5A3TA

Crystal structure of human plu-1 (jarid1b) in complex with kdm5-c49 (2-(((2-((2-(dimethylamino)ethyl)(ethyl)amino)-2-oxoethyl)amino)methyl) isonicotinic acid).
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
462
structure length
454
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
publication title Structural Analysis of Human Kdm5B Guides Histone Demethylase Inhibitor Development.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 150
structure length 454
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a3tA01
5CEHA 2YBSA 4HONA 5FV3A 4EZ4A 3KV6A 5FZ7A 5A3TA 4BISA 5FY0A 2XDVA 5IVYA 2GP3A 5FYBA 5FYZA 5FZLA 4D6QA 1VRBA 5FZBA 5FXXA 4GJZA 3RVHA 4Y4RA 3ZPOA 4QWNA 5LW9A 3N9NA 5FZCA 3OPTA 4GJYA 4D6RA 5IW0A 4QXBA 5FPAA 5FJHA 3LDBA 4V2WA 2OQ7A 4LITA 4CCMA 4QU1A 5F5AA 4IGPA 5FPBA 5KR7A 4Y33A 2YPDA 2GP5A 5F5IA 5FZ0A 5FZIA 5FUPA 3NJYA 5A7NA 5A3NA 5IVEA 4IGOA 5FPLA 3N9OA 3KV9A 5FYVA 2OT7A 5F2SA 3PDQA 5FZFA 5FYHA 3KV5A 5FZOA 5FZ8A 4GAZA 4UF0A 5FZMA 5E6HA 4CCOA 4DO0A 5FYTA 3OPWA 5FY8A 4EYUA 5FP7A 4CCJA 5FZ3A 3DXUA 5LWBA 5FJKA 4Y3OA 4LIUA 3PU8A 5FBJA 5FZOB 2XUEA 4UF0B 5FP4A 5FYYA 3PTRB 5FZ1A 2YBKA 4XDOA 4CUGA 3ZLIA 5F3CA 5FZ4A 2PXJA 5F37A 2YBPA 4ASKA 5F3EA 5FYCA 4IGQA 3N9PA 5FXZA 5F32A 4LIVA 5FY5A 4E4HA 5FZ6A 3U4SA 5A7SA 4EZHA 4QX7A 5FXWA 3K2OA 5FY7A 5IVBA 3K3NA 2Q8DA 5FY4A 4CSWA 5IVCA 4QXCA 5ISLA 5A3WA 2OX0A 2XXZA 4V2VA 3UYJA 4CCNA 3PUAA 5IVVA 2OS2A 3AVRA 5F2WA 5FP3A 5FYUA 4XDPA 5FPUA 5FZEA 5LY2A 5ANQA 3KVBA 5FWEA 5FZAA 5FY9A 2Q8EA 2W2IA 3N9QA 5K4LA 2WWJA 5FYMA 3N9MA 5IVJA 5FZ9A 5FZHA 2Q8CA 5FYIA 5IWFA 5FP8A 4AAPA 4HOOA 5F3GA 5LY1A 4CCLA 3LD8A 5FP9A 5A3PA 4LXLA 5FZDA 5A7PA 4C8DA 4URAA 3AVSA 2XMLA 3PUQA 4QX8A 5F5CA 3PUSA 5FUNA 5FYSA 5FPVA 4CCKA 3KVAA 5A7QA 4BXFA 4QXHA 4TN7A 5A7WB 5FWJA 5FY1A 3U78A 5A1FA 2OQ6A 3KV4A 3DXTA 5F3IA 5IVFA 5FZGA 3PU3A 5FZKA 5A80A 4D6SA 2YU1A 5FXVA 3K3OA 4AI9A 2WWUA 5A1LA 4BU2A 4DIQA 4NUBA 5F39A 2P5BA 3AL6A 3PURA 5A7OA 4GD4A 2VD7A 3AL5A 2YU2A 3N9LA 5A7WA
chains in the Genus database with same CATH superfamily
5IUQA 1JYVA 3OUJA 4CCCA 3S5QA 1EUTA 2BUKA 4DY5A 4BISA 2G9GA 3BOPA 3NJVA 3VBFA 5FZLA 4TYSA 5BNOC 5DZGA 1GP4A 1U5YA 4GJYA 1LR5A 1PGW2 1C1LA 2WAOA 3B02A 4E8CA 2OQ7A 4BDVB 3LDRA 1TEIA 1COV3 3T30A 3FHQA 3VDDC 2TBVA 2VMCA 4ES9A 4NR1A 1AR61 1V70A 1BYHA 1YFUA 2CAVA 3SISA 3NL1A 1CAWB 2GP5A 1UU4A 2RDNA 2ZA9A 3RYKA 1HN0A 5HV4A 1JI6A 1SBEA 2RDRA 2RS52 3DKWA 3P3PA 1T6GC 2FHRA 1CX4A 4B4PA 2A5ZA 3MIEA 4CEWC 2PHDA 3FLPA 3SCHA 4HANA 4PI2A 1ZA4A 4GKYA 5FO9B 2ILMA 1HB3A 1IGOA 2FCVA 4P9LA 1RTVA 2J1SA 3FX3A 4PLNA 1CAWA 5M0TA 1STMA 2C0ZA 3AZWA 3K75B 2HWF1 3VBOB 4FPYA 2WYFA 5FZ4A 2E7QA 1LGCA 3HOBA 3POJA 2BGOA 4YFZA 1NZIA 1VE0A 3TEYA 4EZHA 2RS53 4HN0A 1RITA 1UY4A 3NV2A 3AKPA 3GYDA 3K3NA 3OGGA 1BVVA 1NG0A 4IDZA 1XRUA 2QDNA 1RUF3 2QQMA 4NIDA 4FVVA 5IVVA 2GALA 5CADA 5CKMA 5T50A 3H8UA 4CTEA 1XYOA 5LY2A 4XJUA 3VBOA 4AL9A 1HV1A 3NMBA 5GZEA 1UO9A 2O1QA 3K4ZA 1UAIA 2O8QA 3KS7A 5FOJB 5EYYA 5FZ9A 1CAXB 4I2OA 4NIGA 2F6BA 1HRI1 3AJYA 4Q4V2 4LKFA 1PGL2 3ZDSA 1RUH2 1RUC1 2BNOA 1GNZA 2Q1MA 3LD8A 3MF6A 5FAXA 1OOPC 3VHNA 2AC1A 3OGJA 2WIIB 1AXZA 1MZEA 3UNPA 5A70A 3LB9A 2JE7A 2RS12 1RUE1 1AL22 3IAQA 3WP4A 5I0RA 3WP3A 4GWIA 1AYM1 2EXHA 1XNCA 2WNOA 1VBB2 1H4HA 2JIJA 3NRUA 4TWTA 1CAXA 4HG6B 3AP9A 1BVP1 4BZ4A 1VAMA 3FUOA 4QXHA 3TYJA 4CDQB 3QH7A 4XVHA 1L7RA 4Q4V3 5F3IA 1WMFA 2XONA 4QPGB 2E7TA 5C8CB 2XUMA 5LA0A 4JHZA 1Z0HA 3RJRA 3I2HA 2PHXA 2ZMLA 4A6OA 1VBD1 5J96B 3MPBA 4I09A 2EAKA 4BH9A 1E57A 2UWAA 3AZXA 3VHRA 3ZFFB 1ZZ9A 2CWSA 3HMYA 2RS13 2WSUA 5GLWA 4TLGA 1D7PM 4MYEA 5D21A 3SQOA 2VW2A 4XETA 2VOXA 1Y9MA 4LO8A 4OULA 5JOZA 4RGAA 4CDQA 1VBB3 3LFMA 1W9YA 1K3IA 5FV3A 3GJBA 2ZMNA 4COVA 4QPGA 3R0RA 5C8CA 2C9KA 2XLFA 2VR4A 5FYZA 1EAH2 3OPZA 1W6QB 1ZZ6A 2VMFA 3N7MA 1ZREA 4SBVA 3ZFFA 4ZHNA 4CP1A 1EP0A 5FJHA 2BJSA 2NQYA 3E1F1 3KMHA 4P08A 2ETEA 2JD9A 4V2WA 3ZIWA 2A71A 1PK6B 4HKLA 1FAYA 4YZ3A 5DAWA 4D0QA 1GOFA 4AF9A 4YGEA 3SKVA 1H6XA 1MS4A 3B7MA 4LBJA 3VDAA 3GALA 4A7YA 5F7UA 5C3SA 1U12A 1W3XA 4NAMA 1UOGA 4AHXA 3A0KA 1W9TA 4AI0A 3GZEA 3K77A 1W6QA 3U37A 1R1A1 5E16A 1GOHA 2OW4A 4CCOA 5C33A 2PHTA 1O4YA 5L36A 1O8PA 3WDVA 4E8DA 2VULA 3U0ZA 3BODA 2DWRA 2W1WA 4LT5A 1CR7A 1HJFA 4AHZA 1PK6A 3RZGA 5BNOB 2OPWA 2AEZA 4K8RB 1UKGA 5JSRA 3WUDA 3L2HA 1PNFA 3OBZA 1A3KA 1VMHA 3ACLA 2PYTA 1W8HA 3C3VA 3GJAA 4CUGA 3VDDB 2D3SA 1N3PA 3AFKA 1ULGA 3NNMA 2DFCA 2UU8A 4E4HA 5A7SA 5JMOA 3CZUA 3AMNA 5IVBA 1CX1A 1PVXA 5A3UA 2BOJA 1TME1 3EYPA 4UW3A 2OX0A 2Z69A 3POWA 2ZGSA 5BNOA 4BMBA 5CZKA 5FPUA 2WA3A 2QQNA 4CEWB 1CZVA 3DKQA 2EIDA 5D8AC 5T52A 1WD3A 5GJ6A 2X10A 5FOBB 1QXRA 1QIQA 2Q1ZB 4J6GA 3VDDA 3GZTB 1G9BA 3WX5A 2YB7A 4CDWC 4FCAA 3WLUA 5K8SA 4GKXA 3GZAA 3MV01 4FTBA 3LFIA 4Z2WA 2VBBA 1IG3A 1UKRA 3WW2A 3ZX7A 2WA4A 4YW4A 2V4VA 4CCLA 1KGYA 2OA2A 2EXJA 1HB2A 2IUWA 3JUUA 3T2TA 1BJQA 4ASMB 1JZ6A 2GC3A 4FFGA 4CEWA 3E5UA 1J3PA 3RMXA 2XVGA 4YVWB 5BNPB 2XVLA 1F15A 1SLBA 4ZONA 3GHNA 1XC6A 4META 2K46A 4R4ZA 4XUQA 1BEV2 4FXGB 5LASA 2JJ6A 4AWDA 4CEYB 3MLKA 4FTEA 4QKDA 5C5TA 1ZM1A 1J83A 1JH5A 5A1FA 2VQTA 5JAXA 1CJDA 3VKFC 2VGDA 1S2EA 4RA0A 1VAVA 1NX9A 3D0SA 2ZACA 5EZWA 5A80A 3QH6A 3Q8CA 4Y22B 3LA2A 4YVWA 3ALQA 4D94A 4AVBA 4DIQA 3HNBM 5BNPA 5CBLA 4XUNA 2X8KA 3GCWA 4FFHA 4CU8A 1RUI2 3KZ4C 4M01A 4YW3A 4COUA 3VGIA 1GOGA 3CLPA 2O0OA 4CEYA 2MEV1 4B4QA 2P2KA 3THDA 4XQWA 4IESA 1KITA 2VOVA 3ZSEA 2YBSA 1GQPA 1PGW1 2FD8A 4XACA 1BEV3 3FZ3A 5A3TA 3CKHA 1DGRN 2DURA 2ZPXA 3NWKA 4UAPA 1NQJA 2BP6A 2X5IC 4Y22A 1QJEA 4LJHA 4YYOA 5JPMB 2DU0A 3OEBA 5KHJA 4XUTA 5FZCA 3OPTA 1JZ2A 2ZTNA 4GALA 3CL1A 2WS91 1O3QA 2XGXA 3VDBA 4EV0A 4CCMA 1CIYA 2B8MA 1DFQA 1AR92 1WW6A 3WP5A 2ZGOA 3NJZA 4L8QA 1SBFA 4XZPA 1QWRA 1RUI3 2I2SA 1CAUB 3H9AA 1ZZ7A 1IS5A 4QU2A 3BTYA 1LENA 1TMF2 3OY8B 5I93A 3ILNA 3WINE 4LHKA 3HQRA 1F5FA 1A6CA 5JUVA 5FLJA 1O4TA 1OPMA 4OCTA 5KXEA 1PO12 2JDNA 2P3KA 5T54A 5KHGA 4JGZC 5IFPA 2OKXA 1JBCA 2GU9A 3DECA 2O14A 1J1TA 4LR4A 5FP7A 2XOMA 4IV3C 5C9AC 1IKQA 1J58A 4UWDA 4DNYA 3AKRA 1IOAA 4Q4Y2 5JI7A 1CAUA 4G9SB 4O65A 2OYZA 3EB7A 1W8ZA 1OSGA 1JU3A 4AFMA 1AR93 1NZCA 1RGSA 3V64A 5F3CA 2RS31 3ZFEC 3OGRA 4MV2A 3ZXLA 3BU0A 3WDYA 5JDBA 4LIVA 3DV8A 4XDQA 4TLFA 4AQ6A 2VTXJ 1TMF3 2VAUA 3AYCA 2BYVE 5FY4A 1NQDA 5ISLA 2QZ3A 2P4EA 1PO13 3AMPA 1DG6A 3EO6A 3O12A 5FIXA 3UESA 3WHTA 4AHWA 4B3NA 4MADA 4W6WA 5LRRA 3M3EA 3GBGA 2QQLA 3ACFA 1DGRA 1RUH1 1WW5A 5ANQA 3AX4A 4Q4Y3 1DQ4A 1XNBA 3I7DA 4ZS3A 2VCCA 1RMU1 2MNGA 4Q26A 1WLDA 1Y9GA 3RGBA 4WVWA 1AL21 3JB4C 1W0PA 4XFFA 3J4UH 1GP5A 4XURA 2AGSA 2VMHA 1OH3A 1OPOA 5FMDA 3AVSA 2KD7A 3HIFA 3MW4A 1OURA 2FDGA 2C24A 1OVSA 1ODNA 4P9JA 2UURA 3DYPA 4PT6A 5LBFA 4YPJA 1O3RA 2ZZQA 4F83A 1PX3A 1G86A 2W92A 2XLAA 1H9PA 2ZX4A 3POSA 1IKPA 4N53A 4CDUB 1GZTA 2VW1A 4ARYA 1W6PB 4Y1XA 5A7WB 3PUIA 4XF9A 5FY1A 1SLCA 1JYWA 1DDLA 1ZRIA 4CPBD 2PN5A 3FE5A 3ZYJB 4EN7B 4W50A 4W6YA 1SZBA 4D6SA 1JHJA 2BNMA 3J8F1 3LEMA 4JCKA 3OJBA 1H6YA 3WG4A 4AEJA 4BU2A 4JZRA 1NA1B 1O5LA 4KMQA 1GU3A 3MLJA 5BNNC 2OXBA 3RFRA 1KDMA 1SDWA 3OGSA 1JOPA 4CDUA 1EAH1 2ORZA 2E33A 4RR3C 2VJXA 4DB5A 1W6PA 3H0OA 5A7WA 3RS6A 3VHOA 4EWAA 4AQTA 4QT6A 1ONAA 5G05L 3ZYRA 2XJVA 3VD7A 2VMDA 4YW5A 1QJU2 4NPRA 3I54A 4K6BA 3V65A 2Q0AA 2R071 3NW4A 3W5MA 4D6RA 5JXGA 4DMIA 1NA1A 4LITA 2MHFA 4BQ3A 4MXVA 2WZR2 2VBPA 2AUYA 3DUIA 1O6UA 5DDJ3 3SHRA 4DOUA 5AFEA 1O3SA 1RL3A 1HKDA 1WA6X 4N43C 3KQ4B 4XBLA 3P6BA 2Z2SB 1U5XA 2EIEA 3RJ2X 5CG9A 5KXDA 4LLOA 4WZFA 4MGYE 4PF1A 4YNIA 3BKZA 4N9HA 3H8OA 5IYYA 2C6SA 4FPEA 1H2KA 1SACA 2D5HA 2NM1A 2YMZA 3UJQA 1ASJ2 1W2TA 1UF2C 1RUJ3 4E2GA 1ULEA 2BBAA 2X5IB 2B42B 5F6KA 3I2JA 1HQNA 3ELNA 3LSDA 5FP4A 4OQ8A 3HPNA 1UZVA 2LW8A 1AR81 2GNTA 2CU5A 2VUCA 4MVTA 1W04A 4XMAA 3FFZA 4DY3A 2GMMA 4PLOA 1HRV1 3DGTA 5AVAA 3SXWA 1IS3A 4QMAA 3W58A 5A6QA 1LOEA 2CDPA 5IVCA 1W99A 5T5OA 2X5IA 4YM1A 3LGRA 5FPXA 1ASJ3 3FHIB 5C7GA 2WABA 4MO3M 4IEVA 2FCTA 4IV3B 2V09A 4XJ8A 5FZAA 2Y6KA 1ZBE1 1H1IA 4AAPA 1JODA 2DVGA 4M00A 3ZFEB 1MVQA 5A3PA 2VZPA 1AUYA 5J1XA 3CDZB 4YM3A 4GULA 4WM8C 4Q0PA 1REEA 4M3CE 3T2PA 4LBOA 2VQAA 1LODA 4EN9B 4IV3A 3BTZA 1AHSA 1Y3TA 1W3VA 2Z79A 3PUSA 5FYSA 1NXD1 3AB0A 3BPSA 5FPVA 1UZ0A 4CU6A 4FSJA 2BRTA 2V4AA 4NRPA 1EV11 2IWGB 3SH5A 4RL7A 4TSVA 5FWJA 2ATFA 5L73A 1PMIA 3DXTA 4IW3A 4XFCA 5CAZA 3B93A 4R4XA 2VOTA 1QJY1 3VBFC 2W95A 4B1MA 2WWUA 4L99A 4Q2FA 1JZ3A 2GNMA 5DUWA 1H1AA 1OHFA 4YGDA 2A1XA 3MV11 4OHXA 1NCQB 3GXUA 4QX1A 4UYBA 4XXAA 1FOD1 1JN2P 2DCYA 3A22A 3POEA 4M3CF 5T5LA 2ZAAA 5IFTA 1QY4A 2E7AA 3J7NA 2WZPP 4A6SA 2ZX1A 2VVFA 3ECQA 2XDVA 3IKWA 2VMGA 1KS5A 4H7LA 2PELA 3M70A 5JSOA 3CZJA 3LSEA 3O0XA 1BBT2 4DINB 1FX5A 1NCQA 3WCSA 3DCQA 4GQ7A 5FK7A 3UGGA 2WNUB 2BEOA 1JTZX 1AR73 5FZ0A 4EN6B 5FBZA 4XIKA 5GKAC 2BFUL 5A7NA 2W08A 5DAQA 5BNNB 1IQAA 1LRHA 2VOWA 3PUHA 5EJ1B 1FNYA 1YXWA 3GM8A 2Y6FA 2JE9A 4DUVA 3UGFA 1DYPA 4UW4A 3U10A 4LO4B 1J1LA 3ORJA 4GH4C 2VUJA 3ZKUA 1HQWA 4CCJA 2RMU2 1DCSA 4UOJA 3ZSLA 4A44A 2DYCA 5HXVA 3I59B 4ZY9A 4ARXA 2WNUA 5KHHA 1BBT3 4QGLA 3V0BB 3I49A 4DEQA 1GLHA 2NPIA 1W28A 1IPSA 1LOFA 5BNNA 4DXRA 2VE1A 1BK1A 2PXJA 4OI4A 2JE8A 3JCIA 1YFWA 3PJYA 4FPHA 3POYA 1RVF2 3A4UA 4RGGA 3A7QA 3MZHA 2K9ZA 3SEEA 3ACHA 1G6NA 4N43B 1YQCA 2G19A 1V9U2 3ZN6B 1W0OA 4JDNA 4AG4A 2Q8DA 1U5ZA 3ES1A 5IT6A 1OH4A 4MLOA 1BQPA 2OS2A 3TEWA 1WBLA 3V0BA 2HBUA 2HWE1 1D2SA 2VM9A 3KVBA 5FWEA 4A3ZA 2HYXA 1I1EA 3N9QA 5K4LA 2JDMA 3VKOA 1IHMA 1UD1A 4N43A 3MI8A 4Z2AA 3ZN6A 4PIZA 1VBE1 1YC61 1R081 1MPXA 2XBO1 1W0NA 1WW4A 5ACA1 1QMJA 4LPLA 3T09A 1JW6A 4AQSA 3KGLA 1FPN2 1O91A 3IDBB 4ZU5A 1UNBA 2A6VA 1D4M1 1OFNA 4XFAA 1RUD1 2WNEA 5AVPA 1Q3EA 1AYN1 5FQ0B 4NHKA 2JG8C 3ETQA 4H14A 2BPA2 2F4PA 5K9YA 2ZHMA 4KI5M 1JYCA 4FFFA 4HVRA 5F6LB 4CDQC 1KDKA 3RWKX 5FLIA 2ORXA 4DZGA 4ZKTB 1F4HA 3MDPA 4AK3A 2PHWA 3O1RA 3L9JT 3PHMA 3WUCA 3NSTA 4AI2A 2ZGTA 4NJ4A 1QH6A 3LEKA 2QQUA 5F39A 4QPWA 4B29A 4EWEA 3H7YA 3S6PA 4CCDA 1FPN3 4JKMA 5A7OA 4HK9A 4COWA 3I8TA 4COZA 1FMD2 1QJU1 4Q4X1 1WCDJ 3J26N 4C91A 3PNAA 4XAAA 2QZ2A 2DBNA 2UY8A 3IM0A 5A1AA 4Y26A 2D5FA 5CVRA 4IETA 1UOJA 3POFA 1YNAA 3KV6A 1VBA1 2JX9A 3WXPA 2WZR1 3HAGA 5LEKA 4I02A 2ZZJA 1S0DA 3GDBA 4Y5SA 4YZ2A 3RZJA 4ZU4A 5CIRA 1GZWB 3WHUA 1UZWA 2VECA 2DVAA 5JZGB 3GNEA 2QQOA 1WGPA 4LK6A 1T2XA 3WNKA 4O7XA 4JX0A 4YZ1A 1QJZA 1Z7S1 5L19A 1FMD3 4NWWA 1KD7A 1YIFA 3O1VA 1JUHA 5BUVA 4W8JA 1FXZA 2RG4A 1SFNA 1U0AA 2Y38A 2A6ZA 2L9LA 2P3YA 2J7MA 1GZWA 3MFCA 2D44A 2QQKA 2G1MA 3SC7X 3WF3A 4AVAA 5JZGA 4Y3OA 5C70A 4ISQA 1V6MA 1ZRRA 3FMGA 5EWSA 1NCRC 1NAEA 5FO7B 2JDUA 2R6QA 3LA7A 5KXCA 4TTGA 3M3OA 1LULA 2VZOA 1L7LA 4BIOA 4RD7A 3TOJA 3HNYM 1BKZA 5F32A 2ZEWA 1XYNA 4Y1ZA 5K0UC 3E6BA 1IS4A 2WO3A 4PQQA 3JD72 4YM2A 2AYHA 1HX6A 4IUGA 3UYJA 4YSFA 2O8OA 1RUF2 3GF6A 2WKKA 4K21A 2WR9A 4GH4B 5JLVA 3LEIA 5JI9A 3MPPG 1APNA 4HL0A 5F8PA 4FP2A 5DUUA 5FY9A 2Q8EA 1HDKA 2FBEA 1YQ2A 2YPJA 4XTPA 2Q8CA 3PIGA 2E63A 2IXCA 4XFHA 4AXOA 1FATA 1XBFA 3ON7A 3T0AA 3VBSA 1MEC1 2VMIA 2QNKA 1YCIA 5FZDA 1O4ZA 1MS3A 3J9SA 4O9GA 2WLQA 3AKTA 3JD73 5HI0A 3KT7A 3TN91 4GH4A 4YARA 3GZUC 4YVWC 1QKQA 5BNPC 3AMMA 1YI9A 2HKXA 5GZDA 4CUAA 3O7OA 1AX0A 4NRQA 4KL1A 5A7QA 2R043 4CEYC 1MS1A 2XWBB 1MR5A 1Y7BA 2VXJA 4QM9A 1YQ5A 4OYUA 4Q4W3 1C1FA 1PZ9A 4GMP3 3R4UA 4P5YA 2VNRA 5FPZA 2AREA 1XNDA 4EE2A 1OXCA 4CA9A 3A0NA 3IMNA 4IXLA 4RYDA 3AL6A 4AEMA 4DRRA 2RDSA 4AE2A 5IAXA 5HCBA 1XNTA 4CDXC 1AX2A 1GKBA 3BPZA 5J7MA 3S0MA 1X7NA 2J22A 4AVCA 5CFCC 1XYPA 4LKSA 2Y64A 1EUUA 2JG8B 4Y20B 1POV1 4NE9A 3WQBA 2GSYA 4F3JA 1LOCA 3O1SA 2DCTA 4SLIA 1W8FA 5JMCA 4OMCA 1H2LA 4QXBA 1N1TA 4LO5B 3NV1A 1W2OA 1RUG1 2BZDA 2HWC1 3WZ1A 1DQ5A 2GN7A 4QU1A 4MGIE 3N35A 2Y6LA 4BMEA 4CUBA 5BYNA 1UWWA 2PLV2 3POBA 2VG9A 5DAPA 4FTSA 3WNPA 2XJSA 3JQXA 3W9AA 5FUPA 3WW1A 1J84A 2JG8A 4Y20A 2RMU1 4P9XA 5B4NA 3B3QE 3ZXJA 4NIHA 4FOQA 3PTYA 3AJZA 5LK7B 2ARXA 2VZTA 4H3WA 2HH9A 3MHZA 3OCPA 1OBNA 4UF0A 2CGOA 3T2OA 3W20A 1LGBA 3NV4A 1DLLA 3OSDA 4NPMA 3MFAA 1DQ2A 3PVOA 1RVF1 3ZOIA 1OQ1A 4H7MA 4KBBA 4XPVA 5A3MA 3T0BA 1V9U1 3WV6A 3WR0A 1QXPA 2WL1A 5FDBA 4QKBA 2C5DA 1V0AA 1W6MB 2PLV3 2YC2A 3MYXA 4ATEA 4A7KA 3BI3A 2LTNA 1R091 1CJPA 1S55A 4L92A 5I0UA 4LHSA 4PDWC 3CNAA 4RHV1 2PHLA 4FPLA 4URTA 3OBRA 3W59A 1VRH1 2N7GA 2K2SA 1W9FA 1MS9A 5F2WA 4A3XA 5FYUA 3C8XA 2CL2A 2J1VA 4P02B 4CP2A 4H55A 4LBMA 1F5JA 3LCPA 1VMFA 1NOVA 1W6MA 5BV6A 2W2IA 3WNXA 1BMV2 1XQNA 1NCRB 2JG9C 2HWD2 5IVJA 1CAVB 3LOBA 5FYIA 4E4ZA 3AXDA 4AI1A 5FKBA 4N53C 1PM4A 3DN7A 2C4XA 3B9IA 4EJRA 4N7UA 1MACA 4R52A 3G6JB 3LF7A 4C8DA 5K0UB 2XQRA 4COYA 5EYXA 5E1RA 4MGTA 1O3TA 4NIIA 1HW5A 1E5SA 1UIJA 4BA6A 3F95A 3ACGA 2JICA 4ZS2A 1NCRA 1VBC2 2IXKA 1CAVA 1V6JA 3WF4A 1H1MA 2QVSB 1QOOA 3AM2A 4CDUC 1SLTA 1SFYA 2ZEXA 2PQQA 1WWYA 2HWD3 3TEXA 4AGRA 3KGZA 3WD5A 2GMEA 3ZKYA 1N3OA 4K8FA 1MS5A 3M3QA 1SLLA 5K0UA 1PVC2 3ZXKA 2YU1A 2DF7A 3K3OA 1JZ5A 1QNWA 1PO23 1AJOA 4ORFA 3B9CA 5CB7A 1MS8A 3LDKA 2HBTA 2OIIA 1LOBA 1NA1C 2ID4A 3SH3A 4D7YA 3H8XA 3OUHA 2WINB 3KLSA 4OQ9A 3AL5A 1TQ5A 3C7HA 2GDFA 4YVSC 1VBC3 4DUXA 2BTVC 3WCRA 2EICA 4XW3A 2VZ3A 3ME2A 3QOPA 5IK7A 2QCSB 3RVHA 1NXMA 3AKSA 1COV1 3TAYA 4P5HA 5EP9A 3WSOA 2XPJA 2RM22 4RFRB 1PVC3 2ZGQA 4C0HA 3I3BA 4FOVA 4LULA 1GYKA 4AI8A 3PVBB 3OOXA 1XE7A 3OGVA 3TBDA 1QF3A 2XJTA 2WFF2 1R1ZA 2AEYA 3NAPB 5H9PA 1REDA 1NE4A 4O9EA 3TB0A 1JZ8A 2ZX2A 4CDXB 2BWAA 5CYYA 2DTYA 5J48A 1Q8QA 1VP6A 1POQA 1YEWA 2OUJA 5FZOA 4OHYA 5CFCB 1XJAA 4C90A 3VHPA 1LHVA 2BGCA 3DXUA 4FPCA 4Q5OA 5AC92 1F4AA 1NLQA 1NLSA 4RQPC 3VBRC 5FBJA 2RM23 1S0CA 3EXUA 3GGLA 1QHDA 2H6CA 2ZKNA 5FUIA 4UFHA 3ZN5A 4K3UA 3ZSJA 3I2OA 3K48A 3PTRB 1UPSA 3NAPA 4ATFA 4LHLA 4ONUA 1WCUA 4P9YA 4RS5B 3QCWA 2RS51 5FRAA 3LE0A 4CDXA 2IFRA 4W65A 5EIYB 4ASKA 3FBMA 2DVFA 5F3EA 3GHMA 5FXZA 3X29B 4FBFA 2WFF3 4WVVA 1RUF1 2ERFA 1OI6A 4CXXA 1E5HA 5CFCA 5DN2A 1OMIA 2Y6GA 1QJX2 2PAEA 4E4DX 3USSA 2VUAA 4LQRA 4S2FA 2PHRA 3VKNA 5GLUA 4S2GA 3CJIB 4EQVA 5AC93 4P00B 4RS5A 1YQ6A 1GWKA 1UIKA 2DCZA 4JQRA 1JZ4A 1ND2C 1PMJX 3AYDA 2NYYA 3ITQA 2WQ8A 3IAPA 4HKOA 2ZKLA 4YW7A 4PBPA 4Q8KA 1C8M2 1BLZA 2GZWA 1V6OA 4AFBA 3SLIA 1UOFA 1UY0A 4JGYB 3AC0A 1EPWA 3H7JA 1WCKA 4R9CA 2ENRA 5CG8A 1V6LA 4URAA 5DZFA 5I8TA 1QJX3 3CJIA 4E27A 2QQWA 4PDWB 3VZKA 1DYOA 3LA3A 4HMZA 4DXTA 2VNVA 4XF3A 4BQ5A 2Y0IA 3AMQA 4RFT0 1Q43A 3KT4A 4KGGA 1PZ8A 4C1WA 1GQHA 1JYXA 2RR13 1QU0A 5FR3A 3VDCA 1V00A 1N1VA 5APAA 2G9FA 4Q4V1 4WM7C 3BIWE 1PGL1 4B7KA 4XMIA 1S0IA 4MSVA 3ZYFA 4Z92B 1W2NA 4JGYA 4RSUA 5FFOC 3S30A 2XJQA 2JG9B 3BOWA 1C8M3 4D7TA 4YZ5A 3ES4A 3H3LA 3QD6A 3RSJA 2W0XA 4INDA 4MGQA 1U5IA 4R9DA 4N53B 1RHI3 3CU7A 5FZKA 4PDWA 2RS11 3U14A 2RHPA 3LIHA 2YROA 3OBTA 4UFLA 4XFBA 2E51A 4JHTA 2FDFA 4MHUA 4NVPA 4JC1A 5CU1A 2WJSA 4KU7A 1VBB1 3C7FA 1TZOA 4J1XA 1HXS2 1YJKA 2ZHLA 1MZFA 4K1ZA 4YGCA 1Q5OA 1NCQC 4FOYA 3ZXGA 1X9TA 1ODMA 1ND3B 4P9WA 3M7AA 4LTAA 4J1WA 2JG9A 5DQ0A 1IPKA 2A75A 2GC2A 2JDYA 2RJLA 4XFIA 5IVYA 2XKOA 5A6ZA 4LBQB 3WQ1A 1L3JA 5EJZB 1QH7A 3UJOA 1MQTA 1P8JA 2IXHA 5CKNA 2W68A 3VD3A 1H9WA 1Y43B 2VY0A 3KM5A 2R7EB 1RXFA 4UBGA 4XBQA 3WDXA 5JCTA 1ND3A 2WNUC 2W3JA 3A21A 5DDJ2 1RYYA 4AI3A 5KHIA 3CMGA 5FZIA 1HXS3 1TNFA 1X33A 1DIWA 1XU2A 3WF2A 4Z1VA 1UX7A 1LOFC 1XPWA 4IE0A 3PDQA 4LBQA 5LBEA 1KJLA 2AH2A 4DQAA 4YVSB 5DXDA 3D6EA 5D1IA 4ZZ8A 1HN1A 3DPRC 3BTAA 1W9WA 4LK7A 3WW4A 2R062 1YRZA 3OPWA 3M4FA 4NHMA 4EYUA 4XILA 1QQP2 1CESA 2B9UA 1RJ8A 1HQLA 5FJKA 4ES8A 1YO8A 4PCRA 1RUJ2 3ZYBA 4OZOA 1UYPA 3EMRA 5ABJC 4FFIA 4ZPIA 1G9CA 3WG3A 4DUWA 2D40A 1NT0A 2VNOA 2ZMKA 1EPZA 3T1MA 2Q8OA 4CPBA 1UQXA 3TWIA 1C5IA 1S2KA 3DL3A 3N9PA 3THCA 2SLIA 4YVSA 3BN6A 2I45A 3THTA 4GB32 2WDBA 2VZSA 4GWMA 1DHKB 1QDCA 2HWB2 4HK8A 3INAA 1PIV2 1XE0A 2J1TA 2QQIA 3AP5A 1CONA 4GZ9A 1UYZA 2R063 2XH6A 1QQP3 2BFUS 5IK4A 3ZFGA 3D5OA 4RQPB 3LWCA 4XUPA 3VBRB 1LU1A 1OQEA 4OI1A 4WV8A 5FZ7A 2VTFA 2XJRA 3WDWA 3JZVA 3CQOA 2QTWB 3KCXA 4JRLA 2AZ5A 3Q8AA 1UX6A 4AFCA 4KWUA 4Q0QA 1HB1A 1OLMA 4KQ7A 4XUOA 3VZLA 1J3RA 4GB33 3RZKA 3MIBA 2BNNA 3NKGA 4IEYA 2WNVC 5JVVA 2HWB3 2ZJCA 3RMYA 2E31A 4IERA 1PIV3 3JBG2 5C3OA 3GBFA 4RQPA 3VBRA 3HEIA 1ZBA3 2A73B 4DRVA 3D4KA 3UKNA 2VZRA 2YXSA 4FAHA 3WQ0A 3A23A 1CN1A 2FMDA 5HBAA 4K40A 3O1MA 1RIRA 1ND2B 1VB4A 3ZN4A 1A78A 2OQ6A 1IQDC 4ZU7A 2JKBA 4Y5Z0 1YI7A 3H3ZA 3AXEA 2QE3A 3NNLA 3WW3A 3SKJE 1N47A 2WAAA 3T3YA 3M3CA 2JB4A 5T5PA 1AF9A 3RDIA 1UYXA 1PM7A 3SMHA 1PHMA 3WNOA 2WQZC 3PURA 3FC0A 2BGPA 3ETPA 1UXZA 3JBG3 1BEV1 3OBAA 1AR62 4FO9A 4A42A 4BXSV 3V0AB 2DU1A 2GH2A 2ZEYA 4XEZA 1ND2A 4JTNA 4M4PA 2W5FA 4NROA 4HONA 2X53S 3CEWA 3R6SA 1LTEA 4Y5TA 4WZCA 5L9RA 4RN5A 2LUWA 4I0WB 3NKTA 5K7PA 4WM7B 3C2UA 1ALYA 3I2IA 4F8AA 5C6CA 5I91A 3ABZA 2CGPA 2PHFA 3N9NA 2DBIA 3B00A 4N8MA 5IW0A 4BM8A 1OA3A 1RUI1 1QOTA 2XWJB 4AYUA 4BYYA 5T3NA 4EN8B 1TNRA 5JZGC 4HXCA 4XJZA 4XHXA 4ET7A 2HEYF 4CXYA 1OC1A 1KQRA 1RJ7A 3MIHA 3V0AA 5KR7A 3GBWA 4XAEA 5F9TA 3TNPB 3WEZA 2BQPA 2HWF2 2ZCWA 3APBA 4HETA 5A3NA 1AR63 1AR72 1QDOA 3EQEA 1GZ9A 4WM7A 1JYNA 2C26A 4XZUG 3B01A 2DV9A 2DCJA 4D7SA 1JXNA 1ZZ8A 2ARCA 2B4KA 2LALA 2HJIA 1W2UA 4HLTA 4MHRA 1S4CA 2BVVA 1Y4WA 5E6HA 1MZ6A 1LOGA 5LWBA 4BQ4A 1AR91 5FKCA 1OVPA 2CY6A 2VZUA 1WMDA 2W1QA 1LNSA 2W46A 5CFDA 5J37A 3ZO0B 4WVMB 5DG2A 1VALA 2IC1A 2GC1A 3BU7A 3IPVB 3N36A 1TMF1 5KHKA 3ZSKA 2IXJA 1DF0A 2P17A 2HWF3 2R0HA 1PO11 1REFA 3D3AA 4OI0A 1JS9A 4NIAA 1HB4A 3POIA 1RUC2 1SHWB 1X8EA 1WZXA 5GZCA 1QXJA 3AMHA 5HXMA 3VBSC 4IEWA 4QD2A 5IK5A 3VD9A 3FN9A 4LOSA 3DPRB 4Q4Y1 5HCHA 2W1UA 3NJXA 1ENSA 4WVMA 2VCBA 3T4HB 3IPVA 4UFKA 1AYM2 3RZMA 4FPJA 5LBBA 2BWCA 3W21A 2X05A 5ABJB 2V5YA 5IWFA 1M4WA 2YY1A 4HOOA 1AX1A 5LY1A 5FP9A 2A7AA 3RZZA 3HQUA 4Q0UA 3FL7A 2A3XA 4JDOA 1HRI3 4HT1T 1W8TA 3DPRA 1RUC3 3HWJA 1KFXL 4Q1RA 1GV9A 3SNMA 3P1IA 1VBD2 2YGMA 4QHOA 1SEFA 4CP0A 4KWLA 1XSRA 4QX5A 1SLIA 4KBZA 1VIWB 1RUE3 3JU9A 3I2FA 5ABJA 4BOWA 3KVAA 3CBNA 2D3PA 1H4GA 1MS0A 1XNAA 3M1HA 1ULCA 1AYM3 3VBHC 2AENA 2EAAA 3PLQA 3I3DA 4QHBA 2W87A 3KV4A 1ULPA 2DDUA 1UW8A 2D93A 2WO2A 5DMYA 2J1UA 2H0VA 3BB6A 5GLVA 5EXOA 1J3QA 2YG0A 2ZS6B 3PU3A 4PJYA 1YUDA 2PA7A 4LBNA 3UETA 2BBVA 4BCUA 3PMEA 2VTXA 4TZDA 3N7KA 1DGWA 4NUBA 2WN2A 2YHJA 1UXXX 3EBRA 4QDRA 3FLRA 1WCSA 2X29A 1VBD3 2WNVB 2NMOA 4YFWA 3ZDVA 1FT9A 2VD7A 2ZHKA 4LKEA 3RZLA 2IXIA 2F17A 3MIDA 1SCRA 2WBKA 3ZYIB 5FO8B 3LPFA 1XNKA 1UY1A 4QX2A 5CEHA 1OKQA 4JRAA 2A6YA 2RJ2A 4BWOA 3HNMA 5DUVA 1JHNA 4GJZA 4XQ4A 1FI2A 1R1A2 5JOXA 4QWNA 3RQ0A 3N7JA 1ZRCA 5DDJ1 4CVUA 2ARBA 2WRAA 1YQ8A 5FPAA 3LDBA 4BHPA 4MZUA 3KF5A 2WNVA 3VD4A 1QJFA 4IGPA 5J36A 3RNSA 2E6VA 2XG3A 5F5IA 5LBCA 2BVBA 2RV9A 1S0JA 4IGOA 4LKDA 4LA3A 4P9GA 5FPLA 3KV9A 3T0DA 3AZYA 3RWNA 4LE3A 1RUJ1 5KC6A 2B46X 1O8SA 1UYYA 4GAZA 4DO0A 3O1OA 4XOGA 1HLCA 5FYTA 1C3HA 1DBNA 2A3YA 1HIXA 1D2QA 1SCSA 2J42A 1QGLA 3IIAA 1K45A 4U36A 5L9BA 3ZR5A 5HV0A 1DZTA 1R1A3 5FMBA 4HPKB 4AZZA 4Q0SA 2GMPA 2UYBA 4LIUA 4QGNA 2DUOA 2QBXA 2VH9A 3BALA 4HBNA 2OPKA 1XOYA 2NMNA 4QKNA 1UZYA 5FZ1A 2LROA 1CQ9A 2YBPA 4B8EA 1WBFA 3AFGA 1QOSA 1UMIA 1PMHX 5FK8A 4LUMA 1UY2A 1ASJ1 5E8AA 4C0BA 1ENRA 3AKQA 4YW2A 2Y26A 4HPKA 1F9KA 2EF6A 4FQ4A 5C4WB 1W8OA 2WLPA 1S0BA 5CNAA 1N1YA 4IL7A 1XB9A 1TME3 4AEDC 3KCYA 1D0GA 2ZX3A 4YG0A 4IE5A 3R4DB 4ZXEA 1X8MA 2UYAA 4N90A 4BPZA 2FZ2A 5L9VA 5FZHA 2Z4FA 3MGUA 3H1MA 3H1WA 5DPNA 1WD4A 3LPGA 3ZYGA 3O14A 4MUVA 4YG6A 5I0SA 4PIXA 3HJRA 3JQWA 4I0BA 4U2AA 4Z07A 4CP9B 4OMDA 3G7DA 3JXSA 5DZEA 5C4WA 5TSWA 3M3IA 3VKMA 1K5MB 2W94A 3VBSB 1TG7A 1ST8A 4QPYA 1F31A 1US2A 2AR6A 4X8NA 1A8MA 2FQPA 3U1XA 3WDTA 5CISA 5GZGA 3U07A 2MEV2 2E26A 4GA9A 3RRDA 3ZXFA 2Y8KA 4CU9A 2R042 3ACIA 2WZEA 4BE3A 4CP9A 5A3LA 1C8NA 4A7ZA 5FZGA 4PF5A 2D6MA 4Q4W2 5I8SA 2V5DA 1K5MA 4KWJA 1GR3A 4DPNA 5FCCA 3UGHA 4N7IA 2WS92 4G3YC 4TXWA 4XCBA 4NHYA 2OZJA 5E88A 2X09A 4PI0A 1E5IA 4K20A 3BIEA 4LUKA 4CRQA 5KC5A 3LZZA 2W91A 3I97A 5JIAA 1VB2A 1AXKA 3JB8A 3O5SA 3UKVA 4FAGA 2F4LA 2MEV3 1KEXA 3ZSMA 3LOIA 3VBHB 1JMUB 4N9IA 3BUCA 4QXKA 1EY2A 2JXAA 2ZOEB 3AZZA 4GWJA 1CVNA 2JWPA 1W8NA 3K51A 1RXGA 1AR71 2Q1FA 2DVBA 2FZ1A 2J1AA 4LE4A 4WVZA 2DUQA 4IE4A 1V6NA 3BTXA 2GNDA 3FHAA 5FPBA 4CXWA 2D6PA 2WS93 4Q0VA 3HN1A 3VN4A 2NP0A 5I0TA 3ZMNA 1LCLA 1ZNPA 3I2KA 1OF4A 3NAPC 1AL0G 2EXKA 2RS32 1GWLA 2C9AA 3P5BA 3VBHA 4QQLA 1Q8PA 1AVBA 2CAUA 4FPFA 5JR2A 4IV1C 3KCCA 3USUB 2TUNA 1QNYA 5FZMA 3VBUC 4P14A 2UY9A 1S0FA 3NNGA 4AOCA 1BBT1 1Q8VA 1ULOA 4B1LA 1AJKA 1OD5A 1W8WA 2PQSA 1OFSA 2WT1A 2HEWF 3AP6A 2GAUA 3D8CA 3I2DA 1WW7A 1GSLA 4L2NA 4XXPA 1F2NA 1W05A 4XTMA 4UF0B 1V6IA 1EYBA 4S2HA 1OQDA 4X6QB 4RS5C 1UCXA 2ZGPA 4OUMA 1JYTA 2OUHA 1S0EA 4JV4A 5FYCA 3IT8A 4UW6A 2WFPA 1RMU2 1RUOA 2QDRA 3B69A 5FZ6A 4DXSA 3KWVA 4HFSA 3USUA 3MO4A 1VLNA 3V56A 5JOWA 2RS33 2ZGNA 4R9AA 3RZHA 3LQCA 1K42A 5A3WA 4HVOA 2WO1A 4KGQA 5GM0A 2XXZA 3PUAA 4LORA 4W4ZA 1UPIA 2UWBA 3CJIC 3MIFA 4QHZA 1S1AA 4AFDA 3C7GA 1K12A 2YFUA 3OYWB 1BXHA 5JSPA 5FYMA 3WDUA 2EIGA 1UZZA 2E32A 1JU4A 4XC9A 1RUH3 4I30A 5FP8A 5I8YA 1B35C 5BNQA 5LA1A 4KU8A 5HPOA 4D69A 2LRPA 3ZXDA 1T6BX 1JUIA 1W9SA 1ZX5A 1ZRDA 1RMU3 2B45X 4JGYC 3J7LA 4HZFA 4AAXA 2P3IA 1AL23 2R30A 2Q4SA 3I2GA 1I3HA 3Q8FA 2CTVA 3BYWA 3J8F2 4C1XA 5H9RA 4LA2A 3OEAA 2OZ6A 5FMCA 2XHKA 3OYWA 3VZOA 4YZ4A 2CYFA 4LLFA 4BJ0A 4CCKA 1UMHA 2J1EA 3AK0A 4AEKA 3LAGA 2YC0A 5JXHA 4AEDB 4BXFA 4CYDA 4OHVA 4Q29A 4CCEA 1FYUA 3MICA 3LEGA 3SCFA 3VZNA 3Q8BA 4OFGA 4UT5A 4UFMA 3T2QA 4QQPA 4QPIC 3RG0A 5IVFA 4MGKE 1WUVA 2PAKA 2JDZA 3KB5A 2GNBA 1FPN1 1PNGA 2YYOA 1A34A 4E9KA 2R072 5EQUA 1WA4A 4AI9A 2BDRA 2EALA 1OA4A 3EJKA 1DGWX 1MQTC 4JTOA 4QDSA 1PO22 5KWRA 5L7OC 1G9AA 3J8F3 4R8HA 2TNFA 1MZ5A 2BV4A 2D3RA 4AEDA 2JDKA 1GP6A 3IIIA 3N9LA 1M06G 1ULFA 1SG3A 2QUOA 3MUZ1 1G9FA 1ND3C 1O7FA 5LCWL 3IDEA 1AXYA 1ZVFA 3MEPA 1EAH3 2ARAA 2ZBJA 2ZXQA 2FDKA 1W6OB 4D6QA 3KD4A 1H30A 5DAXA 5B4XA 3H50A 3CO2A 5FZBA 1C5HA 4E2QA 3J7MA 4Y4RA 4LO7A 3HR9A 1D4VB 4IE6A 1B09A 1WCQA 1ZA7A 2PAMA 4K1YA 2CNAA 2P34A 3RYRA 4BLJA 2R073 3FUQA 1FMD1 1LEMA 2ZABA 1H8TC 2YPDA 4YM0A 1CZSA 3DYOA 3GCXA 5C71A 2XL7A 1C4RA 3HN3A 5JXJA 5IVEA 1AR82 4BQYA 5LZ6A 1W6OA 1HV0A 3HVDA 5EPAA 3UK9A 3H1YA 5JXIA 4YGBA 4Q27A 1HRV2 3LKJA 4QQ2A 5BXXA 1O5UA 2ET7A 1A8DA 5D2AA 4AR2A 4LBKA 3ENRA 4JAAA 4BK4A 1O59A 2A6WA 2IFWA 4Y1YA 4AGGA 5FZOB 2B7YA 4FPKA 2D43A 3AP4A 5EV7A 3HT2A 3DYMA 1KRIA 2NLRA 2YBKA 5LB6A 1PZ7A 1YIPA 1LOAA 3ZFGC 3IDAA 4XBNA 2CWMA 3TEZA 1ZBE2 1Z78A 3N4MA 3B5LB 1AR83 2CDOA 3U4SA 4IEUA 5C3RA 4XHBA 2A3WA 2VZVA 3L2YA 1LU2A 1NY72 1HRV3 3AP7A 4FT8A 2Y33A 3WG1A 1KFUL 2QQVA 3PMSA 5A32B 3MBWA 4CCNA 4FP3A 4IV1B 1NE6A 1X82A 2VMEA 2XJUA 3KQRA 4NAOA 5FP3A 2IVJA 3VBUB 3VZMA 5I0DA 3O1PA 2V73A 2IXLA 4OUSA 3VL9A 2E53A 5JR7B 1BHGA 2VL4A 2Y6JA 2Q5TA 4XIOA 5CA6A 3H8RA 1WLWA 4Y1VA 3RI8A 2A6XA 1I5ZA 2D6KA 3B94A 5GLTA 1EV12 1H2NA 2W39A 3JD71 3NV3A 4BIFA 1OOPB 1ZBE3 4UFJA 4DXZA 3KSCA 2RDQA 5A32A 4MG2A 4M0NA 5A7PA 4IV1A 3VBUA 1QJY2 4G4FA 1UU6A 4H2AA 4I3PA 4K9SA 4MGSA 2WQ4A 4QX8A 1W90A 4FPGA 5T5JA 2XKPA 4XF4A 2VOKA 1WLCA 4DFSA 2DUPA 1UMZA 4OHWA 5F5CA 2R041 3WNLA 2I07B 1UOBA 2VXRA 1C57A 1SPPB 2H6BA 1OUSA 1SLAA 5FUNA 4I01A 1YLLA 1GNYA 2RR12 4XJAA 4Q4W1 3SITA 1GUIA 4GMP1 4CU7A 3T4VA 3ZXEA 3MLLA 4TN7A 2JKXA 1OOPA 5KXBA 1LHNA 1I6XA 1FOD2 4QB2A 4E2SA 1IZ3A 1OA2A 2SBAA 1XE8A 2WYSA 3NO8A 2ZGMA 1EV13 1B35B 4XFGA 3WQ7A 1J59A 1W03A 5FXVA 3M8LA 1DQ0A 3Q9OA 4J25A 4EWDA 1GICA 1NUKA 1RHI2 4MOAA 4RGKA 1DP0A 2WN3A 2VO5A 1QJY3 3QBQA 4L0PA 3WOGA 1SPPA 4QGMA 5IK8A 1X50A 4GD4A 4IQPA 5ERLA 5JPNB 2FDHA 5J3UA 2P37A 2G9ZA 1GANA 2ZX0A 3HBKA 3HT1A 4ISRA 2B5HA 2VPVA 3PL0A 2ES3A 2Z5WA 1KXGA 1R64A 1VPHA 2VCMA 1B35A 2GP3A 3OUIA 4QX0A 2VVDA 5FYBA 5FY0A 1VRBA 1FOD3 4HVQA 2JDHA 4KG8A 4MXWB 3IBMA 3ZPOA 4KH9A 2W52A 5LW9A 1JYIA 5C3PA 4QPIB 2VNGA 4PLMA 3WVJA 5JWPA 3O1TA 4FXKB 3OY8A 3U75A 1LESA 3KHCA 2D97A 5A33B 4CE8A 4Y33A 4YW6A 5EJ3A 3PVEA 2KM2A 1MQTB 5L7OB 4L97A 5CFDC 4P9IA 4AQ2A 3CHXA 4MX3A 1OUXA 2J1RA 3OB8A 3N9OA 3E6CC 1MVEA 2BU9A 2JD4A 2OT7A 2R0FA 5E89A 5F2SA 3VL8A 3ZPYA 5J98B 3KV5A 4MXWA 3THPA 3WY6A 1YHFA 5C3QA 2BW8A 1LEDA 2I74A 4FI9A 2B39A 4QPIA 4XJWA 5FY8A 4LO6B 2EXIA 2XJPA 1WMEA 5A33A 3ZYHA 1L7QA 3U4XA 1POV0 3MW2A 2PLV1 3VV1A 3H42B 2E9QA 2HWE2 5GZFA 3C7EA 4XABA 5L7OA 4K7JA 2WWSA 1W39A 2ZGLA 3S7EA 2WC2A 4BQWA 4OLLA 2PMWB 1H8TB 4CZSA 2KXLA 5FY5A 4GXLA 4Y1UA 2Y0OA 3D0JA 5GLZA 4QX7A 4YW1A 5SV5A 1D0HA 1E5RA 1Q8SA 3UL2A 3I3MA 3R05A 1VBE2 2DFBA 4QM8A 1R082 4QXCA 1UY3A 2QJVA 2XBO2 3ST7A 3ZYPA 5ACA2 5F5QA 1BCXA 4KG0A 4V2VA 2D6LX 1UU5A 3UT0A 3AVRA 4D3WA 5D8AB 4S2DA 1RB8G 3ASIA 5LATA 1GBGA 1CWPA 4NMIA 1D4M2 1QEXA 1G9DA 1Q56A 1RUD2 2RE9A 2VCAA 3ZM8A 4CDWB 1AYN2 2HWE3 1H8TA 3ZIXA 4F7ZA 5HCAA 1ZZBA 2D6NA 5F3GA 1GFF2 4LOTA 1F35A 1SBDA 3ZFGB 4NHXA 1SMVA 2ZGRA 3TNQA 5FMOS 2H0BA 1X36A 4I0AA 3T1LA 1ENXA 4UBHA 3WP6A 3OD0A 1VBE3 2XMLA 3OD4A 5D8AA 2FDJA 1DQ1A 1R083 2NZ9A 4IEZA 3WNMA 2XBO3 4LEJA 2VZQA 5ACA3 3ATGA 4PIYA 1LAJA 3S57A 1DQ6A 1UL9A 2ZEZA 2ADEA 2R1BA 5IJRA 3N7LA 4CDWA 2MPFA 2WT0A 2CSGA 1BMV1 2HWD1 3KHBA 5DG1A 1VMJA 2P1BA 1OLRA 1ZBA2 2XB6C 4Q4X2 1D4M3 1TVGA 3CJXA 1RUD3 4GWNA 3POGA 1AYN3 3K46A 3UV9A 4B7EA 4QB6A 1CPNA 1Y9QA 1GNHA 5LRSA 1PO21 2Y60A 3RYPA 1VBA2 3O0WA 2V72A 4I3GA 2YUEA 1CPMA 1YYNA 5FREA 3SH4A 1OT5A 1DZRA 1W06A 2EIBA 1FV2A 3NNJA 2YC4A 4JQTA 4NPLA 4O61A 3WNNA 4DS0A 2JB8A 2JIGA 4LNVA 2KR2A 1VBC1 5A3OA 4Y24A 5A6XA 4AVSA 4BB3A 1WKYA 1OLME 4JKKA 1KJRA 4YLZA 2VUDA 3E6DA 1DLCA 1IPJA 2YU2A 3HBZA 1WLTA 3U11A 1Z7S2 2JENA 4M0HA 1QJU3 3VUOA 4Q4X3 4BLIA 5AFBA 2HYKA 3ILFA 3CF6E 4Z82A 1F8VA 1PVC1 2ZAHA 4FQZA 4ITCA 5FXXA 3F2ZA 3W5NA 3URFA 4W6XA 1VBA3 2WZR3 2CV6A 5LA9A 2W1SA 3D82A 1CZTA 5F5AA 1I9RA 1LHWA 4OI2A 2YGLA 3K4AA 2YFZA 5JIUA 2IVIB 2LS6A 5H9SA 1AZDA 3K4DA 3MUY1 4M3CB 5DAVA 5FYVA 3HQXA 3IWZA 1CD3G 3BCWA 1Z7S3 3FBYA 4OVEA 4UXAA 3S7IA 5IHRA 1LB2A 4JGZB 5FZ8A 3E97A 4PQ9A 3S5AA 3SCGA 2RM21 5C9AB 1ACCA 2IZWA 1RC6A 1OF3A 1ZYBA 3NVCA 1CIWA 1VR3A 4CUCA 1G7YA 1URXA 1W8UA 2VU9A 4A45A 3WT3A 2WFF1 4KNCA 2PFWA 2ZGUA 3IMMA 4LBQD 2PTMA 1Q8OA 4R9BA 1NY71 4M3CA 3LIGA 4XDOA 3ZLIA 4E4SA 5FTTC 1OKOA 5F37A 2GH8A 2EA7A 5H9QA 4EN0A 2HLEA 3I3QA 1LJ7A 2CHHA 4JGZA 3OG2A 5FXWA 5CFDB 2QKDA 5C9AA 3PJQA 1DGLA 5FY7A 5C5UA 4OUEA 4PHZA 4MH0E 5AC91 1MEC2 1VJ2A 1FV3A 1H8VA 2WT2A 5C4WC 1N1SA 2NN8A 1ZRFA 3QACA 1XSQA 4XDPA 1JZ7A 3BVCA 3TN92 1PX4A 1ENQA 5FZEA 4QDQA 4B4RA 4AW7A 2XLGA 4LHNA 3ZFEA 4Q1PA 1V6KA 4XYXA 5FMOL 2AACA 4NRMA 3FLTA 3N9MA 4IEXA 3WF0A 2FMYA 1GMMA 5J09A 2R1DA 2WSVA 4NOTA 1OLQA 1QJX1 2XL9A 5LA2A 3IDCB 4LXLA 2DVDA 3FWEA 5BPXA 1DU3D 4PBOA 3C7OA 2D98A 4L9BA 5EHDA 2RR11 1HRI2 3KT1A 3PUQA 4QB1A 5EFUA 1LGNA 1MEC3 1K5MC 4JKLA 4QAWA 3ROUA 4AVTA 3FJSA 4GIQA 1YWKA 1I5PA 1W2AX 3TN93 4XJ9A 1ULDA 4JDMA 1YFXA 1C8M1 2EVXA 1RUE2 4XCAA 3E5XA 5B2GB 1RHI1 2QFEA 1C28A 2VZ1A 2R16A 4GMP0 3PVNA 4HN1A 4JVAA 4A4AA 3DF0A 2W47A 3AYEA 1JOJA 4X8PA 2G4IA 1X9PA 2WUHA 4QQOA 5A1LA 2UWCA 3ZMOA 4YG3A 2P5BA 4HKWA 3O0VA 2JDPA 3IZOA 3TRSB 1RUG2 4MGZE 2HWC2 3VLBB 4RR3B 3Q8EA 3HD8B 4FOWA 1LHOA 3CIHA 2XQXA 5G04L 1G8WA 4L11A 3VB9A 2A70A 2ZGKA 4EZ4A 1S0GA 4HSLA 1NYWA 4AFAA 4X6RB 3VKLA 2JEMA 4KWKA 1SDDB 4ZZ5A 3BGAA 3M2MA 1K5JA 3FFQA 4BQXA 2B9VA 4LMFA 1POV3 1TE1B 5CKQA 1RINA 2W9XA 4XE9A 1SQ4A 2VVEA 3VBOC 2C1FA 4AGVA 4RR3A 1IG0A 1HXS1 2FCUA 3EHKA 2Y6HA 2FDIA 1GQGA 2Y34A 2XVKA 3MF9A 2P3JA 5T55A 3VD5A 1RUG3 2HWC3 1DZQA 3NJYA 5SV8A 2JECA 1SFPA 1PGSA 5FZFA 4NN0A 5GALA 3I59A 4V1PA 5FYHA 2ZHNA 3UKTA 5IATA 3ZXAC 1R092 3I3EA 2RJKA 2YDEA 2RMU3 4RHV2 1IS6A 5FZ3A 2Q30A 3AZVA 4EROA 1VRH2 4LBLA 3PU8A 4UI9L 5FLHA 1CGPA 2XUEA 3OF1A 2Z42A 2QQPA 2R32A 5FYYA 2P6HA 3MW3A 5DABA 3ILRA 1RVF3 2OVUA 3IN9A 1H2MA 4FPOB 4QKFA 1BK0A 2VW0A 2CGNA 4IGQA 4D8MA 1V9U3 3PIJA 4OHZA 1N3QA 2DCKA 4IE7A 3K2OA 2JDAA 4BK5A 2R061 4BQ2A 1DYKA 4CSWA 1BZWA 1KS4A 1QQP1 3NQHA 3RPQA 5A6YA 1R093 2GN3A 2QQJA 5DUXA 4WBBA 4ZXKA 2RVAA 4NO4A 4DEVA 4RHV3 2TEPA 1ZZCA 3I4IA 1NKGA 4XF1A 5KBFA 3IB3A 2WZ8A 2XR4A 3RI9A 1VRH3 3O1UA 2DTWA 3WF1A 4A2UA 4UFIA 1TME2 3T08A 1RUNA 1GWMA 1NLRA 1GZCA 2WWJA 2LM3A 1VAKA 4QPGC 3KF3A 4GB31 2D7FA 5C8CC 5JOYA 2ADDA 4AHYA 2P6CA 3ZR6A 2HWB1 4OZXA 4M4RA 4WM8B 5LK5A 1PIV1 3ZFFC 3H3UA 5HCFA 3VZJA 2K0GA 4IEPA 4ASLA 5FQ0A 1JOBA 5IAVA 4YRDA 1LHUA 1ZBA1 3DEMA 5F1RA 1LKNA 1OD3A 1YFYA 5ANNA 3OTFA 1YJLA 1FNZA 4XQDA 4IEQA 4NWVA 4BQ1A 3J7HA 2VQ0A 2VBDA 1W6NB 1US3A 4Y4YA 4AVVA 4Z8BA 3NNFA 4XF0A 1LECA 1UN1A 2HEVF 2YZ4A 5LEJA 1WMXA 3U78A 5C8WA 1XU1A 4WM8A 3MIGA 1H0BA 3N3HA 1HJGA 2KA3A 2WO7A 3E5QA 4HSJA 3VBFB 1PK6C 2D6OX 2PHUA 1COV2 2GC0A 2R49A 2ET1A 4IEOA 4QQHA 3JBG1 2BERA 4A41A 4NHLA 1XXNA 4QX3A 2VQUA 3QLQA 3P3NA 5BY5A 3SEPA 2BOIA 3AYAA 3R4SA 4YWAA 1W6NA 2XHNA 4UW5A 2YV8A 4Q8LA 3WG2A 1S2BA 3ZVXA 2VC9A
chains in the Genus database with same CATH topology
5CEHA 2YBSA 4HONA 5FV3A 4EZ4A 3KV6A 5FZ7A 5A3TA 4BISA 5FY0A 2XDVA 5IVYA 2GP3A 5FYBA 5FYZA 5FZLA 4D6QA 1VRBA 5FZBA 5FXXA 4GJZA 3RVHA 4Y4RA 3ZPOA 4QWNA 5LW9A 3N9NA 5FZCA 3OPTA 4GJYA 4D6RA 5IW0A 4QXBA 5FPAA 5FJHA 3LDBA 4V2WA 2OQ7A 4LITA 4CCMA 4QU1A 5F5AA 4IGPA 5FPBA 5KR7A 4Y33A 2YPDA 2GP5A 5F5IA 5FZ0A 5FZIA 5FUPA 3NJYA 5A7NA 5A3NA 5IVEA 4IGOA 5FPLA 3N9OA 3KV9A 5FYVA 2OT7A 5F2SA 3PDQA 5FZFA 5FYHA 3KV5A 5FZOA 5FZ8A 4GAZA 4UF0A 5FZMA 5E6HA 4CCOA 4DO0A 5FYTA 3OPWA 5FY8A 4EYUA 5FP7A 4CCJA 5FZ3A 3DXUA 5LWBA 5FJKA 4Y3OA 4LIUA 3PU8A 5FBJA 5FZOB 2XUEA 4UF0B 5FP4A 5FYYA 3PTRB 5FZ1A 2YBKA 4XDOA 4CUGA 3ZLIA 5F3CA 5FZ4A 2PXJA 5F37A 2YBPA 4ASKA 5F3EA 5FYCA 4IGQA 3N9PA 5FXZA 5F32A 4LIVA 5FY5A 4E4HA 5FZ6A 3U4SA 5A7SA 4EZHA 4QX7A 5FXWA 3K2OA 5FY7A 5IVBA 3K3NA 2Q8DA 5FY4A 4CSWA 5IVCA 4QXCA 5ISLA 5A3WA 2OX0A 2XXZA 4V2VA 3UYJA 4CCNA 3PUAA 5IVVA 2OS2A 3AVRA 5F2WA 5FP3A 5FYUA 4XDPA 5FPUA 5FZEA 5LY2A 5ANQA 3KVBA 5FWEA 5FZAA 5FY9A 2Q8EA 2W2IA 3N9QA 5K4LA 2WWJA 5FYMA 3N9MA 5IVJA 5FZ9A 5FZHA 2Q8CA 5FYIA 5IWFA 5FP8A 4AAPA 4HOOA 5F3GA 5LY1A 4CCLA 3LD8A 5FP9A 5A3PA 4LXLA 5FZDA 5A7PA 4C8DA 4URAA 3AVSA 2XMLA 3PUQA 4QX8A 5F5CA 3PUSA 5FUNA 5FYSA 5FPVA 4CCKA 3KVAA 5A7QA 4BXFA 4QXHA 4TN7A 5A7WB 5FWJA 5FY1A 3U78A 5A1FA 2OQ6A 3KV4A 3DXTA 5F3IA 5IVFA 5FZGA 3PU3A 5FZKA 5A80A 4D6SA 2YU1A 5FXVA 3K3OA 4AI9A 2WWUA 5A1LA 4BU2A 4DIQA 4NUBA 5F39A 2P5BA 3AL6A 3PURA 5A7OA 4GD4A 2VD7A 3AL5A 2YU2A 3N9LA 5A7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CEH A;  2YBS A;  4HON A;  5FV3 A;  4EZ4 A;  3KV6 A;  5FZ7 A;  5A3T A;  4BIS A;  5FY0 A;  2XDV A;  5IVY A;  2GP3 A;  5FYB A;  5FYZ A;  5FZL A;  4D6Q A;  1VRB A;  5FZB A;  5FXX A;  4GJZ A;  3RVH A;  4Y4R A;  3ZPO A;  4QWN A;  5LW9 A;  3N9N A;  5FZC A;  3OPT A;  4GJY A;  4D6R A;  5IW0 A;  4QXB A;  5FPA A;  5FJH A;  3LDB A;  4V2W A;  2OQ7 A;  4LIT A;  4CCM A;  4QU1 A;  5F5A A;  4IGP A;  5FPB A;  5KR7 A;  4Y33 A;  2YPD A;  2GP5 A;  5F5I A;  5FZ0 A;  5FZI A;  5FUP A;  3NJY A;  5A7N A;  5A3N A;  5IVE A;  4IGO A;  5FPL A;  3N9O A;  3KV9 A;  5FYV A;  2OT7 A;  5F2S A;  3PDQ A;  5FZF A;  5FYH A;  3KV5 A;  5FZO A;  5FZ8 A;  4GAZ A;  4UF0 A;  5FZM A;  5E6H A;  4CCO A;  4DO0 A;  5FYT A;  3OPW A;  5FY8 A;  4EYU A;  5FP7 A;  4CCJ A;  5FZ3 A;  3DXU A;  5LWB A;  5FJK A;  4Y3O A;  4LIU A;  3PU8 A;  5FBJ A;  5FZO B;  2XUE A;  4UF0 B;  5FP4 A;  5FYY A;  3PTR B;  5FZ1 A;  2YBK A;  4XDO A;  4CUG A;  3ZLI A;  5F3C A;  5FZ4 A;  2PXJ A;  5F37 A;  2YBP A;  4ASK A;  5F3E A;  5FYC A;  4IGQ A;  3N9P A;  5FXZ A;  5F32 A;  4LIV A;  5FY5 A;  4E4H A;  5FZ6 A;  3U4S A;  5A7S A;  4EZH A;  4QX7 A;  5FXW A;  3K2O A;  5FY7 A;  5IVB A;  3K3N A;  2Q8D A;  5FY4 A;  4CSW A;  5IVC A;  4QXC A;  5ISL A;  5A3W A;  2OX0 A;  2XXZ A;  4V2V A;  3UYJ A;  4CCN A;  3PUA A;  5IVV A;  2OS2 A;  3AVR A;  5F2W A;  5FP3 A;  5FYU A;  4XDP A;  5FPU A;  5FZE A;  5LY2 A;  5ANQ A;  3KVB A;  5FWE A;  5FZA A;  5FY9 A;  2Q8E A;  2W2I A;  3N9Q A;  5K4L A;  2WWJ A;  5FYM A;  3N9M A;  5IVJ A;  5FZ9 A;  5FZH A;  2Q8C A;  5FYI A;  5IWF A;  5FP8 A;  4AAP A;  4HOO A;  5F3G A;  5LY1 A;  4CCL A;  3LD8 A;  5FP9 A;  5A3P A;  4LXL A;  5FZD A;  5A7P A;  4C8D A;  4URA A;  3AVS A;  2XML A;  3PUQ A;  4QX8 A;  5F5C A;  3PUS A;  5FUN A;  5FYS A;  5FPV A;  4CCK A;  3KVA A;  5A7Q A;  4BXF A;  4QXH A;  4TN7 A;  5A7W B;  5FWJ A;  5FY1 A;  3U78 A;  5A1F A;  2OQ6 A;  3KV4 A;  3DXT A;  5F3I A;  5IVF A;  5FZG A;  3PU3 A;  5FZK A;  5A80 A;  4D6S A;  2YU1 A;  5FXV A;  3K3O A;  4AI9 A;  2WWU A;  5A1L A;  4BU2 A;  4DIQ A;  4NUB A;  5F39 A;  2P5B A;  3AL6 A;  3PUR A;  5A7O A;  4GD4 A;  2VD7 A;  3AL5 A;  2YU2 A;  3N9L A;  5A7W A; 
#chains in the Genus database with same CATH topology
 5IUQ A;  1JYV A;  3OUJ A;  4CCC A;  3S5Q A;  1EUT A;  2BUK A;  4DY5 A;  4BIS A;  2G9G A;  3BOP A;  3NJV A;  3VBF A;  5FZL A;  4TYS A;  5BNO C;  5DZG A;  1GP4 A;  1U5Y A;  4GJY A;  1LR5 A;  1PGW 2;  1C1L A;  2WAO A;  3B02 A;  4E8C A;  2OQ7 A;  4BDV B;  3LDR A;  1TEI A;  1COV 3;  3T30 A;  3FHQ A;  3VDD C;  2TBV A;  2VMC A;  4ES9 A;  4NR1 A;  1AR6 1;  1V70 A;  1BYH A;  1YFU A;  2CAV A;  3SIS A;  3NL1 A;  1CAW B;  2GP5 A;  1UU4 A;  2RDN A;  2ZA9 A;  3RYK A;  1HN0 A;  5HV4 A;  1JI6 A;  1SBE A;  2RDR A;  2RS5 2;  3DKW A;  3P3P A;  1T6G C;  2FHR A;  1CX4 A;  4B4P A;  2A5Z A;  3MIE A;  4CEW C;  2PHD A;  3FLP A;  3SCH A;  4HAN A;  4PI2 A;  1ZA4 A;  4GKY A;  5FO9 B;  2ILM A;  1HB3 A;  1IGO A;  2FCV A;  4P9L A;  1RTV A;  2J1S A;  3FX3 A;  4PLN A;  1CAW A;  5M0T A;  1STM A;  2C0Z A;  3AZW A;  3K75 B;  2HWF 1;  3VBO B;  4FPY A;  2WYF A;  5FZ4 A;  2E7Q A;  1LGC A;  3HOB A;  3POJ A;  2BGO A;  4YFZ A;  1NZI A;  1VE0 A;  3TEY A;  4EZH A;  2RS5 3;  4HN0 A;  1RIT A;  1UY4 A;  3NV2 A;  3AKP A;  3GYD A;  3K3N A;  3OGG A;  1BVV A;  1NG0 A;  4IDZ A;  1XRU A;  2QDN A;  1RUF 3;  2QQM A;  4NID A;  4FVV A;  5IVV A;  2GAL A;  5CAD A;  5CKM A;  5T50 A;  3H8U A;  4CTE A;  1XYO A;  5LY2 A;  4XJU A;  3VBO A;  4AL9 A;  1HV1 A;  3NMB A;  5GZE A;  1UO9 A;  2O1Q A;  3K4Z A;  1UAI A;  2O8Q A;  3KS7 A;  5FOJ B;  5EYY A;  5FZ9 A;  1CAX B;  4I2O A;  4NIG A;  2F6B A;  1HRI 1;  3AJY A;  4Q4V 2;  4LKF A;  1PGL 2;  3ZDS A;  1RUH 2;  1RUC 1;  2BNO A;  1GNZ A;  2Q1M A;  3LD8 A;  3MF6 A;  5FAX A;  1OOP C;  3VHN A;  2AC1 A;  3OGJ A;  2WII B;  1AXZ A;  1MZE A;  3UNP A;  5A70 A;  3LB9 A;  2JE7 A;  2RS1 2;  1RUE 1;  1AL2 2;  3IAQ A;  3WP4 A;  5I0R A;  3WP3 A;  4GWI A;  1AYM 1;  2EXH A;  1XNC A;  2WNO A;  1VBB 2;  1H4H A;  2JIJ A;  3NRU A;  4TWT A;  1CAX A;  4HG6 B;  3AP9 A;  1BVP 1;  4BZ4 A;  1VAM A;  3FUO A;  4QXH A;  3TYJ A;  4CDQ B;  3QH7 A;  4XVH A;  1L7R A;  4Q4V 3;  5F3I A;  1WMF A;  2XON A;  4QPG B;  2E7T A;  5C8C B;  2XUM A;  5LA0 A;  4JHZ A;  1Z0H A;  3RJR A;  3I2H A;  2PHX A;  2ZML A;  4A6O A;  1VBD 1;  5J96 B;  3MPB A;  4I09 A;  2EAK A;  4BH9 A;  1E57 A;  2UWA A;  3AZX A;  3VHR A;  3ZFF B;  1ZZ9 A;  2CWS A;  3HMY A;  2RS1 3;  2WSU A;  5GLW A;  4TLG A;  1D7P M;  4MYE A;  5D21 A;  3SQO A;  2VW2 A;  4XET A;  2VOX A;  1Y9M A;  4LO8 A;  4OUL A;  5JOZ A;  4RGA A;  4CDQ A;  1VBB 3;  3LFM A;  1W9Y A;  1K3I A;  5FV3 A;  3GJB A;  2ZMN A;  4COV A;  4QPG A;  3R0R A;  5C8C A;  2C9K A;  2XLF A;  2VR4 A;  5FYZ A;  1EAH 2;  3OPZ A;  1W6Q B;  1ZZ6 A;  2VMF A;  3N7M A;  1ZRE A;  4SBV A;  3ZFF A;  4ZHN A;  4CP1 A;  1EP0 A;  5FJH A;  2BJS A;  2NQY A;  3E1F 1;  3KMH A;  4P08 A;  2ETE A;  2JD9 A;  4V2W A;  3ZIW A;  2A71 A;  1PK6 B;  4HKL A;  1FAY A;  4YZ3 A;  5DAW A;  4D0Q A;  1GOF A;  4AF9 A;  4YGE A;  3SKV A;  1H6X A;  1MS4 A;  3B7M A;  4LBJ A;  3VDA A;  3GAL A;  4A7Y A;  5F7U A;  5C3S A;  1U12 A;  1W3X A;  4NAM A;  1UOG A;  4AHX A;  3A0K A;  1W9T A;  4AI0 A;  3GZE A;  3K77 A;  1W6Q A;  3U37 A;  1R1A 1;  5E16 A;  1GOH A;  2OW4 A;  4CCO A;  5C33 A;  2PHT A;  1O4Y A;  5L36 A;  1O8P A;  3WDV A;  4E8D A;  2VUL A;  3U0Z A;  3BOD A;  2DWR A;  2W1W A;  4LT5 A;  1CR7 A;  1HJF A;  4AHZ A;  1PK6 A;  3RZG A;  5BNO B;  2OPW A;  2AEZ A;  4K8R B;  1UKG A;  5JSR A;  3WUD A;  3L2H A;  1PNF A;  3OBZ A;  1A3K A;  1VMH A;  3ACL A;  2PYT A;  1W8H A;  3C3V A;  3GJA A;  4CUG A;  3VDD B;  2D3S A;  1N3P A;  3AFK A;  1ULG A;  3NNM A;  2DFC A;  2UU8 A;  4E4H A;  5A7S A;  5JMO A;  3CZU A;  3AMN A;  5IVB A;  1CX1 A;  1PVX A;  5A3U A;  2BOJ A;  1TME 1;  3EYP A;  4UW3 A;  2OX0 A;  2Z69 A;  3POW A;  2ZGS A;  5BNO A;  4BMB A;  5CZK A;  5FPU A;  2WA3 A;  2QQN A;  4CEW B;  1CZV A;  3DKQ A;  2EID A;  5D8A C;  5T52 A;  1WD3 A;  5GJ6 A;  2X10 A;  5FOB B;  1QXR A;  1QIQ A;  2Q1Z B;  4J6G A;  3VDD A;  3GZT B;  1G9B A;  3WX5 A;  2YB7 A;  4CDW C;  4FCA A;  3WLU A;  5K8S A;  4GKX A;  3GZA A;  3MV0 1;  4FTB A;  3LFI A;  4Z2W A;  2VBB A;  1IG3 A;  1UKR A;  3WW2 A;  3ZX7 A;  2WA4 A;  4YW4 A;  2V4V A;  4CCL A;  1KGY A;  2OA2 A;  2EXJ A;  1HB2 A;  2IUW A;  3JUU A;  3T2T A;  1BJQ A;  4ASM B;  1JZ6 A;  2GC3 A;  4FFG A;  4CEW A;  3E5U A;  1J3P A;  3RMX A;  2XVG A;  4YVW B;  5BNP B;  2XVL A;  1F15 A;  1SLB A;  4ZON A;  3GHN A;  1XC6 A;  4MET A;  2K46 A;  4R4Z A;  4XUQ A;  1BEV 2;  4FXG B;  5LAS A;  2JJ6 A;  4AWD A;  4CEY B;  3MLK A;  4FTE A;  4QKD A;  5C5T A;  1ZM1 A;  1J83 A;  1JH5 A;  5A1F A;  2VQT A;  5JAX A;  1CJD A;  3VKF C;  2VGD A;  1S2E A;  4RA0 A;  1VAV A;  1NX9 A;  3D0S A;  2ZAC A;  5EZW A;  5A80 A;  3QH6 A;  3Q8C A;  4Y22 B;  3LA2 A;  4YVW A;  3ALQ A;  4D94 A;  4AVB A;  4DIQ A;  3HNB M;  5BNP A;  5CBL A;  4XUN A;  2X8K A;  3GCW A;  4FFH A;  4CU8 A;  1RUI 2;  3KZ4 C;  4M01 A;  4YW3 A;  4COU A;  3VGI A;  1GOG A;  3CLP A;  2O0O A;  4CEY A;  2MEV 1;  4B4Q A;  2P2K A;  3THD A;  4XQW A;  4IES A;  1KIT A;  2VOV A;  3ZSE A;  2YBS A;  1GQP A;  1PGW 1;  2FD8 A;  4XAC A;  1BEV 3;  3FZ3 A;  5A3T A;  3CKH A;  1DGR N;  2DUR A;  2ZPX A;  3NWK A;  4UAP A;  1NQJ A;  2BP6 A;  2X5I C;  4Y22 A;  1QJE A;  4LJH A;  4YYO A;  5JPM B;  2DU0 A;  3OEB A;  5KHJ A;  4XUT A;  5FZC A;  3OPT A;  1JZ2 A;  2ZTN A;  4GAL A;  3CL1 A;  2WS9 1;  1O3Q A;  2XGX A;  3VDB A;  4EV0 A;  4CCM A;  1CIY A;  2B8M A;  1DFQ A;  1AR9 2;  1WW6 A;  3WP5 A;  2ZGO A;  3NJZ A;  4L8Q A;  1SBF A;  4XZP A;  1QWR A;  1RUI 3;  2I2S A;  1CAU B;  3H9A A;  1ZZ7 A;  1IS5 A;  4QU2 A;  3BTY A;  1LEN A;  1TMF 2;  3OY8 B;  5I93 A;  3ILN A;  3WIN E;  4LHK A;  3HQR A;  1F5F A;  1A6C A;  5JUV A;  5FLJ A;  1O4T A;  1OPM A;  4OCT A;  5KXE A;  1PO1 2;  2JDN A;  2P3K A;  5T54 A;  5KHG A;  4JGZ C;  5IFP A;  2OKX A;  1JBC A;  2GU9 A;  3DEC A;  2O14 A;  1J1T A;  4LR4 A;  5FP7 A;  2XOM A;  4IV3 C;  5C9A C;  1IKQ A;  1J58 A;  4UWD A;  4DNY A;  3AKR A;  1IOA A;  4Q4Y 2;  5JI7 A;  1CAU A;  4G9S B;  4O65 A;  2OYZ A;  3EB7 A;  1W8Z A;  1OSG A;  1JU3 A;  4AFM A;  1AR9 3;  1NZC A;  1RGS A;  3V64 A;  5F3C A;  2RS3 1;  3ZFE C;  3OGR A;  4MV2 A;  3ZXL A;  3BU0 A;  3WDY A;  5JDB A;  4LIV A;  3DV8 A;  4XDQ A;  4TLF A;  4AQ6 A;  2VTX J;  1TMF 3;  2VAU A;  3AYC A;  2BYV E;  5FY4 A;  1NQD A;  5ISL A;  2QZ3 A;  2P4E A;  1PO1 3;  3AMP A;  1DG6 A;  3EO6 A;  3O12 A;  5FIX A;  3UES A;  3WHT A;  4AHW A;  4B3N A;  4MAD A;  4W6W A;  5LRR A;  3M3E A;  3GBG A;  2QQL A;  3ACF A;  1DGR A;  1RUH 1;  1WW5 A;  5ANQ A;  3AX4 A;  4Q4Y 3;  1DQ4 A;  1XNB A;  3I7D A;  4ZS3 A;  2VCC A;  1RMU 1;  2MNG A;  4Q26 A;  1WLD A;  1Y9G A;  3RGB A;  4WVW A;  1AL2 1;  3JB4 C;  1W0P A;  4XFF A;  3J4U H;  1GP5 A;  4XUR A;  2AGS A;  2VMH A;  1OH3 A;  1OPO A;  5FMD A;  3AVS A;  2KD7 A;  3HIF A;  3MW4 A;  1OUR A;  2FDG A;  2C24 A;  1OVS A;  1ODN A;  4P9J A;  2UUR A;  3DYP A;  4PT6 A;  5LBF A;  4YPJ A;  1O3R A;  2ZZQ A;  4F83 A;  1PX3 A;  1G86 A;  2W92 A;  2XLA A;  1H9P A;  2ZX4 A;  3POS A;  1IKP A;  4N53 A;  4CDU B;  1GZT A;  2VW1 A;  4ARY A;  1W6P B;  4Y1X A;  5A7W B;  3PUI A;  4XF9 A;  5FY1 A;  1SLC A;  1JYW A;  1DDL A;  1ZRI A;  4CPB D;  2PN5 A;  3FE5 A;  3ZYJ B;  4EN7 B;  4W50 A;  4W6Y A;  1SZB A;  4D6S A;  1JHJ A;  2BNM A;  3J8F 1;  3LEM A;  4JCK A;  3OJB A;  1H6Y A;  3WG4 A;  4AEJ A;  4BU2 A;  4JZR A;  1NA1 B;  1O5L A;  4KMQ A;  1GU3 A;  3MLJ A;  5BNN C;  2OXB A;  3RFR A;  1KDM A;  1SDW A;  3OGS A;  1JOP A;  4CDU A;  1EAH 1;  2ORZ A;  2E33 A;  4RR3 C;  2VJX A;  4DB5 A;  1W6P A;  3H0O A;  5A7W A;  3RS6 A;  3VHO A;  4EWA A;  4AQT A;  4QT6 A;  1ONA A;  5G05 L;  3ZYR A;  2XJV A;  3VD7 A;  2VMD A;  4YW5 A;  1QJU 2;  4NPR A;  3I54 A;  4K6B A;  3V65 A;  2Q0A A;  2R07 1;  3NW4 A;  3W5M A;  4D6R A;  5JXG A;  4DMI A;  1NA1 A;  4LIT A;  2MHF A;  4BQ3 A;  4MXV A;  2WZR 2;  2VBP A;  2AUY A;  3DUI A;  1O6U A;  5DDJ 3;  3SHR A;  4DOU A;  5AFE A;  1O3S A;  1RL3 A;  1HKD A;  1WA6 X;  4N43 C;  3KQ4 B;  4XBL A;  3P6B A;  2Z2S B;  1U5X A;  2EIE A;  3RJ2 X;  5CG9 A;  5KXD A;  4LLO A;  4WZF A;  4MGY E;  4PF1 A;  4YNI A;  3BKZ A;  4N9H A;  3H8O A;  5IYY A;  2C6S A;  4FPE A;  1H2K A;  1SAC A;  2D5H A;  2NM1 A;  2YMZ A;  3UJQ A;  1ASJ 2;  1W2T A;  1UF2 C;  1RUJ 3;  4E2G A;  1ULE A;  2BBA A;  2X5I B;  2B42 B;  5F6K A;  3I2J A;  1HQN A;  3ELN A;  3LSD A;  5FP4 A;  4OQ8 A;  3HPN A;  1UZV A;  2LW8 A;  1AR8 1;  2GNT A;  2CU5 A;  2VUC A;  4MVT A;  1W04 A;  4XMA A;  3FFZ A;  4DY3 A;  2GMM A;  4PLO A;  1HRV 1;  3DGT A;  5AVA A;  3SXW A;  1IS3 A;  4QMA A;  3W58 A;  5A6Q A;  1LOE A;  2CDP A;  5IVC A;  1W99 A;  5T5O A;  2X5I A;  4YM1 A;  3LGR A;  5FPX A;  1ASJ 3;  3FHI B;  5C7G A;  2WAB A;  4MO3 M;  4IEV A;  2FCT A;  4IV3 B;  2V09 A;  4XJ8 A;  5FZA A;  2Y6K A;  1ZBE 1;  1H1I A;  4AAP A;  1JOD A;  2DVG A;  4M00 A;  3ZFE B;  1MVQ A;  5A3P A;  2VZP A;  1AUY A;  5J1X A;  3CDZ B;  4YM3 A;  4GUL A;  4WM8 C;  4Q0P A;  1REE A;  4M3C E;  3T2P A;  4LBO A;  2VQA A;  1LOD A;  4EN9 B;  4IV3 A;  3BTZ A;  1AHS A;  1Y3T A;  1W3V A;  2Z79 A;  3PUS A;  5FYS A;  1NXD 1;  3AB0 A;  3BPS A;  5FPV A;  1UZ0 A;  4CU6 A;  4FSJ A;  2BRT A;  2V4A A;  4NRP A;  1EV1 1;  2IWG B;  3SH5 A;  4RL7 A;  4TSV A;  5FWJ A;  2ATF A;  5L73 A;  1PMI A;  3DXT A;  4IW3 A;  4XFC A;  5CAZ A;  3B93 A;  4R4X A;  2VOT A;  1QJY 1;  3VBF C;  2W95 A;  4B1M A;  2WWU A;  4L99 A;  4Q2F A;  1JZ3 A;  2GNM A;  5DUW A;  1H1A A;  1OHF A;  4YGD A;  2A1X A;  3MV1 1;  4OHX A;  1NCQ B;  3GXU A;  4QX1 A;  4UYB A;  4XXA A;  1FOD 1;  1JN2 P;  2DCY A;  3A22 A;  3POE A;  4M3C F;  5T5L A;  2ZAA A;  5IFT A;  1QY4 A;  2E7A A;  3J7N A;  2WZP P;  4A6S A;  2ZX1 A;  2VVF A;  3ECQ A;  2XDV A;  3IKW A;  2VMG A;  1KS5 A;  4H7L A;  2PEL A;  3M70 A;  5JSO A;  3CZJ A;  3LSE A;  3O0X A;  1BBT 2;  4DIN B;  1FX5 A;  1NCQ A;  3WCS A;  3DCQ A;  4GQ7 A;  5FK7 A;  3UGG A;  2WNU B;  2BEO A;  1JTZ X;  1AR7 3;  5FZ0 A;  4EN6 B;  5FBZ A;  4XIK A;  5GKA C;  2BFU L;  5A7N A;  2W08 A;  5DAQ A;  5BNN B;  1IQA A;  1LRH A;  2VOW A;  3PUH A;  5EJ1 B;  1FNY A;  1YXW A;  3GM8 A;  2Y6F A;  2JE9 A;  4DUV A;  3UGF A;  1DYP A;  4UW4 A;  3U10 A;  4LO4 B;  1J1L A;  3ORJ A;  4GH4 C;  2VUJ A;  3ZKU A;  1HQW A;  4CCJ A;  2RMU 2;  1DCS A;  4UOJ A;  3ZSL A;  4A44 A;  2DYC A;  5HXV A;  3I59 B;  4ZY9 A;  4ARX A;  2WNU A;  5KHH A;  1BBT 3;  4QGL A;  3V0B B;  3I49 A;  4DEQ A;  1GLH A;  2NPI A;  1W28 A;  1IPS A;  1LOF A;  5BNN A;  4DXR A;  2VE1 A;  1BK1 A;  2PXJ A;  4OI4 A;  2JE8 A;  3JCI A;  1YFW A;  3PJY A;  4FPH A;  3POY A;  1RVF 2;  3A4U A;  4RGG A;  3A7Q A;  3MZH A;  2K9Z A;  3SEE A;  3ACH A;  1G6N A;  4N43 B;  1YQC A;  2G19 A;  1V9U 2;  3ZN6 B;  1W0O A;  4JDN A;  4AG4 A;  2Q8D A;  1U5Z A;  3ES1 A;  5IT6 A;  1OH4 A;  4MLO A;  1BQP A;  2OS2 A;  3TEW A;  1WBL A;  3V0B A;  2HBU A;  2HWE 1;  1D2S A;  2VM9 A;  3KVB A;  5FWE A;  4A3Z A;  2HYX A;  1I1E A;  3N9Q A;  5K4L A;  2JDM A;  3VKO A;  1IHM A;  1UD1 A;  4N43 A;  3MI8 A;  4Z2A A;  3ZN6 A;  4PIZ A;  1VBE 1;  1YC6 1;  1R08 1;  1MPX A;  2XBO 1;  1W0N A;  1WW4 A;  5ACA 1;  1QMJ A;  4LPL A;  3T09 A;  1JW6 A;  4AQS A;  3KGL A;  1FPN 2;  1O91 A;  3IDB B;  4ZU5 A;  1UNB A;  2A6V A;  1D4M 1;  1OFN A;  4XFA A;  1RUD 1;  2WNE A;  5AVP A;  1Q3E A;  1AYN 1;  5FQ0 B;  4NHK A;  2JG8 C;  3ETQ A;  4H14 A;  2BPA 2;  2F4P A;  5K9Y A;  2ZHM A;  4KI5 M;  1JYC A;  4FFF A;  4HVR A;  5F6L B;  4CDQ C;  1KDK A;  3RWK X;  5FLI A;  2ORX A;  4DZG A;  4ZKT B;  1F4H A;  3MDP A;  4AK3 A;  2PHW A;  3O1R A;  3L9J T;  3PHM A;  3WUC A;  3NST A;  4AI2 A;  2ZGT A;  4NJ4 A;  1QH6 A;  3LEK A;  2QQU A;  5F39 A;  4QPW A;  4B29 A;  4EWE A;  3H7Y A;  3S6P A;  4CCD A;  1FPN 3;  4JKM A;  5A7O A;  4HK9 A;  4COW A;  3I8T A;  4COZ A;  1FMD 2;  1QJU 1;  4Q4X 1;  1WCD J;  3J26 N;  4C91 A;  3PNA A;  4XAA A;  2QZ2 A;  2DBN A;  2UY8 A;  3IM0 A;  5A1A A;  4Y26 A;  2D5F A;  5CVR A;  4IET A;  1UOJ A;  3POF A;  1YNA A;  3KV6 A;  1VBA 1;  2JX9 A;  3WXP A;  2WZR 1;  3HAG A;  5LEK A;  4I02 A;  2ZZJ A;  1S0D A;  3GDB A;  4Y5S A;  4YZ2 A;  3RZJ A;  4ZU4 A;  5CIR A;  1GZW B;  3WHU A;  1UZW A;  2VEC A;  2DVA A;  5JZG B;  3GNE A;  2QQO A;  1WGP A;  4LK6 A;  1T2X A;  3WNK A;  4O7X A;  4JX0 A;  4YZ1 A;  1QJZ A;  1Z7S 1;  5L19 A;  1FMD 3;  4NWW A;  1KD7 A;  1YIF A;  3O1V A;  1JUH A;  5BUV A;  4W8J A;  1FXZ A;  2RG4 A;  1SFN A;  1U0A A;  2Y38 A;  2A6Z A;  2L9L A;  2P3Y A;  2J7M A;  1GZW A;  3MFC A;  2D44 A;  2QQK A;  2G1M A;  3SC7 X;  3WF3 A;  4AVA A;  5JZG A;  4Y3O A;  5C70 A;  4ISQ A;  1V6M A;  1ZRR A;  3FMG A;  5EWS A;  1NCR C;  1NAE A;  5FO7 B;  2JDU A;  2R6Q A;  3LA7 A;  5KXC A;  4TTG A;  3M3O A;  1LUL A;  2VZO A;  1L7L A;  4BIO A;  4RD7 A;  3TOJ A;  3HNY M;  1BKZ A;  5F32 A;  2ZEW A;  1XYN A;  4Y1Z A;  5K0U C;  3E6B A;  1IS4 A;  2WO3 A;  4PQQ A;  3JD7 2;  4YM2 A;  2AYH A;  1HX6 A;  4IUG A;  3UYJ A;  4YSF A;  2O8O A;  1RUF 2;  3GF6 A;  2WKK A;  4K21 A;  2WR9 A;  4GH4 B;  5JLV A;  3LEI A;  5JI9 A;  3MPP G;  1APN A;  4HL0 A;  5F8P A;  4FP2 A;  5DUU A;  5FY9 A;  2Q8E A;  1HDK A;  2FBE A;  1YQ2 A;  2YPJ A;  4XTP A;  2Q8C A;  3PIG A;  2E63 A;  2IXC A;  4XFH A;  4AXO A;  1FAT A;  1XBF A;  3ON7 A;  3T0A A;  3VBS A;  1MEC 1;  2VMI A;  2QNK A;  1YCI A;  5FZD A;  1O4Z A;  1MS3 A;  3J9S A;  4O9G A;  2WLQ A;  3AKT A;  3JD7 3;  5HI0 A;  3KT7 A;  3TN9 1;  4GH4 A;  4YAR A;  3GZU C;  4YVW C;  1QKQ A;  5BNP C;  3AMM A;  1YI9 A;  2HKX A;  5GZD A;  4CUA A;  3O7O A;  1AX0 A;  4NRQ A;  4KL1 A;  5A7Q A;  2R04 3;  4CEY C;  1MS1 A;  2XWB B;  1MR5 A;  1Y7B A;  2VXJ A;  4QM9 A;  1YQ5 A;  4OYU A;  4Q4W 3;  1C1F A;  1PZ9 A;  4GMP 3;  3R4U A;  4P5Y A;  2VNR A;  5FPZ A;  2ARE A;  1XND A;  4EE2 A;  1OXC A;  4CA9 A;  3A0N A;  3IMN A;  4IXL A;  4RYD A;  3AL6 A;  4AEM A;  4DRR A;  2RDS A;  4AE2 A;  5IAX A;  5HCB A;  1XNT A;  4CDX C;  1AX2 A;  1GKB A;  3BPZ A;  5J7M A;  3S0M A;  1X7N A;  2J22 A;  4AVC A;  5CFC C;  1XYP A;  4LKS A;  2Y64 A;  1EUU A;  2JG8 B;  4Y20 B;  1POV 1;  4NE9 A;  3WQB A;  2GSY A;  4F3J A;  1LOC A;  3O1S A;  2DCT A;  4SLI A;  1W8F A;  5JMC A;  4OMC A;  1H2L A;  4QXB A;  1N1T A;  4LO5 B;  3NV1 A;  1W2O A;  1RUG 1;  2BZD A;  2HWC 1;  3WZ1 A;  1DQ5 A;  2GN7 A;  4QU1 A;  4MGI E;  3N35 A;  2Y6L A;  4BME A;  4CUB A;  5BYN A;  1UWW A;  2PLV 2;  3POB A;  2VG9 A;  5DAP A;  4FTS A;  3WNP A;  2XJS A;  3JQX A;  3W9A A;  5FUP A;  3WW1 A;  1J84 A;  2JG8 A;  4Y20 A;  2RMU 1;  4P9X A;  5B4N A;  3B3Q E;  3ZXJ A;  4NIH A;  4FOQ A;  3PTY A;  3AJZ A;  5LK7 B;  2ARX A;  2VZT A;  4H3W A;  2HH9 A;  3MHZ A;  3OCP A;  1OBN A;  4UF0 A;  2CGO A;  3T2O A;  3W20 A;  1LGB A;  3NV4 A;  1DLL A;  3OSD A;  4NPM A;  3MFA A;  1DQ2 A;  3PVO A;  1RVF 1;  3ZOI A;  1OQ1 A;  4H7M A;  4KBB A;  4XPV A;  5A3M A;  3T0B A;  1V9U 1;  3WV6 A;  3WR0 A;  1QXP A;  2WL1 A;  5FDB A;  4QKB A;  2C5D A;  1V0A A;  1W6M B;  2PLV 3;  2YC2 A;  3MYX A;  4ATE A;  4A7K A;  3BI3 A;  2LTN A;  1R09 1;  1CJP A;  1S55 A;  4L92 A;  5I0U A;  4LHS A;  4PDW C;  3CNA A;  4RHV 1;  2PHL A;  4FPL A;  4URT A;  3OBR A;  3W59 A;  1VRH 1;  2N7G A;  2K2S A;  1W9F A;  1MS9 A;  5F2W A;  4A3X A;  5FYU A;  3C8X A;  2CL2 A;  2J1V A;  4P02 B;  4CP2 A;  4H55 A;  4LBM A;  1F5J A;  3LCP A;  1VMF A;  1NOV A;  1W6M A;  5BV6 A;  2W2I A;  3WNX A;  1BMV 2;  1XQN A;  1NCR B;  2JG9 C;  2HWD 2;  5IVJ A;  1CAV B;  3LOB A;  5FYI A;  4E4Z A;  3AXD A;  4AI1 A;  5FKB A;  4N53 C;  1PM4 A;  3DN7 A;  2C4X A;  3B9I A;  4EJR A;  4N7U A;  1MAC A;  4R52 A;  3G6J B;  3LF7 A;  4C8D A;  5K0U B;  2XQR A;  4COY A;  5EYX A;  5E1R A;  4MGT A;  1O3T A;  4NII A;  1HW5 A;  1E5S A;  1UIJ A;  4BA6 A;  3F95 A;  3ACG A;  2JIC A;  4ZS2 A;  1NCR A;  1VBC 2;  2IXK A;  1CAV A;  1V6J A;  3WF4 A;  1H1M A;  2QVS B;  1QOO A;  3AM2 A;  4CDU C;  1SLT A;  1SFY A;  2ZEX A;  2PQQ A;  1WWY A;  2HWD 3;  3TEX A;  4AGR A;  3KGZ A;  3WD5 A;  2GME A;  3ZKY A;  1N3O A;  4K8F A;  1MS5 A;  3M3Q A;  1SLL A;  5K0U A;  1PVC 2;  3ZXK A;  2YU1 A;  2DF7 A;  3K3O A;  1JZ5 A;  1QNW A;  1PO2 3;  1AJO A;  4ORF A;  3B9C A;  5CB7 A;  1MS8 A;  3LDK A;  2HBT A;  2OII A;  1LOB A;  1NA1 C;  2ID4 A;  3SH3 A;  4D7Y A;  3H8X A;  3OUH A;  2WIN B;  3KLS A;  4OQ9 A;  3AL5 A;  1TQ5 A;  3C7H A;  2GDF A;  4YVS C;  1VBC 3;  4DUX A;  2BTV C;  3WCR A;  2EIC A;  4XW3 A;  2VZ3 A;  3ME2 A;  3QOP A;  5IK7 A;  2QCS B;  3RVH A;  1NXM A;  3AKS A;  1COV 1;  3TAY A;  4P5H A;  5EP9 A;  3WSO A;  2XPJ A;  2RM2 2;  4RFR B;  1PVC 3;  2ZGQ A;  4C0H A;  3I3B A;  4FOV A;  4LUL A;  1GYK A;  4AI8 A;  3PVB B;  3OOX A;  1XE7 A;  3OGV A;  3TBD A;  1QF3 A;  2XJT A;  2WFF 2;  1R1Z A;  2AEY A;  3NAP B;  5H9P A;  1RED A;  1NE4 A;  4O9E A;  3TB0 A;  1JZ8 A;  2ZX2 A;  4CDX B;  2BWA A;  5CYY A;  2DTY A;  5J48 A;  1Q8Q A;  1VP6 A;  1POQ A;  1YEW A;  2OUJ A;  5FZO A;  4OHY A;  5CFC B;  1XJA A;  4C90 A;  3VHP A;  1LHV A;  2BGC A;  3DXU A;  4FPC A;  4Q5O A;  5AC9 2;  1F4A A;  1NLQ A;  1NLS A;  4RQP C;  3VBR C;  5FBJ A;  2RM2 3;  1S0C A;  3EXU A;  3GGL A;  1QHD A;  2H6C A;  2ZKN A;  5FUI A;  4UFH A;  3ZN5 A;  4K3U A;  3ZSJ A;  3I2O A;  3K48 A;  3PTR B;  1UPS A;  3NAP A;  4ATF A;  4LHL A;  4ONU A;  1WCU A;  4P9Y A;  4RS5 B;  3QCW A;  2RS5 1;  5FRA A;  3LE0 A;  4CDX A;  2IFR A;  4W65 A;  5EIY B;  4ASK A;  3FBM A;  2DVF A;  5F3E A;  3GHM A;  5FXZ A;  3X29 B;  4FBF A;  2WFF 3;  4WVV A;  1RUF 1;  2ERF A;  1OI6 A;  4CXX A;  1E5H A;  5CFC A;  5DN2 A;  1OMI A;  2Y6G A;  1QJX 2;  2PAE A;  4E4D X;  3USS A;  2VUA A;  4LQR A;  4S2F A;  2PHR A;  3VKN A;  5GLU A;  4S2G A;  3CJI B;  4EQV A;  5AC9 3;  4P00 B;  4RS5 A;  1YQ6 A;  1GWK A;  1UIK A;  2DCZ A;  4JQR A;  1JZ4 A;  1ND2 C;  1PMJ X;  3AYD A;  2NYY A;  3ITQ A;  2WQ8 A;  3IAP A;  4HKO A;  2ZKL A;  4YW7 A;  4PBP A;  4Q8K A;  1C8M 2;  1BLZ A;  2GZW A;  1V6O A;  4AFB A;  3SLI A;  1UOF A;  1UY0 A;  4JGY B;  3AC0 A;  1EPW A;  3H7J A;  1WCK A;  4R9C A;  2ENR A;  5CG8 A;  1V6L A;  4URA A;  5DZF A;  5I8T A;  1QJX 3;  3CJI A;  4E27 A;  2QQW A;  4PDW B;  3VZK A;  1DYO A;  3LA3 A;  4HMZ A;  4DXT A;  2VNV A;  4XF3 A;  4BQ5 A;  2Y0I A;  3AMQ A;  4RFT 0;  1Q43 A;  3KT4 A;  4KGG A;  1PZ8 A;  4C1W A;  1GQH A;  1JYX A;  2RR1 3;  1QU0 A;  5FR3 A;  3VDC A;  1V00 A;  1N1V A;  5APA A;  2G9F A;  4Q4V 1;  4WM7 C;  3BIW E;  1PGL 1;  4B7K A;  4XMI A;  1S0I A;  4MSV A;  3ZYF A;  4Z92 B;  1W2N A;  4JGY A;  4RSU A;  5FFO C;  3S30 A;  2XJQ A;  2JG9 B;  3BOW A;  1C8M 3;  4D7T A;  4YZ5 A;  3ES4 A;  3H3L A;  3QD6 A;  3RSJ A;  2W0X A;  4IND A;  4MGQ A;  1U5I A;  4R9D A;  4N53 B;  1RHI 3;  3CU7 A;  5FZK A;  4PDW A;  2RS1 1;  3U14 A;  2RHP A;  3LIH A;  2YRO A;  3OBT A;  4UFL A;  4XFB A;  2E51 A;  4JHT A;  2FDF A;  4MHU A;  4NVP A;  4JC1 A;  5CU1 A;  2WJS A;  4KU7 A;  1VBB 1;  3C7F A;  1TZO A;  4J1X A;  1HXS 2;  1YJK A;  2ZHL A;  1MZF A;  4K1Z A;  4YGC A;  1Q5O A;  1NCQ C;  4FOY A;  3ZXG A;  1X9T A;  1ODM A;  1ND3 B;  4P9W A;  3M7A A;  4LTA A;  4J1W A;  2JG9 A;  5DQ0 A;  1IPK A;  2A75 A;  2GC2 A;  2JDY A;  2RJL A;  4XFI A;  5IVY A;  2XKO A;  5A6Z A;  4LBQ B;  3WQ1 A;  1L3J A;  5EJZ B;  1QH7 A;  3UJO A;  1MQT A;  1P8J A;  2IXH A;  5CKN A;  2W68 A;  3VD3 A;  1H9W A;  1Y43 B;  2VY0 A;  3KM5 A;  2R7E B;  1RXF A;  4UBG A;  4XBQ A;  3WDX A;  5JCT A;  1ND3 A;  2WNU C;  2W3J A;  3A21 A;  5DDJ 2;  1RYY A;  4AI3 A;  5KHI A;  3CMG A;  5FZI A;  1HXS 3;  1TNF A;  1X33 A;  1DIW A;  1XU2 A;  3WF2 A;  4Z1V A;  1UX7 A;  1LOF C;  1XPW A;  4IE0 A;  3PDQ A;  4LBQ A;  5LBE A;  1KJL A;  2AH2 A;  4DQA A;  4YVS B;  5DXD A;  3D6E A;  5D1I A;  4ZZ8 A;  1HN1 A;  3DPR C;  3BTA A;  1W9W A;  4LK7 A;  3WW4 A;  2R06 2;  1YRZ A;  3OPW A;  3M4F A;  4NHM A;  4EYU A;  4XIL A;  1QQP 2;  1CES A;  2B9U A;  1RJ8 A;  1HQL A;  5FJK A;  4ES8 A;  1YO8 A;  4PCR A;  1RUJ 2;  3ZYB A;  4OZO A;  1UYP A;  3EMR A;  5ABJ C;  4FFI A;  4ZPI A;  1G9C A;  3WG3 A;  4DUW A;  2D40 A;  1NT0 A;  2VNO A;  2ZMK A;  1EPZ A;  3T1M A;  2Q8O A;  4CPB A;  1UQX A;  3TWI A;  1C5I A;  1S2K A;  3DL3 A;  3N9P A;  3THC A;  2SLI A;  4YVS A;  3BN6 A;  2I45 A;  3THT A;  4GB3 2;  2WDB A;  2VZS A;  4GWM A;  1DHK B;  1QDC A;  2HWB 2;  4HK8 A;  3INA A;  1PIV 2;  1XE0 A;  2J1T A;  2QQI A;  3AP5 A;  1CON A;  4GZ9 A;  1UYZ A;  2R06 3;  2XH6 A;  1QQP 3;  2BFU S;  5IK4 A;  3ZFG A;  3D5O A;  4RQP B;  3LWC A;  4XUP A;  3VBR B;  1LU1 A;  1OQE A;  4OI1 A;  4WV8 A;  5FZ7 A;  2VTF A;  2XJR A;  3WDW A;  3JZV A;  3CQO A;  2QTW B;  3KCX A;  4JRL A;  2AZ5 A;  3Q8A A;  1UX6 A;  4AFC A;  4KWU A;  4Q0Q A;  1HB1 A;  1OLM A;  4KQ7 A;  4XUO A;  3VZL A;  1J3R A;  4GB3 3;  3RZK A;  3MIB A;  2BNN A;  3NKG A;  4IEY A;  2WNV C;  5JVV A;  2HWB 3;  2ZJC A;  3RMY A;  2E31 A;  4IER A;  1PIV 3;  3JBG 2;  5C3O A;  3GBF A;  4RQP A;  3VBR A;  3HEI A;  1ZBA 3;  2A73 B;  4DRV A;  3D4K A;  3UKN A;  2VZR A;  2YXS A;  4FAH A;  3WQ0 A;  3A23 A;  1CN1 A;  2FMD A;  5HBA A;  4K40 A;  3O1M A;  1RIR A;  1ND2 B;  1VB4 A;  3ZN4 A;  1A78 A;  2OQ6 A;  1IQD C;  4ZU7 A;  2JKB A;  4Y5Z 0;  1YI7 A;  3H3Z A;  3AXE A;  2QE3 A;  3NNL A;  3WW3 A;  3SKJ E;  1N47 A;  2WAA A;  3T3Y A;  3M3C A;  2JB4 A;  5T5P A;  1AF9 A;  3RDI A;  1UYX A;  1PM7 A;  3SMH A;  1PHM A;  3WNO A;  2WQZ C;  3PUR A;  3FC0 A;  2BGP A;  3ETP A;  1UXZ A;  3JBG 3;  1BEV 1;  3OBA A;  1AR6 2;  4FO9 A;  4A42 A;  4BXS V;  3V0A B;  2DU1 A;  2GH2 A;  2ZEY A;  4XEZ A;  1ND2 A;  4JTN A;  4M4P A;  2W5F A;  4NRO A;  4HON A;  2X53 S;  3CEW A;  3R6S A;  1LTE A;  4Y5T A;  4WZC A;  5L9R A;  4RN5 A;  2LUW A;  4I0W B;  3NKT A;  5K7P A;  4WM7 B;  3C2U A;  1ALY A;  3I2I A;  4F8A A;  5C6C A;  5I91 A;  3ABZ A;  2CGP A;  2PHF A;  3N9N A;  2DBI A;  3B00 A;  4N8M A;  5IW0 A;  4BM8 A;  1OA3 A;  1RUI 1;  1QOT A;  2XWJ B;  4AYU A;  4BYY A;  5T3N A;  4EN8 B;  1TNR A;  5JZG C;  4HXC A;  4XJZ A;  4XHX A;  4ET7 A;  2HEY F;  4CXY A;  1OC1 A;  1KQR A;  1RJ7 A;  3MIH A;  3V0A A;  5KR7 A;  3GBW A;  4XAE A;  5F9T A;  3TNP B;  3WEZ A;  2BQP A;  2HWF 2;  2ZCW A;  3APB A;  4HET A;  5A3N A;  1AR6 3;  1AR7 2;  1QDO A;  3EQE A;  1GZ9 A;  4WM7 A;  1JYN A;  2C26 A;  4XZU G;  3B01 A;  2DV9 A;  2DCJ A;  4D7S A;  1JXN A;  1ZZ8 A;  2ARC A;  2B4K A;  2LAL A;  2HJI A;  1W2U A;  4HLT A;  4MHR A;  1S4C A;  2BVV A;  1Y4W A;  5E6H A;  1MZ6 A;  1LOG A;  5LWB A;  4BQ4 A;  1AR9 1;  5FKC A;  1OVP A;  2CY6 A;  2VZU A;  1WMD A;  2W1Q A;  1LNS A;  2W46 A;  5CFD A;  5J37 A;  3ZO0 B;  4WVM B;  5DG2 A;  1VAL A;  2IC1 A;  2GC1 A;  3BU7 A;  3IPV B;  3N36 A;  1TMF 1;  5KHK A;  3ZSK A;  2IXJ A;  1DF0 A;  2P17 A;  2HWF 3;  2R0H A;  1PO1 1;  1REF A;  3D3A A;  4OI0 A;  1JS9 A;  4NIA A;  1HB4 A;  3POI A;  1RUC 2;  1SHW B;  1X8E A;  1WZX A;  5GZC A;  1QXJ A;  3AMH A;  5HXM A;  3VBS C;  4IEW A;  4QD2 A;  5IK5 A;  3VD9 A;  3FN9 A;  4LOS A;  3DPR B;  4Q4Y 1;  5HCH A;  2W1U A;  3NJX A;  1ENS A;  4WVM A;  2VCB A;  3T4H B;  3IPV A;  4UFK A;  1AYM 2;  3RZM A;  4FPJ A;  5LBB A;  2BWC A;  3W21 A;  2X05 A;  5ABJ B;  2V5Y A;  5IWF A;  1M4W A;  2YY1 A;  4HOO A;  1AX1 A;  5LY1 A;  5FP9 A;  2A7A A;  3RZZ A;  3HQU A;  4Q0U A;  3FL7 A;  2A3X A;  4JDO A;  1HRI 3;  4HT1 T;  1W8T A;  3DPR A;  1RUC 3;  3HWJ A;  1KFX L;  4Q1R A;  1GV9 A;  3SNM A;  3P1I A;  1VBD 2;  2YGM A;  4QHO A;  1SEF A;  4CP0 A;  4KWL A;  1XSR A;  4QX5 A;  1SLI A;  4KBZ A;  1VIW B;  1RUE 3;  3JU9 A;  3I2F A;  5ABJ A;  4BOW A;  3KVA A;  3CBN A;  2D3P A;  1H4G A;  1MS0 A;  1XNA A;  3M1H A;  1ULC A;  1AYM 3;  3VBH C;  2AEN A;  2EAA A;  3PLQ A;  3I3D A;  4QHB A;  2W87 A;  3KV4 A;  1ULP A;  2DDU A;  1UW8 A;  2D93 A;  2WO2 A;  5DMY A;  2J1U A;  2H0V A;  3BB6 A;  5GLV A;  5EXO A;  1J3Q A;  2YG0 A;  2ZS6 B;  3PU3 A;  4PJY A;  1YUD A;  2PA7 A;  4LBN A;  3UET A;  2BBV A;  4BCU A;  3PME A;  2VTX A;  4TZD A;  3N7K A;  1DGW A;  4NUB A;  2WN2 A;  2YHJ A;  1UXX X;  3EBR A;  4QDR A;  3FLR A;  1WCS A;  2X29 A;  1VBD 3;  2WNV B;  2NMO A;  4YFW A;  3ZDV A;  1FT9 A;  2VD7 A;  2ZHK A;  4LKE A;  3RZL A;  2IXI A;  2F17 A;  3MID A;  1SCR A;  2WBK A;  3ZYI B;  5FO8 B;  3LPF A;  1XNK A;  1UY1 A;  4QX2 A;  5CEH A;  1OKQ A;  4JRA A;  2A6Y A;  2RJ2 A;  4BWO A;  3HNM A;  5DUV A;  1JHN A;  4GJZ A;  4XQ4 A;  1FI2 A;  1R1A 2;  5JOX A;  4QWN A;  3RQ0 A;  3N7J A;  1ZRC A;  5DDJ 1;  4CVU A;  2ARB A;  2WRA A;  1YQ8 A;  5FPA A;  3LDB A;  4BHP A;  4MZU A;  3KF5 A;  2WNV A;  3VD4 A;  1QJF A;  4IGP A;  5J36 A;  3RNS A;  2E6V A;  2XG3 A;  5F5I A;  5LBC A;  2BVB A;  2RV9 A;  1S0J A;  4IGO A;  4LKD A;  4LA3 A;  4P9G A;  5FPL A;  3KV9 A;  3T0D A;  3AZY A;  3RWN A;  4LE3 A;  1RUJ 1;  5KC6 A;  2B46 X;  1O8S A;  1UYY A;  4GAZ A;  4DO0 A;  3O1O A;  4XOG A;  1HLC A;  5FYT A;  1C3H A;  1DBN A;  2A3Y A;  1HIX A;  1D2Q A;  1SCS A;  2J42 A;  1QGL A;  3IIA A;  1K45 A;  4U36 A;  5L9B A;  3ZR5 A;  5HV0 A;  1DZT A;  1R1A 3;  5FMB A;  4HPK B;  4AZZ A;  4Q0S A;  2GMP A;  2UYB A;  4LIU A;  4QGN A;  2DUO A;  2QBX A;  2VH9 A;  3BAL A;  4HBN A;  2OPK A;  1XOY A;  2NMN A;  4QKN A;  1UZY A;  5FZ1 A;  2LRO A;  1CQ9 A;  2YBP A;  4B8E A;  1WBF A;  3AFG A;  1QOS A;  1UMI A;  1PMH X;  5FK8 A;  4LUM A;  1UY2 A;  1ASJ 1;  5E8A A;  4C0B A;  1ENR A;  3AKQ A;  4YW2 A;  2Y26 A;  4HPK A;  1F9K A;  2EF6 A;  4FQ4 A;  5C4W B;  1W8O A;  2WLP A;  1S0B A;  5CNA A;  1N1Y A;  4IL7 A;  1XB9 A;  1TME 3;  4AED C;  3KCY A;  1D0G A;  2ZX3 A;  4YG0 A;  4IE5 A;  3R4D B;  4ZXE A;  1X8M A;  2UYA A;  4N90 A;  4BPZ A;  2FZ2 A;  5L9V A;  5FZH A;  2Z4F A;  3MGU A;  3H1M A;  3H1W A;  5DPN A;  1WD4 A;  3LPG A;  3ZYG A;  3O14 A;  4MUV A;  4YG6 A;  5I0S A;  4PIX A;  3HJR A;  3JQW A;  4I0B A;  4U2A A;  4Z07 A;  4CP9 B;  4OMD A;  3G7D A;  3JXS A;  5DZE A;  5C4W A;  5TSW A;  3M3I A;  3VKM A;  1K5M B;  2W94 A;  3VBS B;  1TG7 A;  1ST8 A;  4QPY A;  1F31 A;  1US2 A;  2AR6 A;  4X8N A;  1A8M A;  2FQP A;  3U1X A;  3WDT A;  5CIS A;  5GZG A;  3U07 A;  2MEV 2;  2E26 A;  4GA9 A;  3RRD A;  3ZXF A;  2Y8K A;  4CU9 A;  2R04 2;  3ACI A;  2WZE A;  4BE3 A;  4CP9 A;  5A3L A;  1C8N A;  4A7Z A;  5FZG A;  4PF5 A;  2D6M A;  4Q4W 2;  5I8S A;  2V5D A;  1K5M A;  4KWJ A;  1GR3 A;  4DPN A;  5FCC A;  3UGH A;  4N7I A;  2WS9 2;  4G3Y C;  4TXW A;  4XCB A;  4NHY A;  2OZJ A;  5E88 A;  2X09 A;  4PI0 A;  1E5I A;  4K20 A;  3BIE A;  4LUK A;  4CRQ A;  5KC5 A;  3LZZ A;  2W91 A;  3I97 A;  5JIA A;  1VB2 A;  1AXK A;  3JB8 A;  3O5S A;  3UKV A;  4FAG A;  2F4L A;  2MEV 3;  1KEX A;  3ZSM A;  3LOI A;  3VBH B;  1JMU B;  4N9I A;  3BUC A;  4QXK A;  1EY2 A;  2JXA A;  2ZOE B;  3AZZ A;  4GWJ A;  1CVN A;  2JWP A;  1W8N A;  3K51 A;  1RXG A;  1AR7 1;  2Q1F A;  2DVB A;  2FZ1 A;  2J1A A;  4LE4 A;  4WVZ A;  2DUQ A;  4IE4 A;  1V6N A;  3BTX A;  2GND A;  3FHA A;  5FPB A;  4CXW A;  2D6P A;  2WS9 3;  4Q0V A;  3HN1 A;  3VN4 A;  2NP0 A;  5I0T A;  3ZMN A;  1LCL A;  1ZNP A;  3I2K A;  1OF4 A;  3NAP C;  1AL0 G;  2EXK A;  2RS3 2;  1GWL A;  2C9A A;  3P5B A;  3VBH A;  4QQL A;  1Q8P A;  1AVB A;  2CAU A;  4FPF A;  5JR2 A;  4IV1 C;  3KCC A;  3USU B;  2TUN A;  1QNY A;  5FZM A;  3VBU C;  4P14 A;  2UY9 A;  1S0F A;  3NNG A;  4AOC A;  1BBT 1;  1Q8V A;  1ULO A;  4B1L A;  1AJK A;  1OD5 A;  1W8W A;  2PQS A;  1OFS A;  2WT1 A;  2HEW F;  3AP6 A;  2GAU A;  3D8C A;  3I2D A;  1WW7 A;  1GSL A;  4L2N A;  4XXP A;  1F2N A;  1W05 A;  4XTM A;  4UF0 B;  1V6I A;  1EYB A;  4S2H A;  1OQD A;  4X6Q B;  4RS5 C;  1UCX A;  2ZGP A;  4OUM A;  1JYT A;  2OUH A;  1S0E A;  4JV4 A;  5FYC A;  3IT8 A;  4UW6 A;  2WFP A;  1RMU 2;  1RUO A;  2QDR A;  3B69 A;  5FZ6 A;  4DXS A;  3KWV A;  4HFS A;  3USU A;  3MO4 A;  1VLN A;  3V56 A;  5JOW A;  2RS3 3;  2ZGN A;  4R9A A;  3RZH A;  3LQC A;  1K42 A;  5A3W A;  4HVO A;  2WO1 A;  4KGQ A;  5GM0 A;  2XXZ A;  3PUA A;  4LOR A;  4W4Z A;  1UPI A;  2UWB A;  3CJI C;  3MIF A;  4QHZ A;  1S1A A;  4AFD A;  3C7G A;  1K12 A;  2YFU A;  3OYW B;  1BXH A;  5JSP A;  5FYM A;  3WDU A;  2EIG A;  1UZZ A;  2E32 A;  1JU4 A;  4XC9 A;  1RUH 3;  4I30 A;  5FP8 A;  5I8Y A;  1B35 C;  5BNQ A;  5LA1 A;  4KU8 A;  5HPO A;  4D69 A;  2LRP A;  3ZXD A;  1T6B X;  1JUI A;  1W9S A;  1ZX5 A;  1ZRD A;  1RMU 3;  2B45 X;  4JGY C;  3J7L A;  4HZF A;  4AAX A;  2P3I A;  1AL2 3;  2R30 A;  2Q4S A;  3I2G A;  1I3H A;  3Q8F A;  2CTV A;  3BYW A;  3J8F 2;  4C1X A;  5H9R A;  4LA2 A;  3OEA A;  2OZ6 A;  5FMC A;  2XHK A;  3OYW A;  3VZO A;  4YZ4 A;  2CYF A;  4LLF A;  4BJ0 A;  4CCK A;  1UMH A;  2J1E A;  3AK0 A;  4AEK A;  3LAG A;  2YC0 A;  5JXH A;  4AED B;  4BXF A;  4CYD A;  4OHV A;  4Q29 A;  4CCE A;  1FYU A;  3MIC A;  3LEG A;  3SCF A;  3VZN A;  3Q8B A;  4OFG A;  4UT5 A;  4UFM A;  3T2Q A;  4QQP A;  4QPI C;  3RG0 A;  5IVF A;  4MGK E;  1WUV A;  2PAK A;  2JDZ A;  3KB5 A;  2GNB A;  1FPN 1;  1PNG A;  2YYO A;  1A34 A;  4E9K A;  2R07 2;  5EQU A;  1WA4 A;  4AI9 A;  2BDR A;  2EAL A;  1OA4 A;  3EJK A;  1DGW X;  1MQT C;  4JTO A;  4QDS A;  1PO2 2;  5KWR A;  5L7O C;  1G9A A;  3J8F 3;  4R8H A;  2TNF A;  1MZ5 A;  2BV4 A;  2D3R A;  4AED A;  2JDK A;  1GP6 A;  3III A;  3N9L A;  1M06 G;  1ULF A;  1SG3 A;  2QUO A;  3MUZ 1;  1G9F A;  1ND3 C;  1O7F A;  5LCW L;  3IDE A;  1AXY A;  1ZVF A;  3MEP A;  1EAH 3;  2ARA A;  2ZBJ A;  2ZXQ A;  2FDK A;  1W6O B;  4D6Q A;  3KD4 A;  1H30 A;  5DAX A;  5B4X A;  3H50 A;  3CO2 A;  5FZB A;  1C5H A;  4E2Q A;  3J7M A;  4Y4R A;  4LO7 A;  3HR9 A;  1D4V B;  4IE6 A;  1B09 A;  1WCQ A;  1ZA7 A;  2PAM A;  4K1Y A;  2CNA A;  2P34 A;  3RYR A;  4BLJ A;  2R07 3;  3FUQ A;  1FMD 1;  1LEM A;  2ZAB A;  1H8T C;  2YPD A;  4YM0 A;  1CZS A;  3DYO A;  3GCX A;  5C71 A;  2XL7 A;  1C4R A;  3HN3 A;  5JXJ A;  5IVE A;  1AR8 2;  4BQY A;  5LZ6 A;  1W6O A;  1HV0 A;  3HVD A;  5EPA A;  3UK9 A;  3H1Y A;  5JXI A;  4YGB A;  4Q27 A;  1HRV 2;  3LKJ A;  4QQ2 A;  5BXX A;  1O5U A;  2ET7 A;  1A8D A;  5D2A A;  4AR2 A;  4LBK A;  3ENR A;  4JAA A;  4BK4 A;  1O59 A;  2A6W A;  2IFW A;  4Y1Y A;  4AGG A;  5FZO B;  2B7Y A;  4FPK A;  2D43 A;  3AP4 A;  5EV7 A;  3HT2 A;  3DYM A;  1KRI A;  2NLR A;  2YBK A;  5LB6 A;  1PZ7 A;  1YIP A;  1LOA A;  3ZFG C;  3IDA A;  4XBN A;  2CWM A;  3TEZ A;  1ZBE 2;  1Z78 A;  3N4M A;  3B5L B;  1AR8 3;  2CDO A;  3U4S A;  4IEU A;  5C3R A;  4XHB A;  2A3W A;  2VZV A;  3L2Y A;  1LU2 A;  1NY7 2;  1HRV 3;  3AP7 A;  4FT8 A;  2Y33 A;  3WG1 A;  1KFU L;  2QQV A;  3PMS A;  5A32 B;  3MBW A;  4CCN A;  4FP3 A;  4IV1 B;  1NE6 A;  1X82 A;  2VME A;  2XJU A;  3KQR A;  4NAO A;  5FP3 A;  2IVJ A;  3VBU B;  3VZM A;  5I0D A;  3O1P A;  2V73 A;  2IXL A;  4OUS A;  3VL9 A;  2E53 A;  5JR7 B;  1BHG A;  2VL4 A;  2Y6J A;  2Q5T A;  4XIO A;  5CA6 A;  3H8R A;  1WLW A;  4Y1V A;  3RI8 A;  2A6X A;  1I5Z A;  2D6K A;  3B94 A;  5GLT A;  1EV1 2;  1H2N A;  2W39 A;  3JD7 1;  3NV3 A;  4BIF A;  1OOP B;  1ZBE 3;  4UFJ A;  4DXZ A;  3KSC A;  2RDQ A;  5A32 A;  4MG2 A;  4M0N A;  5A7P A;  4IV1 A;  3VBU A;  1QJY 2;  4G4F A;  1UU6 A;  4H2A A;  4I3P A;  4K9S A;  4MGS A;  2WQ4 A;  4QX8 A;  1W90 A;  4FPG A;  5T5J A;  2XKP A;  4XF4 A;  2VOK A;  1WLC A;  4DFS A;  2DUP A;  1UMZ A;  4OHW A;  5F5C A;  2R04 1;  3WNL A;  2I07 B;  1UOB A;  2VXR A;  1C57 A;  1SPP B;  2H6B A;  1OUS A;  1SLA A;  5FUN A;  4I01 A;  1YLL A;  1GNY A;  2RR1 2;  4XJA A;  4Q4W 1;  3SIT A;  1GUI A;  4GMP 1;  4CU7 A;  3T4V A;  3ZXE A;  3MLL A;  4TN7 A;  2JKX A;  1OOP A;  5KXB A;  1LHN A;  1I6X A;  1FOD 2;  4QB2 A;  4E2S A;  1IZ3 A;  1OA2 A;  2SBA A;  1XE8 A;  2WYS A;  3NO8 A;  2ZGM A;  1EV1 3;  1B35 B;  4XFG A;  3WQ7 A;  1J59 A;  1W03 A;  5FXV A;  3M8L A;  1DQ0 A;  3Q9O A;  4J25 A;  4EWD A;  1GIC A;  1NUK A;  1RHI 2;  4MOA A;  4RGK A;  1DP0 A;  2WN3 A;  2VO5 A;  1QJY 3;  3QBQ A;  4L0P A;  3WOG A;  1SPP A;  4QGM A;  5IK8 A;  1X50 A;  4GD4 A;  4IQP A;  5ERL A;  5JPN B;  2FDH A;  5J3U A;  2P37 A;  2G9Z A;  1GAN A;  2ZX0 A;  3HBK A;  3HT1 A;  4ISR A;  2B5H A;  2VPV A;  3PL0 A;  2ES3 A;  2Z5W A;  1KXG A;  1R64 A;  1VPH A;  2VCM A;  1B35 A;  2GP3 A;  3OUI A;  4QX0 A;  2VVD A;  5FYB A;  5FY0 A;  1VRB A;  1FOD 3;  4HVQ A;  2JDH A;  4KG8 A;  4MXW B;  3IBM A;  3ZPO A;  4KH9 A;  2W52 A;  5LW9 A;  1JYI A;  5C3P A;  4QPI B;  2VNG A;  4PLM A;  3WVJ A;  5JWP A;  3O1T A;  4FXK B;  3OY8 A;  3U75 A;  1LES A;  3KHC A;  2D97 A;  5A33 B;  4CE8 A;  4Y33 A;  4YW6 A;  5EJ3 A;  3PVE A;  2KM2 A;  1MQT B;  5L7O B;  4L97 A;  5CFD C;  4P9I A;  4AQ2 A;  3CHX A;  4MX3 A;  1OUX A;  2J1R A;  3OB8 A;  3N9O A;  3E6C C;  1MVE A;  2BU9 A;  2JD4 A;  2OT7 A;  2R0F A;  5E89 A;  5F2S A;  3VL8 A;  3ZPY A;  5J98 B;  3KV5 A;  4MXW A;  3THP A;  3WY6 A;  1YHF A;  5C3Q A;  2BW8 A;  1LED A;  2I74 A;  4FI9 A;  2B39 A;  4QPI A;  4XJW A;  5FY8 A;  4LO6 B;  2EXI A;  2XJP A;  1WME A;  5A33 A;  3ZYH A;  1L7Q A;  3U4X A;  1POV 0;  3MW2 A;  2PLV 1;  3VV1 A;  3H42 B;  2E9Q A;  2HWE 2;  5GZF A;  3C7E A;  4XAB A;  5L7O A;  4K7J A;  2WWS A;  1W39 A;  2ZGL A;  3S7E A;  2WC2 A;  4BQW A;  4OLL A;  2PMW B;  1H8T B;  4CZS A;  2KXL A;  5FY5 A;  4GXL A;  4Y1U A;  2Y0O A;  3D0J A;  5GLZ A;  4QX7 A;  4YW1 A;  5SV5 A;  1D0H A;  1E5R A;  1Q8S A;  3UL2 A;  3I3M A;  3R05 A;  1VBE 2;  2DFB A;  4QM8 A;  1R08 2;  4QXC A;  1UY3 A;  2QJV A;  2XBO 2;  3ST7 A;  3ZYP A;  5ACA 2;  5F5Q A;  1BCX A;  4KG0 A;  4V2V A;  2D6L X;  1UU5 A;  3UT0 A;  3AVR A;  4D3W A;  5D8A B;  4S2D A;  1RB8 G;  3ASI A;  5LAT A;  1GBG A;  1CWP A;  4NMI A;  1D4M 2;  1QEX A;  1G9D A;  1Q56 A;  1RUD 2;  2RE9 A;  2VCA A;  3ZM8 A;  4CDW B;  1AYN 2;  2HWE 3;  1H8T A;  3ZIX A;  4F7Z A;  5HCA A;  1ZZB A;  2D6N A;  5F3G A;  1GFF 2;  4LOT A;  1F35 A;  1SBD A;  3ZFG B;  4NHX A;  1SMV A;  2ZGR A;  3TNQ A;  5FMO S;  2H0B A;  1X36 A;  4I0A A;  3T1L A;  1ENX A;  4UBH A;  3WP6 A;  3OD0 A;  1VBE 3;  2XML A;  3OD4 A;  5D8A A;  2FDJ A;  1DQ1 A;  1R08 3;  2NZ9 A;  4IEZ A;  3WNM A;  2XBO 3;  4LEJ A;  2VZQ A;  5ACA 3;  3ATG A;  4PIY A;  1LAJ A;  3S57 A;  1DQ6 A;  1UL9 A;  2ZEZ A;  2ADE A;  2R1B A;  5IJR A;  3N7L A;  4CDW A;  2MPF A;  2WT0 A;  2CSG A;  1BMV 1;  2HWD 1;  3KHB A;  5DG1 A;  1VMJ A;  2P1B A;  1OLR A;  1ZBA 2;  2XB6 C;  4Q4X 2;  1D4M 3;  1TVG A;  3CJX A;  1RUD 3;  4GWN A;  3POG A;  1AYN 3;  3K46 A;  3UV9 A;  4B7E A;  4QB6 A;  1CPN A;  1Y9Q A;  1GNH A;  5LRS A;  1PO2 1;  2Y60 A;  3RYP A;  1VBA 2;  3O0W A;  2V72 A;  4I3G A;  2YUE A;  1CPM A;  1YYN A;  5FRE A;  3SH4 A;  1OT5 A;  1DZR A;  1W06 A;  2EIB A;  1FV2 A;  3NNJ A;  2YC4 A;  4JQT A;  4NPL A;  4O61 A;  3WNN A;  4DS0 A;  2JB8 A;  2JIG A;  4LNV A;  2KR2 A;  1VBC 1;  5A3O A;  4Y24 A;  5A6X A;  4AVS A;  4BB3 A;  1WKY A;  1OLM E;  4JKK A;  1KJR A;  4YLZ A;  2VUD A;  3E6D A;  1DLC A;  1IPJ A;  2YU2 A;  3HBZ A;  1WLT A;  3U11 A;  1Z7S 2;  2JEN A;  4M0H A;  1QJU 3;  3VUO A;  4Q4X 3;  4BLI A;  5AFB A;  2HYK A;  3ILF A;  3CF6 E;  4Z82 A;  1F8V A;  1PVC 1;  2ZAH A;  4FQZ A;  4ITC A;  5FXX A;  3F2Z A;  3W5N A;  3URF A;  4W6X A;  1VBA 3;  2WZR 3;  2CV6 A;  5LA9 A;  2W1S A;  3D82 A;  1CZT A;  5F5A A;  1I9R A;  1LHW A;  4OI2 A;  2YGL A;  3K4A A;  2YFZ A;  5JIU A;  2IVI B;  2LS6 A;  5H9S A;  1AZD A;  3K4D A;  3MUY 1;  4M3C B;  5DAV A;  5FYV A;  3HQX A;  3IWZ A;  1CD3 G;  3BCW A;  1Z7S 3;  3FBY A;  4OVE A;  4UXA A;  3S7I A;  5IHR A;  1LB2 A;  4JGZ B;  5FZ8 A;  3E97 A;  4PQ9 A;  3S5A A;  3SCG A;  2RM2 1;  5C9A B;  1ACC A;  2IZW A;  1RC6 A;  1OF3 A;  1ZYB A;  3NVC A;  1CIW A;  1VR3 A;  4CUC A;  1G7Y A;  1URX A;  1W8U A;  2VU9 A;  4A45 A;  3WT3 A;  2WFF 1;  4KNC A;  2PFW A;  2ZGU A;  3IMM A;  4LBQ D;  2PTM A;  1Q8O A;  4R9B A;  1NY7 1;  4M3C A;  3LIG A;  4XDO A;  3ZLI A;  4E4S A;  5FTT C;  1OKO A;  5F37 A;  2GH8 A;  2EA7 A;  5H9Q A;  4EN0 A;  2HLE A;  3I3Q A;  1LJ7 A;  2CHH A;  4JGZ A;  3OG2 A;  5FXW A;  5CFD B;  2QKD A;  5C9A A;  3PJQ A;  1DGL A;  5FY7 A;  5C5U A;  4OUE A;  4PHZ A;  4MH0 E;  5AC9 1;  1MEC 2;  1VJ2 A;  1FV3 A;  1H8V A;  2WT2 A;  5C4W C;  1N1S A;  2NN8 A;  1ZRF A;  3QAC A;  1XSQ A;  4XDP A;  1JZ7 A;  3BVC A;  3TN9 2;  1PX4 A;  1ENQ A;  5FZE A;  4QDQ A;  4B4R A;  4AW7 A;  2XLG A;  4LHN A;  3ZFE A;  4Q1P A;  1V6K A;  4XYX A;  5FMO L;  2AAC A;  4NRM A;  3FLT A;  3N9M A;  4IEX A;  3WF0 A;  2FMY A;  1GMM A;  5J09 A;  2R1D A;  2WSV A;  4NOT A;  1OLQ A;  1QJX 1;  2XL9 A;  5LA2 A;  3IDC B;  4LXL A;  2DVD A;  3FWE A;  5BPX A;  1DU3 D;  4PBO A;  3C7O A;  2D98 A;  4L9B A;  5EHD A;  2RR1 1;  1HRI 2;  3KT1 A;  3PUQ A;  4QB1 A;  5EFU A;  1LGN A;  1MEC 3;  1K5M C;  4JKL A;  4QAW A;  3ROU A;  4AVT A;  3FJS A;  4GIQ A;  1YWK A;  1I5P A;  1W2A X;  3TN9 3;  4XJ9 A;  1ULD A;  4JDM A;  1YFX A;  1C8M 1;  2EVX A;  1RUE 2;  4XCA A;  3E5X A;  5B2G B;  1RHI 1;  2QFE A;  1C28 A;  2VZ1 A;  2R16 A;  4GMP 0;  3PVN A;  4HN1 A;  4JVA A;  4A4A A;  3DF0 A;  2W47 A;  3AYE A;  1JOJ A;  4X8P A;  2G4I A;  1X9P A;  2WUH A;  4QQO A;  5A1L A;  2UWC A;  3ZMO A;  4YG3 A;  2P5B A;  4HKW A;  3O0V A;  2JDP A;  3IZO A;  3TRS B;  1RUG 2;  4MGZ E;  2HWC 2;  3VLB B;  4RR3 B;  3Q8E A;  3HD8 B;  4FOW A;  1LHO A;  3CIH A;  2XQX A;  5G04 L;  1G8W A;  4L11 A;  3VB9 A;  2A70 A;  2ZGK A;  4EZ4 A;  1S0G A;  4HSL A;  1NYW A;  4AFA A;  4X6R B;  3VKL A;  2JEM A;  4KWK A;  1SDD B;  4ZZ5 A;  3BGA A;  3M2M A;  1K5J A;  3FFQ A;  4BQX A;  2B9V A;  4LMF A;  1POV 3;  1TE1 B;  5CKQ A;  1RIN A;  2W9X A;  4XE9 A;  1SQ4 A;  2VVE A;  3VBO C;  2C1F A;  4AGV A;  4RR3 A;  1IG0 A;  1HXS 1;  2FCU A;  3EHK A;  2Y6H A;  2FDI A;  1GQG A;  2Y34 A;  2XVK A;  3MF9 A;  2P3J A;  5T55 A;  3VD5 A;  1RUG 3;  2HWC 3;  1DZQ A;  3NJY A;  5SV8 A;  2JEC A;  1SFP A;  1PGS A;  5FZF A;  4NN0 A;  5GAL A;  3I59 A;  4V1P A;  5FYH A;  2ZHN A;  3UKT A;  5IAT A;  3ZXA C;  1R09 2;  3I3E A;  2RJK A;  2YDE A;  2RMU 3;  4RHV 2;  1IS6 A;  5FZ3 A;  2Q30 A;  3AZV A;  4ERO A;  1VRH 2;  4LBL A;  3PU8 A;  4UI9 L;  5FLH A;  1CGP A;  2XUE A;  3OF1 A;  2Z42 A;  2QQP A;  2R32 A;  5FYY A;  2P6H A;  3MW3 A;  5DAB A;  3ILR A;  1RVF 3;  2OVU A;  3IN9 A;  1H2M A;  4FPO B;  4QKF A;  1BK0 A;  2VW0 A;  2CGN A;  4IGQ A;  4D8M A;  1V9U 3;  3PIJ A;  4OHZ A;  1N3Q A;  2DCK A;  4IE7 A;  3K2O A;  2JDA A;  4BK5 A;  2R06 1;  4BQ2 A;  1DYK A;  4CSW A;  1BZW A;  1KS4 A;  1QQP 1;  3NQH A;  3RPQ A;  5A6Y A;  1R09 3;  2GN3 A;  2QQJ A;  5DUX A;  4WBB A;  4ZXK A;  2RVA A;  4NO4 A;  4DEV A;  4RHV 3;  2TEP A;  1ZZC A;  3I4I A;  1NKG A;  4XF1 A;  5KBF A;  3IB3 A;  2WZ8 A;  2XR4 A;  3RI9 A;  1VRH 3;  3O1U A;  2DTW A;  3WF1 A;  4A2U A;  4UFI A;  1TME 2;  3T08 A;  1RUN A;  1GWM A;  1NLR A;  1GZC A;  2WWJ A;  2LM3 A;  1VAK A;  4QPG C;  3KF3 A;  4GB3 1;  2D7F A;  5C8C C;  5JOY A;  2ADD A;  4AHY A;  2P6C A;  3ZR6 A;  2HWB 1;  4OZX A;  4M4R A;  4WM8 B;  5LK5 A;  1PIV 1;  3ZFF C;  3H3U A;  5HCF A;  3VZJ A;  2K0G A;  4IEP A;  4ASL A;  5FQ0 A;  1JOB A;  5IAV A;  4YRD A;  1LHU A;  1ZBA 1;  3DEM A;  5F1R A;  1LKN A;  1OD3 A;  1YFY A;  5ANN A;  3OTF A;  1YJL A;  1FNZ A;  4XQD A;  4IEQ A;  4NWV A;  4BQ1 A;  3J7H A;  2VQ0 A;  2VBD A;  1W6N B;  1US3 A;  4Y4Y A;  4AVV A;  4Z8B A;  3NNF A;  4XF0 A;  1LEC A;  1UN1 A;  2HEV F;  2YZ4 A;  5LEJ A;  1WMX A;  3U78 A;  5C8W A;  1XU1 A;  4WM8 A;  3MIG A;  1H0B A;  3N3H A;  1HJG A;  2KA3 A;  2WO7 A;  3E5Q A;  4HSJ A;  3VBF B;  1PK6 C;  2D6O X;  2PHU A;  1COV 2;  2GC0 A;  2R49 A;  2ET1 A;  4IEO A;  4QQH A;  3JBG 1;  2BER A;  4A41 A;  4NHL A;  1XXN A;  4QX3 A;  2VQU A;  3QLQ A;  3P3N A;  5BY5 A;  3SEP A;  2BOI A;  3AYA A;  3R4S A;  4YWA A;  1W6N A;  2XHN A;  4UW5 A;  2YV8 A;  4Q8L A;  3WG2 A;  1S2B A;  3ZVX A;  2VC9 A; 
#chains in the Genus database with same CATH homology
 5CEH A;  2YBS A;  4HON A;  5FV3 A;  4EZ4 A;  3KV6 A;  5FZ7 A;  5A3T A;  4BIS A;  5FY0 A;  2XDV A;  5IVY A;  2GP3 A;  5FYB A;  5FYZ A;  5FZL A;  4D6Q A;  1VRB A;  5FZB A;  5FXX A;  4GJZ A;  3RVH A;  4Y4R A;  3ZPO A;  4QWN A;  5LW9 A;  3N9N A;  5FZC A;  3OPT A;  4GJY A;  4D6R A;  5IW0 A;  4QXB A;  5FPA A;  5FJH A;  3LDB A;  4V2W A;  2OQ7 A;  4LIT A;  4CCM A;  4QU1 A;  5F5A A;  4IGP A;  5FPB A;  5KR7 A;  4Y33 A;  2YPD A;  2GP5 A;  5F5I A;  5FZ0 A;  5FZI A;  5FUP A;  3NJY A;  5A7N A;  5A3N A;  5IVE A;  4IGO A;  5FPL A;  3N9O A;  3KV9 A;  5FYV A;  2OT7 A;  5F2S A;  3PDQ A;  5FZF A;  5FYH A;  3KV5 A;  5FZO A;  5FZ8 A;  4GAZ A;  4UF0 A;  5FZM A;  5E6H A;  4CCO A;  4DO0 A;  5FYT A;  3OPW A;  5FY8 A;  4EYU A;  5FP7 A;  4CCJ A;  5FZ3 A;  3DXU A;  5LWB A;  5FJK A;  4Y3O A;  4LIU A;  3PU8 A;  5FBJ A;  5FZO B;  2XUE A;  4UF0 B;  5FP4 A;  5FYY A;  3PTR B;  5FZ1 A;  2YBK A;  4XDO A;  4CUG A;  3ZLI A;  5F3C A;  5FZ4 A;  2PXJ A;  5F37 A;  2YBP A;  4ASK A;  5F3E A;  5FYC A;  4IGQ A;  3N9P A;  5FXZ A;  5F32 A;  4LIV A;  5FY5 A;  4E4H A;  5FZ6 A;  3U4S A;  5A7S A;  4EZH A;  4QX7 A;  5FXW A;  3K2O A;  5FY7 A;  5IVB A;  3K3N A;  2Q8D A;  5FY4 A;  4CSW A;  5IVC A;  4QXC A;  5ISL A;  5A3W A;  2OX0 A;  2XXZ A;  4V2V A;  3UYJ A;  4CCN A;  3PUA A;  5IVV A;  2OS2 A;  3AVR A;  5F2W A;  5FP3 A;  5FYU A;  4XDP A;  5FPU A;  5FZE A;  5LY2 A;  5ANQ A;  3KVB A;  5FWE A;  5FZA A;  5FY9 A;  2Q8E A;  2W2I A;  3N9Q A;  5K4L A;  2WWJ A;  5FYM A;  3N9M A;  5IVJ A;  5FZ9 A;  5FZH A;  2Q8C A;  5FYI A;  5IWF A;  5FP8 A;  4AAP A;  4HOO A;  5F3G A;  5LY1 A;  4CCL A;  3LD8 A;  5FP9 A;  5A3P A;  4LXL A;  5FZD A;  5A7P A;  4C8D A;  4URA A;  3AVS A;  2XML A;  3PUQ A;  4QX8 A;  5F5C A;  3PUS A;  5FUN A;  5FYS A;  5FPV A;  4CCK A;  3KVA A;  5A7Q A;  4BXF A;  4QXH A;  4TN7 A;  5A7W B;  5FWJ A;  5FY1 A;  3U78 A;  5A1F A;  2OQ6 A;  3KV4 A;  3DXT A;  5F3I A;  5IVF A;  5FZG A;  3PU3 A;  5FZK A;  5A80 A;  4D6S A;  2YU1 A;  5FXV A;  3K3O A;  4AI9 A;  2WWU A;  5A1L A;  4BU2 A;  4DIQ A;  4NUB A;  5F39 A;  2P5B A;  3AL6 A;  3PUR A;  5A7O A;  4GD4 A;  2VD7 A;  3AL5 A;  2YU2 A;  3N9L A;  5A7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...