5A2JH

Crystal structure of scfv-sm3 in complex with the naked peptide apdtrp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
244
structure length
225
Chain Sequence
QVQLQESGGGLVQPGGSMKLSCVASGFTFSNYWMNWVRQSPEKGLEWVAEIRLKSNNYATHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCTGVGQFAYWGQGTTVTVSIVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Deciphering the Non-Equivalence of Serine and Threonine O-Glycosylation Points: Implications for Molecular Recognition of the Tn Antigen by an Anti-Muc1 Antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Peptide binding protein
molecule keywords SCFV-SM3
total genus 56
structure length 225
sequence length 244
ec nomenclature
pdb deposition date 2015-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5a2jH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5a2jH01
5BVJB 4Z5RA 1RULH 1Q0XL 2EIZA 4BZ1L 4ZOBA 1UYWL 2CKBA 2PKDA 3DUUB 4FTVA 4PJ7B 4CBPA 1AGEB 2V7NA 5EU5A 5AWNL 1M6OA 1QRND 4DFIA 2GJZA 1IAIL 1Q9KA 4J2XA 3P30H 5E2UL 3V7MA 4L4TD 3VFSB 1F45A 4IRJD 2NY2C 3WXWL 1VFMA 1U8MA 1XGRB 4XBEH 1H5BC 5C2UB 4Y19B 1FORL 3BPNC 3OPZH 4X7CC 4Y0GA 3RY6C 1ED3A 4ZS6D 3BFOA 4UZGA 2IPKA 1IAKA 2R15A 3QNYA 3MRKB 4GKZA 4YGVA 2OTUA 3P11L 3RDTD 5I76A 4RAUA 4UBDD 2YOCA 1G1YA 4MQ7A 4Y2DD 4JJHA 2DWDB 3D85B 4J3VA 4XC3L 3DSFH 3OB0K 4HWNA 3W82A 2APFA 1B90A 4OTXL 3VWKD 4PJ5D 1NSNL 5ESAB 4RSVA 2H26A 3RWIB 1L7IH 5FOBB 3C2AH 1OAUH 3ARFA 1OAQH 5ICXA 1G9ML 4MJID 1Y18A 5I8OH 3BPLB 1AO7D 4EIGB 4UAOC 3DRQA 3LKPA 5E2JA 1NC2B 1VGKA 2DLHA 4N0CD 3L5IA 5C0FB 4X98A 4M1DL 1NMBH 1JNLH 3HRPA 3MMEB 2ED9A 5I74C 4ZAKC 3P73A 3C09C 4KDTC 3BZFA 3STZB 2FR4A 4DKDC 2PW2B 5T1KA 1QBMH 3TV3L 4MAUL 1U8OA 1R0AL 3REWA 2R0ZH 1NKRA 2HH0H 2W0PA 5TE6L 3RVXD 2R4SH 5AAWA 2AV7B 2IAMB 1M7XA 4DCQB 1I3RA 3RZCD 5FCSH 1PG7X 3ZHKA 3BX7C 5D9SA 3GRWA 3UAJD 3QISA 4NQUA 3IFNH 4C57C 3Q6GL 4F37K 2FBJL 4J3UA 1IGYB 2A6KB 3VI3E 1MIMH 5BZWA 3BKYH 4MJ6A 2F5AH 2F15A 3OMZA 1T0NB 5DJ0B 5L8LB 2N7BA 1V05A 5GGSY 1IL1B 1TNNA 4OUUB 3WMSA 3B9AA 2PTTB 1SEBA 3MLTB 5D7LB 5C0JB 3UTZA 1IMHC 3NFNA 5B38B 3VFGH 5F7UA 3O8XC 1XF3A 4L3AA 1VFBB 4E5XA 1EAPA 5A2JH 1RUAL 5EOTB 2B0SL 4L8CB 3BQUA 3QXVA 2ITCB 4HPOL 3GSOB 2JKXA 4M62L 3VXSD 4IS6A 3S96B 5F7WC 3H3PH 4UOW0 1INQB 5MENA 3SDYL 4C59B 3VD4A 3KYNA 4EKXA 5IROA 1Q0YL 4MLSA 5MEQB 3GSXB 4XNYH 2ZCHL 3JUZA 3BN9C 2ADFL 2H6PA 4L9LA 4UNVA 2AV1B 3K1KC 1OP5K 1WC7A 3L5JA 4NQXA 4OV6F 4HKXA 3CDFA 1FFNA 1DBMH 2DQFA 1GJIA 2DKSA 4B7IA 3SDAB 5EU4A 3UTTB 4XMPH 3DBXB 2WMPA 4F8QA 1FQ9C 4QGYA 5HI5C 1TPXB 2GK2A 4OZFH 4AQOA 4G8GA 3HCVB 4Y4HC 2PW1B 5FKPB 3TA3A 1BQLH 4TNVK 2Y7QB 3V4VL 3MRQA 4W6WB 3RI5K 3TBYA 2AK4B 2PYEB 3BDBA 3ROOA 1LD9A 3GKWL 1QFWM 1VGEH 1F4AA 5DJ8B 1K3IA 3OAYK 1V5JA 4XPTH 2KH2B 5L2KE 4OJFL 5CIPH 1KTDA 3QULB 4JCLA 4E41E 3NCBB 1MCRA 4LNRB 1WWCA 1GXEA 2Y36H 1CGWA 4WTXA 2XZAH 4ZUSA 2B7DT 4YBQC 1F90L 1HXYB 2LV4A 5D72L 2CPCA 1S9YA 1S7TA 4GRWH 4OLZL 2B1HH 4PRPE 3UTTE 4NNPL 5C0AB 4CMHC 1S7RA 1MUJA 1C5DB 5MEOB 2EH8L 3MA9L 1KULA 1AXIB 1T5XB 3IB4A 1G7QA 5TE7H 1KV3A 3UJJH 1KIUA 1VFAB 5ISZB 4OLVL 2IQ9L 5IHBA 2BY3A 4Y5VC 3P77A 2E27H 4P5KA 3EFFA 1GPOL 3FQNA 3LVEA 3FT2B 3IDGB 4HK3N 1YPZF 3O8XD 3U1SH 3QZWG 1WISA 5BVPH 1NGYA 3MGOB 5F96H 2BY0A 1VFOA 35C8L 5D7IB 4P3DA 1J0YA 1S7XA 2BVOB 1N59B 3BDYH 5INDB 3HN3A 5T3XL 1X5FA 3GZKA 3L3HB 5CGYD 3V5DB 3WFBH 5GRJH 5HBBA 3BUYA 3WIIH 5KZCD 4Z9KB 3MLSH 1MSPA 2RBLA 1H3PH 5HI4D 4APQD 1PX4A 4FN0A 1EMTL 1N6VA 1NC4B 4I18C 4MAUH 3DRTB 3JTSB 3JXAA 3T65B 4H1LG 1I75A 4WUKH 5AD0A 3H0TB 3RL2B 4XPGL 5D7JB 1NCUA 3LAFA 2Q6WA 3LKNB 1HHJA 5JZ7D 1QRKA 2GTWB 4P59L 3QRFM 3EO9H 4RCAA 5C09E 3ZKNC 1MEXL 3ARDB 5IB2A 1OTTD 3QCUL 2BSSB 1JF6A 2LVEA 5JA8B 4R0LB 5I17A 1G9NH 1NANI 2GFBB 1ZHBB 4M5YH 1NGWB 4LVHC 5HYJA 3SJVE 3HPLB 3NGBB 4TPRH 2L7JA 4PJAB 1I1AC 4OZIB 4XGZA 4KTEL 3KPSB 3HE6C 3IDJA 3AUVA 4XWOD 3DVIA 1TZHA 5JW4Q 3BH9B 4P5TC 4P2QD 1WUNT 1SBBA 2VZTA 4JVPA 5JUEL 1NANH 3LH2L 1FE8L 1A5FL 4WGVB 3UTPD 2VLRD 2EDNA 2HYMA 4IS6B 3RA7L 3EJZD 3VWJD 4DFHA 3MX0A 4P2RB 4JM4L 1WBXA 3DVNB 4LASL 5AYUL 4MXWH 1T1WA 3VG0H 2Z93B 2HVJA 5GGVL 2COQA 2WWMD 4QRTA 3KLHD 1DJSA 2VLKE 4I77H 4Q9RL 2B2XL 3VDCA 1FNFA 2CDEA 2IPUK 3MO1B 2AQ3A 3AU1B 3SHSA 5F7LB 1XCTB 4MDJA 2OL3A 1QQDB 1A14L 4Z7VF 1DVFC 4Y4FA 1KCKA 2GJ6B 5IMMA 3QBTB 3G6JA 2OZ4A 4QT5A 4HIEA 4W70A 5E2WH 4N0FA 1A9EB 4L1DA 3BESR 4X6DE 5B39B 3UJTH 2GCYA 3GJFH 5TH2B 3PWLA 4X6CB 1HEZB 5B4MC 1OAZH 3E6HA 3SDYH 3QQ3B 2FJGA 5J13C 4NN5B 2NY0D 3SDCD 2E8YA 4PJGE 1J1PH 2ADGB 5F1KC 5T1MB 4OZHE 3T08A 2V6HA 2P5WD 4XCEB 1DLHB 2JB6A 3EDKA 4OFIA 4CMHB 2ARWA 2Q1EA 4FQLH 3BZDA 3FHAA 1DBML 4G9FA 2F5BL 4YDLC 3TT1L 3X3GL 1IC7H 4GSDL 2CLRA 1BEYH 4KKAD 1SJEA 1F8TH 3DRQB 3ESUF 5E4EB 2Y23A 4MVBC 1RIVH 3U36B 4UT9L 5T1KB 4HPOH 4HJGB 3MRLA 2YK1H 4BQ8A 5H37G 4NNXB 4NQTA 4XP1L 43C9A 3L5XH 5EUOF 1I7RA 3SDDA 4HIJA 2P24A 3O9WC 4M8QA 3VJ6A 1MVFA 2F54B 3IDXL 4L5FL 3GMLA 3CCHA 3F7VA 3S34L 4NQDB 1BOGB 5DA0B 5DR5H 2JJSC 4R4BA 2W59A 3DJ9A 2ZUWA 4OD2B 5CS7A 4HUXA 4LSTL 4ERSH 3VMPA 1TVHA 1Z2KA 32C2A 3QI9B 4JHAH 4BSVA 5MHSD 2X4PA 2DQIL 3RWJA 3MNVA 5ITFA 2VQUA 3T3MF 4MX7B 7FABH 3QNYB 4YHML 1BIIB 5CBAB 1WEJL 1DUZA 1HHKB 1HYRC 1ZLSH 3VXOA 2YPLE 4FQCL 4PTTB 2AS5M 3MV8A 3GK8L 4CMMB 4HF5L 1TZIB 2EIDA 4PRAB 2OR7A 1D5XA 2W0FB 1INDH 2IFFL 2FJHA 2NW3B 3IXAB 5FHBH 1EK3A 1U8KB 3T0EC 5CINH 1VEPA 2XRAH 3MJGX 2E7MA 4FQXA 4FG6C 1B6DA 4RMWA 1JHKH 4TUOB 4NKMB 4P4KA 3RUGA 1E27A 2HMIC 4B53A 4OKVB 3AC0A 1RPQA 4RMVA 4XX1G 4BZ2H 1BP3B 2EDRA 3LS4L 1Q72H 4I13B 2FD6L 1G1CA 4FQ1H 1IFHL 3NIGE 4QOKE 4PJ8B 2H8PA 2X4UA 3L3KA 3W2DL 3RZCA 5HGBB 1G6RH 4NQCA 3KLDA 2MJWA 3BPCB 3RWEA 1D9KD 4WVRA 3UMTA 4KUZL 3QPXH 3OTTA 1P5VA 4OKVA 1BFSA 4O9HL 4PTTA 1RK1B 2NXZD 4ZAKB 2OL3B 2CK0H 4K2UL 1DFBH 3ZYJA 3BZEB 1JPGB 4NN6B 4L4JA 4XHQA 4PFEA 3MNVB 5DRXA 4LASH 4RGMB 5AYUH 3LKRB 2A0LC 4D8PA 1D5IH 4JY4A 3WUWA 3EO0B 2Z9TA 3MCKB 2QR0A 3E3QC 5E1AB 5CBAA 1LK2A 5I8EB 4G43B 1XT5A 3ULVC 1DLFL 3MROB 2XFXB 1RJYA 3QUXD 4FZEL 4K3GA 4EDWL 3TEUA 2GQHA 4PB9H 3L1OH 3D18A 4WRLA 2LU3A 3CXDL 1BZ7B 3H9YA 2NY6D 3ZMRA 2V2XA 4M93C 3FT4B 4OM1H 3DXAD 5DJDB 4Z7NF 1EEZB 3PABB 1HXMB 2GY7B 2W60A 2OXHA 1R5IA 2AXFA 2X4NB 4G8GD 43CAA 4F3FB 2HFGL 2YPVH 2IALA 3IFOB 5T5NG 3RVTD 5M94B 1FV1B 3BGMA 5I2IB 5C6TL 1KLGA 4X99B 5ISZE 1KJ2L 1YNKL 5KVMC 1MJ7L 4KKBD 5DQ9B 4NKIL 5I16B 1EHLH 4MMXC 3F7YB 1MI5B 4DOHB 3HTLX 4GRLC 1P84J 4ODBD 1FO0B 4KROB 4JFFA 3L6FA 4DKFH 2RAMA 5GGRA 3TIEA 2NY4B 5T33L 1F58L 4ZO8A 3ILPA 1F97A 3GIVB 2XICA 3QUXB 4XVSH 5I1KL 2IJ0C 3MFGB 1G9MC 4OI9A 5DSCB 1JZ7A 2I9LA 3S37L 4WDIB 5HDBE 2C7UB 3RY6A 5ESVA 5E00A 2GUOA 2SEBA 4PJHA 1Y6KR 2QQLL 1I7RB 4XXCC 4U0QB 3GRWH 1CU4L 1J1OL 4XXCA 3KS0J 2F9BT 3INUL 2OTWA 1IT9H 5D70H 4WV1C 3MRGA 2VKWA 3FFCD 1MREL 3IETB 2QSCH 3Q5TA 3LD8B 5IMOA 1NCDH 4L4VA 1QQDA 3KPQA 5DQDL 2EH7L 4LLDB 3ORJA 2DQEL 3Q6FA 4JGJA 5T5FH 3GMRA 2H41A 4MD0A 1XGYL 1OP3K 4FQLL 1ZLSL 2CRYA 4HGWB 3NZHH 5HHOA 3CMOL 1INDL 2IFFH 1J0JA 2XWTB 1L0QA 4JEGB 5DZOA 4G5ZH 1PX3A 4Z7OE 4NBXB 1CE1L 2HJKB 3VXRB 5IB5B 4APQA 4GKOA 2AI0H 4TNWK 4P46B 3GNML 1LO3L 1ZEAL 2K7QA 3SGEI 2EYSB 2XZCL 1HKFA 4HH9A 4YHMH 2J8UF 1CQKA 1UCBH 2GCYB 3ZDYF 4AZ8A 4YO0B 2VDKH 1IEAB 5C9JA 5IB1A 4UILL 3BD4A 1CE6A 1IFHH 3ZKMD 3K8MA 2QHRH 4I3SL 3VGFA 4CVUA 5E4IA 1OAKH 2C3VB 4HF5H 5A43C 4XPAL 1OL0A 1X5AA 1NAKH 3C8KA 3CVHA 2UYLB 3JTTB 4EQ2A 2YWZA 1SQ2N 4YX2H 5L9DH 1FYTE 2ZG3A 4OF7A 4S1QH 4GRLD 1OGTA 3IDNB 1R3KA 4P2OD 1NC4A 4XI5D 1LEIA 5DDHA 2JJTA 4P2QE 2GITB 4OFVA 1U2HA 4PR5A 5J3HC 5CZKA 2YC1B 3KPSE 2HRPL 2VLRA 3VRLE 5KBNC 2ITDA 1N3NA 12E8L 1S5IH 4JFFE 3ZKQD 3O6FD 5D1ZA 3N1GC 3TIDA 1M7IB 2Y4SA 3OR7B 2EICA 3KPNB 5L8JB 3AS1A 2J4WH 5F8QC 2JTDA 4RRPA 4O9HH 5D2LB 4MD5B 1KELH 2MSPA 1QD0A 5IV2B 1UWEH 3KPLB 3BXNB 5CJQL 4PRID 4QLRA 3RWHB 2AERT 1T5XA 3GGWA 3LKQA 3PWVA 1ACZA 4L9LC 4WJ5B 5IF0A 3O2DH 5E8EB 1V7MH 4LKCB 3O6MH 1W72B 3GMNA 2FGWL 2AXFB 1WTGT 1EIBA 4GG6E 4OM1L 4F7TA 3CFCL 1WQVT 3ZLQC 4FQIH 1D3CA 5C9JB 3N1PC 3QEQE 2H32H 3MXWL 1QSEE 1FN4B 2DQHH 2R0WH 3CSBA 3F6IA 4DCQA 1TCRB 5AWNH 1JL8A 4R7NB 1D9KB 1IAIH 2Z8WC 4LSPH 3KPPB 5C6TH 2BFVL 4DW2L 4ZUWA 3T0VA 3IFPA 4NN6C 3SBWA 4P3CH 5EN2B 5C0IB 4KHXH 4OF3A 3EYOB 1LEIB 1LDSA 4XHJC 2V5YA 4Z7VA 1MJJB 5I6XB 3EFFB 4FABL 2Y9RT 5I1JH 2D7TH 3BEVA 1D9KC 1D5ZB 1G0YR 4M4PA 4CU6A 4LLUB 2NYYD 4RRPG 2JCCF 3VXMB 1GSMA 4EI6A 4OTXH 3PGCA 1NSNH 4MZ3A 5MEQA 1AE6L 3ZT7A 3ILPB 2EDHA 1MWAA 1T2QL 1KXQE 4O4YL 3MJ9A 2E7CA 4M6NH 5J9PA 3GSOA 5EZLA 1KTRL 3LD8C 3C5ZC 3OAZK 1FYTB 5I30L 2XNAA 3DVGB 4PB9L 1FNSH 1YN6A 4HLJA 4GUPA 4NZRL 3W5NA 1QLRB 3OXRB 3ILQC 2QEJA 1EVTC 5F89A 3NIDE 5D6CB 3RWEB 5I19H 1KPRA 3DBXA 2PTTA 3MLTA 4I0PD 4J1UB 3IU4L 4PJFB 5E00B 4XWGH 2K9UA 3SQOL 4H8WH 1YY9D 2VDQL 1JPST 3JVGA 5E5MB 4Z7UB 4ZNEE 1ZV5A 1MFAL 4QOKB 1FL3A 4U1KB 4BSWA 3A67L 4P2RE 1MFBL 4P2QA 4Y8AA 2OSLB 4ODWA 5KSAD 2X42A 5TQ2L 5CP3A 4NJAH 4ZSOE 1N2RB 5T5FL 4JM2B 4RZCB 3HPJB 1JGVL 3QDHA 4UDUB 5JPMB 4KWUA 3O3EB 4D94A 4OD3H 5J1AA 4KMTL 2AJZB 2KUTA 3L3DB 3QUMB 4OFKA 2R69H 4KKLC 4WCYL 2PW1A 4PRIB 2AVGA 1JZ3A 4DKFL 4O58L 3FO2B 3CLFL 4ISVB 4YHKH 5MENE 1DBKL 5E24E 5D7SH 1X5HA 4DN3H 4YBHA 2L4OA 3UTSB 3KLAB 3BISA 3MLVL 4ZNCD 3C6SA 2V5SA 1EEZA 3PL6A 3MLRH 2F54D 3REWB 2R9HC 4KVCL 3AXLB 3FRUA 4P2OB 4GAFB 2DQUL 3DGGA 4HLZG 5A16A 3V6ZB 3BZFB 2FR4B 2HLFD 4EI5D 2WWKT 5F44A 1JHLL 5DD3H 5EZJA 5DJAB 3T3PE 1FV1A 5FHAH 5HDLA 3MRFA 1B3JA 4IJ3B 4S1QL 3ZDZF 4MZ2A 1OM3L 4OF0A 3CDCA 1MFEL 2XN9E 4PG2C 3LS5H 4J4PA 5IIEA 1I1AB 1E4KC 2R4RL 3K46A 3G08B 5EZIH 4XMPL 4YAQA 3D5OF 4O02H 5FOJA 4C54A 1ULVA 4U1IA 4DZ8B 1RIUH 5GJTL 2NY0C 1BQLL 2MKLC 4MAYB 1H15B 2G9HA 2GT9A 5I1IH 1XGTA 3MLUH 5I76B 3PDGA 1AGEA 5ID1B 3OJDA 3RBSA 2FO1A 3DUUA 1WFNA 4HXAH 3MV7A 5GS0C 1NL0L 5F88A 1SJVA 3HUJF 5IVZB 4XP6H 2CXGA 2EE9A 4LDOB 5FM8A 4I4WA 4FFZH 4C56A 3KPOB 4L4TB 1ADQA 3D18B 1AR1D 1QBAA 3RZCB 1KJMB 3RGVC 4RBPH 3X12B 2Y5TB 3BPOC 2X4SA 4JB9H 3KXFB 5HVGB 3FFCA 3LRSA 1E6JL 4LIQL 1QR1A 3DIFA 3D3VE 5I8KL 1KEMH 1UA6H 2UWEB 5KSAB 3KHQA 1J0IA 5DK0A 1M6OB 5CJ8A 4PJCF 1RAMA 1H0DB 2NW2B 2DYPB 4NDMA 3DMMA 2WINA 1SVZA 2NLJA 3FQUB 3UZVB 4XNXH 3WIHA 4XWOC 4X7TB 4N90D 3WIHH 1V3JA 4HXBL 2PYEE 4EN3A 3GJEB 1BFOA 2HVJB 4FABH 5I1JL 12E8H 4Y1AD 3U4EB 1X44A 4UINH 1OAYH 3FMGL 4UTBL 2VXSL 4OCWH 2VB5A 5J57B 1ZTXL 4V2CB 2X1XR 1BMGA 4PJ9D 2EE2A 5L2KA 1UT9A 1N5YL 4TOYL 5DTFA 3TO4C 1KGCE 1OPGL 1LO5B 4LSUL 5MP6H 1P6AB 5CJ5A 4U1NA 3U0WH 1P53A 1U3HA 1KCVH 1BVKA 2JJWA 2Y5TA 4Y19D 3FO1B 4AH2A 3PWPA 3U9UB 3QIBA 4H25B 3DIFB 5C09A 3KPOA 4OGYH 3RIFK 4TVPH 3SE4A 4FQXC 4OB5L 1Q38A 3X13A 4S1DD 3X12A 2JK5B 3L5WB 5BVJA 3MFFA 4JFDB 4ZOAA 3HZKB 4LLQB 4ISVA 4M7JL 3EO9L 1VPOL 4OCSL 5IFAL 1FNSL 3E6FA 3B9KB 4A6YA 4YHNB 1F42A 5ID0B 3ZDXF 1XZ0A 4HIHB 5D1ZD 5JW3L 4WFFE 1T7WA 3DVFA 2Q76A 1SEQL 3ARZA 4GMSH 1B4JH 1RZKL 3SKNA 4XWGL 3HZVA 1ZANH 3LN9A 3Q1SL 3RAJH 2RCSH 2IFGA 5IGXL 2OM5A 3MRLB 1XEDA 4PRIA 3QO0B 1HILA 4ODXB 1A5FH 4HWBA 5EU6E 1WAAE 1QRNE 3ARGD 4ZUVA 4G8EA 2FHBA 3AS3A 4GXVL 1A0QL 2EXYD 5E8DH 2OI9C 3QJFA 3BIKB 3QUML 1VA9A 4RNRA 2NNAA 3V0VA 5K59F 5MERA 1H3UA 1U36A 1OWRM 3V7AE 2XNAB 4G6AD 1U8QB 3W9EB 5MEPB 4AIZA 1QFOA 4U49A 1QACA 1E4JA 1C1EL 5CHNA 2VDLL 1QPXA 3HPLA 4NGHL 3SQOH 4YNYB 1UACH 3PHSA 5DQJA 1H3VA 2QQNH 3GSNA 1DBBL 3VFOA 3CFKA 2L7UA 1QSEB 2EDWA 2BSTB 3SO5A 4L9DA 4Y1AB 1RUQH 4P2QB 2AGJH 4JFFD 3CDYA 5A2FA 2BVQB 5I15L 1U8NA 5CP3H 5C0BB 1CGVA 2AXGA 3QNZA 5MI0B 2BNQB 4Y4HD 1BIHA 1KJVA 2Y06H 2CRMA 2IAMC 1LK3H 3HZYA 3UJIH 4JG1H 5TDPA 4Y5YB 3U7YL 4P46D 3TH3T 1NDMA 1MY5A 4TUKL 3U82B 3UC0H 5LGHL 2VAJA 5F89B 4LLAA 4MA3B 2FCBA 4GUPB 4GSDH 4OZHF 3SY0B 2VLKB 1ZT7A 2CLVB 3BN3B 4V1DB 3K81A 1A9BB 2D7QA 5IJVB 5JIPA 4I5BB 3MCLL 4PUBH 4YZFF 3JWNC 4HKZA 1QA9A 5SWZA 2VNCA 1C5CL 1MWAH 3QEQD 3E3QE 1M7DA 4FP8L 3D39D 4OZ4A 3GI9H 3KJ6L 4TVPE 1NCWL 5I1EH 3DETC 1UA6L 1JFQH 4PJDA 3T4AB 3LHPL 1IC1A 4GBXB 5DK3A 3GMOA 4ZYKB 2P8LA 5IV2A 5FHAL 1DQDH 2ESVA 4M5ZL 3FB5A 4S1SH 2WUCH 5ISZA 4D2NA 2VE6A 1WGOA 4LQ1A 3TJEH 4HJJL 4XTRD 2Q86B 1VHPA 2D3VA 1P4IL 4NKDB 5D7JA 1CFQA 3BQUB 5EUKB 1UQSA 2NY3D 3B6SA 5I8KH 3VU2A 2G5BB 1P5UA 2OTPA 2BVTA 1KIPA 4Y8DC 2X7LA 3FOLA 3IDIB 1A7NH 5ACMA 4R0LA 4R8WH 4WW2C 5EO1A 1A1NA 3F7QA 5F1OB 2X41A 1SEBB 2QQKL 3LKSA 1I8IA 4R7NA 4EZMA 1OP5H 5T1KD 1MLCA 3ZDZE 4DVBA 1OPGH 2N56A 2PN5A 4ZUWB 3ISWA 5BO1H 2DD8L 5DO2C 3CX5J 3KYOA 4NRZA 3I02B 1H5BA 2QTEA 3JTSA 4PJIB 5CIPA 2NX5A 4ZAKD 3I2CL 3ZTJH 5IB1B 4KDVA 4ODTH 4GW1A 3L7FB 4NKQB 4AK1A 3QCTL 4HQQH 4U6HA 4N0CC 3FAXA 4QHUB 2HA1A 4JZNB 5E2TL 3MRNA 1K8DA 1KEGL 3WLBB 1EFQA 1U3JA 3C2AL 1DQML 5FGSA 4QTHA 1NEUA 1TJHL 5ACLA 4M8VA 2O61B 2RJMA 4BKLB 3EO1B 5IEHB 3MLZL 3BHBB 3GUTB 3CFEB 3VWKC 2QHLA 4LNRA 2W38A 5GRUL 2ESVB 2Q8AL 5LXGH 2YPLA 1INEL 4YO0A 1KIPB 4KH2A 3VH8G 4Y2DC 2AK4D 1RULL 1BVLB 1BBDH 3PWJA 2VN4A 1CXFA 5MEND 1OF2A 5DVKA 2VIRB 2DRUA 4WUUB 1NLDL 1QRNA 4RFNB 2IMNA 4DKEH 4FXGB 4WHTA 3DV4B 2FX7H 4K71C 4O2CB 1A64A 3VRJA 4XBPA 4C56E 3LCYA 5E5UB 4EBQL 3SEPA 3IFLH 1B2WL 4X4ME 4XXDB 1T66C 1G9MH 2E7LC 1AKJA 1FORH 1ZLVH 3FOMB 4OCYL 2RQ8A 3QXWA 2LVCA 4DKAA 4NC1C 2H1PL 4HFWB 1N7ML 1XF2A 2EIEA 1A2YA 4HKXB 5FA3A 5EA0L 1C5BH 4OGYL 1ITCA 3VFSA 2HVKA 2RGSA 2YRLA 1JZ6A 3O2DA 3OQ3B 3GFUA 2P43B 3OB0H 1INQA 2VQ1B 2A73A 3CAFA 5I1AA 2XN9B 4XTRC 3FQTA 4YHPB 4K3JH 4LDLB 5SX5H 3VXME 4YHLL 2H32A 3VD9A 4Y1AA 3T0BA 4POYA 3VFNB 5F7HA 1OQOA 2FRGP 2P5EE 3CZFB 3DECA 3O8XB 3TA3C 3BEWA 2IBGA 4DUXA 4LFHD 1JGEB 2AW2A 3BP4B 3MLWL 4PJ9A 1P7QB 3TLRA 4NM8L 3WFZA 5IW3A 4NQEB 3VXNA 4X4YA 4L4VB 1CICA 5GRVL 3OKDA 1ORSA 1DTUA 1T1YB 5D5ME 2VXUL 2DQGL 3G5VB 3QIUA 3PV6A 1QLFB 2BCKA 3GMPB 3OJVC 3MA7A 4MA3A 3FB8A 1XZ0B 3SY0A 4C56D 3PABA 1Z3GL 4D0CB 3BD3A 4WWKA 3S6CA 4PRHB 3VMOA 3PWPE 3RNKA 2R1WB 3VFUA 3GB7A 4XP9H 2XWJB 3ZDYE 2W1NA 2VDMH 4JG1L 1KN4H 1J12A 3FTGA 5MERB 2R2HB 4K55A 1K6QH 2YPKB 3QO0A 4UB0H 2F5AL 2DWDA 2Z8RA 5FYKL 3CSYA 1UCTA 3AY4A 4YHNA 1UZ6E 2QQLH 4GQPH 4XPTL 1CI5A 1A47A 5IEKA 3S97C 4E0RB 3MCLH 1CXKA 1R0AH 2EDOA 4N0UA 2NMSA 4NZDA 1IGIH 1HH6B 4AEHL 2QQNL 3O9WB 4LSRL 4M43L 4OI8A 1C5CH 4BK5A 3QDMA 4X80H 3O6LH 1OP9A 2A6KA 5DQ9A 1F3DH 2BJML 4AIZB 3ZT6A 2Q8BH 1YECH 1MLBA 5SWSD 5K9QI 2XKUA 4LCWB 1U8IA 3P73B 3G5XA 4LSQL 4LVNC 3VWKA 4JANB 3ALXA 5D2NE 4KDWA 3DO7A 4G6AC 9CGTA 3QJFB 4JRYE 2DIJA 3U7YH 4CNIA 1XGPA 1RZIA 4HCRH 4JFXB 3SE8L 3NPSB 4XPHH 4YHIB 3GBLA 4HC1A 3HMXL 5DTFB 4AM0B 1U6AL 1YEGH 3K80A 3QG6A 3EIFA 3CMOH 4Y19A 2X4UB 4R2GB 4PGCA 2FEEI 3B9VA 4LAJH 4YUEL 1HINH 1M1SA 4ODTL 2FO4A 3P4NB 4ZFGL 3GBNH 1Q9KB 2DJ4A 2GJ6D 3QIBB 2NZIA 1CFBA 1NBQA 4QRPB 3BPNB 1BFVL 4CDGC 3DURA 5J13B 4D8PB 3QIWA 4HZLA 5HHXL 5J1SC 1UH3A 3DX6A 2YMXL 2DI8A 4GLRH 1IAKB 1A7RH 4JFYB 3DO3A 3L3OA 4UTAL 2D4FA 5HPOA 3TZVD 5B22A 1SYVB 3T4YA 5J56B 3HI6L 4P3WA 1DSFL 4XCCH 1WWWX 4POZD 3D6GA 2XQYK 4H20L 4B41A 1Q1JL 4RGOH 4JRYB 4HZLB 5D7IE 4U7KA 3VG9C 3RHWF 2K7PA 3JV4A 4D3CL 1IQWH 4HUVA 4YWGL 4U1SB 3NCCB 2R0KH 4XZUB 5DHYA 2VERN 2UWEF 1ZT4B 5ICYA 2A6DB 3IF1B 1E6OL 2JCCE 2YSSA 4PRPD 4LCYB 1AKJD 4QRPE 3OJDB 3MOBH 1BBDL 4MS8C 3RVXC 5T3XD 5CEXB 5DMYA 1Q9LB 1S7WB 3WNMA 2HKFH 4P9ML 4FZ8H 5DJYB 3ZYOA 4IMKC 4Y5XB 4HUXB 1DQLH 1QSFD 4FQJL 4JFDD 1PY9A 3P4NA 4N1HB 4R0LC 3THML 2NTSP 4MNQE 2AJSL 2R1YA 2APBA 4HUUB 1H8SA 1OD9A 4WFEE 5IVXF 1IM9A 4CDHA 1CFTA 5DYOB 1NFDA 5EULV 3R06A 5DUBA 5DK0B 2HFEB 2R1XA 3K8LA 1KTKE 5EPMA 1T1YA 3TA3D 1INEH 2AKRA 2HTLC 3MRPA 1ADQL 2WBJD 3MRRB 1BZQK 1TPXC 2GK0A 5LQBL 3UTSD 3P2TA 4QTIL 3D2UB 1FZJA 3U48A 3ZSTA 1ZGLA 5I6XC 2R2HA 2R56L 4UBDC 1BWMA 3OKLB 3RDTC 2GW5A 4XPGH 1TJGH 3AMKA 3I6LD 4MA1B 3GB7B 4K7PH 4U1HB 5HHMD 5CD3A 2DL9A 1R3JB 1P4BH 5IG7A 5IOPA 1WTLA 4XNMB 2E8ZA 1HIML 5D7KD 5GGVH 2XWJA 1G6VK 2C3WA 5IMLA 3KLAA 2A74B 2VLMD 4X6FB 4JPIA 5D93B 3UEZA 5L0QB 1R5VA 3PL6B 3TBSB 5I0ZA 3TT1H 1R3HB 1NGXB 5A3IC 3B43A 4MNQD 4OV5B 1EMTH 5DZLA 2YR3A 2XKNB 4G7YL 4MJIE 5FYJE 4JCMA 4LSVL 3V6OC 2YK1L 3MV8D 4U6YA 2X70B 2VDML 4FA8A 5F93C 2VDQH 3HC4H 3LQAL 3MRIA 2CKNA 2CMRH 5EZJB 1QRNB 1MFAH 1TZHB 1CFVL 4G42A 4WWID 3KGRA 1CLCA 4JM2F 5HHNB 1O5DT 2HFFA 3ARGB 1YEFL 4XH2A 5JR1L 5CEYA 5JHDD 4BFIA 3LB6D 5CUSL 1IKNA 3U30C 5DR5L 2V2TB 1A6WL 4LSRH 4M43H 2NY1B 4C83A 1Y0LB 1KG0A 1URLA 4ONFL 4ZPTA 5JOFB 5KSBB 2VQ1A 1C7TA 3RVWC 4WCYH 1CG9A 3BEWB 1YEDB 3TBTA 4H1LH 1JPFA 2HVKB 1PEWA 4MXWL 1N64L 3G6JB 4UT9H 2GJ6A 5GZND 5LGKA 3SDXB 5HYJB 1QBLH 2WLYA 3SKMB 1SBSL 2DBJA 1A3QA 4JO3H 3BKJL 1YNTA 1VERA 3GSVB 5EO9A 5DD1H 5C0CB 1R5WB 1LE5B 1K6QL 2D03L 4HGMA 3GJFB 3QZWB 4CW1B 1JYNA 4X0KB 1PKQA 3DWTA 1MJ8L 1T22B 3OG6B 1F4WL 2P5WE 3MO1A 5INDA 1NFDE 5HGHA 4JKLA 1DSFH 4PLKD 5E2WL 1KJ3L 4P2RA 4WTZG 4Y16B 5DFVC 3T2OA 4ZFGH 1ORQA 5GS1B 1YDPB 2C5DC 5E4EC 3BE1L 2OK0H 3EYUL 5D7IA 3O2WL 3MV9E 3SE3A 4JFEB 2F58L 2PUQT 1S9VA 3SOBL 4LVNB 1NAML 1RZ7H 4NJ9H 2W9EH 3QIUD 3QA3A 4YWGH 3WFEH 1HHIB 1HHJB 4J6RL 2BNRD 4KJWC 4M6OL 4QRSB 5DMIH 4DGVL 5GJTH 3X3FH 2G60L 2OQJA 1KFAL 4KUZH 1HH9B 1LO0L 3MOBL 4ZUUA 3LV3B 2Q87A 3MLUL 4GW1B 4K7PX 5H94B 5DMKB 5FHBL 5IBTL 2P8LB 1J8KA 3FFCE 4NNYB 2F54E 4HJ0D 2ZPKH 3D9AH 1CXEA 3HNSH 5FO9A 3WN5A 2OZ4H 3FO0L 3RX8A 1NUFA 2M2DA 3LQMA 2Z91A 4OCMC 1I1FA 1NPUA 1XIWD 4LCUB 1E4WH 1IGCL 2BNUB 3ROLA 5HYQB 1QSVA 3RNQB 5CP7B 4ELME 3U0PB 1NMBL 3NFSL 5DHVB 3UROR 5DJZB 1I8IB 5HGHB 2VZ1A 4XCCL 3DMMC 3RX5A 5DEZA 2P7TA 1FDLL 4QY8B 3MRBB 1GOFA 1AH1A 4GG8A 3IJHA 4ZDHB 1RD6A 3LDBC 2R4SL 2EZ0C 3UTTD 3W0WD 2NY4D 2M26A 1ZT1B 2X44D 2LU4A 1U95A 5KG9B 1LO2H 1ES0A 1P2CA 3HE7B 4NQCD 4PGBB 4YHOH 3RRQA 2VE6B 1G7QB 1RI8A 5DMKA 4FXLA 1RHFA 2FBJH 3STBA 3X14A 3F12A 4X8XA 5ALBL 4NKDA 3QDGE 3SCMC 4PP2A 1FNEA 2VDRH 1J0KA 3OAYH 2VSCA 3F5WB 3T09A 4M9PA 1ROWA 2EXYC 4NT6A 5C0AA 4XC1L 3QXTA 3VFRB 4D0DA 1YMHB 2FSEA 2BNQA 3DX8A 2E6PA 4MNQA 3THMH 3LMJL 5BJTA 2FEDD 1Z5LB 1DN2A 3HZYB 5EFIB 3HRZA 2R0LL 1T1ZB 3HE6A 3T8XA 3GSNB 5D96B 4P2OC 3W2DH 5HHNA 3QUXA 3WKMH 3KPQB 1JNNL 4LHUA 1OTUC 2E9BA 4G8FA 3HI5L 3GRWL 3C60B 3ARBC 3PDDA 3CXDH 2SEBB 1YNTB 4PJHB 4GW4B 2VLKA 4R97B 2EDQA 2D0GA 4NKIH 4UMGA 4IOFD 2BSTA 4C4KO 3P9MA 3VFPA 3QRGL 3JVGC 2YEZA 4JFED 1QFWL 1E28A 4PV9A 2QSCL 3Q1SH 1QFUH 1TQCB 3AM8A 2UZYB 5KJRH 4FQXD 1G6RA 1QSED 2G5RA 4LPUA 4XRCA 5DEFB 2DM3A 2H6PB 5J11C 3W39A 2OXGA 1I4FB 3PP3H 1HDMA 1T7VA 4JO3L 2VDNH 5LJYH 4N5EC 3MRPB 1ZS8A 4UU9B 1A3LL 4OQTA 3MJ7B 4YLQT 4DAGL 4U33A 1YNKH 1EHLL 5I8CA 1MJ8H 1FGVL 3LEYL 5E8NA 4C55A 4JG0H 2YUXA 5ID0A 1F11B 4HWEH 4F3FA 2A83A 3QFDA 5T33H 4WI4A 1IT9L 1C1EH 5D70L 1ZGLB 4PJCA 4LPVA 3UYPA 1FZJB 2AABL 3DX7A 1CTNA 1F90H 1KLGB 4P4RA 3UYRL 2BZDA 3RIFF 3VW3H 1G7JB 4XMLH 5D8JL 1NAMH 2DJSA 3BKJH 1EHXA 1UB5A 5DEGB 3ULVF 5BW7A 43CAB 3VFVA 3S88H 3A6BH 4OF8A 2JELH 3QEHA 3HMWL 1NFDF 2GTZB 5TFSH 1R5IB 1KCRL 1R3HA 3BGMB 4HDIB 3X3FL 5TE7L 4UDTB 4KQ4L 5CCKH 4X6FA 1N5AB 2A74A 1X5GA 1AIFB 3FN3A 5HJ3A 2OK0L 3D25A 3ECBB 3S3PA 2DQDH 3HR6A 4MA8H 3G5YB 5C07D 5LAXA 1OARH 3MACL 2X89D 2OCFD 2CD0A 2A77L 3L3GB 4PG9B 4MXVF 4PJ8A 3D87B 3RPKA 2B1AL 4U1NB 4IIQA 2QHRL 4KKBC 3BMVA 2J6EL 4LDEB 2EDTA 3U4EA 3RHWK 4KROD 3NFSH 1FC1A 4KVNL 5L2JB 2VUYA 1RZ8A 1HN1A 5DYOA 1T80A 3RWFB 3BGAA 3DMMB 3V79C 1EGJH 4PPTA 4ACPA 3PWPB 2D7NA 5BQ7B 4U4BA 5IFHL 3HNSL 5IBLD 3RGHA 4NQSB 5HVHB 1OCWH 3STLA 1RZ7L 1SJHB 5JQ6H 3DSNA 1FP5A 5DUPH 1ZVSA 1IEBA 3BMWA 1WVZA 4XPAH 4MQ7B 1NCAL 1HK6A 1XMWA 2A6JB 1NAKL 5J11B 1RZ8B 5K93A 1PQZB 3TNMB 1CK0H 1PZUB 3UJJL 2BFVH 1GC1C 4KFZC 1T5WB 5CJXA 2BVEA 4RMRA 3WUWB 1MFCL 5EOQL 4NQVA 3LSOA 4NFDA 4F33B 2R9HD 4IOFC 2FO4B 2E27L 3D39E 3O11B 1LO2L 1ZLWK 4JR9L 1OVZA 3ARBD 1MHHB 3TVMA 1CGUA 1JPSH 3BO8A 4NOBA 5A40E 3UBXG 3FJTA 2VAAB 3S98A 3U4BH 1DL7L 3SJVD 1OGAB 4IRJA 2W0KA 4U1LB 5EBMB 3UO1H 4JFXA 5KSUB 3TESA 1HHKA 4N68A 1DUZB 1TVHB 4KKNA 1YPZA 1WIPA 3D0VB 1JK8B 5L0QC 1A4KB 4DK6A 4KK6C 3HI1A 3AGVA 3MV8B 4PREB 2VC2L 5ITFB 4NO0D 1CVRA 2DQHL 4R6UA 4JO1H 3KXFA 1FRGL 1KELL 4OGXL 4M03A 5HHOE 4YR6A 3ULUE 1IEBB 3MRMA 2FZ3B 2BHYA 1KB9J 2Z31A 4XC1H 5CEZE 3I6GA 1KCSH 3O3EA 4MX7A 4FNLL 1MRDL 4IJ3C 1BQHA 4MJ2A 4MA1C 3CSPA 1V7ML 1G9EA 1KSRA 1S5HB 1UM5L 4PRPA 5B8CA 1MHEA 4X6DF 3MGTB 4WIQA 3SCMD 1U8HB 3IDMB 4LAQH 4FQIL 5J8OA 1ACYL 1QFUL 4NN7C 4EI5A 3U7WL 2VKXA 5E5MA 2C4XA 3NTCH 1JF1B 1MI5E 4HZAA 4F7MA 4N0UB 3EOBA 3ILQD 3WS6C 4KQ3H 4YH6A 1IILE 4HC1L 5HYJE 3QHFL 1MCKA 4ZSOA 1XIWA 3FB8B 4F80A 4IDLA 5ESQA 3D0VA 4W6XB 1XR9B 1HSBB 2AJZA 2ICWJ 2QV2A 4P2RD 3CFDA 2FJGB 1OGAA 4IRJB 2KBGA 2VAAA 3LKOB 1TLKA 3OXSB 5K33A 4GKSB 3F8UB 2JF1A 1EHNA 1YN7B 4I77L 1AE6H 4XCEA 2PTVA 1QHOA 1XIWC 3AXLA 4NQDA 4P2OA 1HCFX 2RB8A 4XPBL 5A16B 5J06A 4Y2OA 3T8XB 5ITBH 4G9FB 4JDZA 4Z7VE 5EORH 4KK6D 5IM7B 3CSYB 2BNRE 3V0AC 3WS6A 4NJAL 1X5JA 2H3NA 3GHEL 4NN5C 4HX1A 5IK3B 4KGJA 3PQYB 3B5GA 5CD5D 3EW3B 3GSUA 5D5MF 1HSAB 2FJFB 4J3XA 1NDGB 4YXLL 1CZ8L 4M02A 4XVJH 5TE4L 5B38G 3VW3L 3G6DH 3QXDA 1FNLA 3AREA 5B8CC 4PJGF 3TPUB 4JKWA 3CLFH 2Q7YB 1YN6B 1LILA 5KJRL 2BP3A 1WBXB 3IRZA 4I8DA 3QWOA 5C0BE 5F3BB 4DUVA 4OLUL 3CUPB 3W11D 2ATPA 1AXSB 4MVBD 1KPRB 4K3EL 5E03A 4XP4L 1LNUB 1T89C 5C2BL 4Z77B 2YD2A 3MJ9H 4FQCH 1A3LH 5FK9B 1FYTA 4JPKL 3E1F1 2BY2A 1T21B 3S3JA 1NEZA 1X5KA 4G9FE 4Z7VB 2GFBA 3O4OC 2DB8A 3L3GA 4XP6L 4J1UA 4O58H 4NWTL 1U8LB 1FVEA 4IBLT 4WFGE 3VXMA 3ULUC 3MRNB 3TVMC 1MJUL 5GIRA 3B8YA 3V7AG 4H1LB 3SGDH 4AMKL 4L29B 3C5SB 3W0WA 3DI2B 5HHPA 3FQRB 1N59A 5IW6A 3NMEA 2YZ1A 1MF2L 4OZGE 4XI5C 1F4YH 3G6JE 4RA3A 2ENSA 3MRBA 3WN5C 3AU1A 5JOPE 3L7FA 2Q8BL 1G7HA 2HT3C 4M7KH 2BDNH 4HDIA 2I26N 3FT2A 2M8XA 4U7SA 3FT3B 4YXKL 1LO4H 1PLGL 2YRZA 4NRZB 3BXNA 3C6LA 3NABH 1FYHB 1MFEH 3S5LG 1YEEH 1JWSA 4XNXL 4HCRL 3SE8H 3LKQB 1VKXA 3WFHB 3EJJX 5L88H 4MXQD 2R39A 4U2ZA 3EO1A 5IEHA 2YS4A 3VGBA 4MDIB 4QHNA 1I7TB 2BK8A 4WUUA 3QFDB 1OAYL 3FMGH 1V7NH 4LP5A 3EJZC 2A83B 4UTBH 1K8DB 4DN3L 2DM2A 4ODUB 1S7SA 2MNUA 4P5TD 4Q0XL 2AJUL 1EEQA 3HE6D 3WJLC 3V6BR 5MI0C 1N5YH 4WW2F 2J6EH 2A6IA 2HKHH 1CDUA 1KTLB 3K0WA 1UWGH 5IB2B 4X7SL 1OW0C 5IBUB 3LDBB 1T03L 4PJDB 3TWCL 2BNRA 3M07A 4XCFH 3RTQA 2IH1A 4IRSC 2DICA 4PJXA 4B5EA 1WITA 5IFHH 1OT2A 5J12C 4Y5VB 1FH5H 5FDYA 3VD5A 3H0TA 2VDPL 4LEXL 4PBVC 1NJ9B 2HT4D 4PJAE 4OZIE 5IJVA 4OQTH 1A6UH 1Q1JH 5FM5M 2FD6H 3BP6B 3KJ4C 4XNUH 5D2NB 3OKMB 3G6AA 3P9MB 1S7VA 5ETUA 3FB6A 4ZYKA 4G6KH 4XAKE 3BP7B 4OD1H 2Y7QA 2DLEA 2FX9L 4RGNC 3VXRA 4V1DA 5GSRB 1C5DA 5MEOA 4UV4L 1GIGH 2YA2A 1XF4B 2OMNA 3LOWA 2P8PB 5IP4A 1UH2A 3TO2B 2P47B 5C0RL 1MJ7H 5CGYC 1JF5A 1T6WA 3VCLB 4GMSL 1CE6B 4JREC 5E6IC 1DFBL 4R4NC 4KHTL 3ZTJG 1ZANL 4FFZL 4NNYA 1VFUA 4OZHA 2HJLB 1F58H 3FAWA 1BVZA 5I1CL 1X4ZA 4DVRH 1D5IL 3JTTA 3V6FB 2YXMA 2D2OA 5T3ZD 1AFVH 1OTUD 1UB6A 4GJTB 3QNXA 3CXHJ 4Y89A 3WO4B 3BZ4A 2VC2H 4EN3C 3BP5B 4TOYH 1K5NB 4DGIH 4LHQB 4JY6B 5CKAA 4L3ED 4PJEA 3WKNA 1EAPB 4WV1B 5KW9L 5D2NA 3RVTC 3Q5OA 1MNUL 4K23L 2ZKHL 2J5LC 1CG9B 4GS7C 4OB5H 3KYNB 4UIKL 1A1MB 3WIHL 1Q8MA 1QNZH 5IMOB 4NZJA 3MV7D 5CLWA 4JQVC 4P23B 3Q48A 4QKXB 3V4PH 4WO4C 2YA1A 3EDDA 1T22A 5GXBB 2AGJL 2NTFA 4QY8A 1QZ1A 3CFKB 2BMKB 2HJFB 2X5PA 1U58A 3J8F7 3WXWH 5F3BA 1KYOJ 1YEKL 4I1NB 5IR1B 2KKQA 2Q7YA 3QUXC 4U1MA 2HLAA 5MENB 5LCVL 4ETQA 3MYJA 2CRIA 2E9JA 2EEDA 4NO0A 1T0MA 1CE1H 2RCSL 5F9OL 1S8DB 3IAQA 5HHQB 1DANU 2VDLH 2WNGA 3DMMD 3GO1H 4PLJD 1JRHL 3VFGL 2B0SH 2DTMH 4O2FB 5D1XC 4QHKJ 1I1RA 3PF2A 1RZGB 3QUKB 1J10A 1RUQL 5E95B 5CJOH 3B9KA 1VPOH 4OCSH 1U3HB 2FGZA 3FN0L 3MRRA 4P99A 1QR4A 5KVFH 1TENA 2VLLB 4BFEA 5I2IA 3MODH 4XCNB 3VWJB 3FQRA 4NP4H 2C1PB 5IG7B 4OM0L 1I7UB 2JCCA 3ARSA 5C07B 3X13B 1B4JL 1MREH 2DM4A 5TQ0L 3CK0L 4HIHA 4W4NA 3G6DL 4PJ5B 2ID5A 5HPMA 4M6MH 2MTPA 2OX5A 4XNZC 1IARB 4UAOB 5F9JB 4OSUH 1BBJB 1KB5A 2V2XB 4QF1A 4IDJL 3WHE1 5EU7C 2HMID 1XR8B 1T7ZA 2LQRA 2ZP0T 4GXVH 1CL7I 1R5VB 2EEAA 5C0FA 4FG6D 4NHCH 1GOHA 4NWUL 1MCNA 5KSUA 4FFYL 3EBAA 1CXIA 2XTJD 4KI5D 1YEEL 3K74B 3MLYL 2IH3B 2FX8L 3MV8E 4M3KB 4QRRA 4XZUA 4H88H 4PRHD 4N1EA 1P4LB 4Y5XC 1IEHA 3RPIA 2G2RA 2J1KA 1J8HA 3MUZ1 3QJHB 3I2CH 1H0DA 3UTPE 1KJ3H 1IQDB 1UWXK 4JE4B 2XV6B 4JFHD 4I9WD 2H2PC 1HSAA 2FJFA 5HGDA 3N0PB 4Q2ZB 1KYOK 2NLJB 3FQUA 1NMCC 3S4SB 4TSBH 4ZPTB 1JCKA 3MXWH 4G43A 1F4YL 2F53A 3EAKA 4OZGF 1T83A 5C6PB 2HKHL 5HGBA 3CXHK 3L3KB 2HT2C 2FLRT 3OKEB 1PW3A 1TXKA 1ZT4A 4OFYD 4QRUA 3E8UL 1XGQB 5BOZG 1U8MB 1S3KL 4Y4FD 3RY5A 1KB5H 3C8HA 2AAVA 4UV4H 4WI3A 4F7EB 4GRLB 4UT7H 3JWDL 1SHMA 1NEZG 4JKKA 5E08H 3CU1A 3VJ6B 1GGTA 1N0LA 4XNUL 3ZTNL 4OLVH 3MV11 4LLMB 5I1CH 43C9B 3T0EB 5ESQB 3BH8B 1RUPH 1I9RH 3MRHA 5FUCC 4QHKI 1XR8A 4IIQB 1OY3B 3MRKA 4J3WA 5CWSA 1PG7L 3BW9A 3QYCA 5I1GH 3ZHLA 3RL1B 1KN2H 1T2QH 4O4YH 2VLJB 1JF1A 3QJHA 1Y6NR 2IMMA 3RWJB 4HLZH 2X6MA 3QDMB 4DZ8A 1B4RA 3TFKC 3P4MB 1EFXA 1RUML 5E8PA 5CSZB 4ZTPL 5F7KC 5EO0B 5AAMA 4IRJC 4XNMA 1FH5L 2A2QT 3UX9B 3SDCC 1HHHB 5T3ZL 2VOTA 4QYOB 4JKPL 1FL6B 3HA0A 1Z9MA 5CD3B 2DI9A 1SMAA 2IADA 1WAAA 2NZ9D 3A6CL 5DS8A 5BOPA 1EBAA 2NZ9C 2J6EA 4MA7H 4OCXL 1IKNC 3OHXB 2R1WA 2F19L 3M17B 4LLYB 3ARVA 5DRWB 4L8SA 4IRSA 1R6VA 4RISH 5SWZD 3DX7B 4BSVB 4HIXL 4K94C 4LF3A 1I85C 4KY1H 3G5VA 2O5XL 4RZCA 4OFDA 2JB5L 1CICC 3ZE1F 4LBEA 4RWHA 3BJ91 1DR9A 4OCRL 2VDRL 1XCQA 2VXUH 3IJSA 2DKUA 3QT2A 5EBGA 3FRUB 4WWKB 3PWUB 2OL3L 3CZFA 3O8XA 5KVEL 1G0XA 2HTLD 4RGNB 2PO6D 3IKKA 4X8JB 1IE5A 4YDLB 4XB8A 4WFHD 4UU9A 4R3SA 5J7CC 4JM4H 4ZFOA 2JB6B 1HI6A 3G9AB 5HHVL 4M6NL 1MAML 4KVCH 3IFLL 3TNNA 2JJTC 2EE3A 3HR5B 4CVZB 2QBWA 3OKNB 2VLLA 2EDJA 1I3UA 5KW9H 1GRWA 4OZGA 3IU4H 1C5BL 3U36A 5IQ9B 1RZGA 1OTTC 4U1SA 4NM8H 4OLEA 1FFOB 2PTUA 4X5LA 2IPTL 2XACC 2CLRB 2E6JA 4U3HA 3N85H 1AKJB 3BZ4B 5F7MC 4NO2B 3DLQR 3EDJA 1DQTA 5CSGA 2C1OB 1AGDA 4Q74A 3QDGB 1NGZA 4EI6B 2DS4A 2VLJE 2FX7L 4PRBB 4APQC 5HI4C 2LTQC 4HWZB 3MODL 4NWUH 3LEVH 3IFPB 1MJJA 2ESVE 5D71H 3EZ8A 1EJOL 1UKSA 2EC9T 3V8CA 4NUGL 4TPRL 1NL0H 1TVBA 1I7ZA 4KI5C 3T3PF 2R69L 1YMHA 4UB0L 2A73B 5I1AB 4Z6AT 3HE6B 1T1ZA 2OS7A 1U8PB 1UXWB 2NTFB 3BEVB 1MCJA 3PQYE 1M71A 4OGAC 5HYSB 5I1HL 4WFHE 3ECBA 3HZMA 4JRXD 4K3DH 3C60A 4RA0C 4KPHL 3MBXL 4RAVB 5IHLB 1B9ZA 4AEHH 1CVSC 4MDJB 3R8QA 3VE0A 7CGTA 1NFKA 2EDEA 4M7LL 5I17B 3BP4A 4PJ9B 3I84A 5KANG 3WFCL 2YBRB 5DD6A 3F62A 4N8VA 5J6HA 1JIBA 5DWUH 1T3FB 5J0BA 4X6CE 5HI3D 4WHDA 3OR6B 4HKJB 1X5ZA 4ODSH 3DVGA 5L7XL 2JELL 4M1CD 3PWVB 4U6XB 2EO1A 5D2LF 3MLWH 4YBLB 3IDXH 1EAJA 1UM4L 1ZA6B 3VRIB 3KNBB 1Q9OA 1ZE3C 5JNYB 5IW1B 3RQ3A 3I02A 3W9DB 3UJTL 1P1ZB 1YMME 2A6IB 3MZTA 3DXAA 3SO3C 1J5OL 3HUJA 2XPGA 1FO0H 4X80L 2VLJD 1UH4A 1HINL 4TTGA 4PLJC 1I9RL 1X6NA 1RIUL 3KPLA 1HZHH 4PGZA 1NGYB 3MGOA 4HV8B 4ZMAT 2P7TB 2WK2A 4MXVE 3TF7C 1EUUA 2AJYL 3AS0A 3CFEA 3DROB 4PY7A 1E0OB 1A6VH 3BUYB 2YD3A 4BKLA 1W72A 3GMNB 2MCPH 5FGRA 1XF4A 3OSKA 1RZKC 1I1FB 3RWHA 3NACH 3GK8H 5C3LD 4PJ7E 4PJBB 3QZWA 1AJ7H 1CGSH 1FL5B 4W4OC 3EDFA 2Z92B 4PP1C 4XC3H 2IGFH 1JNHB 3G6AB 5BXFA 4HEME 2MOVA 1RURL 3CFBA 3GSRA 1KGCD 4HKJA 3SDXA 3VXSE 1PG7H 5I1GL 3OX8B 4WO4D 5AZ2L 4TSBL 3V5DA 1H3WM 3NA9H 1J87A 1JPFB 2NQCA 5CZXD 4Y19E 1BD2B 2HJKA 5I18L 4KZEL 4QHNB 4CVWA 3DHJA 4YGAB 2XY1A 4JHZA 2XA8L 5JXEA 4ZTPH 3BN9D 1MCPL 1T04B 4ZUSB 3T1FA 3WL9A 4BUGA 4GBXA 4PJ5E 1ZLVK 4IEFB 5C3TA 1Q0XH 2JB5H 1OOAA 4RGOL 1KB9K 3RAJL 4X6DB 4YQXH 4ZUUB 2VUOA 4NQED 3UDWA 1JGLL 2PYEA 3S36X 2FDBP 4EUPA 1FZOB 1A0QH 3JV6A 1JWSB 2XKNA 1T4KB 3QUMH 4DVBB 2BOBA 4BSJA 4HIXH 5E6ID 5EU7E 3OKMA 4S1RH 3AB0B 5JMRA 2WWKO 2X1PA 1ZHLB 4Z0XA 3DUHA 4HPYL 1G7LB 1PEZA 1ZLUH 4M1DH 5JA9A 1SYSB 2J7LA 4FRWA 1HWGB 2XRAL 4JHBA 3QXDB 1CDYA 3L1OL 2IH1B 4PJXB 5DGQA 3TGXA 3RKDD 4KTDL 3MRDB 4JKPH 2AK1L 4N0RA 1KENH 1AGDB 1HNGA 1FVDA 5T3XE 1JN6A 4LCCB 2YUVA 3WNNA 4GRWB 1W72L 2ZNWA 3CUPA 1MY7A 2B4CH 3HAEG 1UM5H 5DSCA 2NXZB 3V0VB 4GW5B 3TO4D 4WUUE 4U3CA 2K1MA 4DN4H 1KPVB 4P57B 5CP7A 2LABA 4PJ9C 3MCG1 5DRNA 4KJPD 3P0YL 2R0KL 2LE9A 5DLMH 1JPTH 5CILH 3UTZB 4HG4K 1LGVA 1WJ3A 1B88A 2XA3A 2NXYB 3OGCB 4Z77A 1MIML 5DJ6B 5JOFA 1QO3A 5KSBA 3NFNB 1JJUA 3G5ZA 4CAGA 1A6PA 1PZ5B 4XNZB 3CNKA 5DMJB 2OP4H 4LPCA 4PJGB 2WAHA 4K9EH 4NZUH 5DVLA 3TPUA 2D31A 2PYFA 3PHOA 1F5WA 3WS3B 4EI5B 3QUZD 4FMKA 2PETA 4E41A 1KXTB 1HQ4A 2ZG2A 2OJEB 4QHLA 3LY6A 4LLQA 5D1XB 4D9QE 5DJDA 5HHME 4N0YL 3GSNL 4PRPB 5KTEL 3W0WB 3AS2A 3HFML 1I8KB 2XQBL 2XFXA 4U1HA 4LVOC 4S1SL 1JNLL 1DQQA 1ETZA 2X9YA 3GHEH 2HT3D 3PNWB 2NY2D 3U9UA 4WTWA 5D6DC 4DQOL 2QR0B 5E1AA 3WCYA 5IOPB 2E9WA 2R0ZL 4L4VE 3INUH 3HZKA 4G7YH 3MNZA 1P4IH 3O2WH 3WIFA 5DO2D 1KLUA 4X6CF 4YXLH 2W0LA 4IM8A 1ND0B 5T1LB 2J3SA 1HSBA 1OGAE 3S35X 4F9PA 4WU5A 3SGDI 3KWWA 1UENA 4Y16D 4XAWH 3HAEB 1QHPA 3G04A 4RMTA 4J6RH 1QBLL 3FQWB 5E8OA 4DGVH 4RWYL 1CD1A 2AJ3B 1UM4H 4LIQE 3PJSA 1X7QA 4PJEE 4PRNA 4R26H 1S7QA 5FIEA 1OTSC 4G8EB 1FFRA 3NZHL 2IEPA 4ELMF 3TVMB 2ADJA 3QFJB 4UNUA 5AEAA 4AL8L 5IJKC 3MV01 3VFMA 1VSCA 4JFEE 2CK2A 3QIBD 3ZYIA 5SV4A 1IAIM 4HQQL 3PE9A 1U8JB 5K9OB 1WSST 5EBWA 3BH8A 1D6VH 2NW2A 3AM8C 3BE1H 1JK8A 3OKEA 4HG4J 1ZVSB 2GKIA 4I0KA 5I0DA 5F72S 4EN3B 2F58H 4EXKA 3H3PL 5CEXA 5D72H 2DQCL 3DETD 2MCPL 2Z35A 4F58L 1DQDL 2JLLA 2A1WL 5CD5C 2A6DA 3PUCA 2BVPB 2WP3T 4QOKD 5JXED 4HWZA 3LSOB 3SDCB 4JJ5A 1NBYA 1QVOB 3O3BB 4Y5XA 3KPMB 2F8OA 5I1DB 2IBZY 1A4KA 2HAZA 2CKBH 1PLGH 3EYQD 1WBYA 1UFUA 2R29H 4NHUB 4KKCD 5IKCA 4GKZB 2CDFB 2EKJA 1YYLL 1GPOH 4LLWB 1CDGA 1TTFA 2ATKA 3MBEB 5L88L 5FGCB 1FBIH 4WHCA 2IAMD 1FZKA 2HRLA 5LAXB 2OZ4L 3WJJA 1S5IL 4ORGA 5KSAC 4L8DB 2P48B 1L9NA 1QFWI 4GKNA 1W8NA 1RIHL 1YEHL 3OF6D 5D4QA 4FTVB 4TULH 1A1OB 3CFJB 4RAHA 3SCMA 4DTGL 5IIEB 3WFBL 1AO7A 1J88A 3SDDB 5J12B 1BGXL 4BFBD 3LN4B 3KYMA 4FFVD 2GT9B 4OGZA 4QHMA 4WU7B 5FF6A 4JZJA 2ADJB 3MLSL 4HW6A 4ETYA 3MNWB 3FRPG 1FE8H 1DDHA 5ELIA 2JJUA 4C56B 4JPVL 1LP9E 4Y88A 3TCXA 2Y6SD 4PTUA 3ARQA 2XZAL 4PG9A 3UXFA 1KF9B 4M3JA 4PGCB 5JHLL 1BIIA 1A4JB 1BF2A 3T1WA 5BQ7A 4NZTH 1D5MA 1AHWC 2DQTH 3SJVB 1BZ9B 5I75C 3PL6C 2C9AA 1BPVA 2F54A 1ZOXA 4DN4L 3H9ZA 1HQRA 3FFDA 5L2JA 3EYSH 4Z78A 3IXAA 2WM0A 3O6KL 4O5LH 4PJAF 4OZIF 2CIIA 1D6EA 2FX9H 4JPWH 3T2QA 3U2SA 4KTDH 3ULSB 1P7QA 5L9DL 4DW2H 5I9QC 1FDLH 5IJKA 4KRNA 4QCIA 4XHJD 4FXKA 1YMMB 4KTEH 4HS8H 3TN0A 2FECI 4GAGH 3DPBA 1JYVA 2HG5A 4LU5H 2ZUVA 3VMNA 4YHPA 5T1DH 3C60D 3U1SL 3NIDF 3SCMB 4XCNA 3VWJA 4JN2A 1CT8B 4PRIE 2WV3A 3DI3B 3NZ8B 4DVRL 1PBYA 1RK0B 1UADC 1HE7A 2R0LH 3B8SA 4WO4A 5EUOB 3DUSA 2VDNL 4Q9RH 2VRAA 4ZFZA 2H1PH 4ZUTB 5BS0D 3AVEA 3QUKA 2XQBH 2DLTA 4PY8I 2ICES 2P42B 5FFLA 2ZSVA 3WBDA 1DN0B 1JGDB 4LGSB 5HHQA 2ZG1A 3B2VH 5FAAA 1EBPA 1HOCA 5DD5L 4KK8C 1QLEH 5EWIL 5T1MA 2HN7A 4P59H 4Z7WB 3UYRH 1F2QA 4XPFL 4CN6A 1MH5A 1WZKA 3WV0A 4U1GB 2B2XH 2Z4QA 2FYYA 1ZHKA 2VXTH 5F9JA 1KBGL 3I85A 5DI8A 1OB1A 4LSQH 2E9IA 2FSEB 4XGZB 1IGFL 4X6EB 4RWYH 1L6XA 2VLKD 3C6SB 1FIGL 2P5WA 5IB4B 4KROC 4U6VL 3MBEC 2YPLB 1DLHA 1TTUA 2FIKB 3QH3B 5EBWB 3M1BA 1BEYL 2VZOA 3MC0A 1F8TL 5EN2A 5C0IA 4NC0B 3VFRA 5C9KA 3VFMB 3QHTC 1JVKA 4XP5L 5LKNA 4LCWE 4ZTOH 2X40A 5D6DA 4LRIC 2D7TL 4LPTA 4AM0A 1MFDL 4Y4HA 4PJAA 4OZIA 1PVHA 3GDBA 1CFNA 3F12B 4R2GD 1TIUA 5C1MB 3FHQA 1F6AA 1HHGA 3OAUH 3FQTB 4OBSA 3HFMH 1NBYB 1QVOA 3O3BA 2Z92A 4XT1C 1TJIH 4ZXBA 1C8PA 3S36H 2BSED 3VXTA 4K94L 1BD2E 2AEIT 3VXRE 2WSKA 1XCTA 3RGVD 3JZ7A 3SDDD 3H7BB 3FB7B 3FN0H 1F13A 4QOKA 1CBVL 4KQ4H 1AC0A 1QUNA 1IGIL 4HWEL 1L0XA 1AXTH 4JFPA 3HRZB 5IROC 1EV2E 4PB0H 3CK0H 4BZ2L 4X9HA 5K9JL 1YEIL 4WNQA 2FATH 1DQQB 1ETZB 5C6WH 3NCMA 2C26A 2BNQD 3LPGA 2Z91B 5E9DD 2XZQL 1C16A 3T0AA 3CIQA 5F7FA 1H8NA 3OX8A 1WF5A 3RP1A 2AJ3A 3EYFA 4MD5A 4MYWB 3TYGL 5BXFB 3O4LB 1RZFH 5E6IB 4LKCA 1KIRA 1GHFL 4W68A 3P9LA 3U4BL 3ARXA 2DOCA 3QDAA 2W9DL 4HKZB 3DRTA 1GGIH 3T65A 2G75B 1MIEH 1KJ2A 4QTHB 2XN9D 2LAGB 5C07E 4NBZB 3WDHA 2VWEC 4HBQA 4NCC1 4NYLB 3LQZA 4KDTA 1FN4A 4PBXA 4PJDE 2NX5D 3EZJB 3VCLA 4GG6B 4JPWL 4QTIH 4NFBA 2P8PA 1P7QD 2BVOA 1OM3H 2R29L 1FFQA 3ZSSA 3KPRE 3HNTL 4KKLD 4LPWA 3BI9X 3GI8L 3UPRA 2V9QA 5FKPA 3I9GL 3TA3B 5BRZE 5HSFA 1E4KA 5FK9A 1K4DB 3TN0D 2VLRE 1JP5A 1EO7A 1JUFB 1IQWL 3QA3B 4PG2A 1P4BL 4MD0B 2FEDC 3MACH 3T4AA 1XF2B 4BH7B 4APQB 5IB5A 1WZ1L 1ZHLA 4EOWH 4OLWH 3JWOH 3FZUD 4P0DA 4WGWB 4MB3A 5CEZH 5JOPD 3P0VL 2CO7B 2CUMA 1UQSB 3B6SB 1UZ8B 2CIKB 3ARTA 2GIYA 4TULL 2ZOKA 1FSKC 1LMKA 5DJ2A 5H8DA 3VFWA 4TNVF 5GGTH 3DNKA 3QFJE 1MWAB 3QHFH 5TPWL 3D3VB 1N3NB 2J5LB 3D0LA 4YDIL 3RGVB 1AGFA 3O3DB 1X4YA 1KTLA 3ELAT 1S7TB 3D3VD 4AEFA 1MRDH 4I0PC 3RVVD 3QO1B 4JR9H 4HX1B 3ARWA 4RNRB 1C08A 1AD9B 2VLME 4RFEA 1CD0A 3F58H 5DD5H 5GRXG 4NZTL 2DQTL 1MH5B 5C7XH 4GO6B 5HY9B 3ULVD 3D39A 4U6YB 2BSRB 5DT1L 3U79A 4LAQL 5LG1A 2UYLA 5DJCB 4OUUA 1WBZB 4MJ4A 1NCAH 3VI4F 3WN5B 2O61A 4I48A 1M05A 3T0DA 1GZPA 2Y72A 5SX4H 4HWBL 3I50H 3WLBA 4Y1AE 4KJYB 2HP4A 4PGEB 4U6VH 1KCSL 2W9LA 1NCCL 2H45A 3DYPA 1A6WH 3QQ9C 1KOAA 5JO5A 3KPSD 3UPRB 3VFOB 5HDOA 3W9EA 1MAKA 1U92A 3OKKA 1H5BB 5KSBF 1HNFA 3IAGC 2XWBA 2IC2A 1DBJL 1VCAA 3UO1L 1MRFL 5C92A 4P4KD 1IGFH 5F7DA 4XPBH 1HHHA 1UC6A 4YPGB 2MQ3A 3PHQA 3GMRB 2UY7A 3MGTA 2WQ8A 5B8CB 3CMGA 2ICCA 3VG9B 4KK9D 4L3CA 1FG9C 4F7PA 3VH8B 1HCVA 2CIIB 4IOSD 4KJWD 5C0CD 3B2VL 2FZ3A 4URTB 4I3RL 4TYUA 5HTSA 5JNYA 2XZCH 3P0GB 4MHHG 4AMKH 4NGHH 1X5LA 5ICXB 2IPTH 1ACYH 1S5HA 3MCKA 2VABB 3EYFB 3S36L 1UEMA 1BZ7A 2IAMA 5DFVD 3WHXA 3O6FC 5DURB 1YJDC 3NH7L 3MV9D 4A6YB 1M7DB 1J1OH 1AQKH 4OZ4B 4ZS7L 3R0NA 4WO4B 5EUOA 5FOBA 3RWIA 2AQ2A 1KT2B 2APTA 2YD5A 1U9KA 4AY0A 1OP3H 2NCMA 1YYMH 3MFFB 5HYSG 2R8SH 1T5WA 3F65A 4GS7B 4OBRA 1G0DA 4FTVE 4LVHB 4N8CH 4X83A 5BV7H 3R8BB 3LPWA 3QP3A 5SWSA 4ZO6A 5D7LD 2O5YH 3P4OB 4PJ7F 2W9DH 1SBSH 1C7SA 1FNAA 1AD0B 5HGDB 3OAUL 5GRZA 1MIEL 2PW2A 5DD1L 3GBML 3BRFA 4ZOCA 3ZKMC 4JO4L 3ZKXC 1XF5A 3GMMB 1IAMA 3GI9L 2DWEB 5D1QB 1NAMA 3QH3A 1TETH 4GXUM 1F4WH 4IOIB 4J23A 1CU4H 1IGTB 3JWOC 3FFDB 4Y4HB 3RUGF 5IHUL 1BZ9A 2VXQH 1YC8A 2AI0L 3HG1E 1EEYA 4YJZL 3GNMH 4P5MA 4KKAC 1REIA 4RMUA 3SDAC 4FMFA 4K3HA 3B83A 1LEGA 15C8H 4NJ9L 2BVYA 4F33A 1BM3L 5MEPA 4N90E 1I85A 4PJ8C 5D2LE 3WFEL 3WHE0 3WFDL 4JZJB 4ONGL 1WZ1H 2E7HA 2I60H 1M71B 4OLUH 5HYSA 3G6JF 2I07B 4PJ7A 3VFTB 4BK4A 3PQYA 4L8SC 2VR5A 5FYKE 1W0VA 2BDNL 3QFJA 2QADD 3C9NA 1EXUA 4LOUD 4G6JL 4ORZC 4ESKA 3OKLA 2OR9H 4RMQA 4ZFZB 3PWUA 4G5ZL 4TUKH 5JW4R 4BJLA 3CH8A 1K4CB 1FJ1B 4FS0A 3ULUL 4YIQB 3FN9A 3F58L 4M8QB 2CKBB 3BYTA 1AGBA 1V7NL 2DAVA 2V17L 3V52H 3DXAE 1AY1L 1JTTA 1I9IL 4K8RC 1AFVL 2CJUH 2BHUA 1TDQA 4GAJL 2XOTA 1MWAL 1T83C 5EU3B 1XIWB 4H26A 1XF5B 1OAKL 4L8SB 2WWMC 5ID1A 5LWYL 1MCSA 1YMMA 4I2XE 2WBJC 3TT3H 2YUWA 4UQ3A 4JRWA 5DURD 4JN2B 3Q2CA 4M5ZH 4JFDA 3DX6B 4I4WB 2NR6D 1CFSA 5GJSH 1MNUH 4PV8B 1BECA 3V6OE 4P48A 1IM3A 2E5EA 32C2B 4Y4KB 2R23A 5L8KB 3UBXI 4UIKH 3ULVL 5F88B 1QKZL 2A9NL 1E4XH 2NY1D 4HIIB 5GGQL 1I1AD 4FQQA 1K8IA 5EIQA 4L8DA 3TJHD 5E99L 5TQ2H 1U3YA 4BQ6A 3H9SD 4FQ2L 5F9WB 4ENED 2VWEE 5GGSB 3AAZB 4X9BA 1F3JB 1XH3B 1AI1H 5ALCH 2APXA 3ZKND 1JGVH 4XNQB 1A7BA 3KYMB 1PZ5A 5GGTL 1F4XL 5JZ7C 2GJJA 1BD2D 5CZVL 3VFPB 1RVFH 5BMFH 3ZL4L 2AEQL 1FGVH 4KMLB 3CPLA 1QLFA 5DZNA 5F9AC 4MNHB 4PJXF 1I8LC 1WK0A 5DEFA 1F11A 1DDHB 2ZJSH 3FTGB 3L95A 1DVFA 2P8MB 3VXNB 1ERNA 4Z7UF 1CLZH 1JPGA 1CTOA 4GRLA 4QYOA 5C71A 5TJWK 2PO6B 5KOMC 3L3DA 4M48L 1MFBH 3WKML 5KSBE 2BC4A 4M61B 4OD1L 3WE6B 4POZC 5E9DE 4U1KA 2IG2H 3WJJC 5K9KB 1HYSC 5F1SA 1T20B 4JZOA 5EUOE 1U8JA 4ONHB 4UI2A 3DTXA 1Z9SA 5CILL 1LP9B 5IVOA 5FGBC 1N5AA 4GMTH 5EBLA 4LLVB 3QG6B 2O5ZH 3RPIB 1T0PB 1I9JL 1IGTA 1IAOA 3QR2A 4GRMB 1A2YB 3DO7B 5ADPH 4O02L 4ZOEA 5DC0A 1VENA 4D0BA 5C0EA 4OLYH 4LQFH 4ZD3H 3MRJA 5IFJB 1JRHH 5K9OA 1M05B 1R3IH 3P40A 1OAXL 4JQVA 4AENA 4X7FC 3QDJA 5C0AE 5HYIA 2Q6WB 5I30H 4YBQD 5J9PB 1JV5B 3LEYH 4QRTB 4J3SA 3GSNH 4QF1B 3MLYH 1GOGA 2H32B 3IDYC 4I18A 2ZUQB 4F57H 3R1GH 5I74B 3F6LA 5J1TC 5IHZA 1MQKL 4Y4KD 4M7ZB 4YDJB 3GO1L 1S7SB 2R4RH 5EZIL 3OWEA 3RWGB 4JB9L 1BM3H 3KPSA 3L3IB 1JWUA 3S88L 1IC5H 4MJIA 1DUYA 3MLXH 5IESH 3J7HA 3EOTL 3SGJA 1HQ4B 4QRRB 5DJXA 2DQUH 2BJMH 1LE9B 3WFHA 1GC1L 4MCZA 2BXZA 2RR3A 3WS3A 3CCHB 5FYKU 1JNHA 2DL2A 5DJZA 1FGNH 4XAWL 1K9TA 1R3KB 4XVUC 2CUHA 1P9MC 3SGKA 2QKIA 2WBJA 3MUHL 4F9PC 5LCVH 3QFJD 4Y5VA 3R4DA 4LCUA 2HTKC 2Z93A 1NMCB 4EVNB 2EE6A 1MCEA 3OKDB 4I9WE 3RTQB 5FYJL 2EO9A 5KVDH 1A6AB 5CMAB 5CIPB 3BKMH 4F7PB 4F15C 5IMKB 3ZE2E 3TC9A 5D7SL 2B5IB 4S2SA 1MHCA 4ELKB 4GG6A 3U0TB 5BCAA 4J8RB 4WJ5A 1J0ZA 1AY1H 4HK3J 3O9WD 4ZNEA 3LQZB 3TP4A 4RFEB 2R2EB 2WZPD 2BERA 4D9RD 3L3HA 3AB0C 1KN2L 1J7VR 4WEMB 5KSVA 4YEFA 4XMKL 2YHGA 1L9MA 4L4VD 1ZKAA 4LSUH 4OT1L 3SE3C 5MP6L 2EDXA 1VADB 4WFGD 3S3SA 1N8ZB 3CC5B 5CFHA 4JFOB 4V2BA 4H88L 2ADGA 1RFDH 3RKPA 3IDGA 4M1GL 2KZ1B 3GGWB 2IANB 4HKBB 3LS5L 2V17H 3V52L 3VXUE 3REVB 5E08L 5DC4B 1OCWL 2UUDK 2YKLH 15C8L 5E6IA 1NFIA 2DQJH 4JFEA 3MREA 3PIQB 5JO5B 3SBWC 1IZKA 4PBWD 4UINL 1LDPL 3O3DA 2C4FT 5DJCA 5GS2H 3TBYB 4I5BA 3TT3L 1A9BA 4MGXA 3E8UH 1NKOA 3HZMB 4G8FB 1K5NA 3HCVA 1XGUB 3BIBX 2DBLL 3WSQL 4HS3A 4LCIL 3UP1A 3PGCB 4JKMA 1UB6B 5IUSA 1C08B 1R5WA 1LE5A 3B3IA 2WLZA 3HNVL 3TO4A 1T66D 1UKQA 1YY8A 4WI5A 1BQUA 1OGTB 4AIOA 3D48R 1L0YA 4KTYA 1CWVA 1OSZB 3NBNA 1IBGH 3GSQA 4FZ8L 2VDOL 5BJTB 5INCB 2IF7A 2CR3A 3OZ9L 4MJ5A 1MAJA 3CVHB 1ZTXH 3C8DA 1QTYT 1DVFD 4GXUN 2Q86A 4TVPD 3BGFC 3V95A 1RJZA 2C3VA 3KNBA 1JGUL 2Y07H 1J0HA 4ZODA 3QHZL 5DJ8A 5A1AA 5KSVB 5C0GA 2APVA 1A7PL 4AEIL 5JDJA 1IEAA 1FO0A 3IU3B 1MUJB 4UUJA 5JXAH 3H6JA 5IFAH 3X17A 3I6KA 4Q9QL 2ADIA 5CEYB 3MREB 3PIQA 2YXFA 2GSGA 5MHSE 5JIKA 3QG7L 2WQRA 2WUBL 3V9FA 1RZKH 3LN5B 2P5ED 4YDKH 5E0QA 2W92A 5E6ZA 5E8EA 4FTVD 4HK0B 5EIIB 2XY2A 3M1BB 2X4NA 1NGQH 1LEKB 1MHPH 2GUOB 2VN7A 4GBXC 1T89A 1OSZA 4OCWL 1OQXA 5IM7A 5D5MA 3QQ4B 3MUGB 3TO4B 5EO1B 1J8HD 1KLFA 1ZHNB 2AJXL 2WW8A 4NC1E 3VGHA 5C0ND 25C8L 5DHVA 1FVCB 1TMCB 1FFPB 1OAUL 3QWRD 1OAQL 2X4QA 2UY6A 4HS3B 1DUYB 5CHNB 1WCBA 3UBXB 1XFPA 1V8HA 4CRPA 1KPUA 3IVKA 4AEEA 4WFED 5JLZB 2BVQA 4F57L 3U30B 2OTWB 5FECB 1HKLH 5LBSL 3IJYB 1K2DA 4PREA 3GIVA 3DSFL 4WNQB 5DRWA 1QSEA 3VDBA 3GSVA 5EO9B 5T3ZH 5F1IA 4XB7A 5FO8B 3O3UN 4EXPX 5DUBB 3T2PA 4JFPB 2D7OA 4J3TA 3LIZH 3HG1A 3KR3L 4OCXH 5EWIH 4M62H 2Z0BA 3ARFC 2GY5A 3HS0B 3FB7A 5I1EL 5I8OL 3MLPA 3ET9F 3GSXA 2CMRL 1KBGH 4M7KL 3IDMA 3PQYD 4FFWC 3K2UL 1P84K 1NUNB 3KDMA 4HD9A 4YE4L 4RAUB 1ZA3B 2V2WA 5T5NF 4HJJH 5E94B 4WI9A 2Z31B 1S9VB 2DLFH 1LVEA 3BKML 1VEOA 2CLZA 3FO1A 2D4DA 2PXYC 1TJGL 3W9DA 1RJYB 2OL3H 4MDIA 4LQFL 5ESAA 1XCQB 4HUNB 4X6BB 4JO2L 4D0BB 5C0EB 5GHWL 3MMEA 5DRZB 4YDVA 5K9KA 1AQDB 3VD7A 1KTDB 4HGWA 3QULA 5F7NC 1RHHB 3PWNA 1A22B 1CXLA 3LEVL 1H8OA 1FC2D 1QYGL 2PXYA 2OYPA 3ZE2F 4JFZH 3ZZ1A 1EJOH 4X6EA 1CLYL 4P46C 4H5SA 4ODHL 1OB1B 5GQBA 5L6YH 1RJCA 4HUWB 3R1GL 3EJYD 3DTXB 4WHYG 5ACZB 5CSBA 4M1GH 4NDMB 2ZCKL 2DYPA 4TRPH 1SYVA 2IGFL 2K3TA 3EJYC 4QRUB 3T4YB 1NDGA 3ZE0F 3UTQA 1UKTA 2HFTA 4PUBL 1UGNA 3L3OB 2YZ8A 5JQHC 3TNMA 1QR1B 5TE6H 3EYUH 4QNPE 1W2KT 5E2TH 4M7LH 1A1OA 2NY5L 3CFJA 4LSVH 5IB3B 1KIQA 2X4SB 5E7BA 2MCG1 5I15H 4AG4L 1A7NL 4LARL 5GSVB 4O2EB 2F8VA 1A3RH 2BRRL 1O7VA 4PYHA 4Z8FL 5TGBB 4H0IA 4LKXA 1VDGA 3Q6GH 1RFDL 1AGCB 5AUMA 3KPTA 2JIXA 3HE7C 1K8IB 4UDTA 5BO1L 3TJEL 5L2KB 3C5ZA 5LGHH 1AXSA 4YHYB 5FYLH 3S96A 3ABZA 3QEGL 5CJXC 1QG3A 4YQXL 1CDBA 5KS9E 1NLDH 5F1NB 2HG5B 1JGLH 3ARGC 4HS6A 4FFWD 1MCCA 3BVNB 1D5MB 5B3JF 1RUAH 3DUSB 4Q0XH 5JTWA 1NUGA 2AJYH 2ZOLA 4L1HA 4M4RA 4QCIB 5KANI 4DEPC 3WFCH 2DBLH 4CU8A 3FQXB 1N6UA 3EUUA 1O0VA 4EBQH 2ZUYA 5DWUL 3KJ4B 1OTSD 2J8UE 1RZIB 1SY6A 2DD8H 1UG9A 3MLZH 4LEOA 4XNYL 3U4AA 3QI9A 3NACL 4U3XA 4YAQB 2C1PA 1CGSL 1CT8A 3BAEL 5KVGL 1D5BA 3QUZA 5AUMB 2AEPH 1I8MB 1H15A 2G9HB 4L3EE 4WUKL 1LO5A 3UTSE 2Y07L 5BS0A 3GI8H 2G2RB 1S7QB 2ZCLH 1SY6H 4HIJB 4S1DC 1J18A 1A7PH 4G6KL 4AEIH 1U8OB 1OSPL 2YD9A 1DANT 3BVNA 2C3XA 2XTLA 1G9NC 1S8DA 5DLML 4HMEA 5SWQA 3RZCC 4QXTB 1GAFH 3W5MA 4ORGB 3HNVH 4G8IB 4NKOB 1EX0A 1YEJL 3TH2T 3JUYA 1N7MH 4YIQA 5B3NA 4YFLI 1CN4A 4NQEA 2XYCA 3GHBH 3WEXA 4G6MH 4QEGA 2Z35B 4YDIH 4BM7A 2CDEB 1AO7B 2CO6B 3QUZC 4GRWE 2CDFA 2H2SC 2VZSA 4K9EL 4NZUL 3VXMD 2J2ZA 3MNWA 2EYRA 5JOEA 3LIZL 5F96L 4AQ1B 3NA9L 1W72H 2UWEA 4P9HH 5HGGS 5I1DA 3EGSA 3QHZH 1Q9LA 1S7WA 1TJHH 1ORSB 4ZG1A 5FB8B 1UWXH 4RDQF 5E7FA 3FO2A 2OJEA 4QHLB 2LAAA 2XA8H 3ME0A 1CDCA 3RWCB 4LCCC 1QEWB 3IGAA 4PJBE 1A14H 4X4XA 5DHYB 5DK2B 5HVWA 1Q94A 4ZO7A 5HD8C 4KJPC 5TQ0H 2DIAA 2GJZB 1JTPA 4PLNC 3DX9B 1ZMYA 2DLFL 1CS6A 3BKCH 1T2XA 3BDXA 4F2MB 5TH2A 2FECL 1NGQL 1KT2A 2DLIA 4WU5B 2E7LA 3KR3H 1R3LA 1BLNB 1P2CB 3HE7A 4YK4B 1OAZL 4LVOB 1Z3GH 1I3GH 4IHOA 4YDVB 3WIFB 5INCA 3SPVA 5J4MA 3BRDA 3RKDC 3RL2A 2J8OA 3QPQC 5JMOC 4TVSa 1YEKH 3WNOA 1U2CA 1P4LA 3B2UD 3QQ3A 2EKSA 3TYFB 1OF2B 3QUYC 5GS0H 4H5SB 2ED7A 1S9WB 4G7VH 3S4SA 5SWSB 1U6AH 1YEGL 5DVOA 3F5WA 5EA0H 2X09A 2YPKA 2DMKA 2OP4L 4L3EB 5JORA 4RFOH 3V5HA 4YUEH 2ZWLT 3FONB 2AK1H 3TBWB 1BAFL 4AYFA 3PJSB 3E0GA 4E41D 1ZVHA 5M7QA 4X5XA 3MRCA 3BH9A 3F7VB 4HFWA 1QYGH 5IWLC 4K3JL 1NGPH 4QXGH 4PRHE 2OJZL 5KTEH 4WV1A 4WEUD 4JDTL 1KB5L 4PJEB 1GGUA 3QXUA 2X4RB 1JNNH 2QSVA 5EZLB 1G9NL 4F7CB 3HI6H 1S78D 3BIAX 1PGRB 2HLFC 3HI5H 4TRPL 1ZWIA 1IGJA 4R26L 4RIRB 4S0TD 4Q58C 3HS0A 1Q9WA 3NCJH 3UBXA 3QEUA 3QEGH 4MCYA 3GMQB 3PHQB 4AL8H 4ZFFB 3TZVB 1CL7H 1KPVA 1MCLA 4P57A 4ERSL 1S9YB 1RIVL 4XVUD 5D7KE 3LKSB 2UUDH 4JM2A 4K9EC 1GZQB 2NX5B 4NHCL 1IGML 3RIAF 3HAEH 5FYLE 5D1QC 4ODWB 3B9KC 1YNLH 2YMXH 1I8KA 3Q0HA 4RMSA 4MB5A 4ELMA 1ZVYA 3MYJB 5D1XA 4DTGH 3P77B 4U1JA 2ZUUA 4ALAH 2YC1A 2VABA 4PJIF 4P9MH 5CINL 3MJ6A 5D2LA 1A1NB 2GAZA 4DZBB 2KDGA 4FQHB 5DDHB 1PD6A 2B39A 1JHKL 4YBLC 2EYTB 4TSCL 1EGJL 2FL5B 1NUDA 1P69B 3OR7A 4Y2DB 5DA4A 3C5SA 5H35A 4ODVL 1EO8H 1EO5A 4I48B 5IBUG 4BA8A 5DUPL 4YC2B 2BRRH 4X6DA 3V6FA 4A6YL 3KLSA 4WWKD 4UT7L 1NCNA 5DRNB 5C70A 1LP9F 3BWUC 4NQXB 1DZBA 4PS4H<