5A2JH

Crystal structure of scfv-sm3 in complex with the naked peptide apdtrp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
244
structure length
225
Chain Sequence
QVQLQESGGGLVQPGGSMKLSCVASGFTFSNYWMNWVRQSPEKGLEWVAEIRLKSNNYATHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCTGVGQFAYWGQGTTVTVSIVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SCFV-SM3
publication title Deciphering the Non-Equivalence of Serine and Threonine O-Glycosylation Points: Implications for Molecular Recognition of the Tn Antigen by an Anti-Muc1 Antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Peptide binding protein
total genus 56
structure length 225
sequence length 244
ec nomenclature
pdb deposition date 2015-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5a2jH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5a2jH01
4OF8A 1AJ7H 2J3SA 2N56A 3UZVB 3WFDL 2HMID 1UM5H 2CDGA 1G7PA 2GTZA 5B3JE 5ALCH 1VENA 2WMPA 4KVCH 2R8SL 5CILL 1WBXA 1OQOA 2VDLL 1A22B 3S3JA 1JGDB 5J57B 3RWHB 4U05A 3RHWF 2A9MH 3GSOB 1ORQA 5I9QB 4I8DA 1U8IB 5DURD 3UYOD 2FDBP 4LAJH 5B4MC 3NPZB 4JRYE 4Y4HB 2HN7A 2FGWL 4PV9B 3LKSA 3M17B 1MELA 3ABZA 4O9HH 5ADOL 1H8SA 2R56H 4XPGL 4P46A 2Z9TA 4AIXA 3S3PA 4HH9A 3RHWK 1DFBL 4RFEB 3T2NL 5I1JL 1SJXA 4U6YA 3H7BB 1Y6KR 4KZDH 3MUY1 1QSEE 3LEVH 5A43C 2ZUXA 3U9UA 4WHYH 4XBGA 1ZMYA 1IM3A 5F97E 4W4OA 4Z7NF 1FFNB 1NGQH 4CADA 1U8LB 4YR6B 1MH5B 3MO1A 3JUYA 2WWMD 3SGEH 3U4EB 5IR1A 1IC1A 1OTTC 2FGZA 1S5HA 5DZLA 4JQIL 1OARH 2BMKA 4RIRA 2IGFH 2PW2A 5DJ2A 4P9HH 3LIZH 1UGNA 5DJDA 2AXFA 1J8KA 3FRUA 1G1CA 5KVEL 5IVNA 3MYZA 4QRQB 4R97B 5FYKE 4YHYB 1NKRA 1KENL 5I1HH 5IVXE 2X5PA 1KJ2A 1YEKL 4EOWL 5C0JA 2VLME 4PJXE 3JTTA 4BM7A 4D3CL 2YS4A 4HUXB 4YUEL 4UQ2B 3T0ED 4MA8L 3EO0B 3EYVB 1TCMA 3Q48A 5ITBL 3IFOB 1QRNE 2IALB 5DS8A 5HYFA 2F54B 3SDCA 3PHOB 1M6OB 1TPXB 6FABH 1UZ8B 3MLXH 4Q0XH 5IJVB 1JMZA 2OMBA 3V4VH 3QWOB 5TPWH 3DHJA 4MX7A 2A73B 2HFGH 1KJMB 1FN4A 5D71L 5I8OL 2CJUH 2FEDC 1T66C 4ZUVA 1X5FA 3SJVA 3KXFE 2NY2B 1RZKC 4NJAL 2AJSL 1RUAH 3O9WB 5FECB 3PGFL 4OIBA 1LE9B 1J7VR 1VEMA 3FMGL 5IW1B 5I75B 2B4CH 3X11A 3H8NA 3WKNA 3KPLA 5EU7C 5EU4B 3IYLW 2VITB 4FXKB 2R29L 3S97C 4FQXC 2IBZX 2FH6A 2VSDA 2NW3A 1WIUA 3UO1H 3MJ7A 2R15A 1AC6A 2KL6A 4ELKB 1R0AL 3QCVH 3IFPB 4WUKL 1IEAB 5F71A 1QFPA 4NQED 5CKAA 3ZO0A 1NAML 5FXCH 5HHOD 1KBGL 3TBSB 4FS0A 5KSBB 4QRPE 4K3DH 5C70A 1U93A 1BQLH 4TULL 1S7QB 3C09C 1OSZB 4Z0BL 4LIQH 4PV8A 1JPGA 4J8RB 3V4UH 4BFIA 4DN4L 3FB5B 3LN5B 1YMHB 4PJ7A 5DMKB 1E4KC 1BJ1H 4OZIA 4ODUA 4L29A 5E94A 2FRGP 1NBYB 4AIOA 1A7NL 5F3BB 1XGRA 4LRIA 3NCBB 5I1GL 1HQRA 3AB0C 2V17H 2CDGB 1QLRB 2DTMH 4X98A 1DQQA 4HFUH 4EN3D 5F8QC 4HKJA 5IBTH 1WBXB 1CF8L 3AU1A 2DKSA 2X4PB 4N90E 4ZAKB 2EKSA 3R0MA 2CRMA 4Y5VC 5JXED 3TN0D 1GZPA 2ZCHL 5ACLA 2WQRA 1WWCA 2HN7B 1JF5A 4J3VA 4XXDA 1T7WA 4HSQA 4K7PL 2K1MA 1KJ3H 1EGJH 4G42B 2G2RA 5I18H 3HI1B 1FSKC 1T1WB 1AIFA 3QEHB 2VOTA 4P46B 4U6XA 5GGVH 3IRPX 1MF2L 3OJMB 4HH9B 4AQ1B 1F97A 1IGML 2Z92B 5FM5M 4EXPX 1YJDL 4Z7OF 3EFFB 4JFFA 1MQKL 5DK0A 1LVEA 1W0WA 3QPQD 1EHNA 4ONGH 1A6ZA 4CAGA 4K8RD 4ZUSA 1N6VA 2R2EA 3U9UB 1WSST 4XBGB 1WZKA 1PKQA 4JG1L 4CVZA 4LHQB 4CADB 4XBPA 3LQZA 5IROC 3FQRA 3MO1B 3ZKMD 3FFCB 3GJFK 4UDTA 1S5HB 3KPPA 4UTBH 4N0CD 2BMKB 3B3IB 3U46B 1AGFB 1PJ9A 4M6MH 3CXHJ 1T2QH 3SDXE 3V0AC 2EIZA 3S98A 5HHQB 4KTDL 3D87B 3VWJC 1I7UB 5HHME 1KJ2B 4D8PA 4HPOH 3BUYA 5I1IH 2YEZB 4APQC 1LNUA 3FCTA 4FTVD 4NBXB 4JFDE 4I13B 2F5AH 2FWOB 5FCUL 3MREB 4HC1H 4KAQH 5I1LA 2EDFA 3GMLA 4XMKH 3I6KB 4MA7L 3L3HA 1JZ6A 2DIJA 4OFPA 4JFYB 1NL0L 4PJ8D 1GGTA 1VB9A 3THML 3PWNB 1RZJH 1JL8A 3D3VE 4MVBC 2RCSL 1GC1H 5GISL 3CC5B 3NN8A 1VGKA 1J10A 2VLKE 4OD2A 1AE6H 2M26A 1F3DH 3LD8C 2NQCA 3VXUA 2FD6H 4ZXBA 9CGTA 2D4DA 2BRRL 1WBZB 2G5RA 4ZUVB 4FA8A 4ONFL 3G5XA 2YD1A 5F70A 5JOPD 4OFYD 5LG1A 2OSLA 4GMTL 2DIAA 2NY5H 1JUFA 4V1DA 2OCFD 3RFZC 4HV8A 3D39B 3QXDA 1N6QH 4HZAA 4PS4L 3SGKA 4LGSB 2JKXA 2DQGH 2LU3A 2X2YA 3MJ7B 4H20H 4L3EB 3HE6C 4U1KB 5HHNB 1MCWM 2R1XA 5A40E 3S88H 1UYWH 1JHLH 3VWKC 3D18A 1MFBH 3QRFM 3RWFB 3IU4L 1ONQA 4F2MB 3F7YA 1A9EB 1AGDA 4U6HA 1V8HA 4HCRL 3JWOC 1U93B 2B1AL 2BNQE 1KB5A 1RY7B 3QDJE 2A6DA 5ITFB 1BM3L 1JPGB 1VFMA 4PV8B 4GFTB 1SYVA 3NCCB 2E9WA 4PJ7B 2R0KL 1UEYA 4LRNL 2J6EH 1P7QA 2D0GA 4DVRH 4HWUA 5I73C 3EYUL 1MCCA 1J8HA 1Z9MA 5A3ID 1MREL 3D85A 3HMXH 5FDWA 1HYRC 3E6FA 1DQQB 3TVMD 2HT3D 5C0CA 4WI7A 4WUUA 5C2BH 4HKJB 1MCKA 1IAOB 4PY8J 1AGBA 3CDFA 1CLZH 2B39A 3QO0B 3DBXB 1CBVH 3F62A 5D1ZA 1A6VL 1T6VN 1DVFC 4PJ9D 2C3VA 4HZLA 4MXVE 2CKBB 4ETQB 3ARUA 3ME0A 5T3ZH 3AAZA 5ADPH 3BP5B 3UX9B 3VGBA 4XXDB 1MIEH 2IPTH 5HJ3A 1N8ZB 4YX2L 1EO7A 2G2RB 3OGOE 5KSBF 3OQ3B 3SJVD 4G8FB 5BOZG 3VXRD 1AIFB 4QHLB 5BRZE 2XA8H 4ZYKB 1FNLA 4RMUA 4J23A 4FFYH 1T7VA 1TETH 4JFFB 2X4NA 1IGYB 5DK0B 1W0WB 3MJ9H 3B2VL 1A7RL 2EDTA 1J0JA 3QDMA 2FO4A 3CFJA 2R2EB 3CVHB 3OKKB 4PGDA 4ZUSB 5E0QA 5DO2C 1DANU 4U49A 4X6DA 3T8XB 4J2XA 3E1F1 1PKQB 2AJYH 1N64H 4CVZB 5CP7B 1NMAL 4XBPB 3KYKL 5B39A 3FQRB 5CUSL 4XVTH 1Q1JH 5FK9B 3NFPA 4X9FA 3DMMB 2VDOH 2IAMA 4UDTB 5JQHC 2ZOLA 3CUPB 2ICWI 5KG9B 1C1EH 2XG5A 3CH1B 1IL1A 1A1MA 3N85L 3OXRB 3LPWA 4ONHA 5CEZH 1RJZB 1P84K 2XZCH 2AK4D 2EDBA 5E70A 4XBEH 1L4IA 4U1GC 1NUGA 2Y5TB 2DQHL 4HJ0D 3BUYB 1JE6A 3HNVL 1FYTE 4FOMA 3U0PA 1NFDB 1RJYB 5ACMA 1CIDA 1RUQH 4M7KH 3ARBC 5I1LB 3GMLB 3IAPA 3ARGB 1QBLH 3O6FD 5KVGH 4ZS7H 2NY6D 1WAAE 3MR9A 4XC3L 4YHML 5KSAC 4OLUL 1MRDL 4ZTOH 5MHSD 5TJWK 1CGYA 1FJ1A 1FO0L 3LMJL 5E8PA 1YMMA 4R0LB 3ZL4H 1MAJA 1W72L 1QBBA 2GJJA 4LP5A 1AY1L 4OD2B 4KKBD 4I1NB 3RX5A 4MNGA 4YIQB 1UA6L 2Q8BL 2WNGA 4WTZA 3VXUB 2FJFA 4Y16B 4ZXBB 3UZQA 1D3CA 1ES0A 3EYFB 5IJKA 4HIIB 5GZNC 3NFSH 3G5XB 3HR5A 5GGSA 1DSFL 5I16B 4JE4B 5IK3A 1DEEA 3REWA 2OSLB 5F1SA 3QI9B 3H0TB 3VFUA 4NC2B 4QXUL 1YPZA 4CN4A 4FXLA 2QHLA 3F12A 5I1KH 3NA9L 1U8HA 4UT9L 3VMNA 3LH2H 3QIUB 3MV7D 5FO9B 3MV8A 4NN5B 1UFUA 4B5EA 1E4XH 2GHWB 3V6FA 1KJVA 3CDCA 2DWEB 3GKWL 3S5LB 3SGJA 3CH8A 4A6YH 3D18B 4YHLH 1A6UL 2DN7A 5GGUA 4U6VH 5DUBA 2Z93A 2NXYC 2PYFA 1DQDH 3P3YA 4X6BB 1ACYL 3F7YB 1AGDB 4U6HB 3GFUA 3HC3H 5IEKA 4Y4KB 1KB5B 4Y5XB 5FA3A 2A6DB 4GBXA 4NFDA 3RDTB 1SYVB 1NBVL 2MHAB 2A0LC 3LHPL 4Z76A 3LS4H 3SE3C 4D9LH 3NBNA 1I3VA 1QACA 1UWXK 4Y5YB 1ZVHA 2R69H 1NAMA 1P7QB 4JKLA 1S3KH 4PLKC 5C6PB 3TIEB 2YPLE 4RWYL 5JW4N 2OLDA 1J8HB 3O4OB 1LK2A 1G0XA 3A6BL 3BP7B 3GO1H 3D85B 5D93C 3MRNB 4LSUH 4P5KA 5FDWB 4XB7A 5JW4Q 4XMPL 4LLQA 4LCWD 4PGBB 3BDXA 4H0HB 3SQBA 3M45A 5KN5A 4WUUB 3P30L 4OLZH 4R6UA 3DX6A 4Z8FL 5JORA 4PRBA 3ETBF 5D7JD 4HZLB 4GMSH 4NWUH 4PFEA 5HHOE 1OPGH 4FQ1L 5DVNA 4MNHB 1T7YA 5CMAA 2ZSVB 3SDAA 3DUUA 5HJ3B 1JZ3A 5D7LA 1DUYB 1S7XB 4LPUA 1U8OA 4CVUA 1P4LB 3S3SA 2EE2A 5I76A 4PJ7F 2OJZH 4NQDD 1QEWA 3QDMB 2W9DL 3CSPA 2FO4B 3CFJB 3QQ3B 4H1LH 4F9PC 4NYLA 4XNYH 1T20B 2AV1A 3KPSA 3BGFC 5DUMH 4XNMB 1UM4L 2F53B 1M7DB 3KPNA 4FG6D 3NFPB 1BMGA 4P9HC 4WNQA 2Y36L 3NIFF 3HZKB 4KMTH 3MRPB 5FGCB 1IL1B 1A1MB 1HYSC 3W82A 3UJTL 1OL0A 3FT4A 4ONHB 1T1XA 5HGGS 3ZHLA 4OCXL 4RNRA 3QUYD 4BFBD 3ARVA 4X6CA 2FHCA 3W39B 4EUPA 3Q5OA 5SWZA 2WIMA 3AS2A 1QQDB 3S36L 3INUH 1AHWC 3F58H 2QQKL 2ADGA 4NHUA 2OL3H 3D0LA 4HAGA 3U1SH 2NXZD 4HPYH 3NTCL 1JBJA 5L2JB 3O3AA 1XGYL 4U1JB 4OQTL 3VXSE 3VCLA 1LILA 3MR9B 3NZHH 4NO2B 4YAQA 1LQSR 1FJ1B 1XIWD 4P4RA 1YMMB 4M1GH 4NNPH 2R9HC 2EE3A 4Q9RH 4TN9A 2HJKA 1P6AB 5J13B 5D1ZD 4DFIA 5EOCJ 4GG8A 4JR9H 1A1OB 2FJFB 4NBYB 3MBXH 2HTKD 3HR5B 1R3JB 4UINH 3WN5C 4XCNA 3O3DA 2XZQL 4KJPC 4F57H 1YQVH 5KAQG 1CGUA 3UPRB 2IPUG 4Q58C 2BSRB 4QO1A 2PXYA 3H9SB 4I0PA 5FKAB 5FEBA 4FTVE 1KGCD 4LCIL 5F6IB 2VZVA 2J4WH 3WJJC 1KN4H 4PP1D 1UG9A 4ZOAA 1NFDF 4Y1AD 1S9YA 1CICA 1MFAL 3DRQA 4XVJL 1R5VB 2OK0H 1N0XL 1KJVB 1LO5B 4OJFH 4UUJA 5DLML 4DZBB 5B38G 1MCOL 5DUBB 4KUZL 3GSNL 2ZSWA 2PYFB 3JV4A 1W8NA 2IAMD 4JPVL 4M00A 1CZ8L 4NRYA 3CZJA 4J6RH 2E7CA 4LLDB 5BVPL 2D03L 1QSZA 3KLHD 4JGUA 1MJ7L 4XVSH 4X6FA 3BP4B 5INCB 4WO4A 4C83B 2H2PC 3FB7A 4M7ZC 4PB9H 3OB0H 3S96A 2AEWA 3ARYA 2Q1EA 1MI5A 1MFEL 2Q7YA 4LLQB 5KN5B 1YEFH 2FO1A 2EYTA 1QFOA 3K4DA 2AEIT 5DD1L 3OG4B 2VKWA 1UVQA 3DX6B 1KG0A 1FGVL 5JORB 3MRGA 1WISA 5CD5D 4HX1B 4G6ML 5J6HB 4I9WD 3KPTA 1GPOH 3LEXA 4BKLA 2JIXA 5HI5D 3DUUB 4KRPB 1IT9L 1T7XA 5H37H 25C8L 3IXTB 5L0QC 2DQTH 5MI0B 2NTFA 3ZDZE 1U8OB 1T1YA 2ZUTA 3N9GH 3IJYA 1A4JA 3CU1A 1F4XL 4PJAA 1OCWL 1BQHG 3IB4A 2YWYA 3MGOA 1QEWB 1VFUA 2MKWA 2CO7B 2YBRA 1ZLUH 2AV1B 3B2UD 3QDAA 3QDGB 3MV8D 1JYVA 5CBEB 4LSQL 3BT2L 1J18A 3KYMA 1P9MA 3ARZA 4KK6C 4TVPH 2CSPA 3MUGB 2YXMA 3A6OA 5ID1A 1G6RL 1XR9B 3FT4B 3QHTC 5JIHA 3U2SB 4G8GE 2AERT 2P8LB 2W0PA 3GJEB 4RNRB 3A6CL 2PYEB 1M05A 3DV6B 1CE6A 4EUPB 1KCUH 5SWZB 3HG1D 4WI4A 4MWFA 5BCAA 4GBXD 4UILH 1ZHLB 2QSCH 4ODWB 2ADGB 1HXYA 3VXRE 1S5IL 1OAZL 4YDLB 3U83A 1FH5L 1AKJA 1RZJC 4ESKA 1IC4H 4V2CB 4GSDH 4NUJA 4L9DA 4CU7A 1GC1C 2WAHA 4YAQB 1TQBB 3IDJA 4KJQD 4OF6A 4GRLB 1Z2KA 1LO0H 1U8MB 2HJKB 4HWEL 4EBQL 1GHFH 4LCCC 1TNMA 4R8WL 3CVIH 3VFRB 1I8MA 3WKMH 2BSSB 5FF6B 1EEUA 2VDKH 2NY5C 2OX5A 3QIWB 4XCNB 3CK0L 4N8VA 4F9LC 4ZFGL 1NUDA 1QA9A 1BFVL 3MRKA 3GM8A 5D72L 2PXYB 4I0PB 5M7QA 1A0QL 3FO0L 2APWA 1ZA3A 1HNGA 3G5YA 2I9LA 3VDCA 1FNEB 5EZIH 1S9YB 2P8PA 1CICB 3DRQB 3HLAA 4CNIB 1E4KA 1GAFL 5TQ0L 4JHWL 4QEGA 3I50L 1OAUL 1K4CB 3LV3A 1ZWIA 1QFWL 4WY7H 2NY3C 4JQVA 1U91A 5MHSE 4LSPL 4YBLC 5GGTL 5I1CL 1JVKA 1W0VB 1BZ9B 3U0TA 3BKJL 5T33L 1T04A 2EXYD 2QV2A 5B8CC 4JDZB 4K3JH 2P7TB 4AH2A 4UOW0 1MLCA 1CGVA 1SJVA 3RX7A 3GIZH 3X3FH 2FH8A 3HAEH 2ICWA 1MHPH 4DAGH 1I7RA 5GGRA 1OF2A 1L9MA 2A6KB 4RFOH 1MI5B 2Q7YB 1W2KT 3MLZL 3MV7E 3IJSB 1I1FA 3I6LE 4CJ0A 3BD4A 1U95B 3EOTH 1IAIM 2W38A 2BXZA 2IF7A 4JPWL 1H9VA 3AM8A 3EYSL 4JCMA 3HZYA 3MRGB 5F88B 2PETA 5DZNA 4ZNEE 4R96B 5IMLB 5L8LB 1KEML 4MNQE 1YEDB 1GGBH 3VFOA 1QBML 5IROA 2CKBL 2X70A 2JIXB 4RFNC 1NAKH 4C56A 4FQHB 5DSCA 4K7PY 4LPCA 4QXGH 1JWMA 2NTFB 1PY9A 1T1YB 5CFHA 4LPTA 4HWBL 1FC1A 3ULVL 4L8CB 4UV4L 4JFOA 3MGOB 2BFVL 2XPGA 3QQ9D 5IV2A 1UWGH 4MQXD 1UWEL 2QJDA 2B5IC 2YMXL 3KPRA 4K3HA 4U1HA 4UNVA 2YBRB 4WI5A 3VGHA 1P2CA 3QRGL 4FFZH 3MRLB 5H2BA 4N8PA 4LCWE 1U2HA 4DCQA 3GSUB 3KYMB 5EBLA 5DD0H 3BQUD 8FABB 3Q6GH 3WJLC 3AY4A 4NKDA 5ID1B 4DQOL 1INEL 2NR6D 4I2XA 1TTUA 4RX4A 3QDHA 3RL2A 1M05B 1CE6B 5FUOL 1CFVL 5F6HI 4MDIA 1CGTA 2L7UA 1ACZA 5GJTL 4HJJH 5D1QA 1F58L 1R3HA 1UJ3C 2R2HB 2Z35A 5DMYA 5IBLD 2Z0BA 5ISZD 3V0WH 1A7QL 4MJ5A 5EBGA 4TVPE 1MCHA 1Z5LB 2OTPA 3OTTA 1NLDH 4MXQC 3X13B 5JW5A 3MLUL 4NQDE 3BDYH 1I3RA 4G8IA 4NUJB 1YYML 4OIAA 4PRAB 4R2GB 1E0OB 2ATPA 5KTEL 2W60A 5C3LD 2P5WB 2WLYA 1N59A 5E2TH 3PV7A 3T3ME 3SCMC 4FQXB 1DJSA 4GH7B 3VXPA 5EU3B 1I8MB 1S7UA 4M4PA 3X12A 1OD7A 1CFTB 2VKXA 1HHKB 4R7NA 4BFEA 3SQOH 1QA9B 1Q8MA 1T83C 5IFHL 4WCYL 1LO4L 2OJEB 4DTGH 5MEPA 2A9NL 3BRDA 3HUJB 3ZE2E 2JLLA 5EUOE 4OGYL 1ZGLM 4PJ5A 3G5YB 3CMOL 4CRPA 1OAQH 3V7MA 5EOQH 4P49A 2Q6WA 3OKOA 4PG9A 1N2RA 2P8PB 4RZCA 1FNSL 5T1KA 1TJIL 3HLAB 2YK1H 5E4IA 4S2SB 2MFNA 3QUMH 2AGJH 1T1ZB 3MLYH 3QZWG 4FQCL 4KVNH 1R5IB 3JV6A 5T3XH 3AB0B 4KI5C 5E1AA 3GMOB 4XRCA 1FVEA 1T4KB 3RKDC 1UXSB 4YPGA 4QTIL 4NQCA 4RISL 4OLVH 4JJHA 5AG9A 1P4IH 2X4SB 1F6AA 3KVQA 4LBEA 1UCBL 4R4FH 4AH2B 1MLCB 4OKVB 4RAUB 3RZCC 4Y5VB 2HH0H 1WFTA 4N68A 3C8KA 5C0FB 1G9NH 3KPQB 4NNYA 4OM0H 1OF2B 1KCVL 1I7ZA 3FO1B 1I8IB 4LF3A 1CDYA 4ZDHA 4Y1AE 5I8KL 4P0DA 4M1CC 3O3BA 1C5BL 2Y06L 3E6HA 4YXHH 3UAJC 1FBIL 3ARWA 4PJGA 1XF4A 5E9DD 4JN1H 5HBBA 2DD8L 3S8WA 3WBDA 3MOBL 2VDQH 1JPTL 3WNMA 1RZIA 3JV0A 1PEZA 4JO4H 1NCWH 4LDEB 5C08E 1MCLA 1DN2A 1FLRH 4RAHA 1T21A 4G7VL 1BBDL 2NY0C 3LRSB 1D7FA 4FQLL 2ITCA 1XH3B 3ZKQD 2XPGB 1EA9C 3VWJB 1B0GB 1P69B 4APQB 4PTTA 5D7SH 5H2BB 4WEBL 5F7EH 3JWDL 5CEXB 5JIPA 1JMXA 3AVEA 2O61A 3VXMD 4POUB 2EDDA 4MCYB 5JR1L 2O5YH 4ZODA 5GJSH 5E2UH 3FT2B 1JZ4A 1FV1A 3BP6B 4I9WE 2IH1B 1MNUL 3A67H 4IRSA 2V2XA 1KEGL 2HVJA 1R3HB 1WGOA 3BPNC 5ILTL 4DGIL 4J4PC 5HYSA 2QQNH 3LD8B 1II4E 4L8DB 3UYPA 4EVNB 1PVHA 4OTXL 1N4XH 1NCNA 2AI0H 5JXAH 1KLGA 1A02N 3G6AA 4X5XB 5JW5B 4ETYA 1I3RB 4PJBB 1OGTA 2EC9T 5DR5L 4D0DA 2ATPB 4Q6IA 2W60B 5K9KA 2ZCKH 4QNPE 5LGJA 4NGHL 1N59B 1WZ1L 3ZKNC 3DXAB 1WBYA 2A6JA 4Y0GA 3OJ2C 4JB9L 2W9EH 3T0WA 1BVZA 1S7UB 3HE6B 3X12B 2BHUA 3C5ZA 4DJMA 3LKRA 3QZWB 4Z7WA 3RY4A 3ZDYF 4R7NB 4C56D 5DT1L 4YJZL 4ODHH 1PSKL 3D9AH 1H3XA 1XF3A 5F7DA 3RTQC 1KCSL 4U2YA 2VL5B 3HE7A 3U6RA 5CZXC 4X7TB 5CIPA 4HLJA 1N6UA 3GI8H 2UWEE 2BZDA 2Q6WB 1A14L 3OKOB 3QUKA 4PG9B 1SQ2N 3KPRD 3O2DH 2E8YA 3HC4H 3H42H 1AFVL 3NGBC 5BS0D 5I73B 1OWRM 4GG6B 1CVRA 2HG5A 4YNYA 1BREA 2GY7B 4AL8L 3UEZA 1J1OH 5E1AB 1MCJA 1FL6A 4XRCB 1B2WL 4GW1B 3D0VB 1FIGH 4YPGB 5GGRY 3V6BR 1ULVA 4PRNA 3S7GA 1SBSL 5MENE 1F6AB 1K6QH 5SWSA 3BX7C 2MKLC 3IDYC 1DE4B 2AEQL 2Y5EA 2F8OA 3C8KB 4PRDA 1IM9A 3JUZA 2Y07H 1JFQL 4M48L 5IB1A 3UYRL 3WXVL 3N06B 5CP3H 4XPFH 4OCWH 4ZDHB 1X9QA 3TA3A 1I7TA 3HUJF 5C9JA 1RJLB 3S9DB 3T0DA 5DC9B 1B90A 2CMRL 4BH8A 5IIEA 3BYTA 4NBZB 1P6FA 4OCYH 5E8EA 1HKLL 1ZHBA 1HH6A 3BEVA 2QADD 3EOBA 1RZIB 3RWJB 5IEHB 3VFGH 4ALAL 4KQ4H 4XPBL 2D7PA 4NN7C 5A2JH 4WV1A 1T21B 1BOGA 1VESA 3BDBA 5GZOD 5DUPL 2D7QA 4PRHA 4J3OC 2WUBH 4NRZB 3S37L 2Q76B 4FMKA 3T1FA 3WD5L 4YBHA 4MQTB 4DGVH 2ITCB 4NCDA 4U1GB 4WHYG 5LWYH 1RU9L 3WFEL 2B2XL 5CZKA 1NCCH 4PJ5D 3RVUC 4XH2A 3MLWL 4DW2H 4OFIA 2DB8A 3S4SB 1BFOA 5CCKH 4KK5C 2FSEB 3ARBB 1C08B 1T0MA 2BVQA 1NGZA 4UOJA 2OI9C 4U1IA 3UDWC 4AG4L 5E08H 2WQ8A 2ZZUT 2FCBA 4X7EC 3SDDC 1FFPA 5KSAB 4M43H 4DWHA 5HYJD 1WEJL 4OQ1A 2ZPKH 2W0KA 1LD9A 4NQCD 3L3KB 1JTPA 2APBA 1BZQK 3CZFA 2HVJB 2UY7A 4IOIB 2H3NA 4K3EL 4YEFA 1OGAD 1T0NA 2XTLA 1F90H 1PFCA 1U2CA 1YDPA 5F21B 5FIEA 3CLEL 3P2TA 4DK3A 2VLRE 3I2CH 4QTHA 1KLGB 2ESVA 5BZDB 1AQKH 4LKXA 3G6AB 5AD0A 4QRTB 3P0YH 2HP4A 2YUWA 1LP9E 3QB7C 1A5FH 3NACH 1IAIH 1B0RA 4D0DB 5C0GA 1CR9L 4LHUG 3UP1A 5K9KB 4NZDA 5LGJB 3OGCB 4YZFE 3W9DA 1HIML 1CD9B 4M93C 4UV7L 3CFKA 1LO3L 4U1MA 1TNNA 4KMQA 4LSRH 2IBGA 4ZSOB 1ROWA 1F6FB 4BA8A 1VFBB 3C5ZB 1GSMA 3LKRB 1HHIA 1ZA6A 2AK1H 1S9WA 3KHQA 2NXYB 3V4PL 1J0YA 1MAMH 5DHVH 1XF3B 4AYFA 1WWAX 2CK0H 1ADQL 3U6RB 2EXWC 5EO9A 5ISZE 5CIPB 2WBJC 4ZAKD 4MAYD 2DJSA 4GXVH 4XZUA 3OAUH 5JO5B 3QUKB 4R3SA 4N9GA 5CJBA 5HPMB 4YNYB 1OW0C 4EQ2A 4K94L 5D93B 4PJBF 4YHIB 5E95B 5DMGC 5D2NC 4RBPK 3IXAB 3EJZC 1EUUA 4HIJB 4JANA 4NJ9H 2IMMA 4LU5L 1GOFA 5FHAH 4PRNB 3KJ6L 4Z7NE 1IVLA 4ZUTA 4A2MA 2DKMA 2A6IB 2AQ1A 4E5XB 1AP2B 3V5DA 5SWSB 4IRSD 4MMZC 4H8WH 4HAFA 4QWWD 4W70A 5DI8A 4K2UH 2AQ2A 3EGSA 3TT1L 4KPHH 3FFCD 3LSOA 5IHZA 1CS6A 4G6FB 3WFBH 5IMMB 4QXTB 4PRDB 3VG9C 1IM9B 4UBDC 2GJ6E 5D2LB 5C0RH 3P4MA 1A1NA 5IB1B 2GT9B 4KZEL 5TE6L 2IANA 4XGZB 3T3PE 1CI5A 15C8L 1I7TB 4QCIA 3EBAA 4OCRL 1INDH 3BUTA 3W0WD 4TSBL 3NA4A 3UBXI 3O0RL 1GOHA 4PJIB 1L0QA 1EJOL 5IIEB 2HJFB 1DUZB 3OAZK 1HH6B 3BGFB 4GG6F 2EDRA 1LWRA 3GBML 3MRDA 1IARB 3KJ4B 3P4OB 2JJUA 5I8EB 3TV3H 2VLJB 1QSFA 3VI4F 4PUBL 4JO2L 1A7OL 4ZMAT 5I1EH 4BSWA 1BOGB 4XWOC 3C87A 4PRHB 1U9KA 4BFGA 1HWHB 1YEIH 2VXSH 1G7QB 5DJ8A 1S9KC 1J05B 4MJIA 2FYYA 5E4EC 4JRXE 1NGPL 3MOAH 4PTUA 4HIHA 1AHWB 3TO4C 3LKPB 4XH2B 1TCRA 3B9DA 1MVFA 3QCUH 3X14A 3TZVC 1BFOB 1S78C 4FQIL 1T0MB 2BVQB 1NGZB 3MLTA 4U1IB 3S6CA 1DBKL 3E2HC 4HLZH 4YXKH 3O3UN 3QQNA 3D39D 2HLAB 1KXQE 1V7NH 3HZVB 4W6YB 4Z6AT 1G9MH 5D7IB 1UJTA 4RMTA 1MCSA 3NH7H 1K8IA 2HT2D 4LEOB 1JNNL 4CMMB 1NFKA 2K7QA 3V6OC 1T0NB 1KPRA 1X4YA 4KUCF 5IB2A 4P23A 1TVHA 4MMXC 1BWMA 3HNTL 4HWZB 4LKXB 4CBPA 1H3WM 5AD0B 4K3GA 3WIHA 2D7OA 2I5YH 5KSVA 1RZKL 5IHBA 3MNWB 3V0VA 4F15B 5HVHB 4PRIE 3ULUF 2Z31C 4XPAH 5C0AE 3TA3D 3UTTA 4RDQG 4DOHB 3VH8G 4CUCA 3O81A 1VEOA 3W9DB 2ZUYA 2ZUQC 4LSSH 2RFXB 3VXME 1BHGA 2VB5A 2PTVA 4NT6A 2XQYG 4U1MB 3PGDB 1YN6B 3U79A 5C09A 5EC2A 2D7TL 5CZVL 1S9WB 3C6SB 4FFWD 3SO3B 1OLZA 1YEHL 1YA5A 4X80L 4PJEA 5EBWB 1KCKA 2CD0A 4H88L 1J1PH 5SX5K 1P7KB 3WO4C 4HG4K 3BAEH 5EO9B 3MRBA 2ZJSL 5EG6C 3C60D 2B1HH 4JGJA 3ZHDA 5EZJB 3MRJA 5IF0A 4JJ5A 2PO6A 1WTLA 1U58A 4N1CA 5I17B 4N9GB 2ADFH 3FB6A 5TFSL 4NOFA 4Y4FD 4GW4A 4Z7OE 5CHNA 3VRJB 3X17A 4HUWA 3ULVD 1Y18A 3WS6C 3HFML 1HSAA 4JANB 2EEBA 1C16A 2H41A 1FAIL 2G9HA 2VZTA 4IDJL 4UQ3A 4ZUTB 1PKOA 4PJHA 5JUEL 4Y2DD 3V5DB 5E24E 1TTGA 1G9NC 3D69A 4XAKE 5J11B 1A6WL 4ZG1A 4WEMB 3LSOB 4YQXL 3FB8B 5DVLA 3P4MB 3SE8H 3VDAA 2VDRH 1BWWA 1A1NB 4F3FA 3VXOA 3BIKA 5F96H 1L7IL 3SKMB 4DKFH 5L0QB 5JHDB 2IANB 3HB3C 5FOBA 4QCIB 1QLEH 4JY5H 2XACC 1NCBL 1IILE 7FABH 4R90H 3WXWL 5GQBA 2LAGB 3FHAA 1TTFA 5E8NB 3QHZH 5HHVH 3IAQA 3WE6B 1E4WH 4N1HB 3MRDB 1S7RA 5EO0A 4JZJA 2GJZA 1UACL 3TWCH 3O2WL 5JOFA 5CGYC 1IKFL 3IKCB 3BN9C 1KJ2H 2R1YB 2V7NB 4S1DD 5DJ8B 4MJIB 2FYYB 5SWQA 2PKDA 1YEGL 4PTUB 1S7TA 4HIHB 2CUMA 3CFIC 2IQAA 4XAWH 4Y16D 1JHTA 4RRPA 4HXAH 3WUWB 5D2LF 4LGPB 3H3KA 3EHBC 3T0BA 3MLTB 4YHKH 2YD9A 4ORGB 1R3LB 1BIIA 2EDJA 3QI9D 3WV0A 3LEYH 2SEBA 3PL6A 3S34L 4D9RE 4PJIF 3N50A 4UNUA 2BOCA 5B3NA 5L9DH 5F9JB 3VH8B 4GAGH 5JHLH 3QIUD 1VKXB 2IG2H 4X6EA 4M03A 3SCMA 5FGBA 4L9LA 4IJ3C 1KPRB 4LCCB 1PBYA 2F54E 5IB2B 1TVHB 5BV7B 4QRRA 2X89D 3DGGA 5KSVB 5C1MB 2J1KA 1LEKA 3C08H 4JKPH 3ALXA 1U8KB 3TYGL 3P0VH 1JGEB 5SX4I 2JELH 3T1WA 2BSED 5DD6A 4NT6B 2XQBH 4A6YA 5GGQH 3HPJA 1F4WH 3ECBB 4Y19A 5K9QG 3NMEA 5C09B 1V3JA 5EC2B 5LQBL 4IMKA 3MBEC 2NY3B 3EO9H 5TE7H 2I07A 1U6AL 5HYJE 2W07A 4G6AC 4YBLB 4PJEB 4RGNC 4HKZA 4YBQD 4HIXL 5IMKB 4AENB 5D7IF 1JHKL 4AM0A 3HI5L 1QNZL 4QOKA 4X7SL 1NSNH 3RVVD 3JWOL 5E2VL 2JJVA 4S1QL 3AMKA 3ZYJA 3MRJB 2Y25A 4DZ8A 5IF0B 2YD7A 2D31B 5DD5L 5B38A 1U58B 5KSBE 3O8XA 2HVKB 3FQWA 3QUZD 3FB6B 4YHZH 5KS9A 2BC4A 5IHUL 4GW5A 2EICA 5CHNB 2VUOA 5KVDH 1WIPA 5E56A 4JHAH 4MAUH 1HSAB 3O4LA 3IVKA 2GFBB 4IHOB 1N5AA 4J3SA 5FKPA 4FABL 2DMBA 5HYIA 1ZXQA 3I3BA 1I9RH 2JF1A 4OFDA 2F53D 1Q9LA 5CJOH 5J8OA 3NPSC 5EUKA 3MUHL 3C2AL 1RIVL 2VIRA 4P23D 2C1OA 4F3FB 3VXOB 3GSWA 5C9KA 5I1DB 2AJUH 3IDUA 3PP4H 5FM4A 5KSUA 1XGUA 5JDSB 4PLJC 2BNRB 1MQ8A 3QEQA 5ERWA 1NC2A 5DJ6B 3PQYA 3UTSA 3U36A 4LQFL 2CXGA 5ALBH 1QVOB 4K23L 4MCZA 1S7RB 1VACA 3L6FB 4LCYB 1JRHI 2LE9A 3G6DL 1URLA 3GDBA 5AEAA 2LU4A 2RIKA 5JOFB 3MROB 1MPAH 5MP6H 5F7UA 3VE0B 3WLWD 1TDQA 5D1XA 4G5ZL 4JPIB 4TQEH 5SWQB 3ESUF 4H1LG 2PTTB 4WFHD 5J89A 5A2KH 2AXJA 1IJ9A 3FFCE 4KY1L 4P4KD 3V5KA 1NQBA 2EYSA 5ICXA 3RWDB 1BX2A 4P2RB 4HD9A 4OCMC 5DYOA 1B3JA 1UJ3B 3D6GA 2PO6D 1FE8H 3O6KL 2COQA 1VHPA 1IEHA 4P2OA 4WW2C 1XCTB 5D6CA 3L3JA 3W0WE 3MTRA 1BIIB 1RVFL 4O51A 1U3JA 2BVTA 1P84J 4PRPB 2SEBB 3QG7L 4K9EL 1XGTA 3CXDL 3PL6B 4IRJA 1C7TA 3H9SD 4MJ2A 4FQ2L 3U7YH 2BOCB 5HPOA 5C0BD 3OV6A 3VFPA 3RNQA 3CNKA 4Q97A 3L95A 3EZJB 4X6EB 1RURL 3QUXA 3BN3B 3SCMB 1IE5A 1E6OH 1YNKH 3QISA 4L9LB 4YXLL 5GSRA 5GXBB 1T5WB 5I0DA 1WICA 4FZ8H 3UTOA 1I9IH 5C7XL 2DI8A 4QRRB 1KIRA 4Q74A 3H9HA 1IBGH 4DGYL 2GSIA 2QR0A 3U7WL 3CFEB 1BVKB 4CN6A 1LEKB 2VR5A 4XTRD 2DQIH 3L1OH 3ZE0F 1VSCA 5ETUA 3GM0A 3B8YA 4M62H 4A6YB 3HPJB 4Y19B 1RZ8A 3D39E 3SOBL 4Z77A 4TTDD 4PJCB 4LCUA 5IESL 3MA9H 4LVOC 1KB5H 1JRHL 5AYUL 4QHMA 3UBXA 3PDOA 4ZFOA 2VISB 4L3EE 3T0EC 4WWKA 5T1LA 4AM0B 3IDMA 4PY8I 5F8RC 3MLRL 5DVOA 4AT6A 5KW9H 4F37F 12E8H 2UY6A 5KZCB 4OD3L 1DP0A 2OR9H 4TSAH 5AZ2H 3T77A 4C4KO 4XNQA 4TSCL 1PG7L 1UH4A 1VADB 1AJ7L 4KQ3H 4NKMA 3GSRA 1UM5L 4NO0D 5T5FH 4U4BA 4NO3A 4KKCD 5ALCL 4Z0XA 4O02L 4PJ7E 3O4LB 2XQYK 4KVCL 4CVXA 4F37K 1OTSD 5J12C 4NSKA 5DFVD 1IGJA 2VE6B 3QO1B 3PF2A 4K71C 1N5AB 5FKPB 4H8WC 5BVJB 1F2QA 2A9ML 3ARFA 4KJWD 4GS7C 2Y6SD 3QDGD 3NIFE 2M1KA 1MUJA 3MCKB 3PWLA 2VIRB 2E27H 2YN5A 4PJEF 5GRXG 5ESAB 3BJ91 1X3DA 5DRZA 3H3BC 1IZKA 3ZSTA 2R56L 5JA8B 1FL5A 3QNZA 1B6DA 5FYJU 2WINB 3RVXC 4OBSA 4H1LB 4KZDL 3LEVL 3QEQB 1DFBH 1NC2B 1BJ8A 4LSTH 4LASH 3UTSB 4MD0B 4NKQB 1AGEB 3U48A 1TJGH 1NGQL 3DLQR 4GQPH 3P4NA 2HWZH 4MCZB 1CDBA 3PWVA 5GRJH 2CRIA 4GAYB 1A3RL 3V8OA 1REIA 4QHKJ 4XCEB 2IGFL 4LLUB 2L7JA 3LIZL 1FL3A 1D5ZA 1PKQE 1CLOH 5DJXA 4OBRA 4JQIH 4OF3A 4GRLD 1OTUD 4EN3C 3QFJD 4LKCA 5ANMA 4ELMA 4QOKD 3V5KB 5I1HL 2EYSB 1H5BA 2OL3B 2PW1B 5DYOB 3TBYA 1YN7B 4TRPH 1KENH 4ZO9A 1F5WA 1LDPL 3Q5YA 3QIWD 4P2OB 4U7MA 5LGHH 1P4BH 3L3JB 3BESR 4D3CH 3PWUA 5DVMA 4O51B 5H94A 1KFAH 4M6AA 5HHXH 2C1PB 3UJJL 1G9MC 1IQDA 4IRJB 4YUEH 4OAWA 1NFDE 4NC1E 5FUZL 5TF1H 2VH5H 6FABL 3SKUD 1CFQB 4OSUH 1X4XA 2CRYA 4Q0XL 1I85A 3V4VL 3VFPB 5TPWL 3C5JA 3L95B 3B9KD 2FX9H 3QUXB 5I75C 2HFGL 3OKLA 2E6JA 4ZFZA 4ZUUA 3RL1A 5GSRB 2CJUL 4KKLD 4UU9A 1G7JA 3VFTA 2IH3B 4HDIA 3TH4T 1RUAL 4Z7UA 1KIRB 4JQXC 5D71H 5EU6B 3L7EA 1OB1A 1FCGA 3ZKMC 3RTQB 2B4CL 2GSIB 2ZUWA 2AJSH 5A2LH 4NZTH 5I66A 5F1IA 5CD3A 3DETC 3WFHB 4M9OA 1WQVT 2MOVA 3ALPA 3UO1L 5K9OA 3AMLA 5B4MD 1E28A 4OFVA 4HK0A 3NGBB 3RY6A 1J0ZA 4KHTL 2EDKA 4Z77B 3H3PH 2EH7H 1KXTB 3L3IA 4AEIH 1ZAGA 3O11A 5IM7B 3EYOA 1F3JA 3PDOB 4ZFOB 4K3DL 4PJFA 5IW6A 1NAMH 3VFWB 3BGMA 5D1XD 5DRXA 3V4UL 3V5HA 1WCQA 3KDMA 4JHBA 4ZFFA 3T77B 3DROA 4IS6B 3IDYB 2CUIA 2D3VA 4XNQB 1KT2B 5D70L 1K2DA 4XX1G 5TDPA 4JFEB 1OTTD 4NKMB 3NCYS 2V17L 3GSRB 2DTML 4NO3B 4HFUL 1EHLH 4CVXB 5IBTL 5IB5B 4CW1B 4NSKB 1EAJA 2VZSA 3V6ZB 3B9EA 3EIFA 5I15H 3ULSA 3ISWA 4JRYA 2P5EA 3ARFB 4WJ5A 3MNZA 1QFHA 1YY8A 3HAEG 3UC0H 3A0OA 4PJCF 4LVNC 5EZLA 4LFHG 1D5IL 3R8BB 5DHXB 5J1AA 4KI5F 1KJ3L 1ZHNA 1ZVSA 3U0WH 4NN7B 3BH8A 3KR3L 4W4OC 5DJAA 1FL5B 1TXKA 4WU5A 1QSEA 4K7PH 1V7MH 4ODXB 2EYRA 2P43B 1MF2H 4ONGL 2ID5A 4MB3A 5D96B 2XXMB 4KROC 4M7JL 3P4NB 2FEDD 3PWVB 1TENA 3F7VA 1KPVA 3ARPA 2OI9B 3GZKA 3MRMA 3QDME 4EUPH 2H9GA 3E3QC 4A2LA 1FL3B 4M6ML 4E41D 5ENWA 5DJXB 1T2JA 5E2WH 2PCPB 4PJXA 2F53E 5ANMB 3QIBD 2XNAB 4ELMB 1T3FA 4FQXD 1H5BB 3ET9F 4ZS6C 4HPOL 1JZ5A 1Y0LB 4ZOBA 3SDCC 1FZOB 2XTJD 2F5AL 3V6OA 4S10A 3MC0A 4JFQA 1QRNA 2V2WB 2ITDA 4U3HA 4XMKL 3PWUB 1OVZA 2BVOA 3CDGB 3OBAA 3V9FA 5H94B 5IGXH 4QRSA 5GS2D 1ZT7B 3F65A 4Z5RA 2AKRA 3IDIB 4DK6A 1CXLA 1RZJL 2PTUA 4HFWA 3FO9A 1JK8A 3C5JB 1AE6L 2LAAA 4M93B 3OKLB 4PBXA 3KXFA 4ZFZB 3VA2C 4OUUB 4ZUUB 1N0LA 3C2SA 5GISH 4XI5D 4LP4A 5JOEA 2FD6L 1AR1C 4UU9B 4PD4K 2CDFB 1ZKAA 43CAB 3IAGC 5HDBF 4WFHE 1YMME 1EUTA 5DQ9B 3WLBB 2NY5L 1ERNA 3AS3A 1IQWH 3L7EB 5JIIA 2DLIA 4ONFH 3C6LA 4MLIA 3KYNB 4GMTH 5F1IB 1UM6H 4RQQA 5KOMC 1T5XA 1N5YH 2WBJB 4M5YL 2NTSP 1KIPB 4S1SH 2DQGL 3TBVB 2YRPA 4UIMB 1I1AA 4L8SA 4H20L 4WIQA 5L7XH 1MHEA 1JHLL 3H9SE 3O3EA 4HJ0C 4OLYH 1MFBL 4QRPA 3ZKSD 1G7MB 5EB9A 3L3IB 5C2UB 2H26B 5E6IA 2XWTA 2EDOA 1F3JB 4JCLA 5D2NB 1RZGA 3ORJA 4OZGE 4U0RC 1R3KB 2BHYA 1MCIA 3BO8A 4G43A 3KDMB 4N0FA 3C9NB 1VDGA 2J6EL 3DROB 4DVRL 3NABL 1DBJH 3PWPA 1XEDA 2VXVH 1K2DB 3VRLF 5BMFH 5TDPB 2EEDA 1EV2E 2X41A 5DXWA 3VG9B 5F7LB 4JZNB 4U1SB 3HMXL 4L5FH 1JPSH 3LY6A 5C2BL 2LFGA 2EIEA 5T5NF 1CLZL 2AJ3A 1GYAA 1MCRA 1IGFH 4JVPA 5BQ7A 3CSYB 3ULSB 1CBVL 4JRYB 2VSCA 2P5EB 4APQD 1YY8B 3QEGL 3FN9A 5JQ6H 3DV4A 1BECA 4V2BA 1D5XA 1CTOA 4WHDA 4YHNA 4MZ3A 1MIEL 2J8UB 1SEQH 2OXHA 1ZHNB 1ZVSB 3BH8B 1U3HA 2XA8L 3SPVA 3QAZB 4WU5B 1QSEB 2EE6A 4FFYL 3SE9H 2Z8SA 3FOLB 2EYRB 1TETL 5HD8C 4MVBD 3V2AR 5E4EB 3MJ9L 3RWGB 2GKIA 4P9MH 3TH2T 3OPZH 1RUKH 4JM4L 1E4XI 2RQ8A 4JZOB 2AJYL 4YHPA 3TO4B 3B2VH 1XR8A 3F7VB 4XVTL 1Q1JL 4LK4A 3DUHA 3SDXA 2VDOL 1C1EL 1NMAH 3NIGF 5BXFB 5FB8B 3E2HB 1U3YA 5M95B 2ERJC 2XZCL 3QDGE 5DEFA 4JM2A 3QG6A 4IM8A 1D9KA 1QPPA 3FONB 3DXAD 3TGXA 1NEZB 2ZKHH 4NQSB 4KV5F 3MRQA 1HCVA 2D9QB 1RUQL 1U92B 4I77H 3VWKD 4JFQB 2KBGA 1KYOK 2PYEE 3TJEH 1QBLL 4I3SL 4EEEA 5KVGL 4ZS7L 3D3VA 3BIBX 1CL7I 3VI3F 2Q3AA 1TFHA 3WUZA 3TNMB 2AKRB 1HH9B 4ZXBC 2MSPA 1IEBA 4ZTOL 1KXVC 3G5VB 4HFWB 3U4BH 3ZL4L 4J1UA 5I2IA 5EORH 2ZUQB 3BD3A 3K80A 2UUDK 1FZKA 3BWAA 1CDUA 4X4ME 3K4AA 1MJJA 2A1WL 3SGKC 1KTLB 4N8CH 1I4FA 4ZTPH 2GTWA 3WHE1 4FQPA 1V3MA 2W65B 1EEYA 3IKKA 2F8VA 1NEUA 2NCMA 3ILPB 3QWRA 4LHUA 5M94B 1AXSB 1LEIA 3MYJA 2VDNH 4ELMF 3T0AA 2BCKB 5I1KL 3QHFH 3L5WB 3LH2L 2BERA 5L8KB 3DVFA 3WYRA 1DVFD 1I1AB 3GI9L 3ARSA 4HBCH 3QUMB 1E4XL 1F6LL 5A2FA 4G8EA 4HKXA 1MHEB 2X4OA 5FM8A 4NZUH 3O3EB 1BFSA 3ILQC 4QRPB 4YHLL 3RIFF 5BZWA 2QHRL 2X1OA 2BNQA 2NLJB 3IS0X 1DQDL 3VD5A 3QDJA 1HHJA 4JREB 2F8XC 4QGTA 4BZ2L 1JI2A 3PHQA 2XFXA 1JNHB 3LS4L 1EO5A 5DO2D 4D9LL 4MDJA 3RIFK 2Y23A 4QHNA 1EH9A 2R69L 4JFHE 1S3KL 3IETA 4X8JA 5FOJA 1NBVH 3PWPB 2OQJA 3NAAH 1DZBA 5C6WH 4KUCD 3GO1L 3KS0H 1MHCA 5D1ZC 5F7WC 1QRND 4LSUL 3PV6A 1ZHKB 4K55A 4R7DA 4L4VB 5BJTA 3ZE1F 5KANG 3O41B 5ESQB 3NZ8B 4OLZL 5KVFH 4N5EC 4ACPA 2DLFH 2AJ3B 5DRNA 3AREA 5EBMB 1D5MA 3CFCH 2VAAA 1T80A 1MI5E 4PGJA 1OAXL 4NWUL 1OPGL 2OM5A 5BRZA 1VGEL 3ARBD 4YWGH 4FQQA 4I5BB 4P5TA 3MLVH 3WFZA 2C4FU 3SPVB 4IOFC 1OLLA 3DI3B 2DBLL 2NW2B 1N3NA 1U8PB 2XOTA 4KDTC 3C6LD 4P48A 5IFAH 4P2QD 1XF5A 2IAMC 2OR8A 4N0RA 4NQVB 1JWUB 4XP6H 4ZO7A 5C6TH 2QBWA 4XNYL 6CGTA 1UZ6F 4YHPB 4H0GA 2OBGA 5E8OB 5C0NC 4CJ1A 2W9DH 3QCTH 4BQ9A 2CLRB 4KMTL 4M7LH 1IAKB 3DTXA 4JM2B 2AEPH 3U9PH 5K9JL 1FYTA 3H9YA 1OP3K 3WSQH 1NJ9B 1ZSDA 2LQRA 1Q0XH 4M5ZH 2P24B 4OCXH 3F58L 3ZDYE 1BJMA 2J8UF 5MERA 2JK5B 2ADJA 2FEEI 2OL3L 4IJ3B 4S0SD 1GVIA 5CS7A 1I8KA 2P8MA 4HPYL 2V2TA 5CD5C 3OKNA 2NXYD 4X5WB 3MACH 1Z3GH 3D3VB 2JJTA 2R2BA 1BLNB 3NTCH 1HDMA 3DX9B 1EO8L 3NZHL 3MNVB 4RCAA 5IJKC 4JEGB 2Z91A 2BNUA 3VFNB 4M1GL 4NNPL 4TUJA 4J1UB 2A0LD 5I2IB 4WI2A 3KYAA 1U8NA 3BWAB 4PLKD 3V52L 4JR9L 4XNUH 1I4FB 2GTWB 3B2UC 4UINL 3MBEB 2P5WE 1EEYB 3DO7B 3LQAH 4QKXB 4RGNB 1C5CL 1TZHA 4P99A 1U3HD 4I18A 4FXGA 2XZQH 1FIEA 5K59F 2J4WL 4ZQKB 1KN4L 4LPYA 3BZ4B 1XGQB 3IJHA 3DURA 2OK0L 4HKXB 4OJFL 2VC2H 4U1LA 4G9FB 4DEPC 4GBXC 5BZWB 1IKNA 3R1GL 3HUJE 3K2UL 4RA3A 1A8JH 1KN2H 1TMCB 2VXTH 1F4YH 3PP3H 1EIBA 4JG0H 3P9MA 4HUVA 4J6RL 4JPVH 3PHQB 2XFXB 1KLUA 4RGOH 2ORBH 1D9KD 4JFDD 3GBNH 2YPLA 4MDJB 1C7SA 1CZ8H 4QHNB 2BVPA 2NY1B 2CDEA 3IETB 4X8JB 4PB9L 1QLFA 4OV5A 4GOSA 3KPOA 2OMNA 1MVUB 2M8XA 3KWWB 3PV6B 1AD9A 4NZRH 5LBSH 2XZZA 2VAJA 1YEFL 3NFNA 4NQEA 3SDAC 2PR4H 4KRPC 2QSVA 3DSFH 3QULB 5DRNB 2VLKD 3AREB 4XVUC 1MJUH 5HHOA 2XA3A 1DR9A 2DM7A 3TCLB 3WS3A 1D5MB 5MI0C 1PLGH 1QFUL 4URTB 4QRUA 5C07B 5BRZB 1IFHH 2IQ9L 3B9AA 1T22A 5IB3A 4FQQB 4YFLF 3UTPD 2VMFA 1CG9A 4P5TB 1CGXA 3PXHA 3ULUH 2DQTL 1GCFA 4J3UA 4BJLA 1IT9H 1MCPH 3RPIA 3QWRD 4LHUD 2X4TB 1XF5B 4EN3A 1S8DA 4LQ1A 5LAXB 2I25N 4K7PX 5IFJA 1K85A 3CXHK 4ZPVA 2EXYC 1MWAL 5HHPB 1BF8A 1S9XB 3EO1B 2VXQL 4WW2B 4TVPL 5JXEA 5DURB 3TN0A 2BNQD 5F7NC 5ID0A 1DL7H 1QHPA 3CX5K 4RMSA 3DTXB 3QDJD 3R8QA 1XCQB 1DBMH 5DJ0A 4HK3J 2B0SH 5HYQA 4AZ8A 5JPMA 3QFDA 4Z78A 1CDJA 1KCUL 1ZSDB 1CQKA 2DYPD 3FAWA 2QSCL 1FZJA 4G9DA 7CGTA 2ADJB 3LS5H 3VXSA 4M61A 4Z7VA 2V2TB 3MRCA 3OKNB 1OAZH 2BOBA 3G04A 5GSVB 1IC4L 2R2BB 4OLWL 2XN9B 2W0FA 4GSDL 4YFEA 1JZ2A 3CSGA 3ZLQC 3AS0A 2MQ0A 4G6JH 2Z91B 3RBGA 4JFPA 3P9LA 4P3CH 1G7HB 3QH3A 4IBLT 4S0TD 3ZMRA 3LKQA 1LO0L 4FP8L 5BO1H 5LJYH 2PXYC 1GHFL 4I0PC 5GS0L 3CVIL 3KS0J 4PJBE 3WKML 2W1NA 2VDKL 4HWEH 5DHVB 5CIPH 4R8WH 1CICC 4FTVA 3TNNB 4JM2F 3DXAE 1TZHB 4JN2B 1KCRH 4MXWL 2J5LB 5E6ZA 3CK0H 3T0EB 1Q72L 3P77B 1KLFA 2NR6C 4LLWA 4O5LH 4AJ0A 1BZ7B 4PJ8A 5EZIL 3IJHB 4LPVA 3FO0H 1KULA 3CU7A 2C3HA 3RNKA 4JVWA 3RWCA 1RIHL 4WY7L 1CDHA 4X99A 2IADA 2FL5A 3QNYB 2OZ4A 4JHWH 5JHDD 4WO4C 2GAZB 3TM6A 4X9BA 1QKZH 3P9MB 2AJXH 5GGTH 5J12B 4OFYA 4HUVB 2VUYA 2XKUA 4NQUA 4GG6E 4K71B 1KLUB 2KZWA 1FYTD 4K3JL 5FYLH 2EH8H 2BVPB 2GCYA 4GS7B 2DQCL 3MV11 1RFDH 3GIZL 3X3FL 2FX7L 4DAGL 4LLYA 2R23B 3CD4A 4LMQE 3WIIH 3SEPA 4RFOL 1FZMA 1UC6A 1UH3A 3RUGE 5MEOA 1AD9B 1NLBH 3AROA 4ZOEA 1S9VB 1CGSH 4C55A 3EOTL 4NQEB 2YR3A 3OZ9L 5HHOB 4E0RA 3TPKA 3WS3B 3TLRA 2V5SA 2ZUVA 3DVNA 3TT3H 2DQUL 2P47B 2F19H 5DK2A 4QRUB 3T2OA 1JWSA 4WTWA 4F33A 5JW4M 4P57B 1GGBL 1UENA 4FFVC 4GT7A 5IB3B 1NAKL 1CG9B 2HKFH 5IOPA 3NCJH 4OF0A 2C9AA 4QXGL 3KLDA 1QBMH 4H25A 5EC1A 5EIQA 3BHBB 1M71A 2FHBA 1ZGLB 1CLYH 1ZV5A 3KGRA 4C57C 1P9MC 3D1MC 3RU8L 1AQDA 1SYSA 3K46A 4WGVB 2Z8RA 3TVMA 4EN3B 1UWGL 1IAMA 5IFJB 1QO3B 2CLZA 3ULVH 4ZPVB 4L4TB 2BFVH 5D4QA 2Z8WC 3I75B 1UWEH 2Y7QA 1TIUA 2YOCA 2DAVA 4MHHG 3E8UH 5GRUL 4PJ9A 3Q6GL 4FRWA 4G8GA 2DS4A 3TN0B 4NFBA 5DC4B 3BD5A 4RAVA 5DTFB 3BW9A 3VW3H 4YK4B 3RAJH 3P0GB 3T4AA 3I6GB 4DQOH 3QFDB 4Z78B 1O7VA 4D0CA 3VXRA 1U8QA 3RY5A 3TPUA 5F3HA 2IPKA 1FZJB 5E2JA 3L5HA 1LE5A 2YPLD 1EPFA 4R2GC 3V0WL 1CT8A 3OWEA 2XWJA 1PD6A 4M61B 1KELH 2N4IA 3ARDA 4Z7VB 5GJTH 2NY3D 3MRCB 1BGXL 1C8PA 1DANT 4BZYA 4TPRH 4P2QE 1NLDL 1OY3B 3GMMA 4K07A 3NIDF 1WV7T 1NCAH 3BDYL 2R1WA 1HEZA 5CJXA 5JW3H 2O26U 2X4QA 1H3PL 5H35A 3B83A 5EDXA 3P9LB 1H15B 4O58H 3MGAA 1RJCA 3LKQB 5F1NA 4F58H 2AK4A 5GIRA 5ACZB 3RP1A 1FVDB 4WW2F 1QUNA 5F9OL 1FDLH 2VN7A 1AO7B 1AI1L 4BYHA 1CK0H 3SQOL 1YY9D 2GI7A 3L3GB 1T03H 1WWWX 4NC0B 3PXJA 4DTGL 2HFEA 4ZSOE 2G5BA 1CD1A 4MB4A 3O6FA 1JYNA 4JQVC 3J8F7 5IFHH 4WCYH 1G7PB 2GTZB 5EOQL 2YK1L 3C5SA 4JO1H 3RWCB 3QUML 5FCSH 2AGJL 5I19L 3MLYL 2IMNA 4X99B 4KVNL 1FFQA 3AS1A 1ORQB 3PGCA 3L5JA 3WDHA 4HG4J 2BXYA 1G84A 3CMGA 1GGCH 1S7SA 1MCBA 5T1MA 3LKSB 1KTDA 2BNRD 5L2KD 5GS3A 2YN3A 1P4IL 1CU4H 3GMRA 5DFTA 2GCYB 4RISH 5EO1A 2HH0L 3WCYA 5TQ2H 3F5WA 3K74B 4U6YB 4LVNB 4EIZC 1EFXD 2UZIH 1G9NL 3AM8C 3MV7A 3VXSD 4OM0L 2E7LC 4PJDF 1HOCA 1WWBX 2FZ3A 1IM3B 3M07A 5SWSE 2EIBA 1MLBA 2HRPH 1K3IA 3S35L 5IR1B 4ZNEA 4DVBA 2YSSA 4IDLA 5D2LE 4RIRB 1RD6A 2PW2B 5DJ2B 1UKTA 5D9SA 2N7BA 2F9BT 5DJDB 5GRVL 1FBIH 2AXFB 2VDQL 1EHXA 1JWSB 4KROB 2VDMH 3FRUB 4F33B 2JB5H 4JO4L 4WENB 3HMWH 1NCWL 5D5ME 2DD8H 2O5XH 2ADIA 5IOPB 1JPTH 4PJIE 3AC0A 1FLRL 4PRPD 1ODAA 3K7UA 5C0JB 3D2UD 1AR2A 4H25B 2H32A 3JTTB 2OR7A 5EC1B 1M71B 4YGAB 1BBDH 3AY4C 3TVMB 2VLJE 4LCWA 3EAKA 4I48A 2CLZB 1NGXA 3N1GC 1BBJA 1FCCA 3OB8A 5DS8B 1L0XA 1I1CA 4PRHE 5LVEA 3SDCB 5F7EL 4LLVA 1M4KA 3BWUC 3UTQA 5D7JA 4PJ9B 5J9PA 2OYPA 2NY4D 2O5YL 3BZFA 3JWDH 5D1QC 4MX7B 1FN4B 5GJSL 4RAVB 5KANI 5E2UL 4N1EA 3T4AB 1MWAA 1RK1A 3SJVB 1U8QB 3A67L 2YKLH 3U7AA 4LVEA 3KLAA 3EFDH 3TPUB 2LV4A 3UTPE 5BV7H 5F44A 5FA4A 1LE5B 4HUMB 3WIHH 3X11B 2YD3A 2XWJB 3KPLB 4NQDA 3NOIA 3WFCH 4PREA 5D7IE 2AI0L 5JXAL 3WDIA 2QADC 4KI5D 3GMMB 1JGVH 3WHXA 2DICA 3S36X 2NY7H 3P9WB 4WI6A 2NW3B 1HEZB 3TIDA 3MGTA 1NMCB 2X4QB 3Q3GA 5H35B 3OJDA 4IRZH 3FZUD 4O4YH 5F1NB 5HVGB 1SEBA 1BD2D 2AK4B 5GIRB 3RZCD 2W9EL 3QUYA 2XRAH 5DDHA 3LQAC 4WFGE 4WI3A 4JDTL 4BFIB 5JTWA 4ODHL 4DN3L 3D9AL 4OZIB 5EUOA 4ODUB 4L29B 2B7DT 5E94B 2GITA 1D5BA 4M1CD 3S5LG 4U0RB 1XGRB 3UAJD 1K9TA 1HQRB 3FHQA 1QSVA 3JVGA 4NQXA 2CKNA 4X98B 4LARH 3V95A 2M2DA 5HI4D 3C5SB 3QQ4A 4Z7VF 3O2DL 1XIWA 3HC4L 1L9NA 3H42L 3AU1B 5ELIA 4LIQE 4P2YA 1JF6A 2GY5A 1FG9C 1IGCH 2EKSB 3EYQC 4ISVA 3MV9D 1AFVH 1J1OL 4G8GD 2NY0D 1B4JL 1GZPB 4KJYA 5DEGA 3RVTC 1S7SB 1NCTA 1FIGL 1KTDB 3HPLA 2ZNXA 1D6VH 1K6QL 4U6XB 1OHQA 3FRPG 3SDYH 1OAYH 5EO1B 3IDGA 4E9LA 5L6YH 4BZ1L 3MV7B 4Y1AA 1A6ZB 2Y07L 3ARDD 1BAFH 1HOCB 3JSSA 5JW4R 4Z95H 1GRWA 2FZ3B 4XPFL 4OCWL 1RULH 3DPBA 1FRGH 3LQZB 5CWSA 1Z9OA 3WXVH 4M02A 4KDTA 2ILLA 3FAXA 1KIQA 4P5MA 2DQDL 2YSSB 3KPPB 4ORZC 3L9RA 5C08A 4OCYL 5E00A 1CDIA 4J4PD 5JHDE 2IANE 1XF2A 4MAYC 3VFGL 2EIZB 3HHRB 5DMJB 5IQ7H 3ULUC 4MQ7A 1HKLH 4KQ4L 4EIGB 2ADIB 4QF1A 4D8PB 1PEWA 3W2DH 3EKCA 1LNUB 3FCTB 2WUBL 4OM1H 2ERJB 1G7LA 2HA1A 3VJ6A 4F7EA 4D0BA 3WNPA 5DUPH 4XCYA 3ZKND 4OZFA 3L3HB 3L5IA 4I48B 3T2PA 1NGXB 1NCCL 3IFNH 1X5JA 5GS1A 1X6NA 3OR7A 4DW2L 4LLVB 4MJIE 1QTYT 3UTQB 5CCKL 2VABA 5D7JB 4IRSC 1BJ1J 5J9PB 5AAMA 3NN8B 1VGKB 4QWWC 5E08L 1XFPA 3BZFB 2NZ9C 3RTQD 5E5RB 3UTZA 2R0LH 4M43L 4WHCA 5CZXD 1RK1B 4XNXH 2YPVH 2ZPKL 1XF1A 3KLAB 3DUSA 5KVMC 1JUFB 4V1DB 5E7BA 4KGLA 3ZDZF 4HV8B 3NCEB 3QXDB 1F90L 4Q6IC 4NQDB 3WL9A 2WK2A 1DLHA 3B8SA 4PREB 3I2CL 5SV4A 2X10A 4RMRA 3GMNA 3ZTJH 1P1ZA 3I6LD 2OXGA 1R3IH 2VZOA 1A6AA 2BJMH 3CLEH 2MQCA 1IRAY 1FPTH 4WTZG 1YC8A 2R1XB 3NACL 3C5ZC 4OCSH 1IAIL 4Q9QH 3Q3GB 3OJDB 4M6OH 4OIIH 1K4DA 5HI3D 2N7AA 1ONQB 2OP4L 4MNQD 4YFDB 5L88H 1FVCA 3QUYB 3HE7C 2V7HA 4EI5D 4LSRL 1FORH 3HZMA 5DDHB 3HG1A 2ATKA 4KGJA 1LMKA 3REVA 3BGAA 4F7CA 1MAML 1KOAA 4G3YL 5EUOB 2H45A 2CK0L 2GITB 2NXZB 2UWEA 4KWUA 3V4PH 2XY1A 1J87A 5FGRA 4EZMA 4U3CA 1HCFX 3OAUL 4NQXB 3ZKXB 3E6FB 4NM8L 4OLXH 4PJEE 3CX2A 2QKIA 3QQ4B 3QR2A 5C0CB 4NHCH 1AGBB 2FATH 3BPLC 1I9JH 4NDMA 5D1ZB 1BEYL 4ISVB 1SM3H 4F80A 2K7PA 2C3VB 1XZ0A 5J3HC 4YEEA 2V9RA 5MENA 4K94H 4NJ9L 4S11A 3AAZB 4HHAA 5FHAL 2W9LA 2QSQA 4PBWD 4G80A 3MA7A 4N0YL 1G0DA 3CGTA 4XP4L 3RVUD 3TA3C 1FP5A 1DLFH 2EECA 4H8WL 3KJ6H 4K2UL 4TVPD 4KPHL 2X4NB 43C9A 4O2CA 4NO5A 4Y1AB 2F58H 3KHOA 1F3DJ 4OZIF 4PGDB 2NX5D 4N0UA 4X6DB 1N7MH 3RKPA 5KJRH 3SDDD 5T3ZE 1KV3A 1OQXA 3KJ4C 3HI6L 5B39B 4KZEH 1INDL 3OG6B 4HBQA 5D6DA 3MX0A 5TE6H 1BFTA 1KIQB 5A16A 2IAMB 2CQVA 2ZOLB 15C8H 1K5NA 4WV1C 1JF1A 3L9RB 4Y8DC 4OCRH 2EDXA 4TSBH 3O0RH 1CGWA 1XF2B 5CAYB 4DUXA 1PYWA 1WC7A 3UJIH 1WUNT 4MQ7B 3FL7A 5DJCA 3TV3L 2V5YA 1DBBH 1VCAA 4OGAC 5L2KE 2BNRE 4OT1H 4DKAA 4YDKH 4XMLH 3U0PB 4HGWA 5CGMA 1YEIL 2VXSL 4PUBH 2HFTA 1G7LB 3QYCA 1TZGH 4YDJA 3VJ6B 2UZXB 3ULVC 4XCYB 4CDHA 1WF5A 4L1HA 3FTGA 5GS0D 1SHMA 3MOAL 4GLRH 1GZQA 5CEZE 3ROLA 3LZFH 3N0PB 5GS1B 1E27A 4YO0A 5CLWA 5F7KC 3QCUL 3ES6A 4GJTB 4JRWA 4EUPG 5E8PB 1SMOA 2AVGA 3SKJH 5J0BA 1VFAA 3SKOA 1RSFA 4MNGB 4YXKL 4OF5A 4P2RE 4FQIH 3UTZB 2EXWD 1ES0B 1DBKH 2P4AB 1G9ML 5GGSB 1V05A 5IK3B 1ZT1A 3NH7L 1DEEB 3PNWA 3REWB 1G1YA 2ZUUA 4G7YL 2GIYA 2FJHA 3VFUB 1HILA 4PRPE 5HVHC 4F15C 2CIIA 4X83A 1YPZB 1JGLH 4H5SA 5CINL 3WL9B 3F12B 4POZC 1U8HB 1LP9A 2JJSA 3GMNB 1JNNH 4NN6B 1P1ZB 3MV8B 2I5YL 3V6FB 3EJZD 3PDDA 4Z7QE 3BQUA 3MV01 4XPAL 5GGUB 3SO3C 2Z93B 1K4DB 2A77H 4LSSL 1BIHA 2I9TA 4S1DC 5C0EA 1SVZA 4EXKA 5C08D 2V7HB 4QT5A 4LFHD 5IEKB 5F1KC 3HG1B 5FA3B 4DEPB 4GBXB 4UBDD 1QD0A 4Z76B 5ISZA 4F7CB 3BKMH 4ODSH 5LXGL 2MPAL 1NAMB 2D7TH 3FQTA 2X9XA 3WEXA 3BAEL 4X80H 1GOGA 4HCRA 5T1DH 3MLSH 1LK2B 2B1HL 4PJCE 4U33A 3NVQA 4P5KB 5DRWA 5EH1A 2ZJSH 4KI5E 2QKIB 4WRLA 3FT3A 1LDSA 3PIQA 2I27N 4LNRA 4HF5H 4ODVH 1CCZA 1CQYA 5F9WB 4PRBB 1XZ0B 5J11C 3VGAB 4WU7A 1FC2D 1JIBA 1BD2E 5TFSH 4WW1A 5CMAB 3SDAB 4O2FA 3EDKA 4G80B 5D7LB 3GUTA 3ZDXF 1MIML 1TVBA 4G6KL 5CJQH 1FAIH 4PY7A 2UUDH 5JUEH 2HYMA 2VQTA 3TZVD 4NO5B 1S78D 5KBNC 5I76B 1UQSA 3QJHA 3DIFA 2VDRL 4OF7A 5EUOF 4NYLB 4N0UB 5F96L 3KPSB 4QHKI 3I3EA 1QFWI 2AV7A 4RMVA 1QLEL 4XP9L 4JY5L 3LN9A 3KPNB 1L7IH 7FABL 5A16B 4R90L 1HQ4A 4WNQB 1B88A 1K5NB 1CFSA 1MHHA 35C8H 3U4AA 1JF1B 3QHZL 3GGWA 4MSWA 5HHVL 3DARA 1RZFH 2CK2A 4UB0H 3MV9E 3QBTB 1T1XB 3WXWH 2F74A 4X6CB 5FYJH 1NCDH 5DJCB 5LGKA 3TWCL 5CSBA 3MQIA 3QEQE 3QT2A 4JRXA 2CR6A 2V5TA 1NC4D 4HGWB 1KJ2L 4NHUB 3D0LB 2Z31D 5DC0A 3VG0H 2O5ZH 3MLPA 3O3AB 4JFZH 3ZT6A 3FTGB 1INQA 4LHJB 3VCLB 5HDBE 4XAWL 1E27B 2GK0A 1YEGH 4N5UA 3GSVA 3JWDC 5FO8A 4P4RB 5E9DA 4X6DF 2O93L 4YHKL 2ZCLL 4RMWA 3SKOB 3GRWL 4H0IA 3P11L 1J9CT 3MRIA 3T09A 2R4SH 3B6SA 2GSGA 4GG8B 4P23C 4I3GA 4OB5H 4KK9D 4CL7A 2CGRH 3VMOA 4PIRF 5MEND 1WK0A 5BV7C 4GAGL 5JHLL 5JZ7C 1ZT1B 3PNWB 4HGMA 3O3DB 3OKDA 3RGVA 1FO0A 2IG2L 1EMTH 1A3LH 2YPKA 2FJHB 1W72A 1Z9SA 2CIKA 1WZLA 1LP9B 1DCLA 2R2CA 5DQJA 5EIIA 5TDOA 1FGNH 4U6TA 1WLHA 1ZEAH 4AEHL 4UUJB 2VXUH 4RGMC 3VXMA 3I02A 4KC3B 3K3QA 4JKPL 2BHZA 3EW3B 1CDGA 2ZSWB 5J1TC 3JV4B 3VRLE 3WIFA 1CFNA 2JELL 5EU6E 4WEUD 2XQBL 4QT5B 2X4UA 5GGQL 4PD4J 1F4WL 3TYGH 4NRYB 3GK8H 3EO9L 4P59H 5TE7L 3GSXA 5ISZB 2BY0A 2PO6C 2ZG3A 4L4VD 4Y88A 3T4YA 4X6FB 3HB3D 4WO4B 2WWKT 2ED7A 2LTQB 1EERB 2OTWA 3GHBH 3FB7B 5A1AA 2KDGA 3S96B 1MFDH 2VWEC 5HY9A 1NSNL 1H8OA 2E7HA 1OP3H 2WBKA 4PGZA 1YPZF 3MMEA 2WUCH 3GJFA 3PJSA 4X7SH 3FT3B 1NUNB 1HXMA 2EYTB 4WVRA 4S1QH 2WZPD 4HXBH 3PIQB 5HXMA 1UVQB 1KG0B 4LNRB 5DD5H 1FNGA 2E7LA 3TJHC 2WP3O 1JGUH 5KVDL 3GNMH 1UCTA 4JHAL 3OL2A 2X9YA 4LSVH 4MAUL 4WU7B 5HGBA 2YZ1A 3LEXB 4BKLB 1R5WA 3BE1L 2VJXA 4Q9CA 4JFEE 1TVBB 1ZOXA 1I9RL 4NRXA 3IJYB 4PY7B 1A4JB 3AUVA 4PJAB 3RWHA 2VLRD 3NIGE 2R0ZH 4FABH 5CJOL 3GSOA 3QJFA 3DIFB 3H2WA 5BW7A 2XZAH 4C4KT 1B0WA 3MXWH 2BK8A 3OXSA 5BS0A 3ELAT 2Y9RT 3C2AH 3CVHL 2L0DA 4F8TA 2AJUL 2AV7B 2BVEA 3VD4A 2C5DC 4JZJC 1UB5A 2J88H 1HQ4B 1MFNA 4KV5E 1KC5L 4F7TA 4K7FA 2YXFA 1XGPA 3H7BA 4ODTH 2F74B 5ALBL 5FYKH 5FUCC 4MWFB 1UB6A 2H1PH 1FFNA 1MPAL 4HJGA 4XP5H 1U8LA 4YR6A 2BVYA 4FMFA 1HXYB 4JLRA 2QL1A 2EDWA 4TQEL 4LL9A 4KKCC 1AKJB 2EZ0C 2FLRT 5DD3H 5DFVC 3PL6C 2NX5E 2W91A 2GK0B 4R26H 5FYJE 1FE8L 3GSVB 4GQ9H 3IDJB 3S37X 3EDDA 4KJWC 3HTLX 5E9DB 2Y6SC 3MBED 5FO8B 1HKFA 4ZUWA 1G7IA 2ED9A 4RGND 4ELME 3L5XH 5FGBC 3MRIB 3O6KH 4L9LC 2G60H 3MODL 4OQTA 1RVFH 3EYVA 3U7YL 3KYOA 1QR4A 2EDYA 2E5EA 4K9EH 4N8VB 2IALA 1OP9A 3EZ8A 2F54A 3PHOA 1M6OA 1UZ8A 1W72B 1E6OL 1YNKL 3MRKB 2CIKB 4RSVA 4X6CF 4KMLB 4G9FD 4J3TA 2GJ6D 2QQLH 1KYOJ 4FZ8L 2I60H 1RURH 3MRRA 3UMTA 1I9IL 1ZA3B 1PAMA 3UPAA 4M6NH 5DQJB 5E1HB 2I9LB 5EIIB 1O7SA 2FX8H 4MS8C 3JTSA 4NM4H 5E5UB 4KXZI 5C0IA 1IBGL 4S1RH 3O9WA 1OP5K 5FFLA 3LV3B 1ZWIB 4IMKC 1LE9A 2KPNA 1U91B 5IW1A 2DQIL 3L1OL 3WIFB 1CFNB 2V5MA 1OTUC 2X4UB 2VITA 1AXTH 3U0TB 5HYJA 3CFBA 4FXKA 1T04B 4Y7MA 3VXTA 3ZE1E 3EUUA 3MA9L 3IU3A 1KB5L 3GSXB 4ELKA 1OGAA 3GSNA 3DYOA 2MNUA 3Q2CA 1F4AA 1X7QA 2OTWB 3O8XC 1IEAA 4JRXD 2ICWB 3ZTNH 1I7RB 1RUPH 3TBSA 5HY9B 4PLJD 5GGRB 1X5ZA 4XX1E 5KSBA 4EI6A 5KW9L 1S7QA 12E8L 4UT7L 3MMEB 1I1FB 2OR9L 3PJSB 4TSAL 5AZ2L 1LP9F 5D2NE 4IIQC 1HINH 4KQ3L 5I74B 1KTRL 1FLTX 2FJGA 1OD9A 3HZYB 4XP1H 5FHBH 5AUMA 2F5BH 4QLRA 4K94C 1NBYA 4KKLC 5F3BA 3W11C 4UDUA 5HGBB 4XWGL 3VFOB 4POYA 2X70B 1QLRA 3QPXH 1R5WB 1UZ6E 4C56B 3AFLA 4O02H 5DSCB 1FNAA 4UIKH 1YYLH 5LCVH 1JWMB 1SMAA 3QWQB 4NRXB 3RGVD 2X4PA 1YEJH 4ZAKA 3FQXA 5F7MC 1X5IA 4MAYA 3QJFB 4JFOB 2E27L 5IV2B 3OHXA 3KPRB 3OXSB 4U1HB 3ZZ1A 5BS0B 1P2CB 4PRID 2P5EE 5C0AD 3C8DA 4G42A 4DCQB 3HI1A 1T1WA 5EBLB 1UB5B 5D7KE 3QEHA 3VD3A 3ZYZA 1CE1H 2DBJA 2J8UE 4NKDB 3UZEA 2Z92A 4K7FB 4F7TB 4OI9A 2VDPH 4P2CG 4LSTL 4LASL 4I2XB 2CO6B 1WVZA 3EFFA 1XGPB 3FN0H 4MA1C 2IFFH 5D1XC 1TJGL 4ODBD 3KPMA 1UKQA 3RVWC 2HWZL 1DQLH 3RL2B 4QHUA 4X9HA 5GRJL 1HZHH 5E99L 4OKDA 4WWID 1UB6B 4NWTH 5IWLA 4MDIB 1I1YA 4HJGB 1IC5H 2XN9D 3ARTA 5D1QB 1RPQA 4NPYA 4OD1H 2Z35B 4JLRB 3FFCA 5F9DC 4WFFD 1FQ9C 1P5VA 1A3RH 1G6RA 4OCLC 1CLOL 4MJ5B 4BUHA 4P2OC 3WO3B 3S4SG 3B3IA 3U46A 3B5GA 5DK3A 4MB5A 1CD8A 1AGFA 4E42A 4TOYH 4KK8D 4NP4H 4PJAF 2XG4A 3O2VH 3R0NA 3MOQA 4IRJC 4G8IB 3VRIA 5HHQA 3T3PF 3W0WA 4TRPL 1I7UA 4EJ1C 4LOUC 5LGHL 1P4BL 2YEZA 4ZUWB 1G7IB 3QUXC 2QADB 1A2YA 1KFAL 2FWOA 5K59E 5HHXL 1LDPH 3VXPB 3MREA 5HYSG 2HKHH 3K81A 4OGXH 3I6KA 5TF1L 2VH5L 3ARXA 1Y6NR 3KYOB 4OSUL 3V6OE 1O5DT 4JFYA 3CCHA 3UJJH 4XPTH 4UMGA 4XAKD 5FUZH 3PWNA 2FX9L 3K4ZA 3LB6C 1WFOA 4HT1L 3BMVA 5L8JB 2DF3A 3BFOA 3GRWA 3CC5A 1J11A 2DM2A 5HVFB 1VFOA 5AG8A 5MEPB 4CMHC 3MRRB 4U7KA 2DI9A 2V9QA 4UOW1 4PJ5B 1A7PH 5I6XC 3LPFA 1N2RB 4RZCB 5T1KB 3JTSB 3MPCA 1WBZA 3QXVA 5C0IB 4Y4HD 4NZTL 1L6XA 1B4RA 1X6LA 1DN0A 3JV6B 4EDWH 1TZIA 1TITA 3D39A 5EOTA 3QXUA 1FVEB 5C3TA 3BSZH 5HYJB 5C0DA 3CFBB 4WWKC 1DQTA 2Q8AH 3QIBC 1CYGA 2E9JA 4NQCB 3VXTB 3IU3B 3H3PL 2EH7L 3DWTA 4L3EA 1OM3L 4LBEB 4U1KA 5HHNA 4AEIL 2XTJC 2R0WH 1OGAB 3GSNB 1MEXH 4KHTH 1X7QB 5GGTA 3RVXD 2MWCA 3RWFA 4F2MA 1BOYA 1MFCH 5T3XE 4NNYB 4EI6B 1A9EA 1Q0YH 2X09A 1I7ZB 4GXUN 3CDYA 4LF3B 5H8DA 5ITFA 4KTEL 3O3BB 2EEAA 4B0MM 3E6HB 2LU7A 4PJGB 3TEUA 3I9GH 1XF4B 2FJGB 5DMIH 5AUMB 3ARFC 4XI5C 5D70H 4AEFA 4D9RD 4ENED 4J3WA 1EHLL 4PG2A 4Q2ZA 4MD5A 4UDUB 4KRNA 4TNVF 5AZEL 4R4NC 2A74A 3PWPE 3EOYG 5I15L 1O0VA 5MEQA 1K8DA 3BIAX 1IAOA 4W68A 5DVKA 1DBAL 3JWNC 4L4TD 2F54D 3UC0L 4L4VE 3QO0A 3C60A 1RAMA 3DBXA 3FQXB 4PYGA 4MAYB 2MCPL 4GKZA 4FNLH 4TNVK 2CKBA 4ETQA 4UTAH 3OHXB 3U0WL 5D96C 1D5IH 3BP5A 1AH1A 5CLTA 4YDVA 3WNNA 4PTTB 1V7ML 5IT2H 1N8ZA 4Y4FA 4G8FA 4HWBA 4QHLA 2NY2D 3IFLH 3KR3H 4B41A 2O61B 3O9WD 4ZYKA 1TLKA 2EIDA 5D8JH 3TBTA 1IGYA 2H2SC 4HMEA 3KPMB 3OKKA 4QHUB 1FV1B 3CVHA 4Y2DA 3T8XA 1X5GA 4IRSB 1H5BC 2R4RH 4HQQH 1J1XH 1I1YB 4M7JH 5CP7A 2V2XB 1HWGB 1RUML 1SY6L 4NPYB 5HYSB 1MCFA 5FK9A 1G6RB 3DMMA 4TUOA 5KG9A 3CUPA 4JFXA 5E2WL 3CH1A 3G6JA 5GHWH 1OAKH 3OXRA 3RGHA 4E42B 2DM3A 3DETD 1RJZA 3QEUA 4GAJH 1ZLSH 3VRIB 2EO9A 5GRZA 3W0WB 2C3WA 1KB9K 3HRZA 2Y5TA 5TE4H 1OGTB 4UT6H 3VFMA 1F8TH 1I85C 4Q6IB 1LK3H 1AO7D 1NFDA 1RJYA 1WBYB 1A2YB 2APXA 2A6JB 4AEEA 5IGXL 1QYGL 3CX5J 3U30C 2QSTA 3TBWA 3ARGA 1X44A 3MJGX 1CFBA 4Z7WB 3CCHB 5HGHA 4TTGA 4JO3L 3TC9A 1NCUA 5F7DB 3ZT5A 3HE7B 1NBZA 4R0LA 4XCFH 2RAMA 5HGAA 4YIQA 1MJ8H 4FQJL 3Q6FA 1J12A 4Y16A 3EYFA 3QXWA 2VZUA 1IQWL 4HIIA 2KQMA 3RY6C 5I16A 2VYRE 1UM6L 4XC1L 5IVZA 2HG5B 1N5YL 1DN0B 3QI9A 3H0TA 2E3VA 2MTPA 4S1SL 1TZIB 3PHSA 4P46D 2Y1VA 1NANI 5EOTB 1FL6B 1NMBH 3TCXA 4RGNE 1YUHA 4M5YH 5FDYA 5C0DB 5L7XL 3QIUA 3BPLB 5FO9A 4OLYL 3LCYA 2DWEA 3SBWA 3S5LA 3MCLH 1X5AA 4LLAA 3W9EA 4X6BA 4G9FE 3SGDI 3RJDA 3TFKC 2X89A 4X5LA 4Y4KA 3CJJA 4Y5XA 4KROD 1ZLWK 3TA3B 5C9JB 1DBJL 3RDTA 3MJ8A 2MHAA 2VXVL 3O6LH 5BMFL 3IDXH 4BH8B 4Y5YA 3SE4A 1EZVY 3NABH 5E8EB 3TIEA 1ZHBB 4L5FL 3BEVB 1JPSL 2GYSA 3EOBB 5EOCH 1E4JA 4Q2ZB 3BP7A 4MD5B 2A74B 1GIGH 3MRNA 4PGBA 5MEQB 1IGFL 1K8DB 3FRPA 4L8BA 4WV1B 2DM4A 3QAZC 4ZS6D 2PNDA 4LPWA 5J1SC 1HI6A 3SDCD 1PG7W 5JQ6L 2QEJA 4WFED 3C60B 1SJHA 3T1FB 2HLFC 1SEQL 3QEGH 4GKZB 2E7BA 4GRWB 4MNHA 3ZSSA 3W5NA 4YDVB 2ZSVA 3QUZA 1WT5A 3SE9L 4BH7A 5C07E 4Y4FB 2GUOA 1DUYA 3DVIA 1S7XA 2BY2A 1MRFH 4P9ML 1OSPH 1RUKL 3OPZL 1P4LA 3PP3K 3TBTB 1J0IA 5GRYA 1FFPB 1MAKA 4PJGF 1U0QA 4JM4H 1AR1D 3NIDE 3QQ3A 2P45B 1RMFH 4Y2DB 1T20A 3LOWA 1LD9B 4XNMA 3BPOC 4LVHC 2P44B 3CZFB 2F53A 1YECH 1M7DA 4L3ED 3PWJA 2H3NB 4TUOB 3CIQA 3WUWG 1YDPB 3HZKA 1H3UA 3MRPA 4JFXB 3G6JB 4CU6A 1OT2A 4QTHB 2ESVB 1UKSA 4K8RH 2Z8VC 3QEUB 2ZKHL 3P4LA 3W39A 3HRZB 1B0RB 1QQDA 3VFMB 4I77L 2X44D 5C0GB 2DQJL 1KCLA 3GHEH 3TJEL 3BVNA 1CXEA 2J12B 2E8ZA 3CFKB 1TJHH 3TBWB 5L2JA 4I3SH 4K9EC 4U1JA 3IS1X 1HHIB 4AQOA 1ZA6B