KH 4OM1H 2UWEF 1MH5B 4PJ7B 4GAJH 1AD0B 5IP4A 3QFDB 1NGWB 1OAUH 5HDOA 1C5BL 4WENB 5E2VH 1E6JL 4UTBH 1G0XA 2XXMB 4GRMA 3Q3GA 3HPJB 4H5SA 3ILPB 5D7KE 4AH2B 1JNLL 4DW2H 4GRWE 4LPTA 2IAMB 4EJ1C 1AGEA 3P9LA 3F7VB 2GK2A 4AMKL 3MRIA 5DJ2A 5CEYA 4CW1A 2QL1A 4EDWH 1QSFB 3VFTB 3T4AA 4NWUL 1CT8A 1ED3A 1NEZA 3QFJE 4CJ0A 2CO7B 4ZNEA 3WNLA 3T0DA 4JFZH 3D87B 2DD8L 4QXUH 2RCSL 3TCLB 1BZQK 4N0CC 3HZKA 3QWRA 4NKDA 3BW9B 1U3HD 4XWGH 3MR9A 3C5SB 2PO6C 3VXSA 1E4XI 1QFUH 2Z4QA 4ONOA 3CPLA 5LGHL 4OZGE 1MHCB 3GSOA 5FA3B 5FYLL 2FR4A 2Y07H 1UZ6F 4ZUUB 4F8TA 5H94A 3CX5J 4X5XA 2WLZA 1DQML 2GJZA 3BT2L 4ZYKB 5DVMA 4PREB 5IB4A 3TBYB 2VAAA 3DVNB 4NC0B 3FJTA 5D7IE 4D9LH 3C5SA 1UKTA 3BHBA 4K07A 3WUZA 2W0PA 4G6KH 2IBGA 1CIDA 1YEHH 3QULB 3SKNB 1SJHB 1CFVL 4APQB 2CUIA 1NC2D 5I18L 3VFNA 4JANA 1T4KA 2D7MA 3TESA 3TT1L 5JO5A 2X9XA 4HIHB 4K3DL 1ZA3B 3RVVC 5MENE 3ABZA 5KVGH 1OHQA 1AFVL 4NO2A 3T8XA 4O9HH 3PHOB 5F1NB 1L6ZA 4QWWD 2ILLA 2PW2A 5DMGD 2P1YA 4P2QA 5FKAA 5FYKD 5EOTA 1VADB 5F7MC 1DFBH 4PUBL 1BWMA 4ZAKC 4HZLB 3WLWC 1F11A 1IGTA 2BSTB 2E9IA 1X5AA 3GSQB 3MLSL 5MHSE 1XIWD 2W60A 1OB1B 5CZKA 2HJKB 3FFCE 1MCCA 4U3HA 4EI5D 4JO4H 5C0IA 4N8VA 4H88H 4HBQA 4LSSH 3UO1L 1HK6A 2D0GA 4Y1AD 5C8JA 4ZO9A 4MA7L 5IK3B 3E2HC 4YIQA 3FO0H 1F13A 3OL2A 1UADC 3VWJB 3GMOB 3LN9A 2V6HA 3O0RH 4IRJC 5EOTB 3VXPA 1T21A 1S9KC 3BKYL 1FL3B 3E1F1 3VXUA 3KYMB 2VDPH 4U1KA 1B88A 3NIGF 4PGJA 1EGJL 4FNLL 3T2PA 1F11B 4MB5A 5J1TC 1OSZA 4MXVE 1Z3GH 1NMAH 4QTIL 1IL1A 3HHRB 3O4LE 2J6EA 1QACA 2R0WH 5FF6B 2H1PH 3FOMA 1QKZH 4DGYH 4P3DB 1PY9A 3IU4L 3EO0A 4NJ9H 1FO0B 2W07A 4D2NA 1UJ3A 5F9DC 5I17B 3LQAH 4QRRA 3B5HA 4LK4A 3WS6A 2HJFA 1MJUL 5E6IC 5CIPB 1U58A 4HS6B 1R3IL 4LU5H 5E4IA 3GJFA 3G6DH 1GGTA 4GG8B 5FGSA 1G7IB 4S0SD 3S35H 1ZK9A 5IGXH 4ZPVB 4LPVA 3VMPA 1QSVA 3BISA 3VFUB 3S37L 2O5ZL 3TNNB 4X5XB 5F1OB 3DHJA 4HS3B 1UXWB 4LRIA 5KSAD 3PP4H 1A3LL 4JJ5B 1C12B 3KWWA 4JFDA 3OTTA 5CSBA 5F44A 4QHNA 4E0RA 3KR3L 2YR3A 2AXFA 5CEZH 4QXGL 3KPNB 1AXTH 1D5ZB 3QDHA 3CFBA 3L5HA 1F97A 1XZ0A 1TXKA 3QUXB 4FFWC 5T1DH 3FQXA 1Z2KA 1QRNB 1Z9SA 3SKJL 3BVNB 2ZZUT 3DBXB 1S9VB 5D1ZC 4F7TB 4ODTL 5AG9A 1TZIB 1NEZB 2ITDB 5F7UA 2J2ZA 1RUQL 3ARUA 3K4ZA 2L4OA 2ZUWA 5D1XC 2XY2A 5IHLB 3SDCD 1A7BA 4PJIF 4NQCD 3EDJA 3NCMA 5JLZB 3PWPD 5AWNH 1LEGB 3CDGB 5IIEA 4OTXL 1DQQB 3UPRA 5I15L 1H3TA 1BVLB 1KB5L 2UUDK 4NM4L 4JKLA 3FQRA 1TQBC 3X12A 3WUWG 4M43H 1QFWL 2DQGL 1PSKH 1A6UH 4RA0C 4AIZB 5GGSA 1S9XB 4UQ3B 1OAKH 1A7RH 2LABA 1I1RA 4YO0B 2FSEA 4Y4FD 1TJGH 4PJ5D 3AS0A 2R69L 5HHPB 4JKKA 5EBLB 4YXHL 4KTEH 4RNRB 5ILTH 3PHQA 1JHTB 3ZKND 1I85A 3QEQD 1FHGA 3TNMA 4K2UL 3GJFH 3GMLB 3VXOA 4UDTA 3CCHB 4YHLL 4P4KD 1X3DA 2CDGB 3MXVH 3U83A 3VFOA 4WHCA 5AYQA 5B38B 3QCTL 1PAMA 4XZUA 5K9OA 5EUOA 4HIEA 4O2EA 1MELA 5J8OA 3DO7A 3L7FA 3JWOL 3DURB 5E2TL 4Y1AE 2DS4A 3HMXA 4G5ZH 1HIMH 1DQJA 1YECL 5C9JA 1MCFA 1NDMB 3ZTJG 2R1XA 4XT1C 3K7UA 2C1OA 1UWGH 4FN0A 1A6AA 2ZCLH 3SCMC 4LASH 4OLWH 3V52L 5HDQH 4L1HA 3QYCA 1ZA6A 2F74B 4FXGA 3T3MF 4GRWF 3GBNH 4WI8A 4DKEL 1GAFL 1DDHA 1QFPA 3QR2A 4E5XA 5JZ7D 1QD0A 1EEZB 4R96A 1GGIL 4Y5YA 4FQJL 3NCYP 4A6YB 5C71A 4DVBB 4PRPA 4KMQA 3THMH 4CU7A 4L4TD 3QUYD 1CTNA 2PYFB 4RGNB 1CU4H 2K1MA 1FNSH 3O9WD 1KBGH 4TVPD 5I9QB 3OKDA 4JRYD 5FOBA 1FGVH 4GMSH 3P40A 3O45B 3QIBD 4GMTH 1QFOA 4WNQA 2H26A 4MJIE 5H2BB 1YNLH 1PDKA 2HG5A 4X6CA 1PFCA 5KBNC 4U6HB 2IEPA 3HAEG 3HMWH 4G9FE 1D5IH 2D0FA 3BQUD 4LQFH 1DBKL 3RWCA 4M1CC 1HDMA 5MI0C 2B1AL 4HIXL 5D9SB 4YLQT 2NY0D 5DJXA 4R4FH 2YOCA 1F4YH 1RJZA 4WCYL 1JHTA 5EUOF 1MCWM 3O3EB 4RNRA 4GXUM 2CXKA 2BJML 1WEJL 1DBAL 3O2DL 1RZFH 2D31B 3ZYIA 1OQXA 4OZIF 3BDXA 4NZRH 2AABH 2E6PA 4PS4H 4U6XB 4LCYB 1KXQE 2YD9A 2JJTA 2HWZH 4L3CA 2WK2A 4Z7VA 4X4ZA 3MA9H 5JHDB 2YUZA 1LO2H 2C4XA 5INCB 2NY2D 4ZNEE 5L8JB 4XP5H 1UKQA 1K85A 1I4FB 2GQHA 3EAKA 3L5WA 1FIGL 3NFSL 3V4PH 5DJCB 5L2KD 3KPRB 4JM2A 2CKBA 2HP4A 4ZFFA 4QHKI 2XQYK 4UT9H 5KSAC 1KC5L 2AJ3A 4XXCC 4DGIH 2QADB 1A9BB 2V5RA 2WQRA 3SBWC 3MCLH 1IGIL 4MXQC 4Z5RB 2H32H 5E8DH 3SE9L 4J3UA 4OGYL 1XF5A 4LP5A 3ESUF 3V0VA 2BOCA 3GSXB 4U0RB 1JZ2A 3WIFB 1Q0YL 4HKBA 3JWDL 4ZFZB 4TQEH 3NCYS 2OZ4H 1NQBA 1A7PH 4RFNB 3D39E 3DYPA 4G8GE 3MGAA 3M8OH 1EHXA 4PJ9A 4TNWK 3MLRL 3E6HB 3HMXL 2EE6A 3EO9H 3GKWH 1BIIA 3DX8B 4L29B 2Q8BH 2BX5A 1IAIL 3K4AA 2PO6B 1VACA 4KJQC 1KB5B 2G75A 4KRPC 2Q76B 4PJCB 4PLJD 3DMMD 3HRZB 4S1SL 3T65A 4G9FB 1E4WL 1W2KT 2J8UA 3N9GL 2DOCA 3W2DL 2F53B 3W9DB 4BFGA 2VDLH 4NQDB 5FDYA 4EUPH 4Q6IB 3RPIB 1T1WB 5C2BH 5IB3A 2V2XB 1TJHL 5ENWA 5FO7A 3KYNB 3K3QA 5LGJA 1TJHH 3MRRB 2E7MA 2ATPB 2XPGA 3MUGA 5GGVH 1BGXL 5M7QA 1JMZA 2UZYB 3HNVH 3TO4A 3VXOB 2F54B 4PJ7F 3P0VH 3OGCB 4Y4KA 2F5BL 3HZMA 5A2LH 3S4SG 3GO1L 1S8DB 4PJ8B 4J4PA 3UJIH 3OKKB 1SM3H 3L3JA 1H3PL 2CKNA 4YBHA 2NTSP 4WGWB 1FBIH 2BP3A 4KK9D 1J8HD 4LSDA 3TCXA 4OF6A 5C8JB 3BJLA 4PJCF 2Z31A 3T4YA 3PWUB 1MOEA 1K6QH 1YN6A 3SDCA 5HHQB 1PYWA 1P9MC 4OLVL 4X83A 4QRSB 5GRZA 1L6XA 1LO0L 1HZHH 3FTGA 1KIRB 2ARJQ 4MWFB 2DWDB 1FVEA 1PD6A 4LVNC 4UZGA 4AM0A 1CFNB 3VE0B 3PXHA 3RTQD 1QLRB 4JY6B 4Q58C 1B6UA 2P7TB 3E2HB 3QUZA 1AHWC 5DC9B 2AERT 2EYTB 1MLBB 1S9WA 2ZKHH 3MC0A 5C0RH 3O2DA 1ES0A 1CG9B 1RHHA 4NT6A 2LAGB 5KN5B 4HC1A 4KQ3H 3CXHK 1TQCC 4WO4D 2ICEA 2GY5A 1E6OL 2E9BA 3D25B 4RBPH 1NCCL 2IH1B 5B39A 3GMMB 3V0WH 3I50H 2FX7H 1D5ZA 4XNUL 1JI2A 3QDAA 4HJJH 5D2NB 2YPLB 3ALWA 5C08E 5EU7C 4GG6E 3LPWA 4P59H 3FN9A 1RPQA 2GJZB 2XY1A 3IJSB 1F5WA 5TPWL 4TYUA 1OPGL 2H32A 3GRWH 2AV7B 4AYFA 1OCWL 3BKJL 4YHZL 1YEIL 3L9RA 4J8RA 3UJTH 3RKPA 2B7DT 1LEKB 3F7QA 4LHQB 4PGEB 2VZ1A 4WV1B 4Y5XB 2ED7A 2O93L 4Q9QL 1BJMA 1J0JA 1DN0B 1OAKL 4LRNH 2BMKB 1LO4L 3IFPB 3OJMB 2XA8L 3MJ9A 2J88H 3ULUC 2VITB 1MLCB 2J5LB 4WV1A 3CDYA 1CT8B 1ED3B 1OQOA 4KXZH 4LSQL 1KJMB 1YEIH 4NQVB 3EZJB 4LCIH 3QT2A 1SVZA 4ALAH 2FLRT 2UY7A 4EEEA 1NCBH 2QBWA 1R5VA 5C0JA 5GRWA 3IDGB 1JWMA 2GSGA 5E4EC 1RZIA 1YC8A 3QQ4A 4YXLL 3DPBA 1T5WB 5CGYC 5TGBB 1FNSL 5DA4A 4IRSC 3L9RB 1NGPL 4LQFL 1GHFH 4NN5C 4MDJB 4P2YA 2QSTA 1ZHBA 1AD0A 4ONHA 1UJTA 3D5OF 5HPMB 3OR7A 2VLJA 4MVBD 4U2YA 2HJKA 3X14A 1HHGA 4FXKA 3WS3A 1YNLL 1MFAH 1WTGT 3MRPA 4DAGH 3CH1A 1P53A 2R2BA 5DJ6B 4YHPA 4F7EB 1CI5A 3AU1B 3AXLA 1PJ9A 5BQ7A 1MCHA 5CINH 3TN0B 4QTHA 2HYMA 3S37X 4MJ5A 3V52H 3X11A 3IAQA 3OX8A 1QR1B 1U9KA 2FZ3A 4MXQD 2E7CA 1JFQH 4NRZB 1IMHC 4V1DD 2CLRB 4I0PD 5GS1A 1S7QB 5IVOA 1DQDL 3I6KA 3H9SE 1NC4B 5HHOE 3FZUD 4GW4A 4GO6B 3RWFB 3L3HA 3TBVA 3LRSA 5DYOA 1FE8H 2WWMD 3ARYA 3KXFA 5TFSH 3S36L 4L8BB 4UV7H 2CMRH 3TBYA 1EBPA 3GDBA 5HGBB 1KEGL 1NGYA 4Y5XC 2GITB 5C92A 1IGFL 4DEPB 3AREA 3DVGB 3UBXB 1QBAA 3E3QE 1M7IB 1ORQB 4XHJD 3ARWA 5DTFA 1OGAB 2EDHA 2VDRL 3FB7A 2FR4B 1OAQH 2SEBB 4JG1L 5HYQB 4KKBC 2ITCB 3D85B 1MRCL 4U6YA 3RJDA 1FCGA 3CX2A 5C3TA 3I6KB 1F2XK 3BZ4B 1IGFH 5TDPA 2XTJB 2W65A 1I3VA 4YHKL 4AENB 5T5FH 3T65B 3SPVA 1SY6L 2YK1L 2ZSWB 2V2XA 1U8MB 5L0QC 2N4IA 4NO0A 3RHWF 4WU7B 1J9CT 4HKJB 1W0WA 2MPAL 4M6NH 5AWNL 1LGVA 1UZ6E 3MLTA 3PP3H 4O02H 5AZ2L 4H5SB 5E99L 3INUH 2VDQL 1MY5A 1YYLL 4P57B 3RWJA 4I8DA 1S9YA 4XVJL 1Q0YH 2VZ3A 4TVPE 4ONGL 2DQIL 3SGDI 3SKJH 2ICWA 3WFHB 1NDGA 1M7DA 3H2WA 3O11B 3OGOE 3UTTB 3WLBA 2N56A 4KJWC 5FGBC 4Z0XA 5KSVB 1CYGA 43C9A 2ICWI 3ZKSD 4F33A 3RDTC 1VERA 2DLTA 3ARBC 3FT4A 1ODAA 3GMRA 1U8OB 5EORH 3QCUL 1KIQA 4PD4K 1KJMA 5D4QA 3BKML 1FNEA 1I4FA 2DJSA 4HUKB 4UMGA 2VLLB 3GIZH 4ZDHB 5IEKB 2AK4A 3ZE2F 1YUHB 5DJCA 1UKSA 5BJTA 4RGMB 3PGCB 2VH5L 2R2HA 3SHSA 4XPTH 1SBSL 1MVUA 3P9MA 2WIIA 1EIBA 5A16A 5CUSH 3WIIL 4OB5H 1O7VA 1RZFL 5I76B 1NJ9A 2XZQH 3IDIB 3V7MA 1YY9D 1LHZA 1BAFL 4Z95H 3TV3L 2AV7A 2VDNH 3LIZL 1JRHI 1UWEL 3WS6C 4F7PB 4J3VA 4R4BB 1AE6H 3Q6FB 1UJ3C 4Q2ZA 3MUZ1 4PJ7E 4XBGA 3RZWA 1I8MA 4P2OA 3O0RL 4R4ND 1GZPA 1BOGA 1E6JH 1PX4A 1B2WH 2BXYA 4Y5VB 4E41E 3VWKC 7FABH 4UOJA 3QIBB 4NQUA 1LO5A 3LY6A 4K3JL 3ZE1F 4H88L 4LSSL 3UO1H 3ROOA 1L9NA 2NQCA 1UM4L 4DUVA 2OLDA 5DRWB 2AEPH 4DTGL 1NGQL 4GSDH 4JDTL 4X4YA 1U3HB 1JPSH 1KBGL 3SKUD 5J1AB 3TO4D 1QHPA 3QIUC 1NCCH 5DK2B 1DFBL 4P3CL 1IT9H 3VFPA 5DK2A 1T2QL 3RVUC 3NZHH 1Q94A 2HG5B 5C0BD 1OM3L 4G8FB 5D93C 3VA6A 1HH9A 1G7QB 5C0GB 1I7ZB 5EO0A 3Q2CA 4BKLB 3HZVA 3HUJB 4S1DC 1BFOB 4RGNC 3I6GA 5HGAA 3OXRB 3MRFB 1KIPB 4PRPB 5E6ID 3H9HA 4BUHA 1IFHH 5TQ2H 2VLRA 1BOGB 4D9RD 5KVEL 1UH4A 3N1QC 3PGFH 1QLFA 3GGWA 3VW3H 1CDBA 1KENL 1JNNL 2EH7L 4XMPH 4YDVA 3ILQC 3ZE0E 3JXAA 4NUGH 3C60D 4FQCH 1DLHA 1NUNB 1KYOJ 1SY6A 4P46A 5IESL 3VXUD 5H37H 4AEHL 2AJYH 4RGMC 1OD9A 1JNJA 1WITA 4KROB 1KG0A 3KJ6L 3UJJH 2R23A 4E42B 4W81A 4XMLH 4WHYH 5E1AB 5EOQL 5L2KB 3ZYJA 1EDQA 4AEIL 4HIEB 3BEWB 3L3IA 4JB9L 4HCRH 4J1UB 4WHTA 4FFVD 5FO9B 1ZLVH 5EO9A 4HXAH 5TH2B 2H8PA 4K71C 3U46B 3DXAD 1B0GA 4K94H 1QSEE 3HC3L 1HHHB 1LNUA 3JTSA 3LEXA 3HLAA 3VWJD 4ORGA 3RBSA 2KBGA 1S78D 2CDGA 4K7PX 5F9JB 2EDYA 1KCUH 1WIUA 5IR1A 5E5UB 4AEIH 1I1AC 1SEBA 3MA7A 1IKNC 3WO4B 3AY4A 3ZZ1A 2NLJB 4MSWB 4OGXH 1BJ8A 1HSBB 2ZSVB 4RAVA 3T09A 1VEPA 5IVXF 1U8NB 3O3AA 1F8TH 4DCQB 4UIMA 2BNRA 2DQHH 1OGAE 5EN2A 3ZHKA 3EYOA 4OI9A 1E28B 4KZEL 3CJJA 3EOAA 1OY3B 1WVZA 1G9NL 1BLNA 4NJAH 5CLWA 3DMMB 4EDWL 2Z93B 4RGOH 3B9DA 1TQBB 4LKXB 2RFXA 1CXKA 4ZSOA 5CCKL 7CGTA 4Z5RA 5KZCD 2JJVA 1N8ZB 3ARFA 1KTRL 1T0PB 4WW2C 3DO3A 4MNQD 1VA9A 1BZ9B 4NWTH 2B1HH 4LEXH 2O5YH 3ALPA 5HHOB 2X44D 2AJSL 1KT2A 1D5BB 2ZSWA 4QWWC 3O6FC 4N0UA 4D0BA 1B4JL 4PRDA 1CDHA 1C5BH 1ZV5A 1NSNH 1XGUA 2H6PB 2QEJA 1MCIA 3C87A 3IDNA 1AXTL 3R1GL 4JG0H 3ARED 1S5HA 1NGXB 3S5LA 5GGRY 4P3CH 1MUJA 3PABB 1YMME 2X4TB 1K2DB 3QUXD 4ODXA 1N5YH 2HRPL 2P42B 2QSQA 4FTVE 3P4OA 4ETYA 2EC9T 4PRNA 2YD1A 1CLOH 2HLFC 3IDMB 4NYLB 1AC0A 5INDA 5ESQA 4MCYB 4XCNA 1F3DJ 3VGGA 3UYOD 1AI1L 3MZGB 1JGVH 1HDMB 3TBVB 3BJ91 3RTQB 3GMNA 1JV5A 4HGWA 1XAUA 5H35A 2BJMH 3HAEA 2NXZB 4OZHE 1ZLVK 4BH8A 2PXYC 4NBZB 2XN9B 4M7ZC 5IV2A 2H45A 4LPYA 3N1GC 4YDJB 4YHYB 2OK0L 3LB6D 4YE4L 1N64H 4RFEB 1N2RB 2I9LB 3O9WC 3ARDB 2DLFH 4JZJA 5ACMA 1II4E 2YD8A 4JQIH 1JBJA 1X5IA 4K7PY 4U1KB 2V7HB 5ALCL 2VIRB 4K23L 2FEEI 5ICZA 1I75A 2R2BB 3WSQL 4OJFH 4IS6A 1BFVH 1G7MB 4TNVF 5DZLA 5FV1L 1A4JA 4LIQE 5DD0H 5CSZA 3Q5TA 1CZ8H 4N68A 4WW2B 5IK3A 4ZODA 5IBTH 5EWIL 2PN5A 4Y5YB 5JW4R 2R9HD 4AEHH 4P23B 3G9VA 3ZE2E 5SWSA 3IDYB 4LHUG 4FQCL 1C5CL 5C08B 4J12A 4Q9RH 2YPLE 3B83A 3NTCH 4ODVL 4CN4A 4N8VB 4MB4A 4CVXB 5DGRA 2D7TH 4O5LL 1NGZB 4P5KA 3EJYD 2IFFH 4FFZH 1RZKL 1I1FA 1MREL 2Z92A 3B9VA 3WNOA 5DJDB 3X13A 2VIRA 1C08B 2NCMA 3CFKB 4J3WA 5IV2B 5KSBB 1GAFH 3OJ2C 4XB7A 4YR6A 5IVZB 1NAKH 4M3KB 3OKNB 4NN6C 2Q20A 4GW1A 3MRHB 4KC3B 1AXSA 5JW4N 2EE9A 4NJAL 1DQMH 3FAXA 1WISA 3RWDA 4RMWA 1NGQH 1J1OH 1DBML 3F6LA 1KTLB 1UA6L 3W9EB 5C0DB 2PR4H 2D4DA 2IADB 4WJ5B 3U7YH 4WEUD 3SN6N 5FUCE 3GSOB 1AKJD 2HJLB 4OJFL 4X5LA 1HQRA 4B41A 5C2UB 2ADFL 5MEOB 3RWHB 1Y18B 3F6IA 5HJ3A 3C6LA 2ED9A 2EZ0D 4JKPH 4YHMH 4PJXE 3CUPA 1YJDH 2X9WA 3L3KA 1KTLA 5C0DA 5SX4I 1Q38A 3MV9E 4JPIA 2VDRH 4HXAL 2VZSA 5JOFB 2V2WA 1IC5L 1TJGL 1AXSB 1CG9A 3QXDB 4Y16D 3ZHDA 4M6ML 1BD2B 3V8OA 3DHMA 1OTTD 2VO5A 3TCLA 5J6GB 1YNKL 4UT7L 1AI1H 1JZ3A 2GUOB 4MQ7A 4AG4L 2YD4A 1MFDL 4Z7UB 2F53E 2VDML 5E2VL 5GRXG 1KCRL 3ISWA 5F89B 5JOFA 3IJYB 2KKQA 3V7AE 1QZ1A 4ESKA 1NGZA 1FDLH 5AAMA 4GLRI 3OAUH 2IAMA 1OF2B 2BNRB 1HEZB 4M48L 4M7KL 3SE4C 3BIAX 4MSWA 4GRMB 4OFVA 1BOYA 5KVMC 4NFDA 1IM9B 3GJEA 4BYHA 3DIFB 4I77L 2L7UA 5IKCB 4QHNB 4G8GB 4JREB 1EO7A 1J1XL 4JEGB 1N26A 4X9IA 1A47A 4HS3A 3QUMH 2LTQB 4O51B 1DEDA 2D7PA 5D8JH 3KLDA 5JW5B 2VLMD 3ARBA 1NBZA 2EEDA 1DL7H 4Q9BA 4OZFH 3LVEA 1OM3H 1LEIB 4RQQA 3P77A 4KDTC 4OCNC 4MNQA 4PJ8C 2VDQH 3BRDA 4JFYB 2WINA 4JPVH 1WBXB 4D0DA 3FCTA 2IANB 4HKXA 5TJWK 2EXWC 4DTGH 5ITBL 3OKOA 4QYOB 5IVZA 5SWQB 3ETBF 2W0LA 1BQUA 4L8SA 3OR6A 1UB5B 1NANH 2NXYC 3TO2B 3KS0J 2PYEE 4LCIL 5CBEB 4IRSA 3BEVA 3DV4B 3U36B 2QR0A 4P5KB 4PJXB 3DX8A 1QLEL 5ITFA 4KMTH 2OYPA 1GC1H 2DTML 2R4SL 4C4KO 4XPFL 5KG9B 4MD0A 4TUOB 4KK6D 1T66C 3HE6B 3W5NA 5CJXC 5GZNC 1QLFB 5DO2C 3VJ6A 4KKBD 4GJTB 4PP2B 4C55A 2VLRB 3O6FB 4QHLB 5ADPL 3UTSA 5CUSL 5GPRA 4WI4A 1M05B 3CSGA 2H41A 4JN2A 4G80A 4X6FA 4BJLA 3S6CA 4RA3A 5CGMA 1OTSD 3AB0C 3WXVH 2NPLX 4XVUD 3UJJL 1FGNL 2A83A 1INQA 4P4KA 2F54D 2BSRB 3W11C 4CMMB 5K9QG 1RZ8A 3OKLA 2DM3A 1U8QA 4M1CD 1G7QA 1QRKA 1ZA3A 1I7RA 5FUOL 4R7DB 4JQXC 3MRMB 3OB0H 2QQQA 5C07B 3D0LA 3MTRA 3TYGH 4KHXL 3TEUA 1FNLA 4X4YB 2VN7A 4L3CB 1KN2H 4F9PA 4KVCL 1JN6B 4XMPL 1TPXB 1J8HE 3RP1A 1OARL 3PQYD 3CDCA 4RGNE 4EI5A 1MHEA 4OGZA 2HFTA 5GS1C 3C6SA 3MLPA 1RJYB 1BEYL 4QRQA 1CDUA 2IAMD 2IFFL 3LV3A 4HWZB 1OARH 2GHWB 4ZUUA 3LV3B 4KI5E 4U7SA 4XBGB 3REVA 1URLA 3DRQA 1L7TH 4R4BA 1T0NA 2D03L 2CPCA 5F93C 2FJHA 3V7AG 3MA7B 3EIFA 1YEDB 5ESVA 1LQSR 1VFBA 3SJVA 2CIKB 1JMXA 3BW9A 5D71L 4XWOC 4M00A 4LP4A 1RULL 1KJVA 3H0TB 3QJHA 4NM8L 4PJGF 3WFDL 2DTSA 5GISL 3QIWD 5JQ6L 1G9ML 1TVHA 1CL7L 4EUPA 2AJZA 2AS5M 1SJEB 4OBRA 4M8QB 1RZ8B 1MRDL 3OKLB 4LVOB 4HWUA 4MD5B 3GMRB 2PTTA 4MA3A 5DHXB 3RUGF 1YY9C 5L2KA 1M1SA 4KPHL 4LHJB 2W59A 4IOIB 1MCNA 1K5NA 2PUQT 3PL6C 4H8WC 4XNXH 3CSYA 3S97C 1KV3A 4JFQB 1EUUA 3RVWC 3TPKA 1UFUA 3CFCH 2UYLA 2NX5D 5IFJA 3VFMA 1M71A 4PJHF 1MJ8L 1KEGH 3S36X 1A6ZA 1NAMH 2FJFB 3IVKB 2GW5A 2DIBA 4L8SC 2MHAA 5C0CA 2EYSB 1QOKA 3BXNA 1RIUH 2K9UA 5A3ID 1KCKA 1VPOL 1A6PA 2FIRT 3IGAA 1ONQA 4XNYL 43CAA 5E5RB 5F6IC 5CEZD 4EVNA 1QR4A 4MXWH 3RIAK 5I8KL 4HDIA 2R1XB 5BZWA 2F15A 5E08H 3T3PE 3AMKA 1KACB 3D9AH 3L7FB 4EN3B 4FQ1H 1RIVH 3MRCB 5JNYB 5CHNA 4S1RL 2NY6C 4KWUA 4H26A 5DRWA 1NSNL 1TFHA 1LEIA 3GMLA 3ZMRA 4ZFOL 1JUFA 2DBLH 3KJ4C 4LVEA 4OLYH 3SBWA 2NY4B 4OCRL 3L5JA 4I77H 1JF1B 1ITBB 3TGXA 3BOVA 5CWSB 4NWTL 5L8KB 2VERN 2GITA 4WFHE 4BZYA 2JJSA 3EFFA 3MRJB 2KQMA 4PGZA 1XGYL 3HFML 4WO4C 1IM9A 3IJHA 5DGQA 3FB7B 3IKCB 1S7VB 1AGBB 1U8IA 3D69B 1EO8H 3V0AC 4OD2A 1RZJC 4LNVA 1RSFA 2PETA 5D5MF 3ECBB 4WY7H 4HG4K 2P8MA 3SDCC 2JTDA 5L88H 3P0VL 4JFPB 1EEQA 2MNUA 1HWGB 9CGTA 1NFKA 4DK6A 1F90H 4PRAA 4S1DD 4LPUA 5E2WL 2FX8L 5EPMB 5EOCH 3GI9H 1IGCL 4NN7C 3MJ9L 2JCCB 3MLWL 12E8H 1D5IL 2D9CA 4IRJB 3NAAH 3BPCA 3VI4F 5ISZD 2AK4E 2DLGA 2W0KA 1G6VK 4P4RB 1VGKA 4L5FL 5E8PA 1LO5B 1QRNA 2QQNL 1IAIM 1P4BH 4YHPB 4F7EA 4KQ4L 2YZ8A 4FZEL 3BWUC 3ZL4H 1CLCA 1T6WA 4IMLA 1R5IB 5AEAA 5JMOC 4MAUL 1FL6A 4KKLD 1UXSB 4LLVB 4MJ6A 4HIJA 4KMLB 3SGDH 5I1CH 4NN6B 3OWEA 4ODSL 4BZ2L 4XP6L 4MS8C 4XRCB 3KPSA 1S9YB 5K59E 1JFQL 1A4KA 1K3ZA 3MV9A 3KLHD 3B4NA 1BPVA 2FO4B 4PLOB 2XQBH 4HH9A 1U6AL 5EZJA 2APTA 5D7LB 3V5KB 2IMNA 5I1HH 3N1PC 4PRID 5I2IB 1NCWH 4QT5B 3S3SA 4HUUA 5SV4A 5KVFL 4KH2A 3GJFB 2MKLC 3MACH 2A9NH 5IVNA 5I1HL 1N6QH 5FKPB 4Z7WF 3U30B 4KI5D 2FECL 4O2FA 3JSSA 4Z77B 5MENB 5FF6A 1G9EA 3H42H 3VFRA 5CD5C 3TJHC 1N3NB 5JXEC 3I3BA 4TVPL 4E41B 1RJLB 1ITCA 1IC1A 3Q1SH 5JZ7C 4U1MA 1T1YB 2XG4A 3TC9A 3SCMA 4PJ5E 4XHJC 2RGSA 3CFJA 1X7QA 3AM8C 5J12B 5IHZA 5D7IB 1S3KL 3ARDC 1A7QL 1IBGH 3UEZA 4UILL 1AC6A 3AC0A 1U8KA 4OUUA 4HK3J 2QQLH 1GZQB 2EKSB 1T0MA 1YN7B 1FFPA 4ZTPL 5KW9H 3BP7A 4A6YH 5IG7A 1X9QA 4OSUH 4MGXA 1AE6L 3MLTB 3RAJL 4OF3A 2BVUA 3WUWB 3PWPE 1FZOB 4XPFH 3ZDYE 4I2XB 3PHOA 4Z8FH 5DWUH 3RAJH 4MYWB 1U91A 4S1SH 2B5IB 3JTTB 4C56A 1EEYB 4OLEA 2ZPKL 4DGVL 2ORBL 5I1KH 4RMRA 4NKQB 4KI5F 1L0YA 1EFXB 3QEGL 5HXMA 1T2JA 4UTAL 4JANB 1A7QH 1A21A 4PGBA 3VXRD 5DRNA 4P2RD 5CBAB 2WM0A 3BHBB 1X5XA 4N9OB 3X14B 1GJIA 4FQQA 5E1HB 3NGBC 1ORQA 5DTFB 2Z31B 5T33H 3S34H 4JVPA 4QKXB 3A6CL 1RMFH 3NCJL 1IGIH 1UZ8A 2QHLA 4PJBE 2YPVH 3HRPA 3EJYC 4PJ9D 4J7RA 4KI1A 1UG9A 5DT1L 2WBJD 4LVHB 3ARVA 3MV7E 5IM7A 4C4KT 5C0BB 2A2QT 2M1KA 1QEWB 5FV2A 4GW4B 1NBYA 5IB3B 2EDEA 3TYFA 4Y4KD 2V17H 4L9DA 3FMGL 4WFGD 1MQKL 3VFRB 4U0RC 1LO0H 4FQXA 4K55A 5CAYB 4IOFD 3P2TA 2VC2H 4P23C 3O6ML 5K93A 5FIEA 2NY0B 4U1JB 1I9IL 3TWCL 2P44B 3OX8B 1EVTC 3TIDB 1J8HA 4XNMA 1KT2B 1RV6X 2BSED 1I7TA 3PDOA 4RFNC 1L4IA 4NQDA 5EA0L 4G9DB 5BQ7B 4L4VB 3TBWA 4UINL 4D8PB 4ELKB 2YUWA 3G6DL 4ZFOB 3MNVB 1CXLA 2Z91B 1AGEB 1CGXA 1RK0A 3HZYA 1IQDB 1C1EH 5H37G 2UWEA 4OIAA 3QCTH 3B3IA 3QEGH 4GUPA 1U2CA 2BY0A 5I1DA 2F5BH 3KXFE 4WUUA 5FAAA 1UCTA 1GZQA 4HIIA 4XPHL 2BDNH 4ZPTA 4WHDA 1Z5LA 2H32B 3A6BH 4KROD 2ZUQC 3OB0K 5J56B 5D5MB 1T80A 1EGJH 2G5BB 3V0VB 4HMDA 5FUZH 3BAEH 4UU9B 4K94C 2VLKA 3W81A 3NCCB 1MCKA 5F7EL 4GBXC 4KRPD 2PYED 2D0HA 3LKPA 4A6YL 4EBQL 1T20A 1CFTB 4YHIA 2HTKD 3L7EA 35C8L 4G9DA 2YMXH 2V7NB 4Q9CA 5LJYH 2PR4L 4L3ED 1BBDL 1GIGH 5MENA 2FEEL 2CJUL 4RMTA 3B8SA 1H9VA 4G43A 1KB5H 4NM4H 1JYXA 4M61B 4HKZA 2CLVB 5EPMA 3EO9L 3GKWL 4AM0B 2WIMA 1EO8L 3H3BC 3D1MC 3EYQC 2C3GA 2PKDA 1XCQB 4NZDA 2DMBA 1NBYB 3TA3C 4EUPB 4N0RA 1LP9A 1FYTE 4XP9H 4LCYA 1FL5A 3H42L 5AUMA 5FHBL 4OFYD 3TWCH 3STBA 1KB9K 1KJVB 3H0TA 3BX7C 3UTTD 3BKCL 3DI2B 4OCRH 2N7AA 3TT1H 4ZOEA 5I75C 4FFZL 4U6XA 3ARGB 4FFWD 1H8OA 4JDZA 3OKKA 2XTJC 3DRQB 4HJ0D 1CLZL 4YH6A 3D39A 1NUDA 4CVWA 3IETB 2XQBL 4DKDC 5IW6A 2ARJA 1S8DA 1MFBH 1W8OA 5F7LB 1RJZB 3MMEB 3MRFA 3SE8H 1JUFB 3HPLB 4I5BB 2HFEA 4ODSH 1INDL 2B0SH 1EFXA 5J4MA 3MV11 3QFJA 1ES0B 1B0RB 5HI3C 4BELD 3B6SB 4JREC 3ZL4L 4P5MA 3ET9F 4LCWA 1CFNA 3VE0A 5ALCH 4YJZL 3L1OH 2MMXA 2H2SC 4LLQA 5KSUB 4LLWB 3NH7H 5D1XD 3ZDZE 5HHXL 3T08A 1FZMA 4L3AA 2A83B 5K59F 2IALB 4HLZH 4FQ2L 1T1XA 4YE4H 2ZPKH 1JZ5A 2P8MB 1TCMA 3U79A 5CZXC 1PZUB 3LQZA 1U8KB 4U7KA 1UACH 4JKWA 1VDGA 1TMCB 1WWBX 5F9AC 1KGCE 2EIDA 3MRLB 4AMKH 1ZT1B 5ICYB 1FQ9C 1S7VA 3GFUA 5D7IA 3QXUA 4HIXH 4GT7A 3MRGB 4YNYB 4QRPD 1YEEH 5C0CB 3MRJA 4N90D 4PRIA 4A6YA 4LEOA 1CR9L 1FFNB 1T66D 1JF1A 1Q72H 2DDQL 4YQXH 1EHLH 4POYA 5E9DB 5GZND 1DDHB 3QA3B 3NH7L 4M9OA 3PWNA 4J23A 2NMSA 5C9JB 1OAXH 4XBPA 5HDBE 4LLDB 5FYJE 5LGJB 1P4LA 4MA3B 1F6AB 2EDDA 5JUEL 2NW3A 3QUYA 1DLFL 1I1AB 3GMPB 5DMYA 2UZIH 5JOEA 2AJZB 3ZDXE 4PB0H 3KLAB 1F3JB 2KUTA 1U3ZA 1QVOA 4HDIB 1WFUA 4OCWH 2NTFA 5B38A 3C5JB 3RDTB 2OCFD 4AK1A 4HS8L 5GSVB 3SQOH 2F8XC 3DSFL 4IHOB 4KUZH 4Y16A 4C56D 4H8WL 4WFGE 3RUGB 2NY3B 4EOWL 5BZDA 1FL6B 4FP8L 4PD4J 3STZB 2O5ZH 1FAIH 1IVLA 2F54E 2Y5TA 3S96A 3D18A 2OQJA 2UYLB 3CZFB 4TSBL 3WEXB 1MFDH 4YPGB 2Y07L 4MNQE 2FX9H 2Y4SA 2X4OA 2AJVL 3ARFC 5I74C 3WXVL 4EN3D 4XCYB 1W0VB 5FK9A 3D0LB 1GGCL 4MHHG 3UPRB 2DM2A 2DN7A 2QQNH 1FV1A 5IJVA 4XWOD 3BPLB 1RY7B 2I27N 1UGNA 4KTEL 4ZUSA 2VXQH 1KELL 3BVNA 5JTWA 1AKJB 4YUEL 3BKYH 5JHDA 2AQ1A 4NC1E 2CLZB 1T04A 2VNCA 2MQ3A 1KEMH 2AXFB 2FJHB 3OZ9H 3WJJA 2AJVH 3GMQA 5I1IL 1FNHA 5T3XE 3QUXA 1T89A 1ZMYA 4J2XA 4NUJB 4FMKA 1FSKB 1IAIH 2D7OA 1ZVSB 3NZ8B 1C1EL 4YHYC 4HHAB 3TN0D 1K8DA 3MGTB 3MODL 5D7JC 5FXCH 1IM3A 1C12A 3BMVA 2APWA 4FP8H 5ITFB 2VABB 1AFVH 3L3HB 1HOCB 5SWSD 3KJ4B 1I85C 4GKSA 3QHFL 1R3LB 3HE6C 4QXWA 5SV3A 3MRKA 4HF5L 2MCPL 2IPUG 5CBEA 2NY6D 3FQWA 1DEEA 1JGDA 4ERSL 1MREH 1JL8A 3TVMA 1D6VL 3FMGH 3VXMA 4RSVA 1DR9A 2DJ4A 3T3ME 5SWQA 4WNQB 3HCVA 5JHDE 4Z7QF 4F2MB 5EU3B 3V6FB 2ATKB 3EOTH 3HS0A 4QRRE 4QY8B 4DAGL 3BIKA 4PJDF 3UZEA 4JLRB 2JIXB 1VFOA 4JFDD 1OGAD 4EIZC 6CGTA 4FQ1L 5D2LF 3RVTD 3BT2H 1F02I 1MCOH 2WWKO 3ULVC 1WT5A 4TSCH 3C09B 2K3TA 4OZFG 4PJFE 5FYLH 5I74B 2DI8A 4HX1B 5EBLA 1T21B 2C7UA 1DUZA 3TLRA 1CF8L 1Q72L 2DDQH 2LVCA 4QHMB 3VFMB 1ZS8A 2DKSA 4F80A 3ES6A 2C3HA 3V6OA 1VPOH 2X4NB 2WW8A 4WU5A 3SJVD 3QDGA 1Q9OB 2XN9D 4O2CA 4P2QB 2YC1A 4FG6D 5FKAB 5D72H 5C0IB 4I48B 3X12B 1R5VB 1BWWA 1LWRA 2IALA 2G2RA 4KDTA 4HZLA 4YEEA 1XIWA 3GIVA 4BH7B 1I3RA 1G7MA 4LSRL 4H0IA 2CDFB 1FZMB 5F7YC 4LSRH 5ELIA 3CFCL 5MEND 1DQJB 1H3UA 4IIQC 3ULVL 2VUYA 1MI5B 2R29H 4RIRA 1GL4B 1P7QA 2ESVE 3DO7B 3GHBH 4OQTL 1YJDL 5FDWA 1JPGA 2O5XH 1CFBA 5FUCC 1G1CA 1YY8B 4MMZC 1FJ1B 3BN9C 2ADGA 4MCZB 2V2WB 3MX0A 3BGFC 3ZLQC 4FOMA 4MDIB 1CLOL 5JXEA 2VQ1A 3REVB 2OJZH 4YBLC 4XP4L 3QCUH 2P8PB 5FM4A 4XVTH 4WTWA 4P2QE 4WVRA 4XNUH 5E8EB 3L3OB 2VLJE 2B4CC 3VDBA 2Q6WB 4JAMA 2YWZA 3PNWB 3K8MA 3SGKA 3LS4L 1CBVH 1A2YB 2OR9H 2GAZB 1NAKL 4PRIE 3T3PF 4CN6A 3D3VE 3CLFH 3UAJC 1J1XH 1KF9B 2ZUXA 4JGJA 3V79C 2AJSH 4Y1AB 3BKCH 1EFXD 2I26N 2R0LL 3MV8D 4WWID 1XCQA 5FM5O 3IDNB 5HGDB 1FLRL 4O5LH 2VE6A 2GUOA 2X40A 3OKNA 4GQ9H 4LHUD 4OQTA 4XMKL 1QLRA 4JY6A 1MCWW 2ICCA 2P47B 3OKEB 2GJ6E 3WJLC 3BZFA 4PBVC 4X4XB 2GTWA 5B8CA 3X13B 3FTGB 1C16B 1D5BA 4M5ZH 4KZEH 4RMQA 4TVSa 1AO7E 1JCKA 4JFOA 5HYJE 1ZEAH 3JWOH 4HV8B 4APQC 2AK4D 4OGXL 3MSPA 3QDJA 4HK0A 3T4YB 5BV7L 3EOBA 3QSKB 4X6DA 3C8DA 1S5IL 4L1DA 4YHLH 1IC5H 4XC1L 3QFDA 3DX7A 1P7KA 1ZT7A 2Y6SD 3MJ8B 4PJ7A 3ZDXF 4DCQA 1EJ6A 2IADA 4WJ5A 4Y4KB 5FUZL 4OLUH 5GGTL 1JYVA 4OLUL 2J8UF 2QR0B 2DWEB 2EXYC 2CD0A 2X9YA 4UAOC 1NFDA 1DZBA 1OP3H 2F54A 1CICD 2EDXA 4AJ0A 4IJ3C 3NVQA 1HXYA 4QRPA 2YXFA 4LCCA 1GPOL 4CDHA 5ICZB 1UVQB 3TH3T 3FRPG 2J12B 5CJOH 4ELKA 4NKOA 4CADA 4QY8A 4G6MH 4L4VD 5I1AB 3WFZA 3TIDA 1YEKL 1P7QB 1J1OL 1DBMH 4R2GC 2A74A 4U1JA 2A6KB 4LBEA 1OAUL 2Z92B 3V8CA 2Q7YA 3VFNB 4J1UA 1ZE3C 4OTXH 4HQQL 4Y4HB 4EI5C 4CU6A 2IWGA 4YEFA 3MBXH 3SDAC 2HRPH 4M93C 1A7PL 3SQOL 3PGFL 5IJKA 3GJEB 2BVTA 4PREA 5IB4B 2LQRA 4JQXA 3QWOA 4FQIH 1HKLL 1KJ2A 1WFNA 3CPLB 5HVGB 2Z4QB 1CBVL 5I8EA 1G7LA 3VXSB 3BGMB 4IOFC 4KJYB 2LFGA 4X6DB 3LKNB 3NPZB 2O5YL 4X4XA 1CGTA 4PJBA 3DXAB 3L5IA 2BFVH 1IZJA 3OKEA 2H6PA 3HS0B 2CKBB 3RY6A 1LILA 1RUKL 3D48R 2QHRL 2DQFA 3PV6A 2WANA 1QSFA 4D0BB 4OCYH 3JTTA 1YQVL 4M1DL 1REIA 4RAHA 1JHKL 3UTZB 3QEQB 5DUMH 2YBRB 4LSUL 3MRKB 5I8CB 4Z9KB 1VEOA 2FD6L 4KZDH 1X4XA 2GY7B 3ULUL 4LU5L 1MEXH 4WWKD 1LVEA 1YEKH 2X05A 3AVEA 3L3DA 3ARGD 1P69B 4YDIH 5E5MA 4OQTH 2DYPA 3IU4H 5MEOA 2CH8A 1DBAH 4F3FA 1EH9A 3LIZH 2B39A 2EKSA 3D18B 4HXBL 1V8HA 4HXBH 3TBSB 2XZQL 5HHNA 5L0QB 3M1BB 2FYYA 3UJTL 5GGTA 1I9JL 1WAAE 3HB3C 5GGQL 3O2VH 3RUGA 1YDPB 4KKAC 2KL6A 3REWA 4P46D 3TVMC 5C0CE 4IHOA 4GRLA 5JA8B 1WCBB 5DD3H 2HTLD 4RWHA 1I7UB 3MREB 4P59L 4LSUH 4ORGB 4OI7A 1CF8H 5DXWA 5BVPL 1CL7H 2BNQB 1MPAH 2HN7A 3MO1A 1AKJA 5J12C 4GBXD 2H8PB 4PTUB 4ZUSB 4OFIA 5C07D 1MI5A 3P3YA 3SKOB 5GRVK 2R1YB 4TSCL 4XXDB 1C08A 3VFTA 5IJVB 3AM8A 5DMIL 2HKHL 1JPGB 3DOSA 5EU7E 4X7SL 1YMMA 3PQYB 3R1GH 3B9AA 3QDMB 3THML 1FNEB 2YC1B 3WNPA 4XPAH 2QTEA 3ARFB 1HINL 5CLTA 2BVQB 1IAII 4JR9L 5FA4B 2P4AB 4MZ2A 4NQCA 3EOAB 1FFNA 2UVEA 1WAAA 4LEOB 2ED8A 3QAZC 2B1HL 4LEXL 4OZGB 1U8NA 3O3AB 1J7VR 2XKUA 1FLTX 4R96B 3T77B 1E4KC 5HDQL 4KJQD 5CSZB 5F21B 1ZWIA 4YZFE 4D9LL 3NZHL 3GSWA 4H0HB 3ARDD 3W0WD 5FUOH 3QNYA 1FYHB 3HLAB 4R3SA 4P46C 1RK1A 3G5YB 2CJUH 4S10A 4N8PA 3ARZA 5SWZA 2Z31C 3U0TB 5I8OL 2WBJC 3F65A 3VXMB 5C0AB 4HT1L 3DURA 3O41B 1WIOA 4NKMA 4OF7A 4LCWB 4WFFD 5T1LA 2FO1A 2IQAA 5KJRH 2FHFA 1ZHKB 4NN5B 4RRPG 4JM4H 3WLWD 4APQD 4GRWB 4K7PH 3RKDC 2XWJB 3MJ9H 3GM0A 2RCSH 3HC3H 3BAEL 4U05A 1B9ZA 4AENA 1KJ2L 4P23D 5ILTL 2F58H 4PJAB 3TVMB 1QSED 3RTQC 4WEMB 1ZT4A 4G6JL 4LSTH 5SWSE 2YRZA 2G60L 4BK4A 1Y6NR 4Z78B 5C09A 5IT2L 4GKNA 3VD4A 5EOQH 2P5WB 3DNKA 4JGMA 5D1ZD 2FGWH 2J7LA 3ZKMC 4S1QL 1NGXA 3S5LB 4AIOA 3VA2C 1MHHA 1T2XA 1YPZB 2VRAA 3FB5B 4HLJA 4JZNA 3O6MH 3VU2A 1UENA 2QHRH 4HPOL 3MBEB 1EPFA 4XMKH 3VWKA 3SGKC 4KUZL 4DOHE 5IEHB 3P4MA 4LAJH 1J1PH 4PRHD 1IJ9A 1DVFA 2R0LH 1XR8B 5M94B 3VFPB 5BS0E 1S7RA 2R56H 5FB8A 3G5ZA 2VLLA 1IE5A 5IJKC 4M61A 1DL7L 2XZZA 4XCYA 3G5XB 4S1RH 5A2FA 5GJTL 3QRGH 1RIVL 4GRLD 4R6UA 4M6OL 2PO6D 3GSUB 3TN0A 2J8UE 1YPZE 4FQIL 4LKXA 3HPLA 4I5BA 4M5YH 4QRRD 4ZSOB 5C7XL 3DETD 4ONGH 3HG1B 4XX1G 5F71A 4NQSB 5FOJA 4ERSH 3ULUD 3AFLA 3EYQD 4JJHA 3GB7B 2MCG1 3ZT5A 3IGAB 3EGSA 4R90L 3PP4L 3QHZL 5IW3A 5E6IA 5DEGB 5I19H 1BQHB 2MHAB 3SDDD 1NDGB 4HQQH 4R2GB 3MODH 4LVOC 1KPUA 3KPQA 2XV6B 3HR6A 2NXYB 3UC0L 5JIHA 1Z0NA 4JFFB 1JNHA 1G7JB 3IDIA 1L7IL 3FQUA 1X4YA 2BRRL 3V4VH 1HHHA 3ESVF 2VB5A 5I76A 3DV6A 3B3IB 2WMPA 4KFZC 5JW4Q 1WIPA 3G9AB 5F3HB 4IOIA 1A7NL 4QNPE 4W6YB 4OZFB 4K8RD 1W0WB 3L3GB 4LCWE 8FABA 4ZSOE 5C0AE 1NCDL 3MUHL 4R0LA 1F6AA 2BC4B 1TENA 3F7PC 4MAYB 4P0DA 1KTDB 5TDOB 3WIIH 1FFOB 2R23B 4XBPB 4FNLH 1KG0B 3QG7H 5TDPB 5EZOH 1TTUA 4PG9B 4LPWA 3LKRB 1A1NB 2DQJL 3PWNB 1IBGL 4J4PD 1KLUB 5TPWH 3WFBL 2VISA 3BUYB 2VJXA 3KPLA 4ODWB 5EC2A 3PWPB 3KYMA 4LLDA 1F4XL 2LV4A 3D2UD 3FO0L 1JE6A 1IEAA 4N0YH 4RMUA 43C9B 1A6WH 4EIGB 5D71H 2HRLA 3LHPH 4NCC1 3FT3B 4YHNB 4IOSD 3WD5H 1Z6JT 1EA9C 1ZHNA 3C5ZD 1AIFA 3GGWB 3EYVA 3ZYOA 2FYYB 3RGVA 3NABL 4LPXA 1QQDB 5HDBF 2GSIA 3OBAA 5DQDH 3C6LD 4R9HA 3LRGA 2W60B 3DARA 3ULVF 1F4WH 3SO3B 4HAFA 1K4CB 3T1WA 1EK3A 3LRSB 5DYOB 1QHOA 1IQDA 4HLZG 3RIFF 4H8WH 4NHUB 4Z7WB 5MP6H 1JWSB 1H0DA 1Q1JH 4G8FA 1CFSB 1G7PA 5TF1H 5F1SA 1SYSA 5AZEL 4GBXA 4Z0BH 3MRMA 3AREC 3B6SA 1RHHB 3O8XC 2H9GB 4HMEA 4IRZH 1I8IB 2XKNA 3ZO0A 5D7JB 1T7WA 4GLRH 2BNQE 2HFFB 3F12A 5IROA 4N1EA 1C5CH 1IKNA 3O6FD 4HGKC 1G7PB 4FZ8L 5CJBA 1NKOA 1NC2B 5EBMA 1BZ7A 2XRAH 3LMJL 4NHUA 1IT9L 1FGNH 3F7YA 3ZTJH 4XVTL 1T0MB 1YN7A 4KK9C 5T5NG 5IMMA 1KTKE 1YC7A 1E4XH 1M7IA 1N6UA 2Y9RT 1PG7W 4X5WA 3UBXA 1JGUH 3QQ3B 2WWMC 5EZLA 1AH1A 4LSQH 2MTPA 1NL0L 3NACH 1RZ7L 4LIQH 1F2QA 3NIFE 3GHBL 3PL6B 2QADC 1GXEA 3BUYA 2FWOA 1N64L 4R97C 1C5DA 2VDNL 3JVGA 3QEQE 3N06B 1A1NA 3LKOA 4CAGA 4XX1E 2YPKB 1EERB 3FO2B 3MUGB 1D9KC 1MCLA 5IOPB 1HE7A 2VITA 1UH2A 4DKAA 5DQJA 3SE3A 3RPIA 3DXAE 5HHXH 1MVFA 5GS2D 4AL8H 1YMMD 1MY7A 1FZOA 5I71B 1BQSA 4MD4A 4PGDB 5IVXA 1CVRA 2EDRA 3FONA 2VKXA 4JPVL 2Q76A 4PJEB 3HPJA 2V7NA 1K8IA 3RGVD 3O6LL 5KSVA 4KJWD 1FFPB 1WJ3A 2VC2L 4IIQB 4WV1C 2FBOJ 1FG2B 1DBBH 1NGWA 2XWTB 2XWTA 1AJ7H 4X8XA 3DX7B 1JGEA 3U9UB 3SJVE 3MCLL 2DQEH 4MDJA 4UU9A 1NAMB 1OTUC 2B5IC 2ZKHL 5C0RL 1KXVC 3QIUA 4X7TA 2OL3H 1PBYA 5MEQA 2R56L 3V6BR 3D3VA 2YPVL 4QRTB 4ZOCA 3T0ED 3D9AL 1L0QA 3IDGA 5T3ZH 3NCJH 3N1MC 3BWAB 3VXNB 1CE6A 1HZHL 5E08L 3WCYA 4LSVL 3VFWB 3WFEL 4NZTL 4XP5L 4XC3L 3UYRH 4OLVH 4ETQB 4PGDA 3OXSB 3O6LH 3HZYB 5DQ9A 1ZANH 4P48A 3FO2A 1MLCA 1QSEA 4O02L 1S7RB 4OZIE 2FGWL 1NPUA 4M6NL 5L2JB 2NY3D 1NCBL 1PEWA 3FO1A 3M17B 5GGRA 2UWEE 2JKXA 3RX7A 4CVZA 1JHLL 2YSSA 3UJIL 4M62H 2JELH 4GAFB 3NFPA 1IAMA 1BBDH 2H2SD 1MAKA 3B9KD 3L3KB 1BBJA 5EZLB 4WUUE 1A2YA 2DIJA 1LO4H 2X1OA 4N8CL 1CXEA 1VGEL 3IJHB 1BGXH 5EZIH 1UACL 4OF5A 1FPTH 4R26H 4JO2H 1DBKH 5J57B 3GMMA 2DQTH 4X6CF 1Q9LA 1HSAB 1P9MA 2HLAB 5MI0B 3VRJB 3ZKXB 5TE7H 1VESA 1MRDH 2C3XA 5IB5B 3CFEB 4PGBB 3OKMB 1E4XL 4P4RA 1GC1C 4HWBL 5F96L 4TPRH 4Y4FB 5IF0B 4GMSL 2ADJB 1TETL 4GW1B 4DVRL 3VWKD 4OCXL 2FX7L 1SHMA 4J4PC 3KXFD 2R2EA 2XFXB 4UBDD 2PCPB 4QHUB 4FQLL 4OV5A 5SWZB 4U1GC 4M1GH 2YS4A 1LMKA 4M7LH 4R3SB 2MQCA 3MOAH 4QOKD 4I48A 1CGSL 2PNDA 1CFSA 4PFEA 1P5UA 3OR7B 4MJID 3O4OC 1ZHBB 5JDJA 2QSCL 4IMKA 1AIFB 4DGIL 4RX4A 3SEPA 1X7QB 1PG7L 1CD0A 2GFBA 3CFDB 3NTCL 5C6WH 5DJ0B 5DT1H 4OCWL 3O8XB 4X7SH 1G84A 1HCFX 2GSGB 4HX1A 2IG2H 1FIGH 3NFSH 5C0JB 1HIML 5EWIH 3CSYB 1N3NA 5CFHA 1G9NC 2DI7A 4OI8A 1T2QH 4HUXA 1VKXB 2AJ3B 1ZA6B 3BGAA 1S7SA 3MJ7B 2J3SA 3BPNB 2WSKA 5IQ7H 3PQYA 4ZFFB 4XNZC 3B2UD 2WV3A 4EN3A 2CIIA 3VRLF 2X42A 4KUCD 4F37K 4BSWB 2FJGA 3ARRA 3SDAD 35C8H 4YQXL 5GGVL 1F4AA 1JHLH 1H3VA 4XZUB 2Y23A 2VXSL 1QSFD 3R4DA 4TUJA 3SDXF 5KSAA 2V9TA 5IMKB 3QJFA 5EOCL 2IQ9H 3T0WA 1T5XA 1OW0A 3HI5L 3W39B 4Q9QH 2X70B 3MGTA 4YDIL 4XPHH 4XC3H 2P24A 3RI5F 2NY5H 1DCLA 3QBTB 4UTBL 3WNMA 1KPUB 4L8CA 4YHZH 4N90E 5DUML 1SYVB 5EIIB 4ZXBA 4XI5D 2A6DB 3M45A 1KB9J 1MHEB 5TF0A 4OLXL 4F3FB 2J1KA 4QRPE 3WL9A 2V5MA 2OL3L 4LDLB 1T6VN 2C1PB 3VXMD 4G8IA 3C5ZA 2WP3T 1I9IH 1RUPL 2DF3A 2PTTB 1XGUB 5CP7A 2XG5A 1W8NA 3RWIB 4HJGA 3SE8L 1XGPA 1A1OA 5E00B 3UTOA 3BUTA 5EDXA 5JLZA 1EAPA 1HKLH 2ESVB 5B3NA 2W9EH 3H8NA 1PYWB 4NOFA 5CKAA 3FT2B 2ZNXA 2NY2B 3OB8A 4F37F