5A2IH

Crystal structure of scfv-sm3 in complex with apd-sgalnac-rp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
244
structure length
224
Chain Sequence
QVQLQESGGGLVQPGGSMKLSCVASGFTFSNYWMNWVRQSPEKGLEWVAEIRLKSNNYATHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCTGVGQFAYWGQGTTVTVSVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IG LAMBDA-1 CHAIN V REGION S43
publication title Deciphering the Non-Equivalence of Serine and Threonine O-Glycosylation Points: Implications for Molecular Recognition of the Tn Antigen by an Anti-Muc1 Antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 55
structure length 224
sequence length 244
ec nomenclature
pdb deposition date 2015-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
H PF07686 V-set Immunoglobulin V-set domain
H PF07686 V-set Immunoglobulin V-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5a2iH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5a2iH01
3CLEL 4XNZB 1SY6A 1OAQL 1CTOA 1YEFH 2ITDA 1AXSA 4ETYA 1KXVC 3CDCA 3HMXH 5DJZB 5DHVB 1XEDA 3MZTA 4N0YH 3ZL4L 5SX5H 3STZB 1CK0H 3OHXA 4NM4L 3QWOB 4H26A 5F9AC 1XZ0B 5TDPA 4KPHL 4HAFA 3QJHB 1LO2H 3S36L 2ICWI 4ALAH 3H7LA 4U3CA 4JPVH 3TCLB 4QHUB 3HC4L 3BGMA 1OAKH 1JF5A 4IRJB 4PJ8A 5T1LD 1J05B 4NWUL 1I1RA 4NKMA 1VGKB 3X13B 3OR6B 5IWLC 5DWUL 3CFIC 4H1LA 5INCA 5TQ0L 3TBYA 1RK0B 5KSAA 4Q74A 3AROA 2X4QA 2GUOB 1OAQH 1PSKL 3PQYB 3DUSA 1MHHA 4Y8AA 4F8TA 3MV9B 3ZL4H 4GAFB 4NM4H 5DXWA 5TF1L 1IAIL 4DCQA 1T89A 5KN5B 4KPHH 3I6LD 4X80L 4EDXA 5JW5A 3WNNA 3S36H 3SE3A 4P23C 5JIIA 3ULUF 2XQYK 4HX1A 1V3MA 1F90L 1B4RA 4A2LA 4WRLA 3AB0B 3HC4H 3WS3A 1F3JA 4UDUB 1IEAB 3GMPA 5E56A 3HZMB 3T2OA 3V9FA 4NWUH 1OP5H 3UTQA 1ORQB 3S3SA 5IQ9A 2YD7A 5DWUH 5FGCB 1A02N 5TQ0H 3BN9C 4IJ3C 4LLWA 5TFSL 1JBJA 1PSKH 4JM2D 4N0FA 2PW1B 1MREL 4TUOA 4PJFE 2NLJB 3QDMA 1T66D 4Y4HB 4NKDA 4NQSA 4K7PX 2BOCB 4LU5L 4MCYA 1UG9A 1T0MA 5TF1H 5I8EB 1IAIH 4WW2A 4N1CA 5D1ZD 1BVLB 4OZGA 2VERN 4X80H 1U3ZA 3PF2A 3RJQB 4R4FL 4ELMF 1JPGB 1D6VL 3EDJA 3F62A 3SEPA 1F90H 1RZ8A 5DD3L 4BSVB 3L3DB 4QLRA 4YEFA 1B0RA 1RUKL 2VZUA 1QSFE 3GI8L 5EU6A 1BD2D 4MNQA 2IAMA 3FOMB 4NNYA 5DK0A 5TFSH 4PGCA 3PGFL 3GJFH 3V52L 1LEGA 1CDGA 2VDRH 1MREH 2XWTA 2WBJA 4P46D 5EO1A 4L8SC 4MDIA 3QDJE 1JGDA 1TTUA 4APQC 5GISL 2RB8A 2DLEA 4ZSOE 4R4FH 2KKQA 1D6VH 1NGXB 4V1DE 3OAUL 4ELKB 4Y4KC 3FN3A 2NCMA 3QG7L 2V9TA 5C0BB 5JW3L 3IAQA 2FEDD 5HVHB 4PRIE 5DD3H 4HD9A 1WSST 5FYJD 3DRQB 4ZFOL 4AM0B 5ACMA 2OI9B 2QQQA 3KYOA 5CFHA 3C5ZA 2PW2B 1RUKH 1U8KA 3GI8H 5E5UB 3EOAA 3TEUA 1OPGH 3R06B 4LCYA 4XX1E 3PGFH 3V52H 4IHOA 3BH9A 5E8EA 3EHBD 2YXFA 1ED3A 1QBLL 1ZVYA 3PP4L 4Y4FA 2CRMA 3BDBA 5DURB 4ZUWA 1DN0B 5GISH 5ABDE 5I6XB 3NZHL 1G0DA 1T4KA 4MXVE 1OGAB 3BZEB 1S7UA 4ODSL 1B2WL 2UVEA 3QG7H 5JW3H 4P9HL 1TTGA 3JUZA 3QQ9C 1R5VB 1CD9B 4M6NH 4S10A 1PQZA 4LP4A 1U3HD 3O3DA 3WEXA 2CJUL 2FECI 1DBKL 4XCYB 5KJRL 1IAOA 3RTQB 4NSKB 2XA3A 2ESVA 1TCRB 2EXWC 3FAWA 2GAZB 5AD0B 3MX0A 3HI5L 1QBLH 3RGHA 3PP4H 3RHWF 4X7FC 4GRLC 4P5MB 2ZUXA 5EZJA 3MBXL 3NCYS 3SCMB 1T2XA 3NZHH 3ECBB 1F6LL 4YFLI 3PDOB 2NY5L 4G80B 1EMTL 4CJ0A 4ODSH 2BMKB 1B2WH 5ANMA 2BVQA 3RY4A 3O3AA 1S7XA 1P4LA 2R1YA 3BP4A 4P9HH 5H2BA 4DAGL 1NUNB 2F54A 1P84K 3NTCL 5C0DB 3D85B 3MUGB 1B6UA 2CLVA 1Y0LB 4TULL 3N9GL 2LV4A 2Z31A 2CJUH 2NY2B 1DBKH 4PJDF 1S7QA 4QRRA 5KJRH 3RY6C 4QHKJ 3ZE2E 1GZPB 4HC1L 3Q1SL 1TZIA 3HI5H 5D1XD 5HDQL 1AO7E 1DEEB 3PWNB 4MNHB 4XBGB 3LKPA 3OAYH 1GZQB 3MBXH 1ZOXA 4I9WE 3IGAB 4MCZB 2NY5H 1UKSA 2IALA 3BPCB 4UT7L 1XGUB 3EYSL 1EMTH 4WTZA 4ZYKB 2YOCA 3B6SB 4E0RB 4LF3B 3CMGA 1YMMA 3TJHD 3IKCA 3RNKA 3NTCH 4FQHB 3MRCA 2MQ3A 3ZHDA 2YC1B 4TULH 4FQPA 3N9GH 1ZANL 4OZGE 1TIUA 4JCMA 5IEHA 3OKNB 5D8JL 5HY9B 1ZSDB 4PJBE 4HC1H 5E1AA 5IB5B 4L3AA 5HDQH 1JL8A 3TIEB 4RMVA 1MUJA 1NFDA 2K3TA 4PRHB 1LEKA 2UZXB 4K55A 3UMTA 2C3HA 2QQLL 4I0PC 1CG9A 3RZCA 3KPSB 1FP5A 4LCCB 1CT8B 4QOKB 4MNQE 5JXED 1QSFD 5IHZB 4UNUA 5I19L 4L8BB 1B3JA 4NC0B 4UT7H 3EYSH 4K9EL 3P73A 3BRGC 4ODWA 1BJ8A 3QEGL 3WUWA 4LLYA 3TLRA 5ID0A 4LMQI 2DQUL 3QDJD 3V7AG 1MCHA 1ZANH 4YBQD 1MHEA 2XWJA 5D8JH 3FQRA 2MKWA 1Z3GL 3U0TA 5D1ZC 2VB5A 5T1KD 4V1DD 5D5ME 2DQHL 3O6FA 1HI6A 4CW1B 4D9LL 1FFOB 4X8JB 4PRID 3DARA 5FECB 2QQLH 4XXCC 2WSKA 3O3BB 2CO6B 4JFQA 3G6DL 5I19H 3HAEB 2X9WA 1J0ZA 1N6UA 4K9EH 2FL5A 3MRJA 3FFDA 2Z8SA 4HFWB 4KXZI 3QEGH 2GJ6A 2OTUB 2DD8L 3MLTB 5EZLB 4WI7A 2DQUH 3EO9L 4JKKA 3QI9B 5TF0A 1KPRB 1FL5B 4UT6L 5IB2B 1LO3L 4V2CB 3FB6B 2Q1EA 3ARBD 2QHRL 4RMSA 2YD4A 1Z3GH 1RJLB 3AY4C 4WDIA 2DQHH 1C08B 3GSVA 3TYFA 3ZKSD 4D9LH 2X1PA 2XTLA 4RGNE 4C56A 5B38A 4NQTA 2DTSA 1QBMH 3RWEB 5EIVA 3G6DH 2FEDC 1CTNA 1BZQK 1G7JB 2GJZB 3TT1L 1JHLL 5D7JC 2DD8H 3GSQB 1G1CA 4OSUL 4ESKA 2YSSB 3B2UD 1UWGL 1OAUL 1KOAA 4PJ8D 4EXPX 3EO9H 4X5WA 3EHBC 3UDWC 3DNKA 5C0CE 1HILA 2NY6B 4UT6H 5T5FL 1HHHA 2FD6L 5JORA 1LO3H 4H0IA 2QHRH 3QCVL 3DHMA 2OQJB 1MCWW 5KSAD 5ANME 4WI8A 2BY2A 5DQJA 5EN2A 1KCUL 4NKIL 1QBAA 1A6UL 2VXQL 1TVBA 3VRLE 5KS9A 1G7IB 3D5OF 1R6VA 4N0RA 5CBAB 4L4VE 2HG5B 3L3JA 2C1OB 2XTJB 3FO1A 2FWOA 4QRRE 3QO0A 2XNAA 4RRPA 1U3HC 1U8NB 1JHLH 3TT1H 4LASL 4E41E 4OSUH 1LE9A 3T1FA 1DR9A 4KY1L 1UWGH 1OAUH 1AO7D 5FEBA 3MUZ1 3MRKB 3TPUA 2FD6H 1EHXA 1DQJB 1KN2L 4I9WD 4MMZC 1RURL 3QCVH 2BXYA 2OCFD 4WUUB 3S4SA 5F71A 1U9KA 2P48B 1KCUH 2BNRB 1YMME 3O4LA 4NKIH 1A6UH 2VXQH 4QT5A 4HIHA 4UUJB 4AENA 2VDOL 3DVIA 3DMMC 3BEVA 3IB4A 5LKNA 4EJ1C 3KS0H 4YNYB 2ARJQ 1EEZA 3LN5B 2D0HA 2HKHL 2VLLA 5TJWK 4OKDA 4LASH 4LNRA 1G7PB 1NFDE 1WBYA 4KY1H 1MRFL 2XG4A 3CSPA 4LHJB 2HKFL 1ZEAL 2A73A 3OJDB 3S3PA 5JPNB 1P7QB 1A4JB 1NCWL 4P3WA 1KN2H 3EDEA 1YUHA 4L3EB 4MNQD 1CD8A 3H3PH 1RURH 3UZEA 3ZE1F 1LDSA 1AGEB 2BXZA 3WFDL 2IANB 2WBJD 2ATPA 2NXZB 2VDOH 5E8DL 1KTDB 3QH3B 3J8F7 3TJHC 4QXTB 1S7RA 2OSLB 4X4MA 4IIQA 3P4LA 4J12A 1EAJA 4KUCD 1QA9A 4UAOB 1BLNA 2HKHH 4RISL 1R3JA 3IFNL 4IRSA 2IEPA 2P24A 1BP3B 1H3XA 1X5AA 3O6ML 1ZLWK 3HLAA 1MRFH 4NN5C 2HKFH 1JPFB 1ZEAH 2CKBA 5JHLL 3HB3D 4RDQG 1N4XH 4BQ8A 3C5ZD 5DK2B 5BXFB 1YEEL 1NCWH 1X5IA 2YBRB 3W9DA 4P57A 4U4BA 4L9DA 3C2AL 3X3FL 3S5LB 1LP9B 3MRLB 3ZKXC 5ISZB 3MFGB 1D5MB 5F7EL 4X98A 1AIFB 1IKNC 3WFDH 3MJ7B 4H0HB 3EO1B 1Z5LB 2DWEB 2XY1A 5E8DH 5HYJB 4Y4FD 3UTSE 3PXJA 3TF7C 1HQ4A 1ZHLA 4N0UB 4HK3J 4L3CB 2HVKB 3BZFB 4LRIC 2YRZA 5F1IA 1T0PB 1MSPA 1XF2A 4RISH 2W0FA 1KB5A 3IFNH 1I85C 1VADB 4X6CB 4ONHB 3O6MH 5BV7C 4C56E 3H3BC 1MJ7H 4RGND 5JHLH 2FIKA 2GT9B 5IFAL 2XWBA 5BQ7B 1YEEH 3HC0A 3C2AH 2CH8A 3X3FH 5I75C 1PGRB 4P2YA 3GSXA 5DRWA 3IDMB 5F7EH 4NO5B 4NQEA 3QWQB 2ESVD 4U0RB 4ZAKD 4CJ1A 1F11A 3BPLB 1V3JA 1X6LA 3K4AA 5C0CD 4HCRL 5KVMC 4OFYA 4PB9H 2VIRB 1UJ3C 4EUPB 2RIKA 1VEMA 4CMMA 3ARBC 1BF2A 4P2QA 4DJMA 3L1OH 5L8LB 3SPVB 5IVXB 5IFAH 4YXKL 3KWWA 3FQUB 3GSRB 5LBSL 4HIIA 2XI9A 3U36A 2WIIA 2ADGA 5DJDB 2Z31D 1F42A 2B0SL 4BH8B 4QRRD 3B9DA 2H9GB 2HTLD 5DQ9B 2APFA 1I7UA 4BZ2L 1BFOA 4E41D 2X41A 5CKAA 2C3WA 1L4IA 1DQTA 1FNGB 3I3EA 4KH2A 4MA1C 3B2UC 4ZNCD 4HCRH 2X70B 3QULB 2NW3A 4JO1L 4QCIA 4U6XA 3G5ZA 3HN3A 4NOFA 1KUMA 5CWSA 1N5AB 1ZT1A 4BUHA 4Z7VB 4XNUL 1HOCA 4O2EB 4LPTA 1VESA 4HLZG 3VFRB 5F88A 4X7EC 4XP1L 2PCPB 5ICYA 1YMMD 3HI6L 4U49A 4L29A 4YXKH 3DO3A 2QEJA 5LBSH 3JV6A 7FABL 3MRMB 4K8RL 5EULV 4LSDA 4QRPA 2W0LA 3V7MA 1JZ2A 2B0SH 1HEZA 3DECA 1NAML 4Q9QL 2C1PA 4BZ2H 1OWWA 3SE3C 2UY6A 3VA6A 2PETA 2H45A 5F97E 3MODL 1WBXB 3MRNB 4HWNA 3ARGA 5K9OB 1QFWI 3RZCD 1JZ6A 1EUTA 4JO1H 1ACYL 1TJIL 4M93B 1S9VB 3C8KA 1V8HA 3QNYA 3NIFF 2B5IC 1Z0NA 4XNUH 1Q9WB 2ID5A 4Z76B 3RUGA 1RZGB 3PWPE 4XP1H 4G9FB 4GKOA 4NNXA 1G9ML 3HI6H 4A6YB 3RRQA 3LMJL 4XTRD 4FQLL 5IGXL 4U1KB 7FABH 4K8RH 5MEPA 5DZOA 1A6AB 1UB5A 1NAMH 3DXAE 4Q9QH 3QEQA 1NMAL 5F7HA 4FFVD 4UQ3B 4FQ2L 3O6FD 3I3DA 3QUXA 3WL9A 2MHAA 5F9JB 5LGJB 1I8LC 2WBWB 2X6MA 3MODH 3GBLA 3F12A 4X6FB 4L5FL 1T22B 4YPGA 4MJ5B 4P23B 1ACYH 1TJIH 3T8XA 1T5XA 2VJXA 4O4YL 4RIRA 4MAUL 1WGOA 4M6OL 4PYGA 4ZMAT 3TBWB 2ADIA 1G9MH 3NFPA 2HT2D 4P49A 3LMJH 4FQLH 1ADQL 5IGXH 1D5XA 4M7LL 4PLKD 3UTSD 4IJ3B 2WBJC 1CGWA 3EAKA 3V6ZB 5BZDB 3MO1B 4NRZA 2GHWB 3VI3E 4TRPL 2PTTA 4MQTB 1NMAH 4B5EA 4EUPH 5J1SC 4FQ2H 5KSUA 1YEGL 3F7PC 3B5TA 4ZQKA 4C56D 1FVEB 1EZVY 4J4PC 4L5FH 3ET9F 4IOIA 2X4SB 1A1OB 1RZJL 3HB3C 5CJXA 1MCBA 1PFCA 5ESAB 3C5ZC 4O4YH 4MXQD 4MAUH 3N1MC 4TNWF 4M6OH 4UZGA 1MHCA 3TC9A 1JWMB 1ADQH 4CAGA 4M7LH 4PFEA 2KBGA 4Y4FC 1JZ5A 4TRPH 4QF1B 3RWIB 2EDWA 3BISA 1U8OA 1WLHA 2LU7A 4X7DC 4CU7A 4MD4A 3UROR 4P2QE 4K7PL 1YEGH 1JMZA 1QTYT 4APQB 3OTTA 5DD1L 4MD0B 4M8QA 3DVFA 1TPXC 1G7HA 3GBNL 2VE6B 5FV2A 4RGNC 3QG6A 3ZMRA 4JLRA 3ZTJH 1RZJH 5TH2A 1A6TA 4Y4KB 5EO0B 1YEHL 4P4KA 5IQ7L 2NY4D 3FFCB 3T1WA 3OKKA 1TITA 1ZS8B 1MJUL 4QXGL 5GGRB 2A83B 4GLRH 4DVBB 4GAYA 4U2ZA 4TQEL 1YY9C 4JEGB 1ZLUH 5IMKA 4F7CA 3DIFB 4OD1L 1XF5B 3RWHB 4ZAKC 1N8ZB 2NYYD 2QQKL 1KJ2A 2G9HA 3I6GA 5E95B 4ODHL 3LKRB 1G7LA 3TO4A 3VFWA 4I48A 1S8DA 1ROWA 4K7PH 4FFZL 5F9WB 3O4LD 3VGDA 3MROB 5DD1H 3ZDXF 4GG8B 3U46B 1RI8A 3GBNH 4M3JA 1I7ZA 4P5TA 5FYLE 4QRPE 2JK5A 4XCCL 2ZZUT 1YEHH 5IQ7H 4MYWB 3VFNA 3MRRB 2Z31C 2FHCA 1MJUH 2ZOKA 4QXGH 3O3EB 4HW6A 4TQEH 2A1WL 2YMXL 1TJHL 1AQDB 1RJCA 1DLHA 3ZDZE 4I0CC 4OD1H 3L3HA 3S7GA 2M1KA 1NEZG 3KLDA 4R9HA 2QQKH 1ODAA 3BEWA 4AQOA 4ODHH 3RUGE 4EUPG 4X99A 4FFZH 3PWPD 4GRLB 5KSBB 3LKOB 1ZHNB 5DFWH 4RFNC 4NJ9L 1C5BL 2X7LB 5IBTL 5IIEA 3RX8A 3GNML 2GI7A 2G5BB 3RWCB 4XCCH 4WFHE 1OF2A 2R23B 4HF5L 1ZA3B 3QEQE 1Q94A 3DXAD 3WKNA 4IRSD 1EFXA 1QPPA 4NNPL 5I1AA 5C0IB 1MVUA 3BKJL 5EOQL 1AGFB 4BSJA 2A1WH 2YMXH 4NQXA 1TJHH 4PV8B 2ICEB 2J8OA 4HIXL 1ZA6B 1RZKC 4K2UL 2RHEA 3N1FC 1R5WB 2VR9A 3PIQA 5FCUL 3RZCC 4J1UB 2D0FA 1EHAA 3KAAA 5DUBB 4WY7L 1E4KC 5HI5D 3BP7B 4P5KB 1FIGL 1J0IA 1C5BH 5IBTH 5T1LB 1JTPA 4AL8L 5I1IL 3GNMH 2GYSA 1M7XA 4FP8L 2UYLA 5DF0A 1YN7A 3BH8B 4D8PA 4XTRC 3KPLB 2BSSA 3BKCL 3ZTJG 3MZGB 4HF5H 3OKYA 5BZWB 5F7DB 4NNPH 3LD8C 3BKJH 3CH1B 5EOQH 3T3MF 1AGDA 1AC6A 4HIXH 2F53B 4DN3L 4K2UH 4PBXA 5SWSB 3MACL 4C4KO 43CAA 1HH9B 4Z7QE 3K2MC 3EDKA 3DRTA 3DROA 3QAZC 4L9LA 4NC1E 5F9DC 5FCUH 4CMHC 1FO0A 4GG6A 5CIPH 4HS3B 1XGTA 5TE6L 4NQED 3H0TA 4WY7H 4WIQA 4U1LB 5K33A 3FRPG 4B7IA 5GGUB 1FIGH 1UH2A 1KB9K 5JW4M 4AH2A 4AL8H 5I1IH 5EC2A 2VXSL 4PJCA 2CDEA 1M71B 3ELAT 4FP8H 1KEML 4HUNB 3BKCH 2EDKA 3W11C 4LPCA 2A6DA 1NCTA 4U1JB 4F7TB 4PLKC 5T5NG 3WLBA 2HT3D 1QG3A 2PF6A 4P2QD 2XFXA 3O6LL 4JM2B 4OCMC 2CIIB 5IHBA 2WQ8A 4DN3H 4ZPTA 1RY7B 3GUTB 3MACH 4KKNA 5JZ7D 3SO3C 5D1ZB 4M62L 4RGMB 1LP9F 5EO9A 1YZZA 3BMVA 3MUJA 5DJ6B 5TE6H 2P5WA 4N5ED 2E9IA 1CDUA 4MXQC 4R0LA 1H3UA 2Q3AA 4RAUB 4LVOC 1KENL 2VXSH 3SDYL 5DSCB 1PZUB 1KEMH 2JJSC 1BD2B 4DKEL 3C9NA 2YEZB 3K8KA 1MAML 4GUPB 1M05B 3G04B 4K23L 1T21A 1A3LL 5LG1A 1MY5A 3O6LH 4X6CF 1N3NA 4EQ3A 1S9XA 1U2CA 1U8HB 4D0DB 4P46B 2X4RA 1PLGL 5K59E 1QACA 3FQNA 5FYLD 4QRPD 2X4NB 1U92B 3IDJA 3MJ6A 3R8BB 4M62H 4WFFE 5JUEL 2FJHB 3MGTA 5CSZB 5IEKA 2JCCA 1GGTA 3JV5A 3CC5A 2NY4C 2Z92A 3L3GA 1KENH 3OKDA 3SDYH 2DKSA 3ARGD 4S11A 1K8DB 2YD9A 3L9RA 3BDYL 3QJFB 5DMGD 1IGJB 4DKEH 4TPRL 4UQ2A 4HJGA 1MAMH 3G08B 4S0SD 2AV1B 3ROLB 3GIVA 2NYYC 4K23H 1ZGLP 4LHUG 1A3LH 2Z93A 4HH8A 5DS8A 4JFOA 2F58L 3QCTL 1NGWB 2J5LB 4UT9L 1PLGH 4HV8B 1RQ5A 2WANA 4GXUM 2R2EB 4WFHD 5INDB 5JUEH 3C60A 2Q76B 1C5DA 3QEQD 4ZUTB 1T1WB 4QHKI 1J88A 3QUXD 4QO1A 1T83C 1DDHB 2J3SA 5A2KH 4BFIA 4XC3L 3WKML 5DJAA 3QQ3B 2XY2A 5T3XE 2KDGA 1BQHB 4PJGA 5DTFA 3BDYH 1C1EL 1U3HB 5FKPA 5L0QC 1YEIL 4WGVB 1UM6L 5C09A 2D4FA 4Z7VF 5EOCJ 2AEWA 2WV3A 2AJZB 5B3JE 2WK2A 2F58H 3PE9A 5TE7L 1QYGH 3QCTH 5DJ2B 2HMID 3V6FA 5ESVB 4GKSA 4HS8L 4MGXA 5J1AB 4U1NB 2A9ML 1B88A 6FABL 5J6GB 3R8QA 5LJYH 3EOTL 1NEUA 3T77A 2FBOJ 4IIQC 4G8GB 3QXDA 2GTZB 1JUFA 5E9DB 4XC3H 3I02A 3WKMH 2NY1D 4I5BA 2GFBB 4QHLA 5L2KA 1C1EH 3KJ6L 4LCUA 4TUJB 4NUJB 5ICXA 4KROC 3HRZB 4NBYB 1YEIH 1UM6H 2Z91B 5JA8B 1XR9A 4WU5A 1O7VA 3PWLB 5D1XB 4NYLB 5TE7H 4YEEA 4MQXC 3HZYB 4YXLL 3P77B 4PJCE 1P4IL 1OT2A 1DCLA 5HI5C 3IJHA 1UH3A 3PHOA 3AM8A 1Q9KB 4JPKL 5FYJL 4HS8H 5GGQL 3VH8G 3E0GA 2A9MH 4ELMA 2EIZB 6FABH 2CMRL 5CBEA 1HHJA 5T5NF 2QHLA 1MCDA 5FKAA 1HHIA 3EOTH 4Q6IC 1CLZL 1MCKA 1NGZA 5E08L 3IDGA 4C54A 1I7TA 1BOYA 4PJFB 1W72B 5LAXB 3ARQA 3KJ6H 4MQ7A 3KPTA 5DGRA 1U93B 4P4KD 2ZNWA 1T1YB 2P5WE 4JZOA 2W65A 4NN5B 1EDQA 4PJXA 2VR5A 1HKFA 2HVJB 2OTPA 4YXLH 1IGML 1P4IH 4JQIL 4U1HA 5D7IE 3ZKXB 2DQFA 5GGQH 3IJYA 2VXTL 4JPKH 1RUAL 4UV7L 1QSFB 4LLMA 2ADJA 2CMRH 3ZKND 4G5ZL 5FO7A 3TO4D 1RIUL 2DQJL 1JK8A 5C0GB 1ONQA 3BGAA 2VMFA 3GM0A 5E08H 1G0YR 1VGEL 1OP9A 2QL1A 1J8HA 2YUVA 4P5TD 3RDTC 1E4WL 5BOPA 3QDJB 2R2CA 4G6KL 3ZSTA 5HJ3A 3TO2A 3QXAB 1U8JA 1U8IB 4WFFD 5BV7B 4ZSOB 5T1KB 4R2GD 4V1DB 1KIQA 5BMFL 3BKYL 3THML 1J1PL 4LLVA 4ZOEA 4O5LL 1IGMH 4N5EC 4JQIH 4PRIB 4C59B 3QUZD 3EOBA 2VXTH 5TGBA 1RUAH 4JAMA 1JV5A 4UV7H 1F6FB 4G5ZH 4I77L 1T1ZA 1Q9OB 1RUPL 1RIUH 2DQJH 4MX7A 5ID1A 4HHAB 2CRYA 3U9UB 2V2TB 1VGEH 3HI1A 5E2UL 2UV3A 4QHNA 4RAVB 3AFLA 1E4WH 4RA3A 4G6KH 4F7EA 5IW1A 4F9LC 4TVSa 3UPAA 2WWMC 3B3IA 5DFVC 2MWCA 3ARBB 1F4YL 4RMUA 4GKNA 5DT1L 3O2DA 3X12A 3AU1B 1KLGA 1EFXD 5T1MA 3CVIL 5BMFH 3BKYH 3THMH 1J1PH 2ITDB 5MHSE 1AXSB 4O5LH 1EFQA 1FAKT 1BF8A 3KPRA 4HWEL 4PJGE 4Y19A 1YPZF 5T3XD 1CFTA 4I77H 4H26B 5C09E 1S7SA 1RUPH 5IV2A 3VFGL 5DZLA 3SGDI 4WUKL 1JHKH 5E2UH 5HYEA 1X4XA 4MA1B 3OXRA 2VISA 3BGMB 1VFAA 4PJ8B 3VFOA 3FJTA 4NKMB 2Y1VA 1WT5A 1CE1H 1BPVA 3EDDA 1F4YH 4H1LB 5INCB 3EYFA 5KSAB 1NLDL 3CVIH 4Y5VC 2WWKT 1A4KA 2KQNA 4OUUB 3DUSB 1RK1A 3WXWL 5IB4A 1CXEA 4HWEH 3QCUL 3QUXC 2X2YA 4IMKC 4DCQB 2IWGA 3OX8B 5I16A 4EDXB 5JW5B 4MB4A 3VFGH 2FBJL 4UNVA 4L1HA 2VAJA 4HX1B 5D70L 1KCKA 5BV7L 3QUKA 4WUKH 1A7PL 1YN6A 4WGWB 5KSBF 1CL7I 1J11A 3GMPB 1AO7B 1DJSA 2DMBA 1U2HA 2B5IB 3ME0A 1QRNA 3W5NA 3IFOA 1A8JH 2ZG1A 5IQ9B 5DEFA 2HMIC 1ZLSL 1HWGB 2FECL 4LLWB 1NLDH 4GMTL 2FO4A 3D0LA 1G9EA 3NCBB 4N0FB 4F57L 3OXSA 4TUOB 4HUVA 1NGPL 3WXWH 2DDQH 3O8XA 3QCUH 4NKDB 4NQSB 1NC2D 2RCSL 4MCYB 4HK0B 1T0MB 3CXHK 4XCNB 2DI9A 4OZGB 2NY1C 3QUMA 1K4CA 4GW4A 2P5WD 3HMXA 4PJXE 5D70H 5BV7H 5HGDA 4PJBB 1RZ8B 4NC1C 1A7PH 3G9AB 2CRIA 2QADD 4U6YB 3QBTB 1SY6L 3TWCL 4QRTB 2BHUA 3RVTC 1I1YA 3H9HA 4MNQB 1ZLSH 2X4PA 4NNYB 1U3YA 5DK0B 4GMTH 5AWNL 4AIXA 4PGCB 2DTML 1LEGB 3MNVA 4YDJA 5DD5L 4F57H 1NGPH 1Q72L 2XWTB 2WBJB 3ILQD 5I18L 2EYSA 4UB0L 5EO1B 3UJJL 3BMWA 4MDIB 1JGDB 5BVJA 2RCSH 3FZUD 4G8EA 1GH7A 2EEAA 2A0LD 3F58L 2VLJE 3V6OA 4O58L 3D0VA 4JG1L 4P4KC 4WI9A 1OD9A 1SY6H 3TWCH 3UAJC 3KYOB 4CRPA 3VMNA 3C5ZB 4WHTA 5LQBL 1QPXA 4GSDL 1VKXA 2D9CA 4CVUA 1S9YA 5AWNH 4LCYB 3ZKNC 4IHOB 2DTMH 3BH9B 1A1MA 5E8EB 5DD5H 4DKAA 1Q72H 4JM2F 1ED3B 3TO4C 5I18H 4QY8B 4UB0H 3NOIA 3UJJH 4Y4FB 1PKOA 3LHPL 3BUYB 4CBPA 4ZUWB 1IGTA 5DVNA 4KRMB 2VO5A 3HCVA 1IJ9A 1AE6L 1HQRA 3LRGA 1T4KB 4P5TC 1GJIA 3C60D 2C4FT 3F58H 3WFCL 5D2LE 3DYOA 1S7UB 4H1LH 4O58H 5FGSA 1TPXB 1A7BA 1KJ3L 2E6PA 4JG1H 4LCWE 4JZNA 4JDTL 5MHSD 4RGNB 4CVZA 1MCEA 5JMOC 2H3NA 3KPRE 5LQBH 1UZ6E 1PQZB 4GSDH 3M45A 4HG4J 3WEXB 3QUZC 5I1LA 3KPNA 4LLAA 5C09D 1IAOB 1RHHA 3BP5B 1HWHB 2ESVB 4JRWA 1T3FA 5H35A 1GIGL 4PRBA 3LHPH 2EO1A 1VENA 4QKXB 5E1HB 4K07A 4EI5C 5EZJB 1L9NA 1AE6H 3WFCH 1KIPB 1MELA 4PJHE 5ANMB 1KJ3H 2BVQB 3DYPA 2PYEA 2V7HA 3O3AB 2ZG3A 1S7XB 1P4LB 2R1YB 4PGZA 4JDTH 5H2BB 3CFJA 2VC2H 1T7VA 4XP9L 3GRWA 2VSDA 3PG2A 3QUYC 5F89A 3MRFA 1IC1A 4FQ1L 2Z31B 3C6LA 3BN3B 3S37X 1S7QB 4QRRB 3IDXL 4WO4A 3UBXI 3VW3L 1TZIB 1OLLA 4W68A 4E41B 3AREA 1GIGH 2IBGA 5I1CL 1YECL 5HHME 3QPXL 4G8IA 4WENB 2YD5A 3MLRL 5GZOD 1QRNE 1XGRB 3TNNA 1PG7W 3MREA 2IALB 3SDAA 1IAMA 4KXZH 4RFNB 5FFLA 4G8FB 4N5UA 4JFDA 5DDHA 3GO1L 4LPXA 1YMMB 4XP9H 3RNKB 3MRCB 4YHYC 3Q3GA 1A6WL 1HCVA 4FQ1H 1RK0A 4JANA 3TNMA 1EGJL 5IEHB 5C0RL 4XPFL 4ZFOA 3BZDA 3VW3H 2G75A 5E1AB 3MV9A 3W9EA 1MUJB 1NFDB 1LEKB 3CXDL 3VDCA 5I1CH 1YECH 4BFGA 1CD0A 3QPXH 1CG9B 3RZCB 3MLRH 4ZO8A 4BK5A 1QSZA 3P73B 4U7SA 5C07A 2YKLL 4ODWB 3O4OC 5T1DL 2DN7A 4W4OA 1Z0MA 3GO1H 4LLYB 3VFPB 1U36A 2BX5A 1J8HD 4LGSB 5ID0B 2Y72A 3D69A 1A6WH 3RWFA 1RZ7L 3PV6A 3VXMA 3LD8B 3QFDA 1EGJH 1MHEB 4PPTA 4XPFH 5C0RH 3FQRB 1NMCC 1D5ZA 3U0TB 2PW1A 4Z8FL 1CE6A 1FL6A 3NPSB 4M7LT 3O6FB 3PGCA 5DA0B 1HI6B 2C4FU 4PLJC 3CXDH 3MUHL 5I8EA 5C6WH 2OR9L 3UPCA 1BVLA 2R4SL 2QADC 1QRKA 4JFQB 2OK0L 2WNGA 3WFHA 2VRAA 2X5PA 2FL5B 3MRJB 2YPLA 1D9KC 3FFDB 1RJYA 5E4EC 5HD8D 5T1DH 4ZXBA 4R90L 2ZUYA 1H8SA 2BVYA 1H5BC 4KV5F 4PJFF 3UTSB 1RZ7H 3ILQC 4D0BB 3WSQL 3QNXA 3SO5A 3VFTA 2AV7B 1N2RA 1Z9LA 2P45B 4Z8FH 1F97A 3FZUC 3ORJA 3RL1A 3U82B 4WDIB 2IFGA 2A0LC 2PUQT 3K74B 3GSVB 3TYFB 1IT9L 2F9BT 1NBZA 1BIIA 3C09C 4C56B 4ZOCA 3IETA 2RQ8A 2OR9H 3SO3B 5B38B 4U3XA 2ZCLL 1OSPH 4NT6A 3KPRD 2H32B 2R4SH 1FFQA 1MF2L 5DHYA 3WN5A 2OK0H 1ZT7A 2ZUSA 5E00A 4HUWA 1UKQA 4NCC1 4XXDA 1OB1A 3LPFA 3MRPA 4HWUA 4AM0A 1EIBA 4R90H 1NBVL 4GW1A 2HWZL 1RZKL 4XVUC 1FJ1A 1FNEB 4X5WB 1I9IL 5SV4A 1MLCA 1A5FL 1HHHB 4KMTL 3WSQH 5JORB 4M61A 3DGCR 3NN8A 1H3WM 3WFBL 4PG9B 4NO0A 2PYEE 2C7UA 3ALXA 1IT9H 3C60C 1TVBB 5I1EL 1EEUA 4GBXC 2ZCLH 2OTWA 1MF2H 1IEBA 3AUVA 3BZEA 4PJAA 4WV1A 3P9MA 3L3JB 4FFWD 3IAGC 3FO1B 2FWOB 3QO0B 2XNAB 1MY7A 2NY4B 4PD4J 1K6QL 1NBVH 2HWZH 3T1FB 1KPVA 3BQUD 1RZKH 3U1SH 5C0AE 3MNZA 4R4ND 1ZXQA 1I9IH 5HHMD 3VCLB 1FCGA 3TPUB 1ZHKA 1JTTA 1QRND 4KMTH 4Y16A 4CADB 2B20A 2VDKL 4RBPK 3D87B 1TCRA 3ARRA 3WFBH 2GAZA 4MXVF 5F7FA 3O4LB 2ZSWB 5C1MB 3KPPA 5I1EH 4QT5B 1AGCA 2Q8AL 5D2NA 4GT7A 1YC8A 3SCMA 4JFYA 5ALCL 4AENB 4W6YB 3ZYJA 1FYTA 3O8XD 3PDOA 3BEVB 3LY6A 2J6EA 1Z9OA 4XH2A 3ARWA 5F1NA 4EIZC 2VLRA 1EEZB 3KHQA 5GGRY 2VLLB 4D2NA 1K6QH 1T2JA 2EXYD 2EDBA 1WBYB 4KHTL 4QXUL 2A73B 5L0QB 3RQ3A 5EU3A 5L6YL 4J3TA 2VDKH 1YUHB 3OPZL 1ZHBA 2DQIL 3CJJA 2VAAA 3CLFH 1OQXA 3PWNA 3PWPB 2ORBL 4MNHA 1IGYA 2LE9A 1WTLA 1TNNA 2Q8AH 2ATPB 4ODBD 5ALCH 4J6RL 4M1CD 3D48R 3IGAA 4HMDA 3BPCA 5J4MA 3VXME 5MERA 4GXVL 1S7RB 4DKDC 4IIQB 1SMAA 2LQRA 4DUXA 4E0RA 1QA9B 1BLNB 5ALBL 3DXAB 1R3JB 5EIIA 4IRSB 2WBKA 1FNAA 4FQHA 5IT2L 2P24B 3FHQA 1JJUA 4KHTH 3DYMA 4QXUH 2CKBB 1AJ7L 1WV7T 4DOHE 4QWWD 1C12A 4KRLB 2H32H 4P57B 3W9DB 5L6YH 1RAMA 3HS0A 3OPZH 3GSNL 5L2JA 1MCSA 5TE4L 2WMPA 2YPLE 2X4UA 4X98B 2DQIH 2ORBH 4HKZA 1MWAB 1OL0A 1URLA 2RBLA 1KTRL 3PWVA 1SMOA 4J6RH 2VQ1A 3OG4B 4P48A 1HQ4B 1ZHLB 4Z7UA 4FXLA 4WW2F 4GXVH 4MNGA 4OZGF 3LN9A 3B5GA 5J13C 1XF2B 5ALBH 3B2VL 2W0FB 1KB5B 5J12C 3HPLA 3SE8L 3VFUA 5IT2H 3LDBC 4NQCA 4F3FA 3QIBA 2FIKB 1AJ7H 2XWBB 1S7WB 1KGCE 3KYNA 5SWZE 3HC0B 2QLVB 3GSNH 4WCYL 4TN9A 1QZ1A 4WNQA 5TE4H 2DLHA 3GSXB 5DRWB 2IBZX 2EDRA 4NQEB 4X8JA 1QKZL 3O3BA 3K8MA 2MSPA 1F11B 2ILLA 4Z77B 3CFBA 4YDIL 4EIGB 1BZ7A 4PBVC 4YBLB 3B2VH 3MLTA 1K9TA 4CMMB 2MJWA 1JNNL 2PYED 4P2QB 4P0DA 4ORGA 3KWWB 5IB2A 3FB6A 4HIIB 3U36B 2WIIB 2ADGB 3L3OA 4PJAE 4ETQA 4WCYH 4JFXA 2DI7A 3C6LD 3D1MC 4WO4D 3O9WA 4RAHA 4R97C 2Y4SA 1I7UB 3F7QA 1T7ZA 3WCYA 1QKZH 1BFOB 1QFPA 3ARED 4UDTA 3ROOA 4O9HL 5C0AD 3FMGL 2RAMA 5I1DA 2CKBL 2QR0A 2YHGA 1MCQA 2GJZA 4J3SA 3TVMA 1F4WL 2NW3B 2UVFA 5E0QA 4YDIH 4QCIB 4NCDA 4U6XB 3G5ZB 2AXHA 2V2XA 5CWSB 2BNQA 1KT2A 2A74B 1KNOA 1ZT1B 3SDAD 3S88L 4LVNC 5H37H 5GGTL 1HOCB 1CICC 3OKEA 1JNNH 4Y2OA 5F88B 4U33A 1G84A 5ICYB 1MWAL 1FYTE 2ERJC 3JV6B 4QRPB 3S9DB 2VLRE 1HEZB 2C1PB 1JTOA 1KB5L 3SJVA 1KG0A 5F6HI 4O9HH 3FMGH 1BFSA 1IL1A 5D93B 3ARGB 2CKBH 3BQUC 4OCRL 1B0GA 1F4WH 35C8H 3Q5TA 4R4NC 5F7YC 3C8KB 3S88H 4OCYL 5GGTH 3G9VA 3RUGB 2Y36L 4Z95L 3MBEC 3V5KB 3DVNA 3MRKA 3ARDD 1MWAH 3VRLF 2P44B 3RP1A 4ZPVA 3RGVA 2YD1A 5MEPB 3VXMD 1FN4A 3O8XC 1UB5B 4WHCA 3QEQB 1H0DA 2EC9U 2A2QT 1KB5H 2B2XL 4RRPG 3QUXB 2MHAB 4Y5XA 2COQA 4JJHA 2I9LA 4YPGB 4YNYA 4OCRH 1P2CB 5I66A 5E6ZA 1Q38A 2OJEA 1X5HA 2EIDA 3TV3L 5CAYB 3MC0A 3SKMA 2ZSVB 4OCYH 2YPLD 4RIRB 4PP2A 4Z95H 4ZXBD 1BBDL 2ADIB 3NFPB 2HT4C 2QKIA 5JPNA 2D7QA 3WO3B 4HCRA 3SOBL 1JF6A 1A0QL 1N0LA 1D5XB 4HDIB 3FT3A 3UJTL 1FH5L 2YRPA 5EBWA 4NRZB 3H7BB 4G6JL 2YR3A 2PTTB 5FUCE 2I24N 1U8LA 1DL7H 2B2XH 5KSUB 1AHWA 3LZFL 1NFDF 1MQKL 3DI3B 4EQ2A 4XVTL 1E28B 4WWID 2NY1B 1BBJB 2ED7A 4YGAB 4IOIB 1KGCD 1MCCA 4OZHA 1P6FA 3TV3H 5HDBE 4BYHA 5KOVC 3O11A 4QWWC 1UXSB 2VWEE 2NR6D 4WWKA 2P7TA 5H37G 3X14A 4FNLL 1KXTB 1JPFA 1QNZL 1BBDH 1X5XA 1K8IA 1MHCB 3SOBH 5I8KH 1A0QH 1ZTXL 4JDZA 3WHE1 2MPAH 3MRLA 3UJTH 1E4JA 5DJYA 1FH5H 3KJ4C 4WEUD 1AGBA 3HNTL 4G6JH 2YD6A 2MFNA 1U8OB 4NO0D 1TQBC 1K5NA 3PGDA 3LZFH 4M8QB 1MQKH 4XVTH 1NAMA 2VQTA 3QG6B 4JRXA 4JLRB 4DW2L 3U83A 5IM7B 5TH2B 1FFRA 3WDJA 4P4KB 3TCXA 4OD2A 4KJQD 3MRBA 3DJ9A 1OTTD 4FNLH 1AKJD 1X9QA 3OKKB 1QNZH 5DJ0B 2GT9A 2DBLL 2FLRT 5D96B 4RMTA 3GMRA 1ZTXH 4CU6A 1NSNL 5IMKB 4F7CB 3ZT5A 1DE4B 4Y16D 2D4DA 3HNTH 1KJ2B 3VG9B 1SYVB 4G42A 5JO5A 3S34L 3I6GB 3QXUA 5HTSA 4L8CB 3VFWB 3TO4B 4I48B 1S8DB 5C7XL 3S36X 1NEZA 3E1F1 3B9EA 1FYTD 5GSVB 1KCLA 1I7ZB 4P5TB 1FGNL 8FABA 2O93L 4EUPA 2JK5B 4DW2H 3LS4L 3ARPA 4NRYA 1T04B 2YD8A 2VLRD 3VFNB 2YA2A 2R0LL 5IVXA 3GMLA 4R2GB 2ZOKB 1CFSB 3QZWG 3SJVE 1R3LA 2E9JA 3FQUA 4WO4C 4Y89A 3HUJA 1NSNH 3QUZB 1T80A 1DLHB 3L3HB 3Q5YA 3AREC 3NIGE 3V4UL 5ICZA 2NNAA 1BOGA 3S34H 3BEWB 5CSBA 5C7XH 4CU8A 3B8SA 5IKCA 4X99B 1X5FA 5IW6A 4IM8A 1FFPB 2NZ9C 3X11A 5KS9F 5E94A 5IIEB 1FGNH 2GSIA 5C0FA 1N5AA 3REWA 3LS4H 4ORZC 1OF2B 3VXRE 5CZXD 1IQWL 2AW2A 2GK2A 4X6DA 3IT8D 1Q94B 2R0LH 4WI3A 5I1AB 1EFXB 4OM0L 1GAFL 1MVUB 4PJEE 3V6BR 4YWGL 3V2AR 4NQXB 4A2MA 4LDEB 5FYJU 2WZPD 3V4UH 5JMRA 3NFSL 5BRZE 5JIKA 5BOZG 1AR1D 3WD5L 1WBXA 5TDNB 2R29L 1SJHB 5CJQL 4LFHD 2AKRB 3U9PL 4YDLC 4U7KA 1S9KC 5GRYA 2UYLB 1YN7B 4D8PB 2OLDA 3ARDC 3FRPA 3MLSL 2BSSB 3A0OA 1IQWH 1RZGA 3SE4C 1KJ2L 4OM0H 3LSOA 4PRAA 1GAFH 4YWGH 5I17A 1AGDB 5F21B 2V5RA 3MQIA 3WNLA 5IWLA 3OJMB 5I76A 5HSFA 1H3TA 3QIBD 5C2UB 1IAIM 2JJUA 5DVLA 4C57C 43CAB 1NCAL 3D6GA 1FVCA 4L9LB 2XKNA 3NFSH 1FO0B 4GG6B 2DMKA 1F6AA 3BD5A 1INQA 3GIZL 4FS0A 1XGTB 5LGJA 3D2UA 3H0TB 3WD5H 2R29H 4NQDA 1LD9A 1EHLL 5CJQH 1WWCA 3OF6A 4P23A 4OZIA 4AH2B 3GB7A 5EC2B 4PJCB 2P8LA 1PBYA 15C8L 4ZXBC 3U9PH 2CDEB 4M9OA 3MLSH 4NN6C 3RJDA 3O4OB 2A6DB 2E8ZA 4PJ7A 1KJ2H 1FNFA 1FNSL 1MFEL 4MB3A 2XFXB 4IMLA 4KK5C 5EC1B 3V6ZA 4ZPTB 1JPSL 1NC2B 3NCCB 1NCAH 3O3UN 4KAQL 1BX2B 2Z0BA 5EO9B 1YMHA 3GIZH 4J3OC 2IFFL 2UUDH 3FN9A 3WN5C 3O9WD 2P5WB 2AQ3A 2YA0A 3ULSB 3MLVL 1HKLL 1AD0B 1CFNA 3QT2A 2QADB 1JGUL 1MI5E 1A7OL 2FO1A 1ORSB 4MAYC 4RBPH 15C8H 3UZVB 5D7IB 5CJBA 4Z5RA 3TVMD 4MZ3A 1NFIA 5E4EB 4Q9CA 3C9NB 4HAGA 5T3XL 3MRIA 3VI3F 1WK0A 1FNSH 1MFEH 1T21B 5TDOA 1WF5A 2DBJA 1N3NB 1AH1A 1S9XB 2V17L 5D72L 2X4RB 1G7MA 1JPSH 4KI5C 1EEQA 3FQNB 4TUKL 1F2XK 2AI0L 4LHUA 3IDJB 1QVOA 1WFTA 1MOEA 3MGTB 2IFFH 3I2CL 4L8SA 4ODUA 2EEDA 4APQA 5IEKB 3C09B 2JCCB 5CEYA 1M7IB 1JPTL 3MLVH 1HE7A 1CGYA 1HKLH 1C5CL 3SJVD 4KJQC 1JGUH 2Z92B 1A7OH 1OTTC 3L3GB 4MD5A 3OKDB 3QEHA 5DC0A 5CIPA 5E2JA 4Y4KA 5EO0A 3H9SE 3OKOA 5T3XH 4UQ2B 4HJGB 3KS0J 1QHOA 3GIVB 1FO0L 3VE0A 2Z93B 5J9PB 5DS8B 1UC6A 4JFOB 2KZ1B 1OTUC 2V17H 1Q0YL 3DIFA 4JKPL 5D72H 3TM6A 1DBBL 4TUKH 2AI0H 2EE9A 5IB1A 3RGVD 5FDYA 3CNKA 5E8NB 4X6DE 3VD7A 2G2RA 2LU4A 3I2CH 3C60B 1C5DB 1DVFD 2EDHA 2D7TL 4H88L 3U46A 1JPTH 4G9DA 2IH1B 1W8NA 1C5CH 3NFNA 2EKSA 3TA3A 4M5ZL 2Y07L 4BFIB 5DJAB 4JHBA 4PJGB 2QV2A 5DTFB 4R26L 5FKPB 4XWGL 3BPOC 3MA7A 5C09B 3LQAC 3O3EA 2CSPA 5BRZD 4LSVL 4NUGL 1FO0H 1KCSL 1I1AA 1AQDA 2OM5A 1Q0YH 4JKPH 3MJ8A 2FYYB 4KUZL 3MV11 5MEQA 1DBBH 4HT1L 3VFVA 5IFHL 3V6FB 4GKSB 2NW2A 1OCWL 1NKOA 3A6CL 5D7KE 5GRUL 3NMEA 2EDXA 4NO2A 4UI2A 2D7TH 4H88H 1FIEA 5HHQA 5CZXC 3T77B 3VH8A 3QXDB 1T7YA 4P2OC 4M5ZH 2G5BA 3T04D 2Y07H 3RWCA 1HSAB 3OGCB 3ZDYF 1E27A 3O45A 5E2WL 5L2KB 3T0EA 4R26H 4LCUB 3MV8A 4XWGH 4XPAL 1CU4L 5ICXB 3PP3K 2UWEA 2ZUQB 3RX5A 2VITA 1XR9B 4LSVH 1KCSH 4WU5B 4WWKD 2FH8A 1KJVA 3RUGF 2W92A 4M5YL 4NQDE 3L7FB 4KUZH 4OZIE 1S5HA 3RY6A 4ZUVA 4HT1H 1AR1C 1GGBL 4ZD3L 5JQHC 5IFHH 3IJHB 3OG6B 3PHOB 1WIUA 1OCWH 1G9NC 1XCTB 3A6CH 1GYAA 3MV01 5GRUH 5DUBA 5CBEB 4PJ7E 2NY7L 5FKAB 3M17A 4PREB 3IYLW 3EKCA 1QFUL 3BP7A 3EYVA 2Q6WA 5T1LA 2VDQL 3IDGB 4HUXB 1I7TB 5FUCC 2EIBA 3BH8A 3WIIL 3KPLA 2P8MB 4M7ZC 1I9EA 1AY1L 2AXGA 4J3WA 5E2WH 2HFGH 3QIBC 4JRXD 3QIWD 4XPAH 1CU4H 4MQ7B 4UOJA 5F7DA 3SDDA 1E6JL 3VRJA 3WIFA 1I3UA 4JZOB 2W65B 4M5YH 4KU1A 4PJXB 3W82A 4MS8D 2VWEC 1YEDA 1MI5D 1GGBH 4ZD3H 4U1HB 2DQFB 5CCKL 3BESR 3DGGA 3OR7A 4HKBA 5MEOB 4LLMB 4NHUB 2ADJB 4ENEC 2NY7H 5FO7B 2ZCHL 4HBQA 4OF6A 4I0PA 1QFUH 4P2RE 1JK8B 1ONQB 1SBBA 1U3JA 2VDQH 5J06A 1CL7L 5HHOA 1J8HB 3WIIH 3E2HC 2CLRB 1AY1H 4I18A 3DX7A 4U1JA 5J13B 5HJ3B 5J11C 4Q0XL 4YX2L 3SN6N 2D7PA 1E6JH 4Z7QF 4OLWL 2J2ZA 4F7MA 5J12B 5BS0A 1F13A 1B6DA 1XGYL 3LDBB 4Y5YA 1KIQB 4O02L 3WS6C 4LLVB 2H6PA 3O9WC 4K7FA 3EOBB 5CCKH 3VJ6A 5IB3A 5E6ID 1JV5B 1NCUA 1PD6A 3H9SD 3D39A 4OBRA 1T1ZB 2ZCHH 5K9JL 4JQVC 2QSVA 4EEEA 3CX5K 2DS4A 4XXCA 4MX7B 5ID1B 5D71L 4LPUA 1OSZB 5GRZA 1CL7H 3HI1B 3RA7L 5F7MC 5EPMA 4NC2B 3FTGA 5IW1B 4F7EB 5HYSG 4Q0XH 3RWDA 4YX2H 5HHVL 4GUPA 2RJMA 4OLWH 2H26A 5A3ID 3RVVD 1XGYH 4PR5A 4GKNB 3X12B 5ACZA 1KLGB 2QSQA 5D2LB 3K0WA 5T1MB 4D0DA 5HYIA 4JKLA 4O02H 4JGJA 4XHJD 4OZFB 3W81A 5GGVL 3V8CA 3AY4A 1F4HA 2Q7NA 3KPRB 5I8OL 3IS1X 1UM4L 3BPNC 3QRGL 1CFTB 5C6PB 1CXLA 1V3LA 5K9JH 3WV0A 1S7SB 1XIWC 3VMPA 5IV2B 5D71H 4WVRA 4M6ML 5I1KL 1NCCL 3OXRB 3RA7H 2VISB 1K8DA 3QJFA 3EZ8A 1VFAB 5D7JA 2ICWA 5I1GL 5FA3A 4FABL 4LVNB 3ETBF 5HHVH 3G08A 5K59F 2AV1A 1DLFL 3ROLA 1EA9C 1U95A 1SM3L 5D7KD 2MKLC 3BDXA 3EYFB 1L7IL 5CLTA 5FOJA 3U4EA 3GSWA 2ERJB 5CUSL 1NGWA 3L6FA 4MHHI 4B50A 1DVFC 5GGVH 2D7MA 1RK1B 3B9VA 1FDLL 1OAZL 4AT6A 5I8OH 5IB4B 3DUHA 1BFVL 3T0EE 3MV8E 1UM4H 4Y5XC 2DM7A 4ZUTA 2UWEE 5I16B 4HUMB 4NFCA 1BZ9A 3AAZB 3L5HA 4GRWE 1DDHA 4YO0A 4B53A 3ARTA 3QUKB 4CGTA 2BVEA 4M6MH 5I1KH 1NCCH 4NQDD 3OF6D 1UEMA 4LSRL 5I1GH 4FABH 2Y5EA 5HHMB 1QRNB 1DLFH 3L7EA 3OKMA 4G7VL 1H3VA 2F74A 1RVFL 5DEFB 5FDWA 1SM3H 1L7IH 4PJIA 5DEZA 4O51B 1ZWIA 3LQMA 5CUSH 3D0LB 1WBZA 4HUVB 5FYKU 1EVUA 1FDLH 3KHOA 5J1AA 1OAZH 4U1NA 3O8XB 1BFVH 1KEGL 5D1QC 3H9YA 1F3RB 3TH4T 5E7FA 3QUMB 1MAKA 1K4CB 5D6DC 1CGUA 3DMMA 5AG9A 3OAZH 4Z7OE 2HJKA 4HBCL 5B3JF 5JTWA 5HGHA 4CN4A 4PJ9C 1F5WA 1JHTB 4LSRH 4NUJA 1CZ8L 4O2FA 1I1YB 4MB5A 2CDFB 3H9HB 4G7VH 1RVFH 3GSUA 4LDOB 2X4PB 5I0DA 3K7UA 4P2RD 2EE2A 3BP6A 4RNRA 4WW1A 1WICA 4YDJB 5HHOE 4NZUL 4OBSA 1Q9KA 3IDUA 2EYSB 1CDCA 2EIZA 5BVJB 1KEGH 3ARYA 4LHUD 1P9MA 2E9BA 4G8EB 5BS0E 4AY0A 3ARUA 4Y2DA 4GG6F 3S3JA 4MVBD 3QIWC 4HBCH 4PJFA 3D0VB 5LAXA 2WQRA 3N0PB 4OZFH 2X4OB 4PJCF 1CZ8H 1J5OL 4MS8C 4WHTB 3TBVA 1IM3A 1SEQL 1F2QA 3D39E 1VKXB 2APWA 4XPHL 4DZBB 4Q2ZA 1S9YB 1FAIL 4I0KA 3KDMA 2C5DC 3SDCA 5T33L 3O0RL 1A1MB 1VFBA 4NZUH 5ENWA 2PTUA 3UYPA 2WWKO 1QSFA 4X7SH 4PGEB 2DLGA 4HIJA 3VD4A 3HCVB 1TQBB 1LK3L 5A2LH 4QNPE 4X9IA 3BJ91 3RWGA 5E2VH 2VL4A 4JZNB 1A3RL 1FE8L 2W9EL 4N90E 3TA3D 2H3NB 4I3RL 4EBQL 1J5OH 1I85A 1SEQH 1U8IA 3TPKA 4MA7L 4XPHH 5I1LB 3QQ9D 4E42A 3KPNB 4V1DA 1FAIH 1RHHB 5E6IC 1NL0L 4M3KB 1WEJL 3QUML 2CO7B 5T33H 1I1AD 3NVQA 3O0RH 2HRPL 1T3FB 3KLHC 1R0AL 2P5EA 4PTTA 3NCYP 5H35B 2KUTA 4PRBB 5E5RB 5JHDA 1J18A 3RWJA 2X09A 1LK3H 3U9UA 2VDPL 1NCBL 5A3IC 2JCCF 2PYEB 1UJ3A 1A3RH 3QISA 1FE8H 3RKDC 2W9EH 3CFJB 3JUYA 4I3RH 3E3QE 4EBQH 2M2DA 1JFQL 1P6AB 3T0ED 5F89B 3MRFB 3MV8D 3SDXA 2MTPA 1CLCA 3C6LB 5SX4H 4ZO6A 5F8QC 1NL0H 3D9AL 1WEJH 4WO4B 3QUMH 1ZMYA 4X83A 2HRPH 1IAII 2CDGA 1R0AH 2CXKA 3AREB 3QXVA 5C0AB 1BQSA 4G8IB 1QSVA 3K4DA 3TZVA 1EJOL 3P11L 4HMCA 3TNNB 4OFKA 4XZUA 3MREB 1CS6A 2HRLA 5DA4A 3SDAB 4PJIE 5L88L 2VDPH 1NCBH 5TQ2L 4JFDB 4JY4A 3VGGA 5DDHB 4AG4L 5FGRA 2F19L 2EKJA 4OZFG 2ENYA 1JFQH 3Q3GB 4DQOL 2CGRL 5DVKA 4PJGF 1MIEL 3EIFA 3SDDD 1P7HL 4JANB 1YQ2A 3TNMB 2CPCA 3CVHA 1KYOJ 1PG7L 3JSSA 3D9AH 3CFEB 3UBXG 4ZFOB 4OUUA 1KIRA 2G75B 5K9KA 3W9EB 3ZE1E 2X1OA 3ARFC 4Z78A 4QEGA 1LNUB 4J3XA 1HYRC 2VUOA 3OX8A 3IFPA 1E6OL 1EJOH 3P11H 5HHPA 1CFVL 3IJSB 3N50A 2QSTA 4LPYA 1S78D 2BCKB 3I85A 5KSVA 5L88H 4I0PD 4JJ5A 4KZEL 5C07B 4KC3B 2N4IA 5TQ2H 4AG4H 1AO7A 2F19H 5HHOD 1HCFX 2HJLA 3ARDB 3DLQR 4ZDHB 4JRYE 1X7QA 4DQOH 3D69B 1VFOA 2CGRH 2PNDA 5DC9B 2W9LA 3RWFB 1MIEH 3PV6B 4PGBA 4DFIA 3VXMB 3QFDB 1PG7H 4XVSL 4PGDA 2OMBA 5BS0D 1T03L 1YJDC 4NKOA 1D5ZB 2VDRL 3QDGA 1CE6B 1CXFA 4JFHE 1FL6B 4TSAL 3WMSA 2I5YL 1J87A 1A7NL 3PGCB 3IDNB 1VSCA 4HXBL 4HULB 4HK0A 2PO6A 2IPUK 4UU9A 4XCNA 1BVKA 2QJDA 1E6OH 3DUUA 1X5KA 3GRWL 1CFVH 4DOHB 4EI6A 3WFHB 4ZFFA 1I8LA 3D39D 4AMKL 3SBWC 4AZ8A 4PJBA 2YPLB 1RJYB 4KZEH 4TSBL 4U6YA 1CGTA 2ARJB 4ZXBB 4QRTA 5KVFL 1XF3A 3WYRA 1EAPA 4NN6B 2BNUA 1QEWA 5MP6L 4G6FD 1OPGL 3QNXB 4XVSH 3VFTB 4GMSL 1PDKA 1T03H 5J57B 1HNGA 1N2RB 4YJZL 3RL1B 4TSAH 2I5YH 4PJXF 1A7NH 4I1NB 3IRPX 1NBZB 4HXBH 4TTDD 4MVBC 1BIIB 4L8DA 3IETB 4N90D 4P9ML 1VB9A 4NT6B 4Y8DC 5EOTA 3GRWH 5DHYB 3WN5B 4ZOBA 5FK9B 1ZT7B 5E00B 4AMKH 2FCBA 2O5YL 4HUWB 3O81A 1L9MA 4J4PA 3V5HA 2AJ3B 4XXDB 5D5MA 4TSBH 1OB1B 3MRPB 4HWBA 2P5EE 5KAQG 5KVFH 4GW1B 4N8VG 3F7RA 5JW4Q 4HS6B 1FJ1B 4M6NL 5CSGA 5JHDE 4M9PA 5GS0D 5D7JD 3V4PH 5C0JA 5HHXL 2IQ9L 5MP6H 1MLCB 3TYGL 3TH2T 4M61B 3NN8B 4GMSH 2IBBA 12E8L 4NO0B 3DTXA 2C7UB 4QY8A 4ZG1A 5JXAH 4GO6B 2FNBA 3BUYA 3KPMA 4P9MH 3Q0HA 1EGJA 2AXFA 4GW5A 5F6IC 2OTWB 2O61B 3PP3H 2VTFA 2LAAA 1IEBB 3SDXE 5FM5M 3TA3C 4PJAB 4WV1B 3P9MB 2O5YH 2OP4L 1AKJB 3I75A 1ZGLA 1GRWA 1MAJA 1KPVB 1TQCC 1I1AC 2E7BA 3MNZB 3EJYD 4OV5B 4XP5H 3LN4B 5HHXH 2IQ9H 3SKOA 1ZHKB 3TYGH 4Y16B 5HBBA 5J89A 2JB6B 3BP5A 5IFJA 2O5XL 5CS7A 4R96B 5B22A 1C7TA 3BD3A 1MJJB 3NA9L 4LSQH 12E8H 5MENA 2IPKB 4ZAKA 2NY0D 3KPPB 3MRGA 4YHLL 2AJYL 1AGCB 5D2NB 4KVCL 5HGGS 4JFYB 5C0CA 3UEZA 1FYTB 3PV7A 4U6TA 4F37F 1UZ6F 1KIPA 3HHRB 4XH2B 5F1NB 2VLRB 2OP4H 3DMMD 1B4JL 3T0EC 1RULL 2XZZA 5FO8A 3LRHA 4NBXB 4QTIL 4ZNEA 3LEVL 4LCIL 4JO3L 2UZIL 1DUZA 4L4VA 5B39G 3PNWA 5EU3B 2J7LA 1YDPA 5CJOL 5E8PB 2EDQA 1YA5A 1SBSL 2ZUUA 2O5XH 1ZHBB 1KLUA 4L4TA 3NA9H 4E41A 4JVUA 4H20L 4OIBA 5DJXA 1VHPA 2PYFA 1T1XA 2VAAB 3C2SA 3OKLB 1IGYB 2A77L 2WW8A 4YHLH 2AJYH 4KVCH 1XGRA 4AK1A 4NBZB 3RI5F 4P99A 4JRYD 4N1EA 5C3LD 7CGTA 2FRGP 5MERB 4YAQA 2A38A 4G8FA 5GIRA 4Y2DD 4LMQE 4M8VA 1B4JH 3QDGE 1N59A 3SDDC 5EIIB 1RULH 4JFHD 4GS7C 4QTIH 1D7FA 3ZYOA 3LEVH 2XT1B 4LCIH 4JO3H 2UZIH 5CJOH 5FM5O 4XGZA 1C12B 1SBSH 1M6OB 4OUOA 3HS0B 5L2JB 1NLBL 3WNKA 4XP4L 4PRPA 2X4UB 4H20H 4MQSB 3SDCD 4U1MA 2A77H 1S78C 2VQUA 4HKZB 3BWAA 4YPJA 1F02I 1SJEA 3PWVB 2VQ1B 2Q8BL 4RA0C 1DBAL 5KVGL 4Z7UB 1XFPA 1E4KA 3VGAC 5HHNA 4MNGB 1J0JA 4I18C 3FT4A 2NMSA 3VFPA 1KLFA 3OB0K 1UADC 4U6HA 1NBYA 3HPLB 4M7ZB 3VFUB 4NQCB 3ES6A 1AD9A 4F3FB 3QIBB 4Y5YC 5EORL 3KYNB 1EZVX 4PUBL 2VL5B 4NQVB 1NLBH 3TBSA 4XP4H 4WNQB 1XH3B 2J6EL 3B9KD 1JPST 3WO4B 3BW9A 1QBML 2P5ED 5DFTA 2AJVL 2Q8BH 3MOBL 5CILL 5HVFB 1DBAH 5A2FA 5JHDD 5KVGH 2YPKB 3HA0A 3GKZA 4G3YL 3CFBB 1BZ7B 4YHOL 1CLYL 2ZOLA 3AGVA 3E2HB 4FG6D 1L0QA 3GJEA 3RX7A 5J11B 3UTSA 4ORGB 4D0BA 4Q6YA 5EORH 3G6JA 4S1DD 2AV7A 4HSQA 4PUBH 3L3OB 4TTDC 5EUKA 4ETQB 3HR5A 4R7NB 5A40E 5FIEA 1LILA 3UJIL 2J6EH 3FQXA 4JFXB 3O9WB 3SGJC 1BHGA 5FXCH 5J1TC 1SEBA 2H32A 4UDTB 5DEGA 2APBA 3ROOB 2AJVH 3MOBH 2OR7A 5CILH 3VD9A 4F9PC 1UCTA 3HE7D 5ETUA 5I1DB 2QR0B 3TZVD 3CFKB 3TVMB 4LVEA 4G3YH 4LKXB 3LQAH 5GS0C 2V2XB 4JREC 1EX0A 1KT2B 2BNQB 1CIUA 1KNOB 1CLYH 2OBGA 4YHOH 5MENE 1JZ8A 1U91A 2ICCA 3OKEB 1FNEA 2JJSA 2CIKA 3MOQA 1FL3A 5KW9H 5ESQA 5GRJL 1PEZA 5IMOA 1G9NL 4BQBA 4PG9A 3UJIH 3E3QC 2D0GA 1GPOL 4ZNEE 3SJVB 1KG0B 3INUL 3GSNA 3BPNB 5T3ZL 1IL1B 2LFGA 1PEWA 4D3CL 1B0GB 1IC5L 4YZFF 3EJYC 2F5BH 4L4TE 1TZHA 1N5YL 3ZE0F 5E5MA 4C55A 4OF3A 3UC0L 5C9KA 3WHE0 2BVOA 3BXNB 3CAFA 5GRJH 1BFTA 3RHWK 3VCLA 4F2MA 3DVNB 2P47B 3C08L 3X17A 4CADA 1G9NH 2NY0C 4KZDL 3H3PL 4BZ1L 5IBUB 2E27L 2Z8VC 4ZPVB 3RGVB 1P1ZA 1FN4B 3JWOC 2ZSWA 1DVFB 3QDGD 4YHKL 1GPOH 1H0DB 4IRJC 1WITA 4GRMA 4PJEB 3CZFA 3INUH 1ETZB 1G6VK 4Y5XB 2PO6D 5T3ZH 1EH9A 2I9LB 2ED9A 4D3CH 1IC5H 5I66B 1T83A 2OJEB 4PRPE 1N5YH 4LNVA 3SKMB 1HXMA 5D6CA 3UC0H 4PP2B 43C9A 2GIYA 1O0VA 2QKIB 1N4XL 1J12A 1TLKA 3C08H 4GFTB 3T3ME 2JF1A 1JYWA 3RI5K 4KZDH 3DSNA 2ITCB 5HYQA 3FT3B 4BZ1H 2E27H 4OGYL 5EBWB 2XZQL 4FQCL 1BJ1H 2IMMA 3PWPA 1BMGA 2Z4QA 1P9MC 5E99L 4YHKH 1U8LB 2GEEA 2CKNA 1AHWB 2AQ2A 4Y2DC 5EU4A 3KLSA 3CPLA 1MEXL 3WNOA 2XG5A 4OZHB 4KGLA 3DXAA 4HLZH 4R7DA 4GAJL 3IS0X 1DFBL 4J4PD 4KJWC 4OCNC 1J9CT 3O11B 4WWKB 3DURA 2P7TB 3S35L 3X14B 1MJ7L 4Q9RL 1LK2A 1K8IB 3NZ8A 1XF1A 3DX8A 4FFYL 3SDCC 4OB5L 2DQTL 4JDZB 2R69L 4D9QE 3MLWL 5GGTA 5DJYB 4ZOAA 4OGYH 2UZYB 4JPIA 2XZQH 4FQCH 1AGBB 1J0YA 4OQTL 1MWAA 5E99H 3MR9A 1K5NB 2BZDA 3PGDB 1INDL 2BHYA 3VWKD 1CYGA 5SX5K 1F8TL 4Q6IA 1MEXH 3G6JE 2ARWA 5JIHA 1RJZB 4PB9L 1NAMB 2NX5E 1S3KL 4JRXB 5EBLA 3QIWB 2YRLA 4GAJH 1DFBH 4N0UE 4OD2B 3K3QA 3MRBB 3S35H 3L1OL 3CSBA 4Q9RH 1NBQA 3B9KC 1S7WA 3GMRB 3T65A 4FFYH 5FGBA 5BCAA 4OB5H 2DQTH 2R69H 4X6CE 3MLWH 3EJZD 4LFHG 4LSSH 2HTKD 4I2XA 3QZWA 1YY9D 2AJSL 4OQTH 4G42B 5JO5B 1HN1A 5LVEA 5MEND 5GGVY 4XNYL 2DICA 2IBZY 1INDH 2Z35A 4I4WA 1NEZB 2OI9C 4AIZB 1F4XL 1F8TH 4Z77A 4FG6C 8FABB 1S3KH 4N8CL 2DI8A 4S1DC 4NRYB 1MCPL 3RDTA 4F7PA 3GMLB 2VZ3A 4NKQB 4KK8D 1R3LB 2EO9A 1I3VA 4F15B 1OP5K 3HUJB 2CK2A 1LEIA 5I6XC 4L4VD 4Z7WA 5EBGA 4FQQA 3UTPE 3UP1A 5E6IB 3ZT7A 5ICZB 2NNAB 3H9SB 1YNKL 2AJSH 3JTTA 1I75A 3HE7C 1BOGB 4L4TD 5F7LB 3TZVC 2APTA 1QR1B 2A9NL 4HEME 4XNYH 5IKCB 4JY6A 5IW6B 3QA3A 1F4XH 3X11B 5E94B 2GSIB 1BVZA 1NH6A 2E7MA 1MLBA 4N8CH 2A74A 5C0FB 3REWB 3RTQC 4PJAF 3I50L 1FRGL 1MCPH 4X6DB 3L3IA 2F15A 1MRDL 5ECJE 2C9AA 4F9LA 1CQKA 3QEUA 4Z7VE 4Q58C 3EO0A 3HMWL 3CMOL 2YXMA 4ISVA 4DUWA 1RIHL 3IDYC 1NANH 1W2KT 1YNKH 5CINL 1EUUA 4OI8A 5L7XL 1HYSC 3GJFK 4D0CA 4PRPD 1WFOA 2A9NH 2L7UA 3UPRA 4XAWL 3LS5L 4IS6A 1EBAA 5DLML 4PYHA 5HVGB 1GSMA 2GCYA 5DVOA 4QRQA 3I50H 5HDLA 5HXMA 1FRGH 4JE4B 1Q0XL 1QD0A 4QRUA 1MRDH 1P7QD 1UZ8A 4GAGL 3V5KA 1MFDH 3LSOB 3DBXA 4PRAB 5I17B 1NKRA 3RIAF 5I76B 3C8DA 4ZODA 5IR1A 3HMWH 3CMOH 4Z0XA 4FTVE 4G9FE 4Y5VA 4XP6L 4XBPB 1RIHH 3VG0L 1KV3A 5CINH 5IMLA 2R2BA 2PO6C 1WJ3A 1FVCB 5EU7E 2VLME 5L7XH 2XKNB 4FXGA 2FEEI 1F6AB 1INQB 4CNIB 4YQXL 3UO1L 3D2UB 5KVEL 4RDQF 4XAWH 3LS5H 1AP2B 2H8PA 4IMKA 4OCXL 4X6EA 4NQDB 1LD9B 3CSGA 2V5SA 1A9EB 5DLMH 1P2CA 3A67L 4OZIB 4PY8J 3GB7B 1NCNA 2P8LB 3H2WA 4D9QD 3EJJX 2ZSVA 1LVEA 4GLRI 5IBUG 1Q0XH 1N6QL 4PJ7B 5H94A 4GAGH 5GRVK 3NAAL 4AIOA 1DQQA 1MCJA 3W11D 4IMLB 2CD0A 4LCCC 4HDIA 1ZT4A 2XQYG 4XP6H 3H7BA 3N06B 2N1KA 2F8XC 1F4AA 3IU3A 2NX5D 3VG0H 1YEJL 5GS2H 1JZ3A 1YMHB 2X89A 4YQXH 3UO1H 1M4KA 5KVEH 2MCG1 5IUSA 4OCXH 2I27N 1E28A 1NDGA 3UZQA 1CFNB 1BBJA 3A67H 1QP1A 1JF1A 3BX7C 4I2XE 4Z5RB 4Z7UF 1HXYA 1NFIB 1CDYA 1RHFA 1UXSA 1JNHA 1JRHL 1N6QH 3HKFA 3MRIB 3CU1A 1ES0A 4HPYL 3NAAH 1I8KA 5GSRB 4F33A 5TDOB 1GVIA 1KACB 1SQ2N 4X5LA 3BRFA 1CBVL 1G7MB 3DHJA 2WUBL 3VWKC 4HUUA 1YEJH 3ESVF 4LHUB 1BECA 1QVOB 1JN6A 3V0VA 4L8SB 4ODUB 2LABA 5HDBF 1J86A 5CEYB 4ACPA 4KKLD 3I84A 3OAYK 2CUIA 1U8PB 1AI1L 3QI9C 4MD5B 3C6SB 3QEHB 4Z7WE 3ZT6A 5CIPB 5IM7A 1UVQA 1PZ5A 4FQJL 3OKOB 1JRHH 5DJ0A 3EJZC 4HPYH 2HTKC 3MOAL 3GBML 3N1QC 3VI4F 3VE0B 4G6ML 5FUZL 1CFBA 3O41A 1CBVH 1DE4A 5C0NC 4MSWA 2WUBH 1B0WA 1SYVA 4HKJA 5IB1B 2W60A 4L8CA 2ED8A 3T0BA 1DZBA 2G2RB 4POZD 1YPZE 3JVGC 4MA3B 2VZOA 4EN3A 4G9DB 5GSVA 2YUWA 2Y5TA 3NFNB 5B4MD 1AI1H 1JVKA 2EKSB 3TA3B 4KK8C 4E9LA 1N7ML 1T04A 4FQJH 5DZNA 1YJDL 2H2PD 3MA7B 1JYVA 1CFSA 3MOAH 3GBMH 4N68A 1EEYA 3MPCA 1TQCB 1R3KB 1I1AB 2VLKA 2GITA 3VFSA 4G6MH 4HUKB 2EE3A 3QUZA 5FUZH 2DJ4A 3U79A 1JCKA 3MJ8B 1LO4L 5MEQB 3VFVB 1FORL 2NW2B 3FQTA 4NO2B 2EDTA 4KMQA 2XIDA 5LWYL 2OX5A 1MVFA 5C2BL 4EI5A 1FFPA 5HHQB 3VH8B 4MXWL 2DL2A 4W4NA 3CH8A 1HDMA 1N7MH 5KSBE 5DO2D 1E27B 3O45B 4FTVD 4KRNA 3T0EB 3MV8B 1YJDH 3PDGA 1LE5A 2VLMD 2UWEB 3Q2CA 3EGSA 2VITB 3QUYA 3PUCA 1KJVB 5DJ8A 4GRWB 2AEPL 4KROD 5DD0L 4YHIA 1LO4H 1S5HB 4RQQA 4ZUVB 2HLFD 4Q9BA 4DK6A 1H8OA 1XR8A 1FORH 2C3GA 5HDOA 2GKIA 3JXAA 3LOWA 1FZJA 4MQXD 3QPQD 4KKBD 5LWYH 3M17B 5C2BH 5TDNA 1IBGL 3EDFA 1SJHA 2Q7YA 3CGTA 4G43A 3EYVB 2Q6WB 4MXWH 3GMQA 4Z9KB 3TT3L 2AKRA 2B7DT 5IBLD 4HZLA 4Q7DA 2AXGB 4X7TA 5H8DA 3SDDB 1JGLL 3E8UL 5GGSA 3QXTA 2XZAH 3VRJB 3WIFB 3CDFA 1I1CA 1J10A 2AEPH 3KYAA 5E24E 1I3RA 2E3VA 2YZ8A 5DD0H 2NPLX 1BREA 1YEDB 3EFFA 3BO8A 2XV6B 4GQPH 2PXYA 4S1SL 3P0YL 3DGGB 4YIQA 3OR7B 4HKBB 1IVLA 4GJTB 2F53E 3GHEL 5FO9A 2V5MA 3U6RB 5SWSE 3HZVB 4I0PB 1IBGH 3BVNB 4UOW1 4YH6A 5FM8A 3U48A 4MDJB 3F65A 1TJGL 5HI4D 3TT3H 1A14L 1GOFA 3K2UL 5HHOB 1UT9A 5CP3H 4PTUB 1KXQE 4OCSL 4I18B 4JG0L 3H8NA 3DX7B 3P4OA 3SKUD 1JGLH 3E8UH 4KKCC 4OZHF 4F7MB 3HG1A 3NABL 2KZWA 2VZVA 5BS0B 3RDTD 4OLYL 5EC1A 4Y5YB 5HYSA 4DGYL 2Z8RA 4OTXL 4F58L 2H6PB 1NC2A 2VDML 2MOVA 4K7FB 1BX2A 3VWJD 1PY4A 4S1SH 3P0YH 3VJ6B 5IB3B 3WNPA 1WIPA 3GHEH 4TNWK 3D39B 3ULSA 5IJKC 1FLRL 2BVPA 1AD0A 1TJGH 2AEQL 1NCDL 2E7CA 4XI5C 5F3HA 1A14H 1A6PA 1ORSA 2YN5A 4J7RA 3K2UH 5D7IA 3STBA 3KYMA 1D9KA 2A6IA 5EPMB 5EFIB 1CDHA 2IG2L 4OCSH 4JG0H 3FTGB 2XOTA 1FNHA 3RWDB 4G6FB 2H26B 3NABH 1NJ9A 4QGYA 3LQZA 2DOCA 1H5BA 4PR5B 4U0RC 5ACZB 3REVA 4OLYH 2WWMD 2DM3A 5DFVD 3WDIA 4DGYH 1IM9D 4OTXH 4F58H 1R3HA 3BPLC 3H42L 3F6LA 2VDMH 2EDFA 1LHZA 3QIUA 4TVPE 4KKLC 4M03A 1OT1A 4YFEA 5E7BA 1FFNA 1L6XA 1MIML 4KFZC 1M7IA 1KPUA 1FLRH 3AXLA 1EPFA 3C8HA 4RCAA 2VLKE 2AEQH 1NCDH 1F58L 4GRWH 4OAWA 1QFOA 4PRDB 2E5EA 4K3JL 2IG2H 2VXVL 5D7JB 2ICWB 4JREB 5FA3B 2HN7B 1U0QA 3KPQA 1U95B 4XMPL 4XRCA 5J9PA 2J1KA 5IVXF 3U4EB 3GSWB 1QYGL 1CXHA 5CJ8A 5C0EB 4GKZA 4POZC 3L6FB 3H42H 1T7WA 1MCFA 4HLJA 3HUJF 2E9WA 5E8NA 2IGFL 4AT6B 5LGHL 5B4MC 3FHAA 2HFFA 3IKKA 1ZLWH 1MIMH 2FX9L 4GBXA 2IH1A 4K3GA 1MCWM 1BZ9B 2J8UA 1G7QA 4YO0B 2H2PC 5IVNA 1F58H 4PIRF 2E6QA 5JQ6L 3IU4L 3N1GC 4K3JH 5A43C 2VXVH 3QFJA 5KZCD 4WEBL 1BEYL 3AS2A 1RIVL 2EICA 3L7EB 3OKMB 1A47A 2F74B 5FDWB 4XMPH 2FB4L 4X6DF 1BQLL 2VDNL 4PJIB 1ZWIB 2FYYA 5IHUL 1WBZB 2NY0B 4MHHG 5KANI 4OKVA 3LKNA 4HH9A 2ADFL 2XPGA 2IGFH 4M93C 5LGHH 4MMXC 2EEBA 1E4XL 1XF4A 4FQXD 1BJMA 2LU3A 2FX9H 4IDJL 1UKTA 1SJVA 5DO2C 2HJFB 2X89D 4W6XB 3DMMB 3CCHA 2HJKB 2KPNA 5EU7C 5I15L 1HSAA 3RL2A 5JQ6H 3IU4H 3OGCA 1IC4L 5HGHB 3QO1A 1WC7A 5D7SL 5E4IA 3CLEH 4WEBH 1BEYH 4O2FB 4G8GE 1RIVH 2X40A 2VH5L 1WCBA 5E9DE 5A16A 2HLFC 3GSUB 2FB4H 5F3BA 2F53D 3L7FA 3SGEH 1Y18A 5CGTA 5SWSD 1BQLH 2VDNH 1X4ZA 1W0VA 3NIDF 3RVTD 2W07A 3BP6B 3QPQC 4KKBC 5IHUH 1HHGA 4RNRB 4WW1B 5JDJA 4NRXA 5DHXB 3IF1A 1L6ZA 2ADFH 1W0WA 1BM3L 1XCTA 3D18A 3NA4A 5GXBB 1ERNA 1TMCB 1E4XH 4JRYB 5IBLC 1DUYA 4PREA 5GS0L 4YHPA 3HG1E 4IDJH 2R9HD 3ULVE 4Y2DB 4HUXA 1QO3B 4BELD 5I15H 4BQCA 2P8MA 5AUMB 4PGJA 1IC4H 4YC2C 5D7SH 4LK4A 2F8OA 4OZIF 4AEFA 2VH5H 3TBVB 1IM3B 5FGBC 3K46A 4KV5E 3FN0L 3BKML 3UAJD 1DQML 4Q2ZB 4PJ7F 4CL7A 3RIFF 3KDMB 1GHFL 2KH2B 3SDCB 5JW4R 3PL6A 1VFBB 5ENWB 1QFWM 3V5DA 5DRZA 1BM3H 2AERT 5DRXA 1CF8L 4NHUA 5HI4C 5MEOA 2EDNA 1K3ZA 4HIJB 5IROA 5GS0H 3E6HA 4YGVA 2V5YA 4EN3D 3RWGB 2CLRA 3FB8B 3RVXD 2R0KL 4F8QA 1SVCP 3MJ9A 4H0GA 4KKAC 4TVPD 5F93C 3JWOL 1BGXL 3FN0H 3BKMH 3VWJC 4M7KL 1DQMH 2VLJA 3B9KB 4E42B 4LU5H 1GHFH 2VLKD 5I75B 2P5EB 5IVZB 5JOFB 2BOBB 4GH7B 4PTTB 1QR4A 5B8CA 1WAAA 1CF8H 4LEXL 5JHDB 2B1HL 1SYSA 1DTUA 5DR5L 3RWJB 3DO7A 3VXPA 5GRVL 4ODTL 1OSZA 5DHVH 1JHKL 4EI5D 1S7TA 4LQFL 5F1SA 1UJ3B 5AAWA 4H5SA 2R0KH 3OV6A 3LKSA 1CE1L 1H9VA 2BVUA 1OAXL 1BGXH 3BSZL 3JWOH 5FOBA 3SDXB 4M7KH 5D2LA 4RX4A 4R6UA 5F9WC 3JBG7 1ZVSA 2J8UE 3QUYD 4LCWA 4OZFA 4OV6F 2BC4B 5IP4A 2CDGB 4XCFL 2KQMA 3L5JA 3QFJE 4LEXH 3OAUH 2B1HH 3HE7B 3UBXA 5DR5H 3TZVB 4BA8A 1R5IA 4XZUB 4ODTH 4FXKB 1B9ZA 1NC4A 2BSTA 2EIEA 4LQFH 4JY4B 3QHZL 4XMLL 1FV1A 5ILTL 2IPTL 1YY8A 3MLYL 4F80A 1CICA 3ZHKA 2HFEA 1A6ZA 2IF7A 1OAXH 3BSZH 3F7VA 3DX9B 1KTLA 3CVHB 4PJHA 2AVGA 5K9QI 4NOBA 3PDDA 3TIDA 1KIRB 1ZKAA 3WXVL 4XCFH 5K9KB 2DDQL 3G5VA 4Z78B 3IDYB 3ESUF 2R1XA 4OLEA 4B41A 1MQ8A 2PXYD 2R15A 3IFPB 4G8GD 3MCLL 5HHPB 3AAZA 3B83A 5E9DD 3TBTA 5CEXA 5KSVB 1ZAGA 4JJ5B 3BQUA 3T3PE 4ZUSA 3GMNA 3QHZH 1FVDA 4XMLH 5F1KC 5ILTH 2IPTH 2HJLB 3MLYH 1R3IL 1X7QB 4EVNA 3MBEA 3BYYA 4H8WC 4PGBB 4O51A 3HG1D 4PGDB 2UWEF 3ULVD 4D9RE 3SGKC 4NKOB 3QDGB 2XICA 4FQXC 4GRWF 1ZLUK 3WXVH 3UTZA 1OY3B 5KG9A 1JWUA 2PO6B 4UU9B 2XXMB 1BVKB 4FRWA 2OL3B 3P9LA 3DUUB 3MCLH 4EI6B 3MRHB 4DAGH 4PLJD 3QDME 4ZFFB 5ADOL 5FHBL 5C8JA 1KIUA 3BYTA 5SWQA 4C83A 3BWUC 4Z7NF 1JHTA 1P7KA 1XF3B 4HWZA 1D9KD 1EAPB 2CDFA 2FHFA 4RMQA 1R3IH 3C5JA 3Q1SH 2BNUB 3GHBL 4JO4L 1QEWB 5EUOA 1WCQA 4N8VA 4HGWA 2DQDL 3ZHLA 3AS0A 5EU6E 4Z7OF 4TTGA 2R9HC 2VN7A 3OL2A 4M4PA 9CGTA 2W0KA 4UIMB 4DK3A 2DJUA 2C4XA 1QFHA 4L8DB 1NDMA 4NDMB 3RVUD 3QIUD 2DYPA 3FRUA 3HZKA 2AEIT 5EOTB 5ADOH 5C08A 5FHBH 1HSBA 4YHZL 4KK9D 3V5HB 3CVHL 4JM2C 5D5MB 2J8HA 3RIFK 2X4OA 1HH6B 1T66C 1F3DH 2D7OA 1WAAE 5GJSL 4M6AA 4Z18A 4RGMC 5ITBL 4DZBA 3GHBH 4JO4H 5C0JB 4CDGC 4OF7A 4XVUD 2WINA 4LKCA 2YUZA 2DQDH 3WJJC 1HK6A 4LRNL 3DTXB 3VWKB 4PGEA 5I30L 3KPMB 4EN3C 3KXFA 2AXFB 4GW5B 1JNJA 3RVXC 4P4RA 5EU5B 4GBXD 4L1DA 4YHZH 3L95A 3CSYA 3CVHH 3BHBA 4P46C 3I75B 1WZKA 2VC2L 5AG8A 1ZGLB 1EO8L 5I2IB 5GJSH 3QFJD 5ITBH 3NCMA 3FL7A 1UACL 2R39A 3SKOB 4BSWA 1T6VN 1XGQB 4WU7B 1V7NL 2OL3L 5DMKA 2YD2A 2DIAA 5IFJB 4K71C 2QTEA 2XKSA 4G6AD 4LRNH 5MENB 5F96L 5B39A 4QNPF 4ZAKB 5I30H 3MRGB 1X5JA 1WZLA 2ESVE 4LOUD 5C0CB 2BSED 5GS1A 1A9BA 3LCYA 2CK0L 4QTHA 4N9OB 3RKPA 5M7QA 5AZEL 2J5LC 5FO8B 1EO8H 1KYOK 4IOSD 1KBGL 1LDPL 1DUZB 4L4VB 3PNWB 1UACH 1YDPB 5FYKE 1V7NH 2OL3H 2F54E 1GXEA 1KLUB 4L4TB 5DYOA 5IG7A 4QYOA 5F96H 5DJXB 1Y6KR 4ZO7A 5JDSA 5BJTB 2PYFB 1T1XB 5C0AA 3FB5A 4HWBL 1OVZA 4LLQB 2CK0H 2FX7L 4RFEA 4R4BB 4YAQB 1TETL 1JIBA 4MJ6A 5GIRB 3DV4A 1UA6L 1UCBL 1N59B 4D9RD 5T5FH 5AYUL 5AZEH 4DWHA 5JPMA 4WI4A 1VPOL 3GMOA 1S5IL 4Y7MA 1KBGH 1VA9A 2OZ4L 2L0DA 1LDPH 4LAQL 3CIQA 1KJMA 3PJSB 3DX6B 5E6YA 4XGZB 5GS3A 4IDLA 3M07A