5A2JH

Crystal structure of scfv-sm3 in complex with the naked peptide apdtrp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
244
structure length
225
Chain Sequence
QVQLQESGGGLVQPGGSMKLSCVASGFTFSNYWMNWVRQSPEKGLEWVAEIRLKSNNYATHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCTGVGQFAYWGQGTTVTVSIVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SCFV-SM3
publication title Deciphering the Non-Equivalence of Serine and Threonine O-Glycosylation Points: Implications for Molecular Recognition of the Tn Antigen by an Anti-Muc1 Antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Peptide binding protein
total genus 56
structure length 225
sequence length 244
ec nomenclature
pdb deposition date 2015-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5a2jH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5a2jH01
1INDL 4Q6YA 3D25B 1F42A 4QKXB 3TEUA 3HR5A 3SDXF 1CICD 3QEHB 4AMKH 5DD6A 2OL3H 4PJDE 1QFUH 2XRAL 2D2OA 3MJ7B 5I1DB 4KXZI 4GRWH 4NP4L 2ZJSH 4WDIA 5KS9F 1CLYH 5HHOD 3NCJH 4C4KT 5KG9A 1R3LB 4PRIB 2GFBA 3G5YA 5J57B 3GRWH 1XF5A 2ZOLA 3RDTC 5JW4Q 4MAYD 5IG7A 2F19H 5KSBB 3CH1A 1U8LB 4YK4C 3ECBB 4NO0D 2NW3B 4XVTL 2XTJE 2F8VA 4JFED 1QFHA 1CXIA 5LWYL 1PQZB 1YY8B 3UP1A 3QRGH 5F70A 3ZTNL 2G75A 2NY4D 4U1JA 3LOWA 2JJSA 3ARBD 3DYMA 3MRNB 3QNZA 3TV3H 3MNWA 1T1YA 3EOBB 1FAKT 3CSYB 4NQED 5MERB 2UVEA 5T33L 4ODHH 1IGIL 4PUBH 4N9GA 4X5XA 3IDIA 4YO0A 4MVBC 1KB9K 2CR6A 2R8SL 3FO0L 2P44B 4OZFB 4P9HL 4R3SB 2DQJH 3OGCB 1OGAD 2IAND 5DRNA 3VXTA 1R3JB 5FYKE 1U8IA 3JUZA 4XBPB 3KXFA 3HRPA 5L9DH 4Z5RB 1HQRA 4J2XA 3TYFB 1DLHB 3C6LD 3UDWC 3H3KA 4NRZB 5C07E 1J8HD 3BPOB 4Y88A 4TPRH 1IAOA 5HVFB 1ZT7A 4Y5VB 2DI8A 3I9GH 1CL7L 1U92B 1KCVL 3F58L 4JPWL 4KV5E 5TF0A 1PLGL 4M6AA 1JFQL 4QNPE 3RWDB 1YNLH 1EH9A 1WCQA 4G6JL 4YDJA 4I4WB 2VWEE 2X4SA 5FUOH 3SBWC 2AJ3B 4ZSOA 3E2HC 1ND0B 2FH6A 4LMQI 3T0EA 3D69A 2HN7B 1OM3L 1I4FA 4TNVK 3NH7L 1U8JA 5CCKH 4ZDHB 3LIZL 4CUCA 5HDLA 2GJJA 2O5YL 1F4XL 3D87B 3DVIA 5GGVL 4IMLA 1NEUA 5D2LF 4WV1C 1MLCA 4YPJA 4NBZB 2OTWB 4WY7H 5HHPB 2IMMA 2ATPB 4ETQA 5EOCL 4DUWA 2A6IB 3F7RA 4NCC1 4LVNC 4AEFA 1RZIA 4PJBE 2P5WA 1ZS8B 5I18H 1IRAY 2F53A 4DTGL 4M7LT 1X3DA 4EI5C 1T6VN 3MJ8A 4ODSL 4JFFE 4PJCE 5F3HB 2GIYA 4LSUL 4UDUB 5DHVB 4P5MA 2XKNA 4O58L 3G6AA 3RVVD 4QEGA 2CUHA 2EEDA 4KI5C 1MREH 1KN4L 4YEFA 3WKMH 4GXVH 1JZ4A 4HUVB 5MENB 4AIZA 3QJFA 4NOBA 3X14A 2X70B 3NAAL 1RK0B 2XWTA 4JQIL 5KVGH 2C1OA 5F1KC 3U4BL 2EIBA 3N85H 1KT2A 3B4NA 4OZFH 5JO5A 2EDHA 3V95A 4QHLB 4WW2B 3ZMRA 1DN0B 1YMMD 1I7RA 4JR9L 2R2HB 5JW4R 4IRJD 2JIXA 1E6OL 3DURB 2O61A 1CBVL 1MI5E 4YHNB 1JWUA 3HZKB 1IGFH 2XQBH 1D5MA 3QXDB 1Q0YH 1CXHA 3GFUA 1E4KA 1ETZB 1NFKA 1HINH 3QDJA 3OHXB 1FO0B 1OARH 4X9GA 3REWB 2HVKB 5EU6A 4Z77A 3DXAE 2MQ0A 3MRGA 4L9LB 5EOQL 2WP3O 5FA4A 1ED3B 4YFEA 3R8BB 3MROB 1LE9A 4Z7WB 1YN6A 4L3AA 4UT9L 5IB1B 4UB0H 3ZKNC 2CUIA 4C56E 4X7TB 1QFPA 4EUPG 1RZFH 3UJTL 4HUNB 1MFCH 2X5PA 2D03H 1A7QL 1BD2E 4LLQB 1ZAGA 5SV3A 4ODVL 1UCBH 4JY4B 5GRYA 4JPIA 1MWAA 1QYGL 1W0YT 5CD5C 5EWIH 3ARED 2YA0A 5JOPD 5DR5L 4L9DA 1CG9B 1D6EB 4Y4FA 4ZFFA 4MHHG 1UH2A 5D1XB 5CEYA 4WI4A 1XF3A 2XV6B 1MHPL 4JM4H 1KB5A 1G84A 1NFDA 3CLFL 3VFSB 5HY9B 4OZHF 1I7ZB 1V3LA 2X7LA 1SJHB 3DSNA 3SGDH 1LNUB 4KQ3L 3MCKB 1U95A 3VFOB 4OLWH 4YHLL 3PQYB 5DHVH 4JRYB 1D5ZB 5DJCB 2AJYH 4HKXA 3D39B 2GJ6A 4QRTB 3Q3GA 4NSKA 4P57B 4QHUA 3NCCB 4UDTB 1V5JA 1IFHH 3JWOH 1N5YH 3GI9L 1JN6A 4GG6F 4FRWA 3VXPA 2E7MA 2VLLB 4P46B 3D18B 3LRHA 2VLRD 1JP5A 3S37H 3QXWA 3S34H 1MCNA 1CFSB 3IFNH 3MYZA 5I30L 3GB7B 2BOCB 5EA0H 1R24B 1T0NB 2GK0B 2H2SD 3QWOB 5FO7A 3RY6C 4P23B 1RUQL 3E1F1 3FN0L 4W6YB 4O2CA 3D85A 2YZ8A 4XPHH 5D71H 3SKOA 3GSRA 3KPLB 4O9HL 3DGGB 1QVOB 2OTUA 3MO1B 4OIIH 5GGRY 4YXHH 2DLTA 4NKQB 4L4TD 3U4EA 1FO0H 4JG0L 4IRSB 1WCBA 5BO1H 5C8JA 4RBPH 5KSUA 1JPSL 2APTA 1ZT4A 3EYFB 2YXMA 4WUUB 3FMGH 2GQHA 3ULUC 1YEGL 4I0CC 2VZOA 4X4MA 5KSVA 3LKSB 3MJ6A 4PBVC 4PG9B 5I17A 3TO4C 2IH3A 3BJLA 3O9WC 4HEME 3SGJA 4WWID 1AGCA 5SWZB 1AY1L 3MUJA 4KTEL 2Z4QB 4MD5A 4FZEH 4WFHD 3CUPB 1Z9SA 3RDTD 5IVOA 5K9OA 3NA9H 2OZ4L 3W5MA 4XWOC 1BZ7B 1HKLL 3MREA 1EEUA 1S9WA 4FP8L 3JSSA 1IAMA 4E41D 4JO3H 4CJ1A 1BVLB 2H1PH 4HAGA 3QUMB 1L7IL 4Y19A 1T66C 5DRWB 4E5XA 1NL0L 5I1JH 3VD4A 3MYJA 4XNUL 3ZKSD 3TA3A 4YAQA 3LB6C 5ERWA 5IVXA 3MV7A 4ZAKA 2IQ9H 5HYJD 1G7IB 3D3VB 2EDLA 4PRHB 1VSCA 3MTRA 5TE6L 3EJYC 4OV5B 4PJ8C 4KJQC 4Z7VF 3QO1B 5GISH 1NUGA 1HZHL 4M03A 5EO0A 4DAGL 4LLWB 3B5GA 4EN3A 1TENA 3D9AL 2PN5A 2MHAA 1RZGA 2AKRA 4B53A 4DCQA 2NNAB 4M93B 5DVOA 4Z95H 4N0YL 5I8KH 4POZC 1SM3H 3IDYB 1SY6L 3VA2C 4WENB 3FOMB 2Y5EA 5C0CA 4H88L 2DB8A 3TPUA 4CL7A 2ILLA 1NLDH 5ACZB 1FLRL 4K8RL 4M6NH 3WJLA 2EO9A 2A9MH 4MYWB 2YWYA 1ZMYA 4H5SB 4AEIH 2GI7A 3C8DA 3L1OH 5FM8A 3MXWH 1S7UA 3OKDB 2GCYA 5C0BE 3BEVA 4LRNL 3TBSA 2UZIH 1I9JL 3VMOA 5TQ0L 5IB2A 3FHAA 4XMLH 1I7TA 1QTYT 1NUNB 3VFNA 5DRZB 4YUEL 3DX7A 4ODTH 5DD3L 4AT6B 1TQBB 2GSGA 4EI6A 4QXGL 5JW5A 4ZOEA 4QXUH 3F7YB 2V17L 2GW5A 3CMOL 2HT2C 4HUUB 1I8KB 3BHBB 3F12A 2WSKA 4U6VL 4NO5B 4OIBA 3L6FA 1RUKH 3VCLA 4EBQL 2XFXA 2EO1A 4EEEA 3FQUB 1NCUA 1KFAH 4XXCA 5HGHB 3O3AB 1Z9LA 1MIMH 2BVYA 5DMIH 2DKUA 2WWMC 4JY5L 2IAMA 5DUMH 2NY5H 2XXMB 2VISA 1KTKE 3FRPG 5C6WH 5TDPB 3MJGX 4N9OB 2W9LA 1LK3H 1NGZA 1DN2A 3GSUA 4OZGF 5IMLB 4EI5D 2D3VA 3G6JB 4P2RB 1JNHA 2ITCB 1FZJB 5LBSL 3ZDYE 3WIHA 3OF6D 3PXJA 1S8DB 4KI5D 3HG1D 3RRQA 3QQ9C 1OAXH 5C08A 2BSSB 1WEJL 3L5XH 5J12B 1WIOA 3RUGE 1FH5L 4WO4A 4I9WD 5CGTA 4LSRH 1SYSA 2HRLA 3MRRB 3T0VA 1ZHBB 3CH8A 3WHE1 4CMMB 3BGFB 4WU5B 4UTBH 3EGSB 2DDQH 4W4NA 4UAOB 4KJYB 4WTZG 5HHQA 4HS8H 3TIEB 4XBEH 4Y5VC 4G7YL 1BFOB 1T04A 1LP9E 1EGJA 1N3NA 1I1YA 3PGDA 5HI3C 1PSKH 5FK9A 3BRFA 1HOCA 3IRPX 1VCAA 5AYUH 1AGFB 5LJYH 4FQHB 5SWSE 5GGSY 5HHME 2P5EA 4MNQA 3HFMH 4F8QA 4MJIA 3I6GA 3X3FL 5TDOA 1F8TL 4LL9A 3CVHL 4ZPVB 1BLNB 1MUJA 1QEWA 1I3VA 1FGNH 3PNWB 1MEXL 4K23H 5FYJH 5C7XH 1LEKB 1VEMA 2AK4E 3KPQA 1XH3A 1UGNA 1KCUH 4HS3A 2EZ0C 4MXQC 4FXGB 4I3SL 3ZKND 1ZHKB 3C8KA 5IHZA 2OR9H 4ZPTB 3WDHA 3RAJL 3OR7B 4FABL 1UFUA 3JV0A 5KOMC 1KB9J 4WEBL 4LLMB 4HUWA 3VFVA 3RWJA 4RRPA 4RGNE 5CD5D 4FQPA 3TT3L 4LLYB 4GW1B 4OFDA 1J18A 5I1AB 1X5ZA 5AZEL 1EHLH 3F62A 4QHNB 1TZIB 3JV5A 3R0NA 3B2UC 5HHNB 4XPGH 2VDMH 1BREA 3CFKA 3HE6B 3MUGB 4LCWB 1C08A 1R3KB 4PGJA 5JDSB 3O2VH 4BZ2L 1U8QA 4LP4A 5B39A 3KYOB 2F54A 5FOBB 4MCZB 2Y5TA 4G8GD 4JE4B 4LASL 3CZFA 2W9EL 4M8QB 4NQCE 4CGTA 1QSFA 1IAKB 3U1SL 1QRND 4E42A 5L7XL 1FG2B 1WZLA 2E9JA 4BKLA 3WV0A 1FIGL 2BSRB 3WN5B 1U3HB 3QIBC 4XT1C 1FNGA 3BXNB 3VFWB 3MLSH 1DQTA 3KPOA 4KPHL 1BQSA 2Y4SA 2AP2A 2HFEA 4WW2C 3QCTL 3SOBH 3C6SA 3ZHLA 2VL5B 3QUXA 5C07B 2E9WA 2JCCA 3NACL 3FAWA 3CZJA 4XCCH 4LVOB 1YECH 1FDLL 2EH7L 5I71B 1UC6A 5I1KL 5DJ2B 2VLJA 4CADA 1INEH 2O93L 1KV3A 3PWNA 1IQWH 2ZCHH 1OOAA 3BT2L 3CX5K 4M48H 2BZDA 4QOKA 2QHRL 5DK3A 4RGOL 4V2CB 1DCLA 5EZOH 3VH8A 1IT9L 1G6RA 1JHLL 3L3HB 3JXAA 5ESQA 1DBKL 4FMFA 1NJ9A 2JE8A 5L2KD 5FYLH 3QI9D 4XP4H 1AO7A 4PB9H 4Y16B 5CZXC 1J05A 2BC4B 5KZCD 2HFGL 2JTDA 3BRGC 3MGOB 1G7HA 5ELIA 4LMQE 4ELMB 4NQUA 3TO4D 4QRUB 5KVEL 2EKJA 3LQMA 3HR5B 1ZXQA 3V2AR 5C0NC 1I1FA 2ZNWA 3L7FA 4X9FA 5FHBH 1F3JB 3THMH 4P2OD 4FFYH 1WISA 5D1XC 2O5XL 1DTUA 4OLEA 4PJBB 3G5YB 5DQ9A 1LVEA 2ZOLB 4JDTL 4LSSH 3WNOA 1GGYA 2NZ9C 5IG7B 3QNYB 3OAYK 4JFFB 1XT5A 5F8RC 4HWEH 1IC1A 3CH1B 4RQQB 1T1XB 3ROOB 1NC4D 3MRKA 5C86A 2ZUUA 4XPAH 3UMTA 3RI5K 1QBML 1Q1JH 1VGEH 3LB6D 3G08A 5DVKA 4K2UH 1AIFA 3QUZB 4M7ZC 3VWJA 5C09E 1K8DA 5TE7L 3GBMH 2EYRA 4R96B 4CAGA 2H26B 2HTKD 3QNZB 4PJ8D 4KJQD 1LK2A 3MNWB 1T1YB 4YHIA 4BK5A 2NY1B 5HXMA 2AJXL 4M62H 1JVKA 5EO9A 4RAVA 4OT1L 1X5IA 5C92A 1ZKAA 4P46C 1J1XH 5KSAB 4PGCA 3IDIB 5GIRB 5GGTA 4V2BA 5GS0D 1RUML 2AEQL 5CJQH 3B8SA 3IB4A 3VI4F 4POZD 3VMNA 1QO3A 1GGBL 1YQVH 1RZ7L 5EUKA 2E27L 2FZ3A 3UBXG 1U8IB 2R1WA 2M1KA 1P84K 3KXFB 1ZVSA 1HQRB 1NMAH 4P23C 5ISZA 2CIIB 3V4UL 4A2MA 2M2DA 2SEBA 2UUDK 5E9DA 3S88H 1ZT7B 3DXAB 1NCDH 4U05A 3S96A 3HMXH 5ANME 3OAUH 3P9LA 2B1HL 4CNIB 4PJHA 4IRSC 3V8CA 1WFOA 4PTTA 4C56B 3LRGA 3AY4C 3ULSB 1NCCH 1T1ZB 3U0WH 1OP3H 1BD2B 4YDJB 4QOKE 1VFOA 4YPGA 4PB0H 2X4SB 2BJMH 5DC4B 3BH8A 5EZLA 3DVGA 4ZSOB 1G7QB 5BS0E 4HFUL 3T0EB 1AD9A 3D69B 4UBDC 4ZD3H 2HT2D 3NZHH 2BK8A 4D9QD 1U8JB 1EFQA 4RWYL 4Z7UF 3SDDA 1JPTH 1MRCL 4NOFA 2F58H 3EUUA 5EZIL 1G0DA 1REIA 4X4XA 2NY5C 2LFGA 1NAML 3F5WA 3TESA 3DX8A 4NN7C 3ZDZF 4IMLB 1JGUL 3TBTA 3IVKA 1MLCB 2LU3A 3OXRB 4DKEH 4OLVH 3SKNB 2ZSWB 1EXUA 4ETQB 5L2JA 1WAAA 5F7DA 5F7EH 1T4KA 1Z5LA 4KUCD 5IESL 2I9TA 3P2TA 4PRDA 3OKOB 5D1QA 4G43B 1V7MH 2EDDA 5HJ3A 3F7PC 3VFRB 2EYTA 1U58B 5E8PA 5HPMB 1NFIA 4I0PA 3QQ9D 1T21A 3QEGL 2CDEA 3HC3H 2FO1A 2G2RA 3B5HA 1XR9A 1S7TB 3ARGA 5DVNA 4HMDA 3DLQR 2DWEA 2VXQH 1G9NL 4YHYB 1TVDA 4K3DH 5HYSG 3DUUA 5SX5K 4AIZB 3QJFB 2CJUL 2FHCA 1L6XA 3F7VB 5ETUA 4OKVB 2ORBL 2XWTB 2C1OB 3IDYC 1ZTXH 5I1IH 5DUBB 1YDPA 1PG7L 5EUOE 5JO5B 1RIUH 5HI3D 1PX4A 1JZ8A 3NFPA 3CFCH 2C5DC 5FA3A 1I7RB 1GGUA 5FEBA 1CI5A 4PV9A 2JIXB 3DRTA 2O61B 1TJHL 1S5HA 4PRPA 1KTLA 2BRRL 4MMXC 3IKCA 3GSNL 1D5MB 1AC6A 1FNFA 5I74B 2Y06L 3C5JA 2EZ0D 4MXQD 3QXAB 1AJ7H 4RMUA 3BN9D 5EU6B 1GZQA 1U8PA 4Z77B 3MRGB 3LS4H 2Z31A 1TQBC 1FQ9C 5D7JD 1QNZH 4MGXA 4M7LL 4GMTH 4XPBL 4GS7B 3W2DL 4MA8L 4NHUB 3S5LG 4QRPA 3UJIL 4QO1A 5GS2H 4O02L 3S4SA 1MCBA 3B2UD 1S7RA 5T5FH 2VUYA 4S1SH 1CGVA 1AKJA 5J9PB 2FX7L 3FRUA 4Q6IC 4D0DB 4Y4FB 1ZANH 1MJ7L 4ZYKA 4M8VA 1XF3B 3SDXA 5MEPB 5IWLA 1XFPA 1XGUA 4OM0L 1NFDB 5IF0A 3KPSA 4TSAH 1A6UL 2X7LB 5BZDB 5KS9A 4XCYB 5MEND 2WUBH 5GRVL 1CF8H 4D9LH 4GAGL 3QIBD 3NMEA 3E6HA 1H3UA 1EBAA 3I50L 4N90D 2VQ1B 5JUEH 2QQNL 2X9WA 3MRPA 3RTQA 3O4LD 4HKXB 3Q3GB 2W91A 4NSKB 4ZTPH 2R0ZH 3UJJH 3RPIB 3EDKA 1JN6B 2AJUH 2W59A 2QSVA 3GJFK 3VXPB 4XVJH 5T1DH 3RVXC 2IBGA 4S10A 2PXYB 1U8MB 1W8OA 2VZTA 2ZUQB 5D8JH 2FBJL 1HDMA 4RGMB 5AAMA 3EFDH 3LKOA 4NFCA 1RURH 4TULH 2IFGA 4HH8A 3P77B 1CWVA 5ESAA 5FO7B 4OLZH 5C0BB 3RL1B 3LH2H 4F58H 5IMOB 2VDLL 5B3JE 4O51A 4ONFH 1MFDH 2DM7A 4NRYB 4L4VD 1RJLA 3K4AA 4LSVH 3SKOB 1AGEA 3P30L 3OJDA 5CZXD 4JY6A 3UCRA 5I16A 2ESVA 1GL4B 3A6CH 1A7OH 3U4EB 2ZKHL 4G6AD 1WCBB 4XPFH 4APQA 1BJ1J 3C2AH 5KSUB 3F65A 1ZT4B 4XTRC 5TJWK 5KVDL 5C0ND 1UKSA 5ABDE 3HPJA 5K9JL 3CXHK 5KSVB 5I17B 4S1QH 4XP1H 2IH3B 1IM3B 5D1XD 2XTJC 4HK0A 1A4KB 3HE6C 2YMXL 1JZ7A 4O4YL 1Z3GL 4PJGE 5KVFL 2IF7A 2IFFL 1MWAH 2NY6B 3BUTA 2NZ9D 5K9OB 3VGBA 1AR1D 5BOPA 1HHGA 2DQHL 4KWUA 4S1RL 1G9EA 1T0PB 5DHXB 4HLJA 3CFJB 3W39A 3QG7L 4ODUB 4YIQA 3PQYD 2EDTA 2EH8L 1KB5H 4JRYD 4E5XB 3GK8L 5JXEA 4EUPB 4XCFL 3DRQA 3RUGB 2RJMA 4AIOA 3R0MA 5B8CC 3EYSH 3MYJB 1U3HC 3IAQA 3C5SA 5D2LA 4WCYH 4YAQB 4F2MA 1MPAH 4TOYL 4UT7L 3WXVL 3ZTJH 4MQ7A 5IVXB 5CMAB 4ZAKB 5EBLA 1FC1A 4DW2H 6FABH 4HXBL 3B9AA 4P46D 4JHWL 3NABH 1KELH 4RDQG 5E6ZA 1QKZH 1VA9A 1MCPH 4FQIL 2YKLL 1LP9B 4LVOC 3MRBA 1BOGA 3ARSA 3ROLA 5DMKB 2DQFB 1IC7L 5I71C 5HDQH 5KTEH 3V79C 1FL5A 1LDPH 5SWSB 1FVDA 3PDOA 5HHMB 4FQLH 1HHJA 4B0MM 4DCQB 4HUMB 2FWOB 4P23D 1DUYB 4N1CA 5E8DL 4U2YA 1TVHB 1QLEH 3A6BL 4QHMA 2VWEC 4HUKB 4NJ9L 5C0CB 4IRSD 3S9DB 3TPUB 2UVFA 3K4ZA 3AM8A 4NQSA 1C5BH 4YBHA 4NM8H 4Y16C 1S7QB 1KJ2L 5B22A 4EQ3A 3UPCA 1S7UB 2VZ1A 1LO4L 1FL3A 3KS0H 5CKAA 3C5ZA 3BEVB 3SDAD 3T65A 1HCFX 2DYPD 4IDLA 5IB2B 4AMKL 1I7TB 5SWZD 3O11B 2OL3L 3OPZH 3PHQB 5FGBC 2CKBL 1UKTA 3HUJE 4CN6A 2GSGB 1CLZH 4TN9A 5JW5B 1CLYL 3ULUL 3H7BA 3NCJL 1FP5A 4HLZH 1FCGA 1TJIL 3F12B 3TT1H 1MLBA 3GRWL 2DLIA 3LV3B 5CP7A 3VCLB 2XFXB 5INDB 4Z6AT 1F4YL 4LHUA 5TF1H 1F45A 1HI6A 2X4RA 3CX5J 3BI9X 4HJGB 2VISB 3GM0A 1MNUL 4YHPA 5J3HC 3QUZC 2ADGA 3D0VA 1NGZB 3U46A 3D3VD 3GSUB 4Y4HA 5ID0A 5D72H 3S6CA 1JNHB 4JZOA 4HZLB 1JGLL 3TV3L 2NY1C 3GBNL 2UYLB 4LU5H 5FB8A 4ODHL 5KSAC 1I7UB 3RIFF 2Q8AH 3TBWB 2EEBA 2HJFA 3QG6B 4WO4B 1X44A 4FXKA 2YRPA 4KROB 4JFZH 1SYSB 5IOPA 1DE4B 4CVXA 3MC0A 1LDSA 1TQCB 5E8OA 5HHQB 3H6JA 4TQEL 1C16B 1WT5A 3PV6A 1YEKH 4R6UA 3NCFB 1UM6H 1S5IH 3V6FB 2EICA 1N3NB 1I1YB 1HOCB 4XCEA 3I9GL 5GHWL 1EMTL 2P5EB 4MNQB 2DBLL 2A77H 4LQFH 3I6GB 2MQCA 4C59B 4R9HA 3TGXA 4GG6A 3UTTE 2EIZA 5J13B 2VN7A 1T83A 1WWCA 1QEWB 1KPRA 3P0GB 4LRIA 1U41A 1FNEB 3VFGH 1J12A 4MS8C 1XCQA 3KPQB 5IP4A 1XH3B 2GJZB 5J6HB 5FUOL 4PJ5A 4BFGA 4JPKH 5I0ZA 4WU7A 3OZ9H 4M7JH 2A1WL 4NDMB 3EFFA 4JRXA 3C8KB 5IHZB 1G1YA 3MSPA 4KXZH 2P8MA 5E1AB 2W92A 1FZOB 3PDDA 2DMBA 4NBXB 4RFEA 4TUKH 5JW3L 1MIEL 3JV4A 2ZOKA 1U8NB 4RMRA 3VFVB 5CEZE 25C8H 3RWJB 4GXUN 2H2PC 4F37F 5FV1L 1NGQH 5JTWA 2FYYA 3IJHB 1P84J 1YEFH 1AE6H 4P2RD 3CFKB 5J11C 1EJ6A 3T8XA 4I18C 4Q9QH 3BKYL 4X7DC 4U7SA 3QULA 2F54B 3QNXA 5DJDB 5GJSH 1RZJH 1K8IA 5JQ6H 4XNXL 2IPTL 2VUOA 3U79A 2W0KA 3MZGB 1K3ZA 4GXUM 3O3BA 4YHYC 3EO0A 5JOFA 2Y9RT 3WKML 3WIHH 4E42B 1C5DA 1CGSH 4M5ZH 4P49A 1OSZA 2OP4L 2M8XA 3HMWH 1ZA6B 4ONGH 1FNGB 5A2FA 2CIKB 3STZB 3VXRE 5KVGL 2E7LA 3KPOB 1KYOK 1KTDA 4OJFH 2IG2H 3C6SB 3QUXB 1P4IL 4GT7A 4UIMA 1A6PA 5CKGA 5F6HI 4NC1E 1RJCA 3F7QA 4OZHE 1BAFL 1EGJH 4PG2A 3KYKL 3RNQA 4CADB 5I74C 3D1MC 4Z7NE 1QG3A 3IU4L 3PWNB 1R5WA 3VGDA 1BGXL 4OFYD 4Z7VA 1Q0YL 2YEZA 3T0WA 1LE5A 4WFFE 4KUCF 4QOKB 1GAFL 1CIUA 2VZUA 4N0UE 5JPNB 1T22A 2RAMA 3VH8B 2FECI 5FCSH 5BS0B 2OZ4A 1BECA 2Y7QB 4OF5A 4U1GB 1P7QA 4XTRD 4MAUH 4GG6E 1JMXA 2C1PA 1OWRM 4I8DA 1J05B 4UB0L 3UTSA 4ZUTA 1D9KB 4DJMA 1HNGA 4QF1A 2VXSL 1U8KA 3VW3L 3QPXL 4K3HA 4PV8B 4XAKD 3WHXA 2XTJD 1DQLH 3HE6D 2FO4A 1DQQB 2PETA 3L7FB 1I1FB 3P4MA 4JJ5B 4ALAL 3N50A 1OB1A 5ACLA 5T3XE 3B6SA 3QUYC 1WZ1H 4BK4A 1EO7A 3GJEA 3ZE2F 2EDEA 5DQ9B 4JM4L 3I6LE 3JWDC 5F1NA 2C3WA 5FUZL 2DM2A 3HCVB 1OD7A 3MACH 1CR9H 3MRKB 1U3HD 4Z7QF 4NKOA 2EDBA 2RB8A 2QKIB 1SY6A 5FYKD 5KAQF 3G08B 2H3NA 3MFGB 2DS4A 1C7SA 3FO9A 1WQVT 3QA3A 4DN4H 1FL6A 5C07D 1OP3K 3VXMA 1KCRH 3SPVB 4OI8A 1N5YL 3RKDD 1MFAL 2FEDC 2A74A 3V5DA 2PXYC 4OZGA 1ITBB 2ZUQC 4PGCB 3WHE0 1DBJL 4RGMC 1OAQL 3MRFA 3S37L 1QO3B 4MB3A 2FZ3B 1XR8A 2IALA 3Q6GH 1I1AC 5D7LD 2J4WH 5ITFA 3EO1A 4GUPB 4YR6A 3I85A 4HH9A 3O0RH 1N6VA 3QDGD 5B4MC 4XC3H 4Y16D 3S96B 4PRBA 5C0AA 3U7YL 3P9LB 4YXHL 4OBSA 1CICA 3QPQC 3ULVH 1FO0L 4NQTA 4Z0BL 1IL1B 2FATL 5K33A 2HJKA 5KANG 1FN4B 1G6RH 4PTTB 1Q94B 5A40E 2C3GA 3DUHA 4Z7VE 4MNHA 4U1KA 3FOLB 4C83B 5HHOA 1YEEH 1JCKA 3FMGL 3IU3A 3BDYH 5GSRA 4YPGB 3LZFH 5D4QA 3OX8A 3DVGB 2VXTH 4PLKC 4OI7A 1JK8A 2VE6A 3SGJC 1AD9B 4K7PH 4MAYA 2VYRE 3SQOL 5IKCA 3TJEH 3BKMH 4XVSH 3NPZB 2BNQE 2GYSA 4L29A 3SDDB 2NY6C 4FZEL 4NO0A 1IKNC 4GSDH 4JFEA 2CDGA 4X4XB 3QEUB 3F5WB 4ZOBA 4ODWA 3TBTB 3IVKB 2MNUA 4NPYA 4OCSH 3OXSB 1JYVA 4JO3L 3ARBA 1EXUB 5L2JB 5J3HD 3QAZB 2DMKA 3QUZD 5F7DB 3AU1A 4RZCA 1T4KB 1Z5LB 1CXFA 3TLRA 4K3EH 4KAQL 4NQEA 1RSFA 1F6AA 5D1QB 1MQKH 5DQDH 3V4VL 5I73B 3MOAH 2UY6A 2WBJB 3A0OA 3PGFH 3R1GL 4I0PB 1LHZA 4G3YL 2IQ9L 2NY7H 5DI8B 3I3DA 5CLTA 1OGAA 2IANA 1WWBX 4TSBH 5KSAD 4XP6L 2CDFA 4QRUA 2CDEB 2Z9TA 3OSKA 2A9NH 4PJ7E 2PUQT 1OSPH 1II4E 4JRWA 4OBRA 4NNYA 3ARGB 3WFHA 1MAKA 1MI5D 2DWEB 3WL9A 1AFVL 3L9RA 3CXHJ 1EVUA 1J8HA 2Q6WA 3VG0H 5JIPA 3SQBA 3BUYA 2EDFA 3KHOA 5GGTH 1SM3L 1EJOL 4Y5YA 3DXAD 4HGKC 4J23A 4I3GA 4W81A 3GZKA 3QYCA 2VSDA 4NO3A 4OZGE 1DQJA 5FA3B 4F8TA 4M6OL 1CE6A 2AQ1A 1A1OA 4A6YB 1EFXB 5IUSA 1JUFB 4M6NL 3AXLB 4NO2B 2RQ8A 4PRPB 1KTLB 1YN7B 4OV6F 3L1OL 3IKCB 4U2ZA 4MS8D 5TE4H 2VRAA 2W0FB 1WGOA 1U2CA 4MXVF 35C8L 2BHZA 1YYMH 5CILL 3MLUL 4MJ4A 4RGNC 1L7TH 4XMKL 4FA8A 2ZCKH 5I9QB 1GZQB 1U8PB 1IGYA 3BWAB 5D6CB 2HVJB 3TBYA 3WFEL 3O81A 3SJVA 5MEQB 4ODTL 4PRAA 5EIQA 2CGRH 3Q2CA 5IT2L 3W9DA 1K6QL 4QXUL 4PJGB 2G60L 1F4WL 3O6LL 2H2PD 3CU7A 1ZEAL 4JHAH 4QRPB 1BM3H 4OFVA 3S4SB 1BBDL 2EE2A 4XXCC 2XG5A 2B4CH 3WE6A 3TIDA 1K4DA 1MIML 2VN4A 4YGVA 2HT3C 3FRUB 4HMCA 2NY5L 3QZWG 3GGWA 1S9YB 3H3PL 2P43B 3KPPA 1RHFA 2BX5A 3I2CH 3DO7B 2R1YA 3NIFE 3QUML 3SDXB 12E8L 4NKMA 4UIKL 2BXZA 4JGUA 5DUPH 2JB6B 5DA0B 4LLAA 5D5MA 2WLYA 3KPSB 5HGDA 3LQZA 5KS9B 2DM3A 3P40A 5TQ2L 4WO4C 1XF2B 4KROC 5EPMA 3DX9B 3E6HB 1YMMA 3ARQA 1Z6JT 1TZHA 1IKFH 4DZ8A 4IRJA 4HBQA 1TQCC 2GT9A 3RY4A 4ZOCA 2IANE 3CFEA 4KJPC 5HHVH 5EBMA 3KLHC 3VXNA 2LQRA 5EIIB 4OD3H 2BFVL 1NGXA 2B0SH 3GNML 4U6HB 1PSKL 3SE3A 4QY8A 8FABA 2MSPA 1HDMB 4P2CG 4QWWC 2CLZB 3EOAB 5FGRA 5J13C 5CIPA 5F9JA 3IDGA 4ZFOA 4ZQKB 5FYJL 4IIQA 1NEZG 2AJSL 4O51B 1IEBA 1U91B 4PGBA 3HKFA 3OJDB 1UYWH 4JY6B 3BZ4A 3DSFH 2ESVB 4DK6A 1PZUB 5D1ZD 3AREA 2YWZA 2DL2A 2ZUXA 2GITA 4FG6C 3LKRA 2DMCA 5ALBH 1FYHB 3SEPA 2HJLA 2X4NA 4HZAA 5DFVD 3KWWA 2FJFA 4JO4L 4X9HA 5TDNA 3O4OB 4I3RH 4ZNEE 3QUYD 3L3DA 3JTSB 5DEFA 1EUTA 2DQGH 4GAJH 2XZCH 1G0YR 4M7KL 3ZYIA 3H0TA 3MA9L 1GZPA 4P5TC 1AGBA 4QT5B 3FCTA 3RZWA 4FTVE 2JKXA 4NT6A 1HHGB 5JORA 43CAB 1F00I 2IGFH 4KVNL 4Y2OA 3VXSE 4EVNA 4PTUB 4AZ8A 1ZV5A 4K7PY 4QTIH 3VGEA 5IM7A 1KJ3H 3Q6FA 5SX4I 3KDMB 3C5SB 1S9XB 5D2LB 4NQXB 4GLRI 2DQEH 4M6MH 4F2MB 3FFDB 5EULV 1F6LL 1MFBH 4MQ7B 2VLRA 3RWHB 2FEDD 4OZIE 1IGTB 1MY7A 2PXYD 5IQ9A 4LBEA 4JM2F 2IJ0C 5T5NG 1BQUA 5FO8B 5EDXA 4XCCL 1M4KA 1NKRA 1JGEA 3MRBB 3BIBX 1SYVA 2OR8A 4ODBD 4JN1L 2QV2A 1XGPA 1I1AD 5C0BD 2YD6A 1INEL 4L4TA 5F9WB 3UTTB 1QFWL 3JVGA 3Q1SH 5B4MD 4M48L 1INDH 4QHMB 3EAKA 4U1NA 4X9BA 1B0GA 3QPQD 4Q7DA 5E24E 1AR2A 4KMQA 4NQSB 4U1GC 5FYLL 4NP4H 4XP4L 4PB9L 1XF1A 1D9KC 1CCZA 4MA3B 2IPKA 4N0RA 3C5ZB 3TVMC 1WWWX 4XMPL 3BIKA 8CGTA 1UWEL 3RDTA 1MCSA 3VI4E 2Y6SD 4TNVF 3MRHA 2DQUL 1X6LA 1KYOJ 4PJAE 4MXWL 4GMSL 4MJ2A 1DANT 1J1PH 2VQUA 3MFFA 4JLRA 4E41A 5LWYH 3H7BB 4UV7L 4L3EE 5DFWH 3ZTNH 4U1LA 3EYOB 4OGYL 5IEHA 1Q72H 1Y18A 2DKSA 5CP7B 4X80L 1RIVL 2EDXA 1JGVH 4HWEL 5T33H 1NUDA 3VXUD 1HI6B 2A83A 3DMMC 5C0FA 3EHBC 4P5KA 5DZNA 5HYJA 1LQSR 2CLRB 1DDHA 4XPAL 4OUUB 1B90A 3RWFB 2R8SH 3H9SD 3FO0H 1SHMA 4YHPB 3RIAK 1WFTA 4P9HH 5ID0B 2ADGB 3D0VB 2AXJA 3U46B 2DTSA 4PJDF 1XAUA 5EOTA 3QEQE 3VXRB 4RA3A 1EO5A 3KYMA 3ABZA 1Q38A 4GW4A 5FB8B 5TPWL 4M62L 3UDWA 4Z7UE 2EC9U 2R2CA 3BD3A 3MCLH 5SWSD 5HHMD 1JRHL 3SCMB 5IB4A 5FYKL 1CL7H 2D0FA 2HJFB 3F58H 3MBED 4JPWH 4HV8B 1RFDL 1PLGH 1JFQH 4OZHB 3RL2A 1MCRA 3S35X 2AK4D 5J6GA 4G9FE 3PV6B 4QLRA 4KKAC 4KJWC 1OWWA 1WIPA 5LCVH 3OAUL 1BZQK 1OM3H 4Z78B 1QR4A 3O41B 2XY1A 3PE9A 3WIFB 4KHTH 4OF0A 4GG6B 4L4TE 2R69L 4JDZA 4RGND 2CK2A 2EIZB 2O5YH 1F4XH 1NCCL 5HGBA 3U0WL 5GGVH 2R2BB 1XCQB 4WV1A 5DYOB 4PJ5B 4X6EA 4F7PA 3TNNA 4WU7B 1E6JL 4ZD3L 3EFFB 4L1DA 3SDDC 4LDOB 1U42A 2B4CC 2FX9L 2EKSB 3FQNA 4G9DB 1XGQB 1VADA 1OAUH 4DTGH 3JV4B 4KV5F 1FNHA 3K4DA 4ODSH 4Z7OF 4EI5A 4FS0A 2HT3D 4LSUH 4DKEL 2FYYB 2VLMD 4NQCD 5BOZG 4OLVL 1CFVL 1FORH 4KC3B 3AAZA 3OF6A 2NY3D 5E95B 4JFYA 3HG1A 5I73C 4LCUB 5GZOC 3T8XB 1V7ML 2WBJC 3RWIA 3CNKA 3NAAH 4I0PC 4JQIH 3QULB 2VDOL 3QNXB 3U4BH 1CLOH 1J11A 2V5YA 4MZ2A 3RGVB 1MJJA 2IWGA 4KROD 3ARGC 4JR9H 2P7TB 3O3BB 2VXQL 1E6OH 1INQB 2DRUA 4IS6A 3ZYOA 1GRWA 1PKQA 4KJPD 3KLHD 3TBVA 2CRYA 4NQVA 2R4RL 4GH7B 4MLIA 4ZS6C 4HG4K 5DJAA 1A6TB 3OKEB 3JWNC 1SQ2N 5J06A 1S3KL 3IS0X 1RIUL 3GHBH 1K5NB 4UIMB 2ADIA 2MQ3A 4JDVB 4AJ0A 4QWWD 4PJCF 4LPTA 4D94A 4UT9H 1F02I 2MCG1 4CJ0A 3RNQB 3VFPA 2P48B 1OAYL 4X6BA 4NZDA 1R5WB 4LLVA 4Z7VB 4QXWA 4PGZA 1LE5B 5CGYC 5JR1H 1X5JA 5I9QC 1S7VA 5EB9A 1EEQA 1Y0LB 4RMQA 1VEOA 1KCLA 4U6XA 3RWCA 1T22B 1QYGH 5E7BA 1MH5A 4MCYB 3PP3H 3FQTA 1OTTD 5IBLC 1VFAB 2QJDA 4WEUD 4CRPA 5AUMA 4FG6D 1JV5B 4MDJA 2BNQB 4KZDH 4NWUL 4QGTA 1MHPH 4DZBB 4JVUA 1S7SA 5DSCA 3AGVA 4U6TA 1D5XA 2BHUA 3CLFH 4FHBD 5H35A 3BDXA 3H9YA 1DL7L 4YE4L 3L95A 2X9XA 1OB1B 4G8GA 1A1NA 5HDBE 1P5VA 4GG8B 4G80A 4LPUA 3B6SB 4YHLH 1IC5L 5C09D 4P5TD 1YYLH 2CK0L 5J8OA 2F5BL 2RCSL 4UI2A 1F90L 3ARYA 3GJEB 3MLPA 3KPMB 1QRNA 3TFKC 3ZYJA 3DWTA 4N8VG 4WW1B 4OCLC 4N8PA 3GI9H 5H94A 5F1NB 4PP1C 3QQNA 5DQJA 1HWHB 2X4QB 3TNMA 1BPVA 1SVZA 4D9LL 3KLAB 2DF3A 4XB8A 1QSEE 2R0LL 3GMQA 2Q7YA 2H3NB 5E6YA 3M1BA 4R0LA 5FDYA 5CJBA 3QA3B 1A2YA 3QIUB 1I3GH 3UJJL 4FFVC 2EDQA 2GY7B 4HIJB 4L8DA 3RY6A 1RUQH 4X6DE 1IZKA 1MRDL 4XVJL 2BSTA 3V5DB 5I1EL 3MRLA 1KJ2A 4OZGB 1YPZA 4EXKA 5DHYB 4JG0H 4ZTOL 1N2RB 1SEBA 3WNKA 3IFPB 2DBJA 4LKCB 4EIGB 1J87A 4UQ3B 1M7DA 1KCKA 5JIHA 5L2KA 4TULL 2IALB 1ORQA 5E4EB 5LQBL 1IM9D 1MCDA 4I1NB 3EO1B 2V5RA 5BS0D 2CKBA 3LH2L 4QRQB 2WIIA 4HH9B 2ADJA 4MNGA 4K3JL 5L0QC 5FUCE 3TO4A 2YR3A 3HAEB 1D9KD 1A4JA 1A7OL 1AY1H 4GRMA 4KTEH 5ALCL 3EBAA 1ES0B 3TVMD 1FRGL 1CTOA 4S2SA 1KLFA 4P2OA 2OZ4H 4MNHB 1BOYA 2BDNL 2D7QA 1HILA 2Y72A 3HI5H 5GSRB 4FP8H 3T1WA 3F6LA 3QT2A 5ADPL 4LHUG 2Q7NA 3OX8B 4K71C 1VGKA 1JK8B 2VE6B 5ILTH 4MAYB 1L7IH 4Y0GA 1X5AA 5CBAA 2P49B 4UU9B 3UTZA 2OXHA 4L29B 3I84A 3VI3F 1NC4A 2Q1EA 1MFNA 1T5WB 2AERT 2CDGB 4D8PA 4G8IA 4KRMB 3SDYL 4IOSD 5GGVY 3DMMD 9CGTA 3EHBD 3T3ME 4B7LA 3BW9B 1TVBB 2BVPA 1LO2H 2NY4B 5TE6H 4NPYB 1ZVHA 3ARBB 5IK3B 1IC4L 4PJ8A 1HZHH 4RZCB 4Z18A 1K3IA 3GMMB 4DAGH 3PV7A 2A38A 3QQ3B 3D9AH 1Q0XH 1F6AB 3JWDL 3EYSL 5GQBA 4L3CA 4S0SD 3QRFM 2NW2B 3IDNA 2NMSA 1MPAL 5JIIA 4JQXC 4DW2L 2IANB 5IBUG 6FABL 1SY6H 3U0TA 3AFLA 4OB5L 5D7IE 4KDVA 4H88H 2R39A 3M17B 4NNYB 3WFHB 3C6LB 5FKPA 3PWJA 1FVCA 3WL9B 3L9RB 1J8HB 4RX4A 3BUYB 4TRPL 3KJ6L 1UACL 1UQSA 1U8HA 2HKHL 4HPYH 5ICYA 4Y5YB 1MHHA 4KJWD 4KKAD 4LRNH 2F74A 1I9JH 4HUXA 1CTNA 5TH2A 3D25A 5TQ0H 3WEXA 1A5FL 4ENED 2YUVA 2W60B 5GJTL 1UZ6E 5F6IB 4YUEH 2YZ1A 1EO8L 4M3JA 5DD3H 1C5BL 3H9ZA 3MJ7A 5I1DA 4QXGH 1OHQA 5F72S 2VTFA 3GSVA 4U1SA 2V17H 3CMOH 2AV1B 4PRIA 3C5ZC 3L3OB 3K1KC 1MRFL 5DS8A 4K07A 3WS3B 4EBQH 3KS0J 5KSBA 1TTUA 1U8LA 1IGYB 1CVSC 3ECBA 2ATKA 2NW3A 4CDGC 5M94B 2XWJA 5T1KD 1CLZL 2X4TB 3W9DB 1AXSA 5JNYA 3SN6N 3KNBA 3MRNA 5LBSH 2OCFD 3B43A 3PIQB 1CDYA 2C7UA 3EOBA 4RISL 3R4DA 1FNSH 2EE3A 4NGHL 2XI9A 3TIDB 3WE6B 1K4DB 5MERA 1GH7A 1WEJH 4XX1G 3GSOB 2WBJD 1FH5H 3GGWB 1J1OL 2Q3ZA 4R3SA 3KPPB 2P8PA 1R3JA 1XCTB 5D72L 4NKMB 4XBPA 4PLOB 1YUHB 1C8PA 4NRZA 4HX1B 4XNZC 2AJVH 3SCMC 4G7YH 4GKZB 1BQLL 2Y07H 4Y5VA 4NN6B 2Q8AL 4NC1C 4ZS6D 1U92A 3BKJH 4G42A 5EPMB 1YMMB 5K9KB 2JJTC 4JFZL 4WI7A 3A67L 1TZHB 3X3FH 4DZ8B 1F8TH 2XY2A 3FT4B 3CFEB 1QD0A 3MLWL 5EBMB 1WT5C 1A7NH 1MEXH 1I9EA 1EFXD 1S5IL 4ZO9A 2AJ3A 1G7JA 3GMPB 1ND0A 4QY8B 8FABB 7CGTA 3WUWA 4HWUA 2A77L 4ZDHA 3RAJH 3VXOA 3V5KA 3W0WE 4FABH 5D7JA 3I3EA 3HHRB 3RUGF 1ZE3C 3IDGB 4ZFOB 3CSGA 3ARDD 5IBLD 4DN3L 5T1LD 5AZEH 3CSBA 3DETC 5HHPA 4PGBB 2A6IA 2V2TB 3V52H 4P4KD 1OF2B 4RMWA 3H9HA 5CBEA 1KXQE 4BZ2H 4OFPA 2BY3A 5E94A 4X7SH 3AREB 4CKVX 4L3EB 3O6FB 3NZ8B 2P47B 3U0PB 1S9KC 4K9EH 2X4NB 2FJFB 4UDUA 5TDNB 2YK1L 4LASH 5E6IC 2W9EH 2C3VA 1YEFL 4WI9A 2N1KA 3U1SH 3H0TB 3QIWB 1HHKA 5MENA 3TFKD 4HUVA 3PL6C 1GZPB 1RV6X 1RK0A 1AGBB 3C87A 3QIBA 4KPHH 4NT6B 3B83A 5JORB 3QEQB 5CSGA 1RZJL 3BYYA 3RGVC 3U6RA 2DQCL 3QCTH 4QHLA 3RI5F 3O4LA 1JRHI 1ZLUH 1TITA 1DN0A 1D3CA 4Z7UB 4R97B 2R2HA 4X98B 4XPTL 2YPLE 3TO2B 5IM7B 1MCOH 3QFJE 3Q6FB 5DWUL 5ACMA 4MSWB 4M5ZL 4FFZH 4JFDE 5I1KH 2YN5A 1W0WA 4FFVD 3HZKA 1ZOXA 2VLRB 3QXDA 1NDMA 1ETZA 3BT2H 2NTFA 4OJFL 4G9FB 5GRWA 3OHXA 5JHDD 1Y6KR 2ARWA 3REWA 2QHRH 4LBEB 4RGOH 1IT9H 4NKIL 3ZE2E 1DBKH 1JGEB 1SYVB 1FFNA 4FOMA 3V0WL 4L4VA 1XGPB 4YQXH 4X9IA 1UVQA 5I66B 5I8EB 1YEJH 4X7TA 4L4TB 4LLQA 4PJEF 3E3QE 5KVEH 4LCIH 4GAYA 3G5ZA 5CIPH 4JN2A 1VESA 1TPXC 1CG9A 1D6EA 3R06A 3WFDL 4X7FC 1BQHA 5D1XA 1BWWA 2ZUVA 1A21A 4JDTH 3ZT5A 1I7ZA 3MJ9L 1JMZA 3DOSA 5JA9A 3VGAC 3MRHB 1HYSC 4H8WH 2WINB 1LNUA 4YK4B 3MCKA 3VFOA 1QBMH 1MCWW 1WZ1L 3PQYA 4JRYA 4DKFL 4BFBD 1D5ZA 3MRIB 5TE7H 1UWGL 4NRXB 3HN3A 1JZ6A 4QRTA 4UDTA 5IEHB 3B2VH 5IHUL 2XNAA 1OD9A 3T0BA 4LSDA 1C7TA 2AJXH 1RY7B 4OT1H 2A83B 2VLLA 4P5KB 1MOEA 4P46A 3D18A 4H1LG 1MVUA 1RUMH 2AEQH 3MNZA 1CFSA 4J3OC 2X2YA 2E27H 3SGEH 3O3UN 4DN4L 3QIUC 4CBPA 1R24A 4TSCL 3KYMB 4R8WH 1A8JH 3QWOA 2XZQH 4GW4B 4P23A 1UH3A 4LHQB 5DD0L 1KIQB 2N4IA 3KPLA 3MO1A 1NCNA 2B1HH 3GSXA 1BFTA 7FABH 5EORH 5F71A 4IRSA 5FGCE 3RL2B 1OY3B 5E4EC 3Q6GL 5I15L 5J6GB 3EYFA 1KNOB 2I25N 4XX1E 3JTTA 5EZJB 1VACB 5DTFA 5I19H 5LXGL 3LKSA 4PG9A 3SDAA 4XC3L 2YD7A 3G5XA 4HFUH 1TJGL 3E2HB 3HS0A 1YC8A 3CGTA 4L4VE 4OCRL 4HIXL 5SWZA 4RWYH 1I8MB 1L9MA 3WS6C 5CEZD 3BVNB 3CUPA 3K2MC 2QBWA 2Z8WC 4JDZB 5EZIH 1NAMH 1KIRB 1BZ7A 5DJZA 1L4IA 4WV1B 1PG7W 4YDLB 3DARA 4F7PB 3HE7B 3QUMA 1DFBH 1CT8A 4LVNB 3FQNB 4XVUC 5CJ5A 1H3GA 1OP9A 4QCIB 2FH8A 1G7IA 5F7HA 3D3VA 4XNYL 2YD2A 3QEGH 4M1CD 4EI5B 2NY4C 2VJXA 2IEPA 4OCSL 4OV5A 3AAZB 5KN5B 1KPUB 4JFYB 4K3EL 1SJEB 3VXRD 3DIFA 1MQKL 4NBYB 1QSEB 2IBBA 3MLRL 2CJUH 3MOAL 2NNAA 2ORBH 2EDRA 1BF2A 4J8RA 1JGDA 2WV3A 5T1MB 3WJJA 1PG7H 2R29L 2Q86A 1FFOA 4U0QB 1JF1A 4X6DB 4DOHE 3C6LC 5F9OL 1R3IL 1A7BA 2VZ3A 4IS6B 5H2BB 4C58B 4X5LA 2BRRH 4NQVB 4WFFD 3OKDA 2Y06H 1WIUA 5HDOA 3ARWA 2OXGA 1EHNA 1IZJA 2CLVA 2X4UB 3EOYG 5J7CC 5F6IC 5L8KB 2ADIB 1K85A 4X8JB 4FQ1L 4AT6A 3CFBA 2ARJA 3AS2A 3F7YA 5DRXA 4XPBH 4HUUA 3VFPB 1I8KA 4NKDB 2JELH 4N5UA 4X6BB 4RSVA 1J5OH 4NO5A 2Q76A 3DVFA 4O02H 1YYML 3DETD 2RBLA 2VO5A 3LD8B 5T3XD 2ZCKL 2QSTA 1HE7A 5EO1B 4U6XB 3RWCB 3QFDB 1ZHLA 5JW4N 1OQXA 5EUOF 4K9EC 5F7YC 4Q6IA 5AUMB 1UM4L 1G7PA 1MJ7H 1JYWA 5IMLA 2J5LB 4MDJB 5JDJA 1CXLA 3G6JA 4P2RA 5DSCB 2ITCA 1FE8L 1ZWIA 5E6ID 1FZJA 4GO6B 3T2NH 4YFDB 1A6UH 1S8DA 2B4CL 2PNDA 2FSEB 4LSPL 3ESVF 3L95B 1EBPA 4RFNC 3G6DH 1ZLSL 1A1NB 4TVPE 3PL6D 4G80B 4GAGH 5IMKA 3UYRL 3OKNB 1W2KT 2B5IC 3I2CL 3RGVD 1ZHBA 2QQNH 4JKKA 5K93A 4WU5A 1I9IL 1QRNB 3EGSA 4H0IA 2FIKA 2KKQA 4AL8H 4FQXD 1DR9A 5DQJB 4NN6C 5CLWA 4FQHA 2FBJH 5H8DA 2VMFA 3CPLB 3GMQB 2YXFA 2CXGA 3M1BB 1AHWB 4R0LB 2VC2L 3BO8A 3UTQA 1I3UA 4JKPH 3DTXA 3QISA 4RA0C 1LEKA 4L8DB 4UZGA 1MAML 1HXMB 5JPMA 2BSTB 4OFYA 3MRLB 1KJ2B 4WI6A 4PJDA 1ZHKA 4ZPTA 2ZKHH 1M7DB 4V1DE 3IJSA 1NMBL 3T1FB 1ORQB 3QI9B 5IGXL 4LLMA 5D93C 4A6YL 3ZSSA 3GBLA 2D0GA 3ALXA 4ORGA 2WIIB 2XA8H 4MNGB 5F93C 5K9JH 1BVKA 1J0HA 4I2XE 1KEGL 2KL6A 2R0KH 1TDQA 1WBXA 3RNKB 3LQAC 1TZIA 5IBTH 2BNQD 1G7LA 4FQCH 2YMXH 1A4JB 5IB5A 3HE6A 3MUGA 1R3KA 1Z3GH 4GRMB 1YJDC 5KVFH 3O6FC 2P46B 4H8WC 5I8CA 4S2SB 4WHYH 4HKJA 4P2OB 5EG6C 1CDCA 3VDBA 1GYAA 2DQHH 4S1RH 2N56A 2P24A 4I3RL 5C0RL 2UZXB 1YMHB 5HBBA 3FT2A 3U36A 5CBAB 1IAKA 4XCFH 3QIWC 4YHOL 5B3JF 5B8CA 3N1MC 1U3HA 2RFXB 4X99B 4D8PB 4UT7H 4TOYH 1AQKL 2LU7A 4HXBH 3BPLB 2P42B 4OLXL 4Q2ZA 4JHWH 2BVPB 1EA9C 2NPLX 2VL5A 4R97C 5C07A 1NBZA 4FQIH 5DMYA 3QCUH 1IC7H 4MHHI 3QIUD 1MCWM 1FYTE 2LAGB 4M6ML 2DQEL 1MFBL 5E8DH 3VFTB 2LV4A 3MV9E 4PJGF 3A6BH 4MJ5B 4LSTH 4M1DL 3U0TB 2J6EL 5D7LA 4L4JA 3BFOA 4J4PD 2V5SA 5FKPB 2YA2A 3PWJB 2WQRA 1FBIH 1RIHL 1NBVL 3QDGA 4N8VB 4JVPA 4Y16A 5DK2B 2BC4A 1KJ2H 1GJIA 1LO4H 3W0WB 1U8HB 3A6OA 3JVGC 2ZG3A 5ICYB 1NBYA 3MV11 2Q3AA 4HUXB 5TH2B 3WEXB 4XH2A 4XP5L 3INUH 1F3JA 5GXBB 2CKBH 4LIQE 5FGBA 1VPOL 3K8MA 3GSVB 3ULUH 1QOKA 4U1SB 4PJBA 5I1HL 1IEAA 1TJIH 2KDGA 4WTXA 4ZS7L 5DS8B 4NQDE 4AENB 2J1KA 3OG6B 3LY6A 1F4YH 2R1XA 3QNYA 2WP3T 4JFFA 4BJLA 4PJCA 4HF5L 4RQQA 1T1XA 3HC4L 3RJQB 3ROOA 2ATKB 4XAKE 3H3BC 2XWJB 1ORSB 4XVUD 4Q9RL 1J1PL 1MNUH 3ARXA 1AXSB 5JNYB 4X7CC 4PJFF 3QUZA 4RAHA 3KNBB 1VFBA 4LKXB 2KZ1B 4R96A 1Q9OB 2H26A 1Q72L 1JGLH 2XA3A 5DDHB 3PABA 3GBNH 4KK9D 2C7UB 4KGJA 4Z0XA 1W72B 1JGVL 4LCCC 2UWEE 4ZXBB 5BMFH 2D4FA 4I77H 5KSAA 2I5YL 4Z76B 3OAZH 5DF0A 5CSBA 5GIRA 5E03A 3QFJB 3SDCB 2MKLC 5DFTA 3HI6L 5B38A 5EU7E 2NX5E 4X4YA 5SX4H 2PR4H 1MI5A 2P8PB 4HK3N 2AAVA 4OQ1A 4GLRH 2YD4A 3HUJF 4TQEH 2CIIA 3AROA 3QDME 3MCLL 5GS0H 3MV7D 3DXAA 5GHWH 1EMTH 4G42B 1R0AH 4CNIA 2VDNL 2DBLH 4Z7OE 3NFNB 4LAJH 3T2OA 3BP7A 4C56A 4EN3D 3ULSA 1T1ZA 4IMKC 1BD2A 1VEPA 2X4OA 4HCRL 1ROWA 5D7LE 4BM7A 1G7JB 2LVEA 1G7QA 3ZKMC 4UTAH 5LCVL 4WHYG 2A1WH 3WUWB 3Q48A 3QDGE 5GS1B 2BNRE 4PY7A 4WFGE 3VXOB 1M7XA 4KHTL 3V5KB 3P9WB 3HC0A 5D7JB 3VJ6A 3NCYS 4BH8A 5I75B 5JW3H 1MIEH 3GIVB 3RA7L 4R26H 1N5AB 5KVMC 3WFBL 4YDLC 3SE8L 1CE1L 1TETL 3OXRA 4PJ9B 1U9KA 5D9SB 5CGMA 3SKNA 2ITDA 2ZSWA 3HE7C 1GSMA 1RHHA 2DIAA 2PCPB 5CEZL 4I0KA 3OKOA 1IAIL 3BJ91 3H9HB 4G43A 5F7NC 5CBEB 4FTVD 5EOCJ 5SWQB 1F5WA 1T5XA 5E94B 4I18A 3VFRA 3BKYH 1I8IB 1U58A 4LSQH 5HPMA 5LGJB 1OAUL 3RU8L 3VXSD 1VERA 2YN3A 1PFCA 1MCKA 4XNXH 2IPTH 3K8LA 3ZKQD 2YD1A 2VQTA 1FORL 4U49A 2C3VB 1S7TA 2XZZA 2V6HA 3FQRB 2LTQC 1JZ3A 1DBAL 4AEEA 1CD9B 1HHKB 3P9MA 3S3SA 4KQ4L 2OP4H 3F7VA 3EW3B 3NCMA 5CEXB 4OKVA 3QIBB 3SGDI 1KACB 5DUBA 1CLOL 5LKNA 3MNVA 1A6VL 3U6RB 3O4LB 4NHCL 4R4ND 1P4IH 3MRCB 2WNGA 4GQ9L 1PY9A 1Q9WB 2QR0A 4QYOB 1EAPA 4MQTB 3FL7A 1BAFH 4ODXA 3HZVB 5C08D 5BW7C 1W0WB 3MXVL 5FGCB 3KYKH 4ONHB 3M8OL 1B6DA 3IU4H 2C3XA 1BGXH 1NDMB 2XZAH 5TFSL 2NTFB 3SKJL 3GHBL 3QXAA 4Y8AA 1T03L 1GAFH 3AS1A 1S7WB 1CDUA 1HSAB 1FAIL 5FUCC 3LKNB 3S36H 1YEDA 1FFNB 4L4VB 1A6AB 1UVQB 4IOFC 4P0DA 5C6TH 1VFMA 4OAWB 5D7SL 4NHUA 4IEFB 1UXSB 1JTPA 2VXSH 3RBGA 3VW3H 5LAXB 5D1ZA 3LD8C 3P0YH 3QPXH 4MJID 5MP6H 4KK5C 5JR1L 1SVCP 1A3LL 3FT3B 2LU4A 4PJIE 4EXPX 5J9PA 4GAYB 4BQ9A 4ALAH 3G5ZB 5DURD 4ZUSA 4JN2B 4L3ED 3O6FD 1NCBL 4D0DA 2J5LC 3QUYA 3R06B 2BERA 1BQHB 5FDWA 4KZDL 4WWKD 5CJXC 3PP4H 5T3XL 4K7FA 5MEPA 5E5MB 1UB5A 3U9PL 2VH5L 2OR7A 5FUZH 4Z7NF 5BZDA 2PTUA 3QIWD 4XCYA 4KDWA 3N0PB 1YYLL 3CFIC 5IVNA 4JQVC 1NANI 1RJZB 3QEQD 4JAMB 3WO4C 2VQ1A 5DJ0A 1V3JA 4M7ZB 4KI1A 4KUZL 5CZKA 3PWPE 3LEVH 4NM4L 4XC1L 3RPIA 3LPWA 2XNAB 5ITBL 1MFAH 3D0LA 4RDQF 2XYCA 3ZT6A 4DOHB 2PXYA 5E08L 1U8MA 1MVUB 1WUNT 1DBJH 1WF5A 1OAQH 3MNZB 3P73A 4G9FD 1AHWC 4R0LC 1RU9H 4HT1H 3P77A 5GRZA 4NFDA 1U2HA 1I3GL 5C3LD 1I1AA 5C0BA 3RL1A 5IMOA 4NZUH 4ZUVA 3PWLA 4FQJL 4DGVH 3VI3E 3TH4T 4NRYA 3U7YH 4P9ML 2DLEA 2V7HA 3GSXB 1VB9A 2VZSA 4Z0BH 1UB6A 2B7DT 1S9VA 2FATH 1EHAA 3J8F7 4JO1H 3QI9C 3RHWK 5IV2B 4LGSB 2XOTA 3BP6A 5DJ6B 2F15A 4WTWA 4MJ6B 1HQ4B 5IR1A 3JTTB 5KBNC 5DTFB 3MRQA 3BEWA 3RGHA 1U93B 4PD4K 3S7GA 5KW9H 3SDAB 2WBKA 1BBJA 1IM3A 3G5XB 3B9KC 5HI5C 4M00A 3SQOH 3HS0B 2VLKE 2DYPB 1A4KA 4UMGA 3ULVD 4OI9A 4YDKL 1DP0A 5C0EA 1UZ8B 4P2OC 4HC1L 1TTFA 1IKNA 1ZA3A 3MUZ1 2YC1B 3EJJX 1TZGL 1AO7D 3ISWA 5DJZB 3HI5L 4NN7B 3DV6B 3CFJA 4ODUA 5GPRA 2DOCA 3RVUC 5ILTL 4P2QE 3KPNB 1CT8B 2FDBP 4EUPA 4HXAL 4KAQH 3RUGA 3V4VH 4OZFG 2GTWA 5M7QA 4D0CB 4K3GA 1DLFH 4FQ2H 1JHTB 4JB9H 3KPRE 5CMAA 4G3YH 4M1GL 3BPLC 2ICWJ 1IBGL 2DTMH 4XP6H 2KH2B 1LO2L 4LEOA 2HTKC 2V5MA 2CKNA 5T3ZE 2PYEE 3Q0HA 5HVGB 1LP9A 1X6NA 5DMKA 1AFVH 1Q0XL 2DQFA 3DHJA 3DIFB 3LKQA 5SWSA 5GGRA 3I02B 3M45A 5GS0C 2FWOA 1DUYA 3MBEA 1JGDB 4J8RB 1BMGA 1GGIL 1EJOH 1PAMA 1TVHA 1AXIB 1QPXA 2VR4A 4W4OC 1FFOB 2Q86B 3WXWH 1JF1B 2AK4A 3ZYZA 1J86A 4M6OH 1UWXH 3V8OA 3IJYB 3GMOA 1D7FA 1S7QA 2Z93A 4HPYL 4LARL 35C8H 3QXUA 5CILH 3MLUH 2QQQA 2BY2A 3ZKMD 1CFBA 4XMKH 3WIIH 1N7ML 3P4NA 1KG0A 1FSKB 5FO9B 3K81A 5GRVK 4I2XB 2CLVB 3O11A 4JFHE 4HJJL 3WFEH 2V7NA 3SE9L 3MBXL 4JG1L 3PHQA 2P45B 3CFBB 2ARJB 4PJ7F 5IT2H 2BY0A 5E9DD 1K6QH 5ICZA 5DRXB 2G60H 1F4WH 3O6LH 3KGRA 4JM2B 1ZEAH 4DFHA 2Q76B 5GRUL 2C4FT 1T6WA 3HE7D 3LV3A 1BBDH 5INDA 3VGFA 1ZHLB 1ONQA 1BVZA 1H5BA 3ARUA 4HJGA 3VE0B 1OP5K 4NQCA 4Q6IB 3H3PH 1G7PB 1P7KA 3STLB 3BZFA 4GRWE 3QUMH 2CSPA 3P4OA 2XXCB 3QXTA 12E8H 4UIKH 4HZLA 1ZWIB 4JCMA 4Y7MA 2UYLA 4ZXBC 1FNSL 4GKSA 5C0GA 1FZKB 5GZNC 1OPGL 4WRLA 3CLEL 1QSED 1I7UA 2AEWA 5F21B 3WBDA 5TQ2H 3TBWA 5K59F 3QG6A 5IMKB 3SDCC 1T0MA 3VXUE 4XZUA 3W82A 1DE4A 2Y36L 3S37X 3H9SE 4E9LA 3TN0D 1F3DH 5CHNA 2FIKB 4O5LL 1I85A 3CDGA 3MV9B 1C16A 1EAJA 1FFQA 2BFVH 4JGMA 3ES6B 2AJVL 3GNMH 3V6FA 4Q74A 2Y07L 3VD9A 4MD0A 2NY0B 3G5VB 1X9QA 2MFNA 3MLZL 3BKJL 1R5IA 5E2WH 3BO8B 3MV8D 1IGCH 3IXAA 3UTQB 4U3XA 1A7NL 5GSVB 3DTXB 4POYA 1FNEA 3E3QC 4KK6D 2OX5A 5AD0A 3IRZA 2AJSH 4U1MB 5BV7B 3ZL4H 2GJZA 5J6HA 5JPMB 3NIFF 4M61A 4WEMB 4GRLB 4IOFD 4PJDB 3BN9C 5GS1C 4NDMA 5FKAB 3KAAA 3LRSA 3MJ9A 1G0XA 5D7JC 4EDWH 5I75C 3IJSB 4KK5D 5E1AA 1FZOA 1RPQA 1U8NA 1M71A 4ORGB 3D48R 4PJ9C 4JO4H 2DAVA 1BVKB 3IJHA 1WBXB 1CFQB 3MOBH 1G7LB 5J1SC 2XTJB 4M7KH 3SE4A 5IB5B 2WBWB 3V52L 3MA9H 2EDNA 5BJTA 2BY1A 4JZJB 4X7SL 3O6KL 4YZFE 5I8CB 2FJGB 5C09A 4HKJB 4P5TA 5CJOL 2NYYC 3RWEA 5DJDA 5C70A 1I9RL 5C0IB 3RFZC 5MI0C 4K9EL 4ZO7A 3T4YB 3RVWD 4KVNH 1P6FA 3VRLF 5HYEA 4JPVL 2QHLA 2P24B 3IS1X 5BZWB 3FT2B 2YUZA 2VLME 3U36B 3AB0C 3DX6B 1S7XB 2IH1A 5HGAA 1DQML 4PJEE 1KIUA 5B8CB 1ZA6A 3LHPL 4Y4KB 2CIKA 1NQBA 5EC1A 5FYJU 3STZA 5GGSA 4FFWC 4Q2ZB 3BP4B 4JEGB 3FRPA 2VDKL 3RIAF 4LEXL 5E2JA 1NBZB 4BUHA 1DEDA 4DQOH 1MCOL 1WLHA 5ANMA 4JN1H 1E28B 4FFZL 1OW0C 4S1DC 3L3GB 1A0QL 2RR3A 3FHQA 1QFWH 2ZPKL 3FQWB 2MPAL 1KPVB 3TWCH 1IM9A 4F9LC 5JPNA 5D7LB 3W11C 5BS0A 1UEMA 1RK1A 1XGTA 4OLUL 1RD6A 2VAAA 2Y7QA 4NUJA 1QACA 3KLSA 4WTZA 3QDGB 4YQXL 4YXKH 3F8UB 1YEJL 1X5HA 5AYQA 1P9MC 1F58L 1D9KA 3VWKB 4G6AC 4FQQB 1NBYB 4XMPH 3TVMA 4OCYL 4PV8A 4XWGH 1UWEH 5HI5D 3B9KD 3FFCE 1RZKH 4LCIL 3LEXA 2DWDA 1DQQA 2DQUH 4ZUWA 4JJ5A 4P99A 4XH2B 1X7QA 3OAZK 5J56B 4QHKJ 4OZIF 1IAII 4MXWH 3G9AB 3IF1A 4GMSH 1JWSA 4ZFOL 3HLAA 3GJFA 5EU4B 1EEZB 1UCTA 3TCLA 5IFJB 4UV7H 3HPLB 3QJHA 1GOHA 1IEAB 3LQAL 5MEOA 2DQIH 4OGYH 4HIEA 3RVUD 4PS4L 3KYNA 2R1XB 3GI8H 4X80H 1RIVH 5FF6A 1AR1C 4PJCB 3ZE1F 1YJDL 1K2DB 3HCVA 4H8WL 3WLWC 4IBLT 3DMMA 1RAMA 2QADD 2QKIA 2D7MA 1PGRB 1L6ZA 2AABH 4F7TA 1VFBB 4J6RH 2DLHA 4BH7A 3SPVA 1QLFA 3B2VL 1R5VB 4OTXL 4XXDA 3FN3A 3PABB 5EUOA 4Z0XB 5TPWH 1KC5L 1JIBA 3D5OF 2AV7B 1JRHH 4F57L 3X17A 5FYKH 3V0VB 3H7LA 2X40A 1RFDH 5B38B 2APWA 2Q8BL 2YUXA 4X4YB 2FGWH 1MI5B 3V6OA 1LO3L 4PJAF 5IFAL 1CVRA 2DN7A 1B6UA 2ENSA 3PJSB 4R8WL 4GKNA 1A64A 2XZQL 4GUPA 4GJTB 5ECJE 3T4AB 1HSBA 2VXUL 2W38A 2QL1A 3W0WD 3EJZD 7FABL 5EORL 4MDIA 2E3VA 1IL1A 1JNLL 1T7ZA 4K8RC 1FN4A 4YNYA 2R69H 3N1PC 1Q94A 5A2LH 3BP7B 4C83A 3FOLA 5EBWA 4FZ8L 4MWFA 3KR3H 1CD1A 4DUXA 3L5WB 2GK2A 2X4OB 5I19L 2MCPH 3SDAC 2FNBA 2FCBA 3HNSL 2EDKA 1E6JH 2ZCLH 2FECL 4OCWL 1CGUA 2FX9H 3L3JA 4PY7B 1A3QA 3H2WA 2X42A 3HC0B 4PREA 2DD8H 3VJ6B 2UZYB 2HH0H 3QHZL 5T1KA 3QEUA 4BH8B 1P4LA 1JPGA 1NCWL 1T1WA 4GW5A 4WI8A 3BPCB 4RWHA 4X6CE 3VD3A 4Z7WE 3U2SB 4BFEA 1Z0NA 1CFVH 2ITDB 3OXSA 2VOTA 1RHHB 4KRNA 4MQXC 1DFBL 4JFOA 1K4CB 2HLAA 5F8QC 5J11B 3LCYA 4DWHA 1T5XB 4I18B 2WBJA 3RY5A 3T0XA 2DICA 2VDOH 1DVFD 2NCMA 4ZUUA 4ZXBD 5GZND 5DI8A 3CFDB 1GC1C 4CN4A 1EEYA 2HTLC 2YPLD 3BKCL 3QFJD 3AUVA 3SDCD 2PTTA 1EV2E 1SJXA 4U7MA 2JCCF 4F15B 4JFDD 1IQDB 4P3CL 1MHEA 1ITCA 4PD4J 3P9MB 3X3GL 2E9IA 2R4RH 3WJJC 1N0XH 4F7MB 3CXDH 1N59B 1S3KH 3MNVB 5E2UL 4Y4HD 3IGAB 1MQ8A 1WTGT 3ULVF 5KJRH 5D2NE 3RX8A 2MJWA 3NA4A 2QR0B 1PY4A 4UUJB 2RIKA 4A6YA 2J3SA 1EAPB 1EFXA 3D39E 4KMTH 2EE6A 1JUFA 4XI5C 3AXLA 4NO2A 1YN7A 4WHDA 4ODXB 3V6OE 1GCFA 4CW1A 1KEMH 1OAYH 4XGZB 2W0FA 3L7EB 2LE9A 5CZVL 4YX2L 1FSKC 3C08L 3BWAA 5D6CA 2HVJA 3ARDA 2COQA 5MEQA 1YEDB 3U30B 3PF2A 5T1LA 4KTDL 2ZUYA 2B1AL 4PJGA 4J7RA 4NWUH 1UXWA 4GBXB 2JELL 4JM2C 4PJ9D 4R7NB 1J5OL 4P4KA 1T2QL 2WMPA 5D1ZB 4HK3J 5HHXL 1DL7H 2XPGB 4YBQD 4YE4H 1MJ8L 4ZUSB 4IOIB 1IC5H 1VDGA 1S9YA 2CK0H 2NYYD 3QUYB 3OKKA 2F5BH 1XIWB 2RCSH 4WHTA 4WUUE 5FDWB 3ALPA 1F90H 1X5GA 5F1IA 1C1EL 4ERSL 3DO7A 1A6WL 1D6VL 3QUKB 3X12A 4JRXD 5J1AB 3OR6A 4K7FB 4KKCD 1MCCA 5FM5O 2JB6A 3RZCC 3UC0H 3OMZA 3T2NL 2YD9A 4LGPB 4WVRA 1UB5B 3BZDA 4MA7L 4WFED 3G6DL 2FLRT 1XF2A 1EX0A 3DX9A 3NGBB 2R0LH 5ID1B 4RBPK 2D31A 5DJ0B 4FFWD 4Q97A 2J6EA 1ACZA 1UA6L 3VRJA 5KOVC 5EIIA 4CVUA 1CD0A 4AL8L 1NCTA 3D0LB 3MODL 1QFWM 1MRDH 3DV4A 5I1EH 5T5NF 1F2QA 4U6HA 2NY0C 3E8UL 2I60H 4S1DD 1FFRA 1HEZA 3MRMB 4G6ML 4LLDA 4PJHF 4ZTOH 2PYFB 4RNRA 4PRHE 3P73B 2I27N 2CLZA 3EDEA 3EOAA 5HDBF 5GRJL 4OQTL 1MFEH 1T2JA 5LQBH 3B5TA 5HSFA 4JKPL 5JLZA 1I1AB 1NLBL 2FJHB 4ZQKA 4ZUVB 3W11D 5BV7C 4OUOA 4OSUL 3PWLB 5DK0B 4K3JH 1U91A 1LEGA 4GRLC 1NGYB 3O3EA 2V7HB 4LPWA 4M9OA 1YNKL 2BOBB 1UB6B 1RZKC 3HUJA 3AC0A 5ALCH 1S9VB 4L8BA 3ARFB 1FRGH 1FCCA 5EU5A 3MRJB 2JLLA 32C2B 4URTB 3BP6B 15C8L 2BDNH 4YXLH 5IR1B 2YOCA 1HK6A 3ZO0A 2XA8L 5ADPH 3MRQB 3BEWB 1BJ1H 5FYJE 2R0KL 5D70L 3O2DA 3JTSA 3S35L 1BBJB 5IBTL 1UH4A 5L8LB 1NC2D 4FQCL 1J7VR 1UJTA 1I1CA 4X6DF 1A6ZB 2JF1A 4JZJC 3S3JA 1A9EB 1RUPL 2OBGA 5C0EB 4YC2B 4QT5A 3SDYH 1ZA3B 3RVTD 43CAA 1CFTB 3Q5TA 3WLWD 5E2VH 4I48B 4NZTL 4KMLB 4PTUA 3EYVA 2P4AB 1IC4H 4NWTL 1RVFL 3T08A 2PW2A 3LKPB 3S5LA 3WNMA 3JWDH 3VXUB 4H0HB 4YDIL 5EU7C 2GTWB 1MCLA 1L0XA 1S9XA 3KDMA 4Y4KC 4NQXA 3Q5OA 3FFDA 3FB7B 5K9QG 3H9SB 3RWHA 2MWCA 1A47A 1IGTA 4JQXA 3OL2A 4OB5H 4LEOB 4UQ2A 4LNRA 5FO8A 1MJUL 4Y1AE 3RKDC 2CRZA 3QCUL 3LKQB 4F7EA 4TRPH 5GGRB 2E8ZA 3KJ6H 4HCRA 1UACH 2A6DB 1S78D 3MBEB 4M43L 2HKHH 3UTTA 1OAKL 1B88A 2EYSB 2GAZB 1MCQA 3IT8D 4LSTL 1CIDA 1CFNA 4XHQA 2AK4B 3BGMB 1A5FH 4PJFE 2NXZB 4LK4A 1WWAX 5GJTH 3VXMD 4OGXL 5JHDE 4K8RD 4KHXL 1EO8H 3T3MF 1FBIL 3GMOB 3NCBB 3BQUD 2EDOA 2HWZL 1JI1A 4R90L 2Z93B 2R23B 4MA3A 3VWKC 4UINL 3MMEB 1N8ZA 1MRFH 4OFKA 3BE1H 4RGNB 3P4NB 1KG0B 4MZ3A 2O5ZL 3CC5B 3H8NA 3INUL 3RKPA 2V7NB 1PVHA 4R2GB 1WITA 4FN0A 2HRPH 5HTSA 1UENA 4Q0XL 1T7WA 1H3PL 5D7IF 2DQDL 5FYLE 5ICZB 5C0AD 3NTCL 4FNLL 2K7PA 5IVZA 3EYOA 4HKBB 4QRRD 3K3QA 4JZNA 4RAUB 4ISVA 1UT9A 4MQXD 4TVPD 4RISH 3NIGE 4NGHH 2J8UF 5C1MB 1ONQB 2CLRA 1H5BB 3MLYL 4OUUA 3RWFA 1JF5A 2IADB 4NQCB 3FB5A 4ACPA 4U31A 1J1OH 1P7KB 2X9YA 4PJEB 5KANI 1H3VA 3BZFB 5JIKA 3TM6A 5FHAH 1UZ6F 3CCHA 2NY3B 3P4OB 2HTLD 3VXRA 5EC2A 2A0LC 4EUPH 2VDQH 4HWBA 1UJ3A 5DD5H 5FCUL 4GKSB 4LCWE 5C0GB 3GHEH 4LDEB 5BMFL 3BYTA 3I75A 4I77L 1BQLH 3SCMA 2XACC 2LABA 3TF7C 2ED9A 1NBQA 1T0MB 3WNPA 4XZUB 2GUOA 4HV8A 3NCYP 1G9NC 1V7NL 2JJTA 3A67H 5C9JB 4OZHA 2PR4L 4J3XA 1O7SA 3QQ4B 3QCVH 1F3RB 5CHNB 2BVQA 2KBGA 2HMIC 2NXYC 3MLWH 4AIXA 3CDGB 4N1HB 1DBML 4TYUA 4PGEB 3ESUF 2R4SL 2JJVA 5GS0L 4XI5D 4N0UA 1QR1A 3DVNA 3SKUD 4MD0B 2OQJB 5IMMA 1WSST 4TUJB 4Z78A 1R0AL 4V1DD 3O41A 2R2EA 1JHKH 1R5IB 3AS0A 3WIFA 3N1FC 1DBBL 2WLZA 3OAYH 2WWKO 3IXAB 3FZUC 3E6FA 5IW6B 2D9QB 2R2BA 1U0QA 5AD0B 5F89A 3U4AA 3FFCB 5DYOA 4DN3H 4M61B 4AEHH 3D2UB 2B2XL 4UTAL 3QHFH 4LF3A 3ARVA 4JM2D 1G7MA 43C9A 3LRSB 2EKSA 4G9DA 3T2PA 3DYOA 3MLVH 4DVRL 1P4BL 1XGQA 1A7PL 4X5WB 4R26L 1M71B 2D7TL 2FEEI 1PBYA 2YK1H 1B0RA 5E6IA 1U36A 2FGZA 3C8HA 1I8LC 3BP5A 3LN5A 4TUOA 1CDJA 3ZTJG 4E0RB 2H6PB 4NZRL 2MKWA 4LCUA 1LWRA 3EO9L 4G6KL 4ELME 2XKSA 5BJTB 1B4JL 5FOJA 3RZCD 1GHFL 3PL6A 4LSQL 1G9MC 3SJVD 2MTPA 4P5TB 5C09B 3RWEB 3QWRA 2CH8A 1FVEA 4UNTA 2UUDH 3RX7A 3RGVA 2DQCH 1N4XL 5DJXA 4PFEA 1RZ8A 2BMKA 4F15C 4XPTH 3AVEA 1GXEA 1KJMB 2P7TA 4JKMA 1EUUA 1INQA 1FYTD 2D7PA 2BSED 2IH1B 4FQXA 5DWUH 5HGAB 1DUZA 1RMFL 1W72L 3EIFA 4O2FA 3MV9D 3MR9A 1QBLL 4MX7B 1JYXA 2W9DL 5ENWA 1SBSH 5EC1B 1A6TA 5GGSB 3OKEA 2K1MA 2VKXA 2CQVA 4KY1L 2XKUA 5DJYB 3V4PL 2NY0D 4AY0A 1K5NA 1KBGH 1ZT1A 4EZMA 4NKIH 3EYUL 4JDVA 1XGYL 4X4ZA 5HYIA 3GMNA 3GO1H 5CSZA 1JTOA 5ANMB 5F44A 3V0WH 3GIZL 4N0CD 4CMHB 5GGQH 1T80A 4WJ5A 4X8XA 5C71A 4NFBA 2XZAL 3CDFA 4WGVB 4HFWA 4GRLD 5J1TC 2HFFB 5DT1H 4PIRF 1Y0LA 1IM9B 4BZ1L 2AXFB 4HLZG 4HC1A 4MCYA 4I5BB 1RK1B 1XGTB 3O8XB 1VFAA 2UY7A 3S36L 3U30C 2VAAB 3UROR 4LPVA 3JV6A 4NUJB 3KXFE 3WFDH 1AP2A 2W65A 1JV5A 1N64L 3C60C 4C4KO 2BNQA 4GBXC 4NQDD 5C6TL 2GTZA 1QHPA 1TXKA 4AM0A 4DZBA 5D1ZC 5MP6L 3P0YL 3TVMB 4WGWB 3KVQA 1HHIA 3MJ9H 4KRPD 4X6CB 1H3XA 5IW1B 3MZTA 1YA5A 1OAZL 2DWDB 3LEXB 4ZUWB 5JZ7C 1X7QB 5DFVC 5SX5H 3IF1B 2CPCA 4GG8A 1JWSB 3HLAB 4PGDA 4WUKL 1XIWC 3GJFB 1LO0L 1WJ3A 4XCNB 3TCLB 4DKFH 3QJHB 3BAEL 1UWGH 3KPMA 4PPTA 5MEOB 3PP4L 4KH2A 4ZSOE 5LGHL 1JL8A 4HIEB 1LEIA 1W8NA 3K8KA 5DD1L 4WW1A 5IHUH 3T0EE 1T20A 3KYNB 5FF6B 5CWSB 1MCFA 3DI2B 4X6FA 4PJ7A 1EK3A 1CYGA 4NJAH 4EJ1C 3DMMB 2X4QA 3EYQC 4P2YA 4Y4KD 2NX5D 2EIEA 3NGBC 5C0JB 3KLAA 1IE5A 3QP3A 4F7TB 3WKNA 1BZ9A 3QIUA 3LEVL 4TSCH 4BH7B 3QDMD 1QLFB 4XXDB 1JZ2A 3M07A 1P2CB 4JFPA 3K74B 5EUOB 4HIJA 1HIML 5DD0H 5A43C 4G7VL 1YZZA 2BVOA 4DK3A 2X1PA 5D2NB 2P5WE 4R7DA 1E4XI 2HKFL 2QEJA 3NOIA 4ZG1A 2F53E 5DHYA 4HGWA 1WZMA 4YWGL 1N2RA 5CJ8A 3IFPA 1URLA 4J4PA 1QP1A 4LKCA 3C2SA 4UQ3A 1RU9L 1IILE 4HT1L 4EOWH 5I15H 4AG4L 4KVCL 4GKNB 5H37H 5E00B 3HNTL 4QRQA 4LOUD 4NZUL 4NN5C 3FB6A 3VRIA 4OLYL 1QRKA 4DGVL 5LXGH 1H8OA 1HSBB 2BNRD 2OTPA 3IDXL 4WFGD 4LDLB 1TJGH 4HPOL 4HS6B 1IGJA 3HAEA 1E27B 4YHZL 4OCRH 3VWKD 4MDIB 4HIXH 3ARFC 1ES0A 4YNYB 4JO1L 1JNJA 3WS6A 1DEEB 4TNWK 2YA1A 2A2QT 3V0AC 2PW1A 5EBWB 5C3TA 4MWFB 1CD1B 1HCVA 2BVEA 1QLRA 4L8SA 3ZZ1A 2FR4A 2YBRB 5KW9L 1A9BA 1RI8A 4ZFGH 3PGCB 2Y6SC 4UU9A 4F3FA 1FFPA 1CXEA 4HDIA 3L3JB 2FB4H 4RCAA 3OKMA 3MPCA 3QDJE 1T5WA 4YC2C 4IJ3B 4PREB 3ARPA 5F9AC 5EU6E 3BX7C 5T1KB 1P4LB 1JPGB 5CAYB 1T1WB 4GW5B 5BXFB 2AK1L 3FB8A 1KGCE 3GJFH 4XNYH 3BW9A 4WNQB 1TVBA 2J88L 1X5YA 1RULL 1B9ZA 4PY8J 1A7RH 5IK3A 5JXAH 5I76A 3BWUC 4JFOB 4KK8C 3GMMA 2HLAB 4YGAB 1C5CH 3QQ3A 2PO6C 1FJ1B 4Z8FH 4HWNA 1QSZA 3MLRH 2A0LD 5F7KC 1NANH 2NW2A 4N8CL 3LS5H 1DLFL 4FQ2L 4W68A 4ZUUB 4JB9L 4Y2DC 4LPXA 1DANU 3HR6A 4F33A 2DTML 3OKLB 4YHML 2R29H 1EEYB 4UOW1 4GKOA 1V05A 2PTTB 3M17A 2H9GA 3C6LA 5F9OH 1CGXA 1R3IH 2Y25A 2AI0H 1MHEB 4U7KA 4HSQA 3FTGB 1NFDE 4MMZC 2HMID 4ELKB 2NXYD 3MBEC 4KTYA 2VNCA 3ZE0F 2ED8A 4MVBD 3HZMB 3QO0B 3WXWL 2NXZC 4OD2B 2W60A 4FQ1H 1A1MA 2GJ6E 1WFUA 3FZUD 2VSCA 1ZHNA 2AV1A 2VITB 4CW1B 1WV7T 1C12A 1KLUA 1KCSH 3L3OA 3IDMA 3WS3A 1PYWB 1Z9OA 4LCYB 5K59E 1WBYA 4HW6A 4RRPG 3WIIL 3LPFA 4ZNEA 1M7IB 4G8FB 3VG9B 4R2GC 3ARDB 1EPFA 3UBXB 3LAFA 1YQ2A 1TMCB 4LVHB 5T1LB 1UM4H 2X4TA 3QH3B 4BA8A 1HH9B 5B39G 1U8OB 1UXWB 4P4KB 1FE8H 1PDKA 2FD6H 3K2UL 4FTVA 1A3RL 3PIQA 4PJXF 2Z35A 3EOTH 4LSPH 3VXSA 1NAKH 1H5BC 3WSQL 1ZLSH 3BSZH 3GSOA 4Q9CA 2DLFL 3UYRH 3OKKB 4WHTB 2Z0BA 3PWPD 5F1IB 2NY3C 4X4ME 1XCTA 1GGCL 1I9IH 3X12B 5I2IB 3ARZA 3OR6B 4TVPL 2VZVA 2I9LA 1D5IH 1YUHA 4OZIA 2D7OA 4B5EA 4HX1A 4YHKL 5BRZD 4GKZA 1ADQA 3VFMB 1QA9B 3LVEA 4C57C 5IHLB 4Y1AB 3X11B 2ZG1A 1GC1L 4BQCA 5H37G 5K9KA 4XNQB 1JWMB 3L3KA 2D31B 2H8PB 4J3UA 3FT4A 1NCAL 2VC2H 1I85C 3VRJB 4U1HB 1N26A 4NNPL 4Y19E 2AEPL 5ADOL 3GSQB 4LP5A 2ZZUT 1F3DJ 3MLTA 1MAMH