5A3TA

Crystal structure of human plu-1 (jarid1b) in complex with kdm5-c49 (2-(((2-((2-(dimethylamino)ethyl)(ethyl)amino)-2-oxoethyl)amino)methyl) isonicotinic acid).
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
462
structure length
454
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
publication title Structural Analysis of Human Kdm5B Guides Histone Demethylase Inhibitor Development.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 150
structure length 454
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a3tA01
5FXWA 3AVSA 4QWNA 3K3OA 4QX7A 3OPTA 5CEHA 3N9MA 4UF0B 4URAA 3N9LA 5IVBA 5A7WA 4D6SA 5F2WA 4EYUA 3PU3A 2YBPA 3PDQA 5E6HA 3KV5A 5FYHA 4BXFA 3ZPOA 5FZKA 5FV3A 5F5CA 5FUNA 3N9NA 5FZOB 4UF0A 5FZMA 4QU1A 5FZAA 5FP3A 5FY5A 5FZ4A 5FYTA 5A80A 4CUGA 5F5IA 5A7OA 3KV4A 5F3EA 4IGOA 5FZ8A 5FZBA 2XDVA 4CCLA 4E4HA 5FZOA 3PU8A 4IGQA 3RVHA 3UYJA 2YU1A 3K2OA 5FPLA 5ISLA 4Y4RA 3PUAA 3PTRB 5FZLA 5IVCA 5FYIA 4LXLA 5IW0A 4BISA 2OS2A 5FZIA 5F3CA 5FZ3A 4QX8A 5LW9A 2OQ7A 4D6QA 2Q8DA 2GP5A 5FYCA 5FZ7A 3U78A 2YBKA 5FBJA 4NUBA 5A7NA 2OT7A 2P5BA 4CCJA 3NJYA 5F3IA 4GD4A 5FUPA 2XXZA 5ANQA 5IVFA 5LWBA 3AVRA 4CCOA 3AL5A 5FY0A 2VD7A 5A7PA 4XDOA 5FXXA 4AAPA 2WWUA 3PUQA 4GJYA 5LY2A 5A3PA 4Y33A 5F37A 4LITA 5FZCA 4LIVA 3OPWA 3AL6A 5FYUA 3N9PA 2YBSA 3KVAA 5A1LA 2GP3A 5FP8A 3KV6A 4V2WA 5FJHA 2YU2A 5KR7A 5FP7A 5A1FA 3PUSA 3LD8A 3K3NA 5IWFA 2Q8CA 2OQ6A 5FY7A 4QXHA 5FXVA 5FYMA 4CSWA 4XDPA 2XMLA 5IVEA 5A3TA 5FPAA 4LIUA 5FZ1A 5A3NA 5FPBA 4GAZA 5FJKA 5LY1A 5F2SA 2Q8EA 5IVJA 3KV9A 5FP4A 4HONA 4EZ4A 5FZHA 3KVBA 5A7QA 5F39A 3N9OA 5F3GA 4IGPA 4C8DA 3LDBA 5IVYA 3PURA 4DIQA 4DO0A 5FWEA 5FY4A 4CCKA 4HOOA 5FZ9A 5FYYA 5FY9A 4BU2A 4CCMA 5FYVA 5FY8A 3DXTA 5FZ6A 4CCNA 4AI9A 5A3WA 4D6RA 3U4SA 5A7SA 5FZ0A 2W2IA 5FZEA 4GJZA 5FP9A 5FXZA 5IVVA 5F5AA 5K4LA 2YPDA 5FZFA 2WWJA 4Y3OA 5FYZA 5FZGA 5A7WB 4EZHA 5FPUA 5FPVA 2XUEA 2PXJA 4QXCA 1VRBA 4TN7A 4V2VA 5F32A 5FYSA 2OX0A 4QXBA 3ZLIA 5FZDA 5FY1A 4ASKA 5FYBA 5FWJA 3N9QA 3DXUA
chains in the Genus database with same CATH superfamily
3R05A 4QX5A 4AEDB 1EY2A 5GM0A 5G04L 4MOAA 2B7YA 3V0AB 2DVAA 4URAA 3A22A 2LTNA 5JMCA 2CGPA 4A6SA 1W8ZA 4MHRA 4FPFA 2B46X 4X6QB 2HWD2 4XFAA 2GH2A 2ZGLA 3WG3A 4CP2A 4DQAA 2NP0A 1JOJA 1U0AA 3DCQA 1ZRIA 3VKLA 2EAAA 5LATA 1V6LA 5JOZA 2LW8A 3C7HA 1NCRC 3POYA 4CEWC 1WMFA 1S55A 2WO2A 1BYHA 1N1YA 2XH6A 1XNKA 3PHMA 4PQQA 5FUNA 3ZFFC 3RMYA 3H9AA 1PIV2 3RPQA 4CU8A 3NV1A 2A73B 3O0VA 4K8FA 4F7ZA 3VD4A 3SEEA 3VKFC 5FREA 2G9FA 1R082 3WOGA 5A33A 2DU0A 4Q4X2 3ZN5A 3WF4A 1OQDA 4J6GA 3VBRC 5FZ8A 4AHZA 1H9WA 1UD1A 3H8RA 2XDVA 4CDXA 3ABZA 2XBO3 3I3DA 5FZOA 5DXDA 3ZFGB 4IGQA 1PNFA 1Y9MA 2R16A 3T1MA 4A3XA 4Q4V2 1JYTA 1WW5A 3PTRB 4YZ4A 1Y4WA 3JD72 2QQIA 2WRAA 1RUI1 3LGRA 1AYM3 4OMDA 2ZKLA 1L7LA 5FYCA 1RUC2 1NKGA 1JW6A 4AVCA 1TEIA 1S0GA 2D97A 2GSYA 2WDBA 2WZR1 4L2NA 2FCVA 4GB33 4NUBA 5GKAC 3IKWA 3FL7A 4HL0A 1QJFA 2JDAA 1W3XA 4UW5A 5FUPA 5C7GA 4FBFA 4QPYA 4GH4C 3VD5A 3CL1A 3J8F3 5L7OC 5KXDA 3WF0A 5KXBA 3ITQA 2OYZA 3VUOA 4TLFA 3ZX7A 1GQGA 2ZZJA 3PVBB 2ORZA 4N7UA 2WNUB 4YYOA 2VAUA 3CJIB 1YI9A 5EFUA 5BNOB 3RZGA 4BCUA 2NYYA 2RJLA 4COYA 3VBHC 1UXXX 2PAEA 3MLJA 1NQDA 3OUIA 4UFJA 1RUI2 5FY7A 2YC2A 5FKBA 4E2QA 1E5IA 4AVSA 5JIUA 1NXD1 2A6YA 2Z4FA 2A6VA 2R043 3IBMA 1AX0A 4UFMA 4FXGB 4FAGA 1LOCA 2QDNA 2VUAA 3ZFEA 3ASIA 5ABJB 3KVBA 1SLBA 2R30A 3UKVA 2CGOA 2VG9A 2ZMNA 3N9OA 3VKOA 2X8KA 5KBFA 4DIQA 1R093 1ENRA 1N3QA 2FBEA 5F6KA 5FWEA 3GCXA 3RZKA 5I91A 3T0AA 3M70A 4BU2A 4CXXA 4FPHA 5CKMA 1AJOA 1V6IA 4INDA 3VKNA 3AYEA 1NAEA 4UFIA 3O1RA 4IV3C 1US2A 4PT6A 3RS6A 1UIJA 1WW6A 1J58A 1SCSA 4GKXA 1G9CA 3QH6A 5HCFA 2G9GA 3KT1A 4ZY9A 2XWBB 1NCQA 4L11A 4UW3A 3SCFA 2GC3A 3KS7A 4OHWA 4QQLA 5T5JA 1O3RA 4CDWB 1YYNA 4TN7A 4XJ8A 2QCSB 2VBPA 4CP9A 4EV0A 4QPGB 5CVRA 4ASKA 1S4CA 1B35C 1DBNA 1T6BX 2XJQA 2ZCWA 1I5PA 4W6XA 2WFF3 3I3QA 3SLIA 1CX4A 1ZZ8A 1EV11 2JDYA 1RVF3 3LSEA 2BYVE 4BJ0A 4A6OA 1JZ5A 4AFAA 1LB2A 2Z79A 3PU3A 2WA4A 2YROA 4PLOA 3VBFA 2XHNA 5I8YA 1UWWA 2P3KA 3K4ZA 1I3HA 1UU6A 1XJAA 3H3ZA 2XJTA 2O1QA 4W8JA 4DMIA 2E7QA 2I45A 2VCAA 3Q8EA 5A6YA 2XB6C 2HLEA 2YZ4A 4S2DA 3PVEA 5LA1A 1JTZX 1UOGA 3VBSC 1E5SA 2GC0A 4YW7A 4CUGA 1KFUL 1WLCA 1A8MA 1YFYA 5L73A 5ACA1 3A21A 5HPOA 4ISQA 4QPIA 1ASJ3 1RUF3 2ADDA 1OLMA 2ZEZA 5JOWA 2K0GA 2ZMKA 3HQXA 3OY8A 1AL22 1ZX5A 1EV12 4GMP3 5FBZA 1N47A 3W5MA 1VIWB 2GDFA 4Y4RA 3AFKA 5FYIA 1LU1A 1MZ5A 3B3QE 5FZIA 4B7EA 5JZGC 1HRI3 4D3WA 3BTAA 2WSVA 4J1XA 1XPWA 3ACLA 5EV7A 3NAPC 4H7MA 1X8EA 3CJXA 1W6OA 4IDZA 1IS4A 1DLCA 3IWZA 4JKLA 1GZ9A 2E53A 1XU1A 3TN92 5JXIA 3GBGA 1OOPB 2W3JA 4LKEA 3ST7A 2ZGKA 3AL5A 3S0MA 1DDLA 1WKYA 1EYBA 3OUJA 1PK6B 5A7PA 1OPOA 3MFAA 4W65A 5BNNB 2FMDA 2HYKA 3U14A 3WG4A 4XF1A 1O8SA 4RQPA 1LCLA 4YW2A 4BH9A 3H8XA 4KG0A 1LAJA 3H1MA 2PHXA 3MDPA 2WLQA 3MLKA 4LA2A 4HBNA 4L8QA 3VZNA 4R8HA 3UJQA 3FX3A 4EN7B 3BPZA 1DGRN 4UWDA 3B94A 1HV1A 1Q8VA 4AF9A 4CDQC 2EXIA 3IN9A 3FBYA 4YVWB 2B9UA 4QQ2A 4Z07A 2MEV1 5J7MA 1ND2C 1X33A 3AZVA 3FHQA 3J8F1 1C5IA 2R071 3DKWA 1RXFA 2BNMA 2PA7A 2JG8A 5IAXA 1K5MA 1O4YA 1IKPA 3O1PA 4I02A 1E57A 1G86A 2XBO2 2G9ZA 5T5LA 1UYXA 3T3YA 4B4QA 2YXSA 3M7AA 1ZBE1 2IVIB 2R061 1IPKA 2OUHA 1W90A 3FHIB 4WM8B 4M3CE 1REFA 4BPZA 3BB6A 3D0JA 1C3HA 3PIGA 5FFOC 2PHWA 1UYPA 2YGMA 4OCTA 3WNOA 5KWRA 1JBCA 1AYM2 3CDZB 2ZHLA 1ND3B 1UQXA 1WW7A 2XUMA 5FYZA 3TEYA 1XQNA 2R041 3E97A 3GCWA 5JUVA 3T09A 2B39A 1JYIA 3B02A 2MEV2 3BU7A 3HN3A 4QXBA 3WDVA 2BUKA 3VD7A 4FPGA 4ZHNA 3J8F2 2XVKA 1CONA 2ZMLA 1PX3A 2XJVA 5A6QA 4CUCA 1GMMA 3M1HA 1AF9A 2W47A 2QBXA 4FT8A 1RJ7A 3USSA 2RMU1 5IVBA 1O91A 2A3XA 2P17A 1LNSA 4GWMA 1W6PB 4IV1A 2ZTNA 1AR81 2ORXA 1GUIA 2Y0OA 3NNMA 2IXJA 3KMHA 5C3QA 3I2FA 1EUTA 2D6OX 2R062 1VBD3 4LBQB 3IDEA 4XABA 5IK5A 1DQ2A 1JMUB 1IOAA 1X7NA 4AEDA 1W04A 5F1RA 1LOEA 3KGLA 3NRUA 4JRLA 4KL1A 3V0AA 4D8MA 3K77A 2VVDA 1F35A 1W6NB 3WP3A 3OGSA 4NIIA 1OT5A 3AMHA 2R042 4HFSA 1XNDA 2JIJA 4MH0E 4NOTA 4XQWA 4MGIE 4Z2WA 1BEV3 1GWKA 1G9DA 2RV9A 1YQ6A 2RG4A 3VHNA 4JGYB 5EWSA 4AGRA 2L9LA 3POFA 2D98A 3DECA 4JAAA 3WUCA 1YFUA 2PHTA 3GYDA 2RR11 3LPGA 2XQXA 1HQLA 2AENA 1LECA 3HEIA 1R092 3UYJA 3ACHA 2PHFA 2V09A 4LJHA 3V65A 4Z2AA 5IVCA 2UWAA 3MHZA 1H30A 3JBG3 5HXVA 2B9VA 2IVJA 1DYKA 4D69A 2P3JA 3RZHA 5J37A 1HIXA 1VBA1 3N7JA 5FO7B 5IK4A 3ZFGA 3JUUA 4X6RB 1LHVA 3KCXA 2DCZA 3BI3A 4XJAA 4RFRB 3O1SA 1UPSA 2ERFA 2XJSA 5CFCB 4FPEA 2DBIA 5A32B 3WW1A 2RS11 4LO7A 3AXEA 3QLQA 4IE7A 3VN4A 1LR5A 4L92A 1J3PA 1HJFA 1RITA 2A71A 4QHZA 4RS5B 4XF4A 1ASJ1 4E4DX 3VZMA 3MW3A 1B09A 1I5ZA 1H2MA 1H6YA 2BQPA 2RR12 2WFF2 1ST8A 5FP7A 4D94A 1ZBA1 1RVF2 2QQVA 3X29B 4QD2A 2WNUA 1CAWB 3CJIA 4FQZA 4FXKB 4GKYA 1UX6A 1V9U3 5FPAA 4I2OA 1H9PA 1UCXA 3FLTA 5BNOA 5BNPC 5FPBA 4CU9A 4B7KA 5J98B 3R4DB 5T3NA 1QJY3 3E6BA 2A1XA 2RM21 4JGZB 1AYN1 3I4IA 3WQ0A 1J59A 1COV3 1BBT1 4QQHA 3LFIA 2GC2A 4UI9L 4WM7C 4HOOA 5FZ9A 1GKBA 1JZ6A 4FTEA 1ASJ2 1RUF2 1S0IA 2JXAA 2QQWA 3GGLA 1IQDC 1CGPA 3GHMA 1GV9A 4HK8A 5LA2A 4RGAA 3CIHA 5ABJA 4WVVA 2PYTA 2A75A 3CBNA 3PMSA 2YDEA 4OZOA 5FLJA 3WG2A 4QDSA 1FNZA 3V0BA 5DG2A 4Y1YA 1HRI2 1WCSA 1UZ0A 4QM9A 4UFHA 1W0NA 5K4LA 2WWJA 5GLZA 2ADEA 2IWGB 3TNQA 1HN0A 2BEOA 4XBLA 3HNYM 2ZAHA 5FYSA 3IB3A 4BQYA 4XEZA 1S0CA 4YZ1A 5A1AA 4FFFA 2ZGNA 4COWA 2ZHNA 2RM22 3WQ7A 5KHJA 4HVRA 4E4ZA 1WBLA 4S2HA 4CP1A 1QJU3 1P8JA 2WR9A 1W8UA 3ILRA 3H50A 4P9LA 4BQ3A 5I93A 5BV6A 4CDWA 4WV8A 2CDOA 3BKZA 4QPGA 1QOTA 4PBPA 2VZTA 3APBA 2VBBA 1FAYA 3OJBA 1HKDA 5ANNA 3VGIA 4FOYA 1JODA 4O61A 1HXS3 5A3OA 3ZXLA 4CDUC 4LKDA 3UKTA 2A5ZA 4YGBA 4BZ4A 3EYPA 1W99A 2RVAA 2P37A 5T50A 4HK9A 2XONA 4ATEA 1PZ8A 2PTMA 4Q0UA 4UT5A 5F5IA 3W5NA 4LBJA 2ARCA 5FZBA 1V00A 3VDAA 2H0BA 1AR63 2DUQA 1BK1A 3SXWA 4I0BA 4E2SA 3PU8A 4H2AA 4KMQA 4MV2A 5ISLA 2EF6A 4AK3A 1KQRA 3SEPA 5FOBB 3S57A 1SHWB 3WF1A 3VBUA 4OI1A 3TEZA 2ZHMA 1W6MB 2OS2A 1FNYA 4D6QA 4AFBA 2Q4SA 3O1OA 1ZA4A 1ENSA 1VBD1 2OT7A 2WNVC 1LEDA 2H0VA 4K7JA 4LLFA 3UKNA 4CDXB 5C4WB 5L19A 3TRSB 4YGCA 1WW4A 3MO4A 4XIOA 4JV4A 5LCWL 5GALA 4PDWA 3J7MA 1UY2A 4KGGA 3NV2A 3LEMA 5FRAA 1YIFA 4DXTA 3PUHA 1NLRA 5K0UC 2E26A 4PLNA 1T6GC 3D82A 3LA7A 3AXDA 5C3SA 2VXJA 3O5SA 4N43C 1U12A 5FYUA 1LGNA 2LM3A 1DHKB 5HV4A 3V0BB 1Z0HA 2HH9A 3GZUC 3KV6A 1OOPA 5LEJA 5CG9A 3RYRA 4DEVA 3S5AA 2UYBA 3DKQA 1XYPA 4Y20B 4LT5A 1PK6A 5IWFA 2HEVF 3SQOA 1S1AA 2AUYA 2VZSA 5BNNA 1Q8PA 2G1MA 3JBG1 3K51A 5KHKA 3RNSA 3OEBA 1BQPA 4UW4A 1VBD2 4DRRA 4A4AA 4OI2A 3HBZA 3ZM8A 4ASLA 4JDNA 2BRTA 2Q1ZB 4GAZA 4OUMA 1RC6A 4BA6A 4Q4Y3 2RDRA 1UN1A 1M4WA 4O65A 5BNQA 4GZ9A 1UPIA 4M0HA 4RR3B 3ZXGA 4M00A 4IESA 4AGVA 5A70A 3VD9A 2IC1A 5F8PA 3RYPA 2AGSA 1OC1A 5I0SA 1QNYA 2WT0A 4NHYA 3WDYA 2WIIB 3NMBA 4YVWA 1NLQA 3HJRA 4BQ2A 5HCHA 1W8OA 1REDA 2BFUS 4LBOA 4HLTA 5JSOA 4QX3A 3KGZA 3U4SA 4MSVA 3JBG2 1RUNA 4JX0A 3RJ2X 1YQ5A 2UURA 3KQ4B 1W8HA 4B4RA 5FTTC 1R083 3POEA 4Q4X3 2AYHA 3ETPA 4WM8A 3AZZA 3VLBB 3FN9A 1OD3A 1H4GA 3KCYA 1E5HA 4FPKA 4G3YC 1ZREA 2J1VA 3UL2A 2Z5WA 4TWTA 5FYBA 5FWJA 1IPJA 2ID4A 5FXWA 2VC9A 1X82A 3KLSA 4BWOA 3IAQA 1GZWB 1ND3A 2HJIA 1APNA 3RQ0A 2VQ0A 2ZEXA 3LZZA 5F2WA 2C9KA 2YBPA 2XLFA 3ROUA 1LU2A 1N1SA 4XVHA 3ZPYA 1PO21 2RJKA 3O1MA 2VOWA 4OULA 2FDIA 2RE9A 3DPRC 4PLMA 4Q8LA 4YVSB 3O1UA 1QGLA 1Y9QA 1W8WA 4C0HA 5CFDC 4QU1A 2ZX3A 2O14A 3MIBA 1V9U2 4XPVA 4YW6A 3M4FA 3CU7A 1OLME 3VDDB 4EWAA 4LUKA 1DU3D 1PZ7A 4LBQA 3CHXA 1EP0A 4CPBA 4OQ8A 1QJY2 2HKXA 5BY5A 1XSRA 2VGDA 5D8AC 2AR6A 3PVOA 1COV2 4PCRA 2YGLA 1W6NA 3M3OA 1FV3A 3PNAA 5CISA 1JZ3A 4D7SA 2YC4A 4JRAA 2XL9A 3D5OA 3URFA 4ZXKA 4Q4W3 3U10A 3Q8CA 4B1LA 5DAPA 4CDQB 5F9TA 3M2MA 2WZR3 2ENRA 3A0NA 1YJKA 5FBJA 3AB0A 3INAA 4JGYA 2WNOA 3NJYA 4PIXA 3I2HA 1AXZA 1CZSA 4XBNA 5AVAA 4BQWA 2W0XA 2WJSA 2VE1A 4LKFA 5DQ0A 1HXS1 5KC5A 2W1SA 5JXHA 5LASA 3R4UA 2Q1FA 2XJPA 5EIYB 2XHKA 1KITA 2VW0A 2ZGUA 3ZDVA 4XDQA 1H1IA 2D43A 2VOTA 2P2KA 2BDRA 1MR5A 2GP3A 1OURA 3NKGA 2WL1A 2VR4A 1QJU2 1VAMA 5CFCA 4AXOA 1LKNA 2A3WA 3MPPG 5A32A 4FOQA 4CRQA 5LZ6A 2W9XA 1DQ5A 5FXVA 2Y8KA 4HANA 4P14A 4RS5A 2J7MA 2I2SA 1CZTA 1RUE3 1H1AA 5FZ1A 4TZDA 3WP5A 4LHKA 1BZWA 1HXS2 4XFHA 2W1QA 5DAQA 4LUMA 2A6ZA 3LEKA 5J36A 3E1F1 3L9JT 3DV8A 5IATA 4EN9B 3I49A 1CAWA 1JOPA 3PURA 3AKRA 5E8AA 2IXKA 4IEQA 5FY4A 2GZWA 3BGAA 1D0GA 1UX7A 1WGPA 2NLRA 3W58A 2PMWB 2VXRA 1BVVA 4ASMB 3CEWA 1AR62 4KG8A 2D6MA 1POV0 3PMEA 3ZYGA 4XJWA 5FY8A 4AI2A 1RUJ1 4IEWA 4JGZA 2VMFA 2VTXJ 2DURA 4MVTA 5DZGA 4CEYC 1ZRCA 1O8PA 2OPKA 1HDKA 3LEGA 3NV3A 3TAYA 4Y3OA 4BQ1A 4AFDA 5A6XA 4A42A 1SCRA 1YQ8A 3B00A 2XPJA 1Z78A 3I59B 2DWRA 3ZFFA 4B4PA 1ULPA 2WZPP 4J1WA 3I54A 4LBNA 4KU8A 1MS0A 2XL7A 1D2QA 1GSLA 2HEWF 2VZ1A 4P5HA 4UF0B 3H3UA 2JD4A 5SV8A 1LODA 2XR4A 3PDQA 3U07A 4BOWA 3P5BA 4TYSA 1NG0A 3GJAA 3THPA 3I2IA 5F5CA 2R1DA 4IE6A 4NHMA 3I8TA 4ONUA 5FZMA 3THTA 5F6LB 1MQTC 1WLTA 2GALA 3AZYA 5D1IA 1G7YA 2GMMA 4GIQA 2BOJA 1H2NA 2EIGA 3CQOA 4GWIA 1W2AX 1BVP1 1W05A 2BGPA 4IE0A 3LIHA 3ACIA 4HPKB 5ACA3 5C8CC 3MW2A 1YO8A 4AI3A 1SPPB 2R49A 5BUVA 1L7QA 1RMU1 4AVTA 5CA6A 3UJOA 1C4RA 3MBWA 4K1YA 5KXEA 2DBNA 2HWC3 2Y6FA 3PUAA 1O4TA 1Q8QA 3W9AA 5IW0A 4BISA 3R4SA 1A78A 4XF3A 2BGOA 1MS4A 3KT7A 3U78A 3O0XA 1A8DA 1QIQA 1VLNA 4LEJA 2E32A 2YY1A 4NIAA 3VB9A 5CADA 2C4XA 1AXKA 4KI5M 4WBBA 2WO7A 4N53B 5FQ0B 3SKJE 1H6XA 5C9AC 5LBCA 1PZ9A 3L2YA 1VJ2A 1LEMA 1SBEA 3ZDSA 1FYUA 2DFCA 2JDKA 1W6MA 3B9IA 3K4AA 3B69A 3UK9A 1ULEA 4GJYA 4I09A 4QGNA 5C4WA 2P6CA 4MLOA 4A45A 2WT2A 1RMU2 1PX4A 3EO6A 4PIYA 4GWJA 5EP9A 1FXZA 1LJ7A 1RUD1 1SFYA 3WX5A 3ZN4A 3ZYHA 5IT6A 1CESA 1SBDA 2VECA 1CVNA 2RS33 4I0AA 4XXAA 2OQ6A 1O3SA 1O7FA 4Q4W1 4QXHA 2X05A 3S7EA 3POGA 4YPJA 1U5YA 2OW4A 3S5QA 3GF6A 4CSWA 2D3SA 3T4VA 4FPLA 1QXJA 1QQP1 4HKWA 1J1TA 4WVZA 4DXRA 2MEV3 4N9HA 2AEYA 4YRDA 2VNGA 4K9SA 2DCTA 4Y20A 5IVJA 3KV9A 3BUCA 2FDFA 3BTYA 2OZJA 2R073 4BK5A 3AZWA 5BYNA 3D6EA 4LE4A 3HBKA 1CQ9A 1UY4A 3S6PA 5EJ1B 4IGPA 5I8TA 3WLUA 2PQSA 1NLSA 3ENRA 3WP6A 1IQAA 4OUEA 4H55A 1DYPA 1ZBE3 2R063 4UFKA 2FQPA 2ATFA 3CZUA 3O1VA 1TG7A 1RUD2 1UL9A 3RJRA 3W21A 2FZ2A 1WCKA 3LIGA 4RR3A 4CCNA 3PTYA 3ZR6A 1ALYA 3BU0A 5FZ0A 3WF3A 4NE9A 4K8RB 4Q4W2 2F17A 4QHOA 2XWJB 4G9SB 4DINB 1SLLA 2WZR2 1REEA 1H8TB 1RUH1 1YI7A 1RUE1 1QQP2 2ZBJA 3J7NA 2JE8A 2VW2A 2ZGSA 1VRBA 4META 2JG9B 4KWJA 5IJRA 1Q5OA 4OFGA 2Q5TA 4ARXA 1CPMA 2HEYF 3DXUA 3I3BA 4XF0A 2N7GA 4MX3A 3K46A 3HAGA 5C71A 1K42A 2RMU3 5GZEA 4I3PA 4U36A 2YFUA 4D6SA 1AR83 2OVUA 2VULA 2WAOA 3BOWA 1CZVA 1IS3A 4JHTA 3ON7A 1YNAA 1BCXA 3ES4A 5GLVA 5JWPA 2VM9A 2OKXA 3B01A 4IETA 2BJSA 4YW4A 2UWBA 4JQRA 1GP6A 1ENXA 1GZWA 3N9NA 4WZFA 3QH7A 2PN5A 3FJSA 3Q8FA 1HV0A 3I2JA 4LO4B 3NAPA 4NO4A 4HN0A 4YGEA 1GOHA 1RUE2 3VDCA 4BMBA 5IK8A 1E5RA 3NVCA 1O6UA 4UAPA 4HKOA 4IGOA 5AFEA 4YVSA 5KHHA 2RR13 3K75B 3MIGA 3N36A 4FO9A 4J25A 2YU1A 1UMHA 1AR91 3ALQA 4NPLA 5FK7A 3AKSA 3N35A 4IEPA 5FPLA 1MZEA 3GZTB 3OD4A 3WR0A 5F5QA 3VDDA 2E6VA 3T0BA 2AACA 1ENQA 2CHHA 2Z69A 4YM0A 3LDRA 1VBA3 5IUQA 4HVQA 4CXWA 2XG3A 4MHUA 4URTA 3N7KA 3DN7A 2XXZA 4YZ2A 1HQNA 1POV3 1TME1 3N3HA 3RMXA 4DXSA 2ZABA 5DG1A 2VUDA 3RYKA 1MZ6A 2X5IC 3VBUB 2IXHA 4CDQA 4MXVA 4QQPA 2RS13 1CAXA 3PUQA 3C2UA 4ZZ5A 2F4PA 3WCRA 2YBSA 2BWAA 4IW3A 2WZ8A 4YGDA 2YG0A 3LWCA 4V2WA 3J7LA 4YFZA 3MF9A 2D6LX 3OPZA 2D40A 4PDWB 1ZBA3 3C8XA 4YG3A 2HWC1 5T52A 3LAGA 4LHNA 4LKSA 1W9TA 4D7TA 5LA0A 3ZFEC 1MVQA 1F4HA 3AP9A 4OLLA 4YZ3A 1M06G 4XTPA 1UXZA 1AJKA 1K5JA 4G4FA 4NWVA 2WWSA 1ZRFA 4R9DA 1TME2 2BERA 2VZRA 2RM23 4HN1A 1KS5A 1AYN3 1VR3A 4QGLA 1BBT3 4FOVA 4XFGA 5JSPA 3WHUA 2BBAA 3H3LA 4DUWA 5ACA2 3I2OA 4K21A 5EYXA 3HOBA 5BXXA 3AJYA 3AFGA 3KD4A 4AGGA 1K45A 3WQBA 1C8M1 3DEMA 5JI7A 2B4KA 3KSCA 5CFDB 1PGL1 2NMOA 1NCQC 4QAWA 4XE9A 4ZS3A 1URXA 1FOD1 2CU5A 1W9SA 2HWC2 2RS31 2WYSA 3E5UA 5JDBA 5FP9A 4AAXA 1JUHA 2VMDA 4GALA 2WABA 3POIA 2RDQA 3HR9A 4NRQA 4OZXA 1JYVA 2Y33A 2CGNA 3ZLIA 1SEFA 1DQ4A 5FY1A 3WD5A 3VBFC 2VTFA 1OLQA 1QDCA 1YQCA 1AUYA 3FFZA 3K3OA 4QX7A 3WNNA 3N9MA 3AX4A 3N9LA 4DOUA 1CR7A 3HQRA 4HT1T 1OQ1A 4H3WA 2CL2A 1UZZA 2OA2A 3I59A 1MS1A 4QB2A 3MIEA 4BXFA 4CCDA 1PGL2 2DCKA 5B4NA 5L9RA 3ZYBA 2RS32 1OBNA 4JTOA 2GU9A 4MGSA 1HB2A 4UF0A 4YW5A 4LBLA 4F8AA 4S2GA 5FZAA 3HNBM 4QPIC 5T55A 3RZZA 4HSJA 3GDBA 5EZWA 1J3QA 1UKGA 2WKKA 3P6BA 3SH4A 3WG1A 1TNRA 2VQAA 2ES3A 2BFUL 2R072 3VBOB 3TWIA 1WLWA 2C9AA 3KCCA 3RVHA 3ZSJA 5C3OA 4FFHA 5A3UA 1YUDA 2VVEA 3KHBA 4RL7A 4ZU7A 3BOPA 4LBQD 1OFSA 1ZBE2 4HPKA 4CPBD 5HCAA 2YBKA 4CE8A 4XMIA 3MV01 1HB3A 1SPPA 3EQEA 3KF5A 1HX6A 2WQ8A 1W9FA 1XYNA 2HYXA 1GR3A 1GU3A 1YC61 1OKQA 2AZ5A 2VZQA 3POSA 1JHJA 3SCGA 3FE5A 2DF7A 5FY0A 4RQPC 1YQ2A 2ZGTA 4BB3A 3SC7X 4Y1XA 1DZRA 1JYWA 4FAHA 1WD4A 2A3YA 3UV9A 4KBZA 3J9SA 3O14A 3WCSA 4XTMA 3AYCA 3I3MA 4N53A 5EJZB 4FPCA 5LB6A 5FQ0A 2V4VA 1ACCA 2RMU2 1QY4A 2E51A 3WW2A 4COUA 1BJQA 1AR82 4K1ZA 2DCYA 3VZOA 3NNLA 5D21A 4UOJA 2YB7A 3VL9A 1D7PM 3RWNA 3MV11 3T08A 3NSTA 2H6CA 4OUSA 3KHCA 4Y5SA 1DGWX 2VVFA 5CNAA 2ZACA 4BYYA 2ZEYA 4LA3A 4ES8A 3AP4A 3HPNA 1NY71 1MPXA 1LOBA 3ZYPA 4Q0PA 4PBOA 5JPNB 2JDNA 4YW3A 2VW1A 1POV1 3VZKA 3PL0A 1DF0A 2BNOA 3B5LB 4XIKA 2QQOA 4MGTA 4OI0A 3HVDA 3D8CA 3MUZ1 2V73A 1ULGA 2GN7A 1O5LA 5L9VA 3JQWA 4FP2A 5FYYA 1LOAA 1XYOA 2TBVA 4P9YA 5DUUA 1WA4A 4M0NA 2JIGA 2IXLA 3MLLA 4UYBA 5H9PA 3ZSKA 3ZSEA 3DF0A 1SLTA 1U5XA 3NW4A 1KDMA 1GFF2 5CG8A 3WZ1A 1VBA2 1LOFA 5ERLA 1YFWA 4QPWA 1JYXA 1RL3A 1WZXA 1NY72 3C7FA 3OBTA 4QXCA 2X29A 2E31A 4IV1C 5IAVA 3N9QA 4P02B 4AL9A 2UY9A 4BM8A 3ILNA 2CAVA 2RS12 3LOBA 1DGRA 3RZJA 4LTAA 1H8TA 2HWB3 4XQ4A 4AEDC 1K3IA 2IFWA 4UBGA 1NCRB 4CA9A 4LO8A 2JG9A 3POBA 1PO23 5E6HA 3ZFFB 4CEWB 4C90A 1VP6A 2J1TA 1ZBA2 1GNHA 1Z7S1 2IFRA 3EXUA 3J7HA 5TSWA 2PHRA 3WNXA 5FPUA 2RS51 4BK4A 4O9EA 4P08A 4IL7A 4NVPA 4P9GA 3VBRB 3AP6A 4ZPIA 3R6SA 4NIDA 5EXOA 3VHPA 5F3EA 5C5TA 1YCIA 2NN8A 4OHYA 3UGGA 4OQ9A 3SKVA 4MGQA 2ZPXA 1AYN2 1XE8A 3WNMA 2ZGPA 4JCKA 3FUQA 3ZXDA 1BBT2 4E8DA 1UY0A 5KHGA 5IFTA 1O3QA 3K2OA 3TNPB 4E2GA 5FZLA 2DTWA 2ZEWA 4OHZA 2LROA 4W6WA 5A6ZA 5F3CA 1UU5A 2XGXA 4W50A 3CO2A 3BYWA 3UNPA 1AVBA 1OA2A 1V6MA 1ZZ9A 3GBFA 2JKBA 4N8MA 4AVVA 1C8NA 4GH4B 4CCJA 5L7OB 1K12A 2RS52 3D3AA 5GZCA 4EWEA 4QQOA 4HETA 1HQWA 2J1RA 1CN1A 2B5HA 2VL4A 1XC6A 5FXXA 3IAPA 4HMZA 3MI8A 1MACA 2MHFA 3ZXFA 5GZGA 4A7YA 1QJEA 2ZS6B 4LR4A 3N9PA 4P00B 1HB4A 1OD5A 2X53S 4FFGA 4QM8A 5DAWA 2Y34A 3VBHB 3RSJA 1LULA 2WNUC 3CJIC 3J26N 4AWDA 5JLVA 3P1IA 1ZRRA 3OB8A 1OH3A 3NQHA 4BHPA 3M3CA 3T30A 5J09A 2C26A 1WWYA 1X36A 3SH3A 4OVEA 1UU4A 4XDPA 5IVEA 1SQ4A 1V70A 5FO9B 2R0HA 1UZWA 1BHGA 3J4UH 3FMGA 3IIIA 5F2SA 3ZYRA 4ES9A 4L99A 3SISA 2W46A 5FP4A 3USUB 4QDRA 2P4EA 2R32A 4ISRA 5F3GA 1D2SA 3I97A 1A6CA 2BU9A 4C8DA 5ABJC 3IPVB 5DPNA 1W8FA 1KJLA 1UY3A 1NOVA 2D5FA 2GMEA 3FLRA 4QHBA 4BE3A 4XUTA 4OI4A 2BV4A 3C7GA 4IV3B 4XHXA 1Q43A 1TVGA 1RUJ3 4Y24A 4YW1A 2CWMA 5FZ6A 4AOCA 4AI9A 4AEKA 1XB9A 5LBEA 1NYWA 2V72A 3A23A 2XLGA 4MZUA 1F4AA 2E63A 5F5AA 5FZFA 4XJZA 3FHAA 2ETEA 3UGHA 3B93A 4XJUA 2XUEA 5FR3A 2VMIA 1B35B 3ZIXA 1VE0A 1GQPA 1ULFA 1JS9A 4N7IA 2J1AA 5CFDA 2EALA 2NZ9A 5A80A 4CDWC 3AVSA 4RD7A 4QPGC 4XZPA 3TB0A 5A3LA 2ZX1A 1DLLA 3W20A 2ILMA 3NNJA 1IHMA 3LF7A 4XF9A 4CVUA 4LHSA 1W8TA 5E16A 5DZFA 4AQ6A 3HD8B 5I0UA 1CX1A 1ODMA 5APAA 5K8SA 1JUIA 2AH2A 2DVDA 2V5DA 2VTXA 2VUCA 3SMHA 2AC1A 2X5IB 1DQ0A 3VBSB 1LRHA 4DY5A 3ZSMA 4BLJA 5A3MA 4EN0A 5FY5A 1FMD3 1PMJX 2WLPA 1ZZCA 4XC9A 1QWRA 4K6BA 2SLIA 4OHVA 1POQA 3CF6E 1Y9GA 3OYWB 3CMGA 4A44A 4AI8A 4Z1VA 5C5UA 1F5FA 1S2BA 1DP0A 4YM3A 4GA9A 3ZYFA 1RMU3 4E4HA 1VBC1 4NN0A 1SLAA 2ZAAA 4NHKA 1TQ5A 2Y6LA 2VUJA 5JZGB 2OIIA 1W9YA 1KFXL 2HWB1 2IXIA 3NAPB 4CUBA 3DUIA 2OQ7A 3WNPA 1HRV3 2GP5A 5FZ7A 2IZWA 4EWDA 1CD3G 4XAEA 2ARBA 3VBOA 3WV6A 3OEAA 4JC1A 4I3GA 1IKQA 3R0RA 2W68A 3WDXA 3UESA 2FDKA 5T5PA 2JE7A 5CKQA 1QDOA 2I74A 1D4VB 2A6WA 3PJQA 4XDOA 4AHWA 4XFCA 1OOPC 4YZ5A 2C6SA 1XOYA 2WWUA 4BLIA 2W39A 2R1BA 5CBLA 4TSVA 5F37A 5FZCA 1PK6C 1SFPA 5T54A 4F83A 1I6XA 4P9XA 5BNNC 4FQ4A 4OHXA 4A2UA 4RN5A 2PELA 1NUKA 1OI6A 1RUD3 2D44A 2YU2A 3H7JA 5B2GB 4COZA 2Z42A 1W9WA 2Q0AA 3LD8A 3WDUA 1V6JA 2HWB2 4ZU5A 1VB4A 2AEZA 5EQUA 1Y3TA 4LO6B 2QQJA 3PUIA 1CAXB 1NE6A 1PO22 1PVC1 3AMMA 1TMF1 2EXJA 5A3TA 2CAUA 4EE2A 1ND2B 1G9AA 1H0BA 1QQP3 4P9WA 3NO8A 5A3NA 1VMJA 5FJKA 2PQQA 2Q8EA 3U37A 1RHI1 3BN6A 4RYDA 1WUVA 1N1TA 3ME2A 1O5UA 1W6QB 4YVWC 1DGWA 2B8MA 2Y0IA 1OVSA 1CIYA 1ZM1A 3LDBA 5IVYA 5CAZA 2G4IA 2LS6A 4H7LA 1GNZA 1NXMA 5DUWA 3IMMA 3KWVA 1S0EA 4LPLA 2D6NA 4PI0A 3DXTA 3CZJA 2PHLA 3AJZA 4CP0A 4Q0QA 5JAXA 5IVVA 4WM8C 1UOFA 1PGW1 5FZEA 5FIXA 3AK0A 4Q1RA 2A7AA 1C1FA 1GWLA 2GAUA 1S0FA 1RUH3 3OG2A 2JDZA 4OYUA 2KA3A 1HLCA 2CV6A 1ND3C 3NJZA 3DL3A 1IS5A 1G8WA 1WMDA 3NL1A 1PO13 3ZXEA 3BIEA 4LO5B 4DS0A 4QWNA 4SBVA 2WSUA 1FT9A 5DAVA 4AVBA 3VHRA 4UW6A 3GZAA 1GOGA 5IHRA 1CIWA 4A3ZA 3HT2A 4LMFA 3VZLA 2KM2A 1GQHA 3RRDA 1ONAA 1HB1A 3A4UA 1ZNPA 4MGKE 4YM1A 4AQ2A 4TLGA 3LCPA 5HV0A 5DZEA 4S2FA 4NAOA 2EIEA 5D2AA 4X8NA 1ZZ7A 5FV3A 4B1MA 4OMCA 1ULOA 1C1LA 1XE0A 4P9JA 2C5DA 2BBVA 4RGGA 1OKOA 1ULCA 1OMIA 4GULA 3U0ZA 1VAVA 2YUEA 4A7KA 1NCRA 2QFEA 4CEWA 1FV2A 4JVAA 4ORFA 1AHSA 5FPZA 2FDHA 2JECA 4HZFA 3DYOA 5DABA 5C9AA 5LA9A 5KXCA 5CKNA 1LGCA 2DDUA 2VOKA 4BIFA 3OD0A 2VZ3A 1MEC3 2GMPA 3ZN6B 3NKTA 1AR93 5J96B 4LE3A 4JGYC 3VBRA 5C6CA 2WUHA 2Z2SB 1QXRA 4RHV3 1OF4A 1YXWA 4NRPA 2QE3A 4AZZA 3U4XA 2GNBA 3T2TA 1WCDJ 3KZ4C 4ZKTB 5CZKA 1RYYA 4X8PA 1RUJ2 2YYOA 2D93A 4NPMA 2P5BA 4JKMA 5DDJ3 3H8UA 1V6KA 4NIGA 2Y6GA 1TME3 1KS4A 2JDMA 5H9QA 1DYOA 1EUUA 2WS93 2FCTA 2DYCA 1GP5A 3OOXA 5F7UA 2VD7A 1FMD1 1HW5A 4QT6A 4AAPA 2WZEA 4XUOA 1ULDA 1UW8A 2ET7A 1W0PA 3ZXJA 4D7YA 5CFCC 1WMXA 3OPWA 1GICA 3EMRA 4GH4A 3VKMA 3WT3A 4AI1A 5L7OA 2UY8A 3LDKA 2HWD1 1N3PA 2X10A 2V5YA 2TNFA 2EIDA 2EXHA 4RS5C 5IFPA 3GALA 2JDPA 3MPBA 5GLTA 2JKXA 5BNPB 1YIPA 4JKKA 1VMFA 1PIV1 1HRV1 1XNTA 2EICA 3I2KA 3IMNA 4TTGA 3WDTA 1NA1C 4AFMA 3AM2A 4Y1ZA 1H4HA 3VBHA 1PVXA 5LY1A 2R6QA 1JZ7A 2P3YA 2D6KA 4KWLA 1Y43B 1N3OA 3FUOA 1KD7A 5FDBA 1SG3A 2WINB 2F4LA 1QJZA 3CLPA 1YJLA 5SV5A 1FMD2 3FBMA 3LPFA 4WM7B 3E6CC 5F39A 3QACA 2WFPA 5J48A 4BXSV 3NNGA 4GXLA 4JGZC 4Q4V1 4CCKA 1VALA 1F31A 1R64A 2KXLA 1YFXA 3JD71 2J42A 2YFZA 1R1ZA 5FY9A 3KT4A 4CCMA 1C8M3 2BPA2 5LRRA 3C7OA 1KRIA 1RUC1 3FWEA 4PF5A 3FZ3A 4IUGA 1WCUA 1XNCA 3USUA 1FOD3 2D3RA 2ZGRA 2Q1MA 4XQDA 5FXZA 5A7SA 1L7RA 4GJZA 3RGBA 2P34A 3ELNA 1CJDA 5FAXA 3ZKUA 1HRV2 3IPVA 3WW3A 2WYFA 1N1VA 5HI0A 1JXNA 4QX2A 1VPHA 4PHZA 5FUIA 3ZVXA 1LTEA 4IV3A 1RTVA 4MYEA 5F32A 4V2VA 4BMEA 4WVWA 4CU7A 5FZDA 2EVXA 2J1SA 4NPRA 3MIDA 3OTFA 3AMNA 4XYXA 4XMAA 2RJ2A 1KGYA 1OUSA 3M3EA 1VB2A 1Q8SA 1LHUA 4YG0A 1W8NA 4EYUA 1AR73 3POJA 4FPJA 1B35A 2QQNA 1O59A 3OGVA 4LK6A 3LE0A 5AC91 4NWWA 4Q8KA 2VMHA 3GXUA 4CDUB 1KXGA 3PLQA 2EAKA 4A7ZA 2VZUA 3M3IA 1PNGA 2DV9A 2JE9A 1XXNA 4K40A 4Q2FA 2D5HA 3MF6A 2VZVA 2J1EA 1KEXA 1SDDB 1X50A 5FYTA 1QXPA 1CPNA 1W06A 2QVSB 3RFRA 2JENA 4MADA 3WNKA 1ODNA 3ZXAC 4IQPA 1F5JA 1LOGA 1QF3A 4QX0A 4MO3M 3E5QA 1PO11 3CNAA 2DUPA 2X5IA 2UU8A 4DFSA 5FMCA 3VBSA 3MFCA 3M3QA 1GNYA 4IEZA 2WNVB 1RB8G 5CB7A 4NHXA 3OYWA 4UBHA 1OVPA 2Q8DA 5AC92 1T2XA 1OUXA 4XFFA 2W95A 5H9RA 4BDVB 3M8LA 3FC0A 3ILFA 4QKDA 4CCEA 5K0UB 5ANQA 1VAKA 3G7DA 5JZGA 5C4WC 4CDXC 1MS8A 2FMYA 4Y22B 3S7IA 1C28A 1RUH2 4N43B 2CSGA 2FHRA 4QGMA 5C3PA 1MS3A 1MZFA 4FI9A 4C1WA 5A3PA 2Y64A 3T2QA 2ZZQA 4XBQA 3AL6A 2CTVA 2ARAA 3KVAA 5E88A 5A1LA 1PO12 1OSGA 3BTXA 3GNEA 3GJBA 3BIWE 2XVLA 4M4PA 1MEC1 4LNVA 5KR7A 1J83A 3IZOA 4NROA 2K2SA 2C1FA 3B7MA 3ZSLA 3ZMNA 1SACA 2O8QA 1JN2P 4RHV1 1S0JA 1YRZA 2GN3A 2W08A 1NQJA 3P3NA 4JQTA 3CKHA 3ACFA 1QKQA 4CTEA 3AYAA 1FX5A 4XCAA 5DDJ1 1OA3A 2UWCA 5FMDA 3VHOA 1RIRA 3I7DA 5IYYA 2NMNA 2ZX2A 2WS91 3I3EA 5C33A 1WD3A 2VOXA 4Q5OA 1R1A3 2I07B 3WINE 1AL21 4XFIA 4RR3C 1H2KA 4HG6B 1ND2A 2Y60A 4TXWA 2VCMA 3AP7A 4NMIA 1UOJA 1MEC2 3NNFA 5FMOS 4NR1A 3G6JB 1AR92 1W6QA 1UO9A 2WT1A 4D6RA 4H14A 4P9IA 4EJRA 1IGOA 2VOVA 2W1UA 4RHV2 3TN91 1YWKA 1EAH1 4PQ9A 3WUDA 4BIOA 2O8OA 4B8EA 5J1XA 1VRH3 3Q9OA 5A7WB 5DUVA 1KDKA 3MIHA 4R4XA 5DDJ2 1SZBA 1WLDA 2VZOA 4V1PA 2GNTA 3T2OA 3ZR5A 1UMZA 4B3NA 3TEWA 1O4ZA 3B9CA 3DYMA 3NJVA 3LQCA 4KWUA 2V4AA 2WS92 2ZKNA 4WZCA 4IE5A 4LLOA 3RDIA 2WO1A 2ZGOA 4FTBA 2YC0A 4GWNA 5FPXA 2XOMA 1LHWA 1CWPA 3DPRB 4YFWA 3OGJA 4DXZA 3KV5A 3WQ1A 1XNAA 3VD3A 1Z7S3 3RI9A 2CDPA 1F2NA 5FZKA 4E8CA 4RFT0 3ZXKA 2JDUA 4QXKA 2G19A 2RS53 3AC0A 2D6PA 4JZRA 5LBBA 1EAH2 1GLHA 2JEMA 2GNMA 2VNVA 2VY0A 4XW3A 3ZO0B 4EQVA 3T0DA 2XJUA 4IERA 3OBAA 2WQ4A 1LENA 2VNRA 4YVSC 2HWF3 2Y26A 5JOXA 3DYPA 2XLAA 1J84A 2OXBA 1MVEA 5CU1A 3MEPA 3SITA 2PHUA 3THCA 5J3UA 5D8AB 4W6YA 4JHZA 3BODA 1PGSA 3VDDC 5KHIA 2XBO1 2XJRA 3ATGA 4DUVA 2W91A 2BWCA 3A0KA 3EHKA 1O3TA 4AW7A 2EA7A 2Y6JA 2DVFA 4R9CA 2XKPA 1CAVB 1S0BA 1EPWA 4O7XA 1XNBA 1AR71 1SBFA 1BLZA 2C24A 4QX8A 3RG0A 1AYM1 1C8M2 1LHOA 2QJVA 2RDSA 4K3UA 4XAAA 4XUPA 4ITCA 3IDAA 1FOD2 5F3IA 2ZJCA 4GB31 4DEQA 3ZN6A 4MGYE 3UETA 4F3JA 2OPWA 2BOIA 1GANA 1V6OA 1YEWA 4FP3A 4M3CF 4NAMA 3QOPA 4Q0SA 4CCOA 3O1TA 5LRSA 2QQKA 3AYDA 1D4M3 3WSOA 5M0TA 1GZTA 4FTSA 1GP4A 4FPOB 5FLIA 3E5XA 5EJ3A 2KR2A 4RA0A 3OBZA 4U2AA 1TZOA 1JYNA 2K46A 3NJXA 4BQ4A 2RHPA 4KH9A 1Q8OA 3JB4C 1FI2A 5AFBA 1AR72 1DZTA 5E1RA 1IS6A 3THDA 2XMLA 4CYDA 5HBAA 1IPSA 4GB32 4FCAA 2JB8A 4FPYA 4LQRA 3LA3A 2IXCA 2YHJA 3AMQA 4AHYA 1S2KA 2C0ZA 2ZX0A 1RUG3 1W2NA 1PMHX 2CNAA 1NZCA 2DUOA 2VU9A 4E27A 5BNPA 5JSRA 3HT1A 2HWE3 1QOSA 3LOIA 4DO0A 1R091 4M3CB 5DUXA 2A6XA 2P3IA 2JWPA 1PHMA 2PAKA 1JU4A 4NJ4A 1QHDA 4QKNA 4YNIA 3ZIWA 4CEYB 1MS5A 4AE2A 1X9PA 1OFNA 1F9KA 2ZOEB 4HXCA 3MIFA 1YLLA 5A3WA 3EB7A 5JI9A 2DU1A 4WM7A 4IE4A 5E89A 3HWJA 4WVMB 4XFBA 1X8MA 2YV8A 1W28A 3LFMA 3EBRA 4PIZA 2K9ZA 1D0HA 5FZGA 1DG6A 1OF3A 2X09A 2ZGQA 3LA2A 4I01A 2HBTA 2JG8C 4QKFA 1STMA 4QU2A 4R9BA 4XCBA 1K5MC 4L9BA 2DTYA 4Y5Z0 5H9SA 5LEKA 4Y26A 3OSDA 1H2LA 1UYZA 1W0OA 2FZ1A 2JB4A 5G05L 4JTNA 1RUOA 4IEUA 4IEVA 1R1A1 3OPTA 4ZU4A 2JD9A 2VPVA 2WFF1 1AX1A 3PVNA 1BKZA 1C5HA 1RVF1 1SMVA 1A3KA 2WBKA 3N4MA 1EPZA 2YPJA 2VZPA 3KQRA 4ATFA 3ZMOA 2UYAA 3HMYA 1XE7A 4ZXEA 1QU0A 2P1BA 4KNCA 1DQ1A 1MQTB 3ZPOA 4EROA 1FPN3 3WVJA 2Y6HA 1BMV1 2E33A 2PFWA 4ZONA 4R9AA 4M4RA 1WCQA 2BTVC 4LK7A 1JU3A 3TEXA 3HIFA 5FP3A 1QMJA 1ZA7A 4FFIA 2W52A 1VRH1 4QX1A 5C8CB 4IEOA 5GJ6A 3NWKA 2DCJA 3E6DA 3QBQA 1QJX3 1GBGA 4ZS2A 4C0BA 4CDUA 3LKJA 1UMIA 3BCWA 3H0OA 4O9GA 1U5ZA 4B29A 4C91A 1W2UA 1RUF1 1VBC3 2NPIA 2W5FA 1R1A2 2W1WA 3PJYA 1L3JA 4GMP1 3W59A 2CYFA 1LESA 3AMPA 2PAMA 3NV4A 1NA1B 3Q8BA 4LXLA 5LW9A 2O0OA 3WNLA 5FZ3A 4DNYA 2QUOA 2VJXA 1DGLA 1HRI1 3VDBA 1ZZ6A 2W87A 5EPAA 5C9AB 3HQUA 1SLCA 3JCIA 1ZVFA 3RZMA 1A34A 1US3A 1BMV2 1CAUB 1KJRA 2PLV3 5B4XA 2BVBA 2VBDA 3Q8AA 2FDGA 2BW8A 2WNVA 2HWF1 1VRH2 5FCCA 1VBB3 2FCUA 4CZSA 4N53C 3JQXA 3QCWA 1U5IA 1G9FA 1S0DA 4LITA 2F6BA 4LIVA 3TBDA 4MXWB 5IVFA 2CWSA 2WQZC 4XXPA 5FP8A 5K0UA 3U11A 1JOBA 3HNMA 2ZXQA 5EHDA 1VBE3 1IZ3A 2A70A 2QKDA 4Y22A 2ZHKA 4N43A 4XUNA 3F2ZA 3ZFGC 4MGZE 3JXSA 2XKOA 1PVC3 3MYXA 4FVVA 1RINA 5DN2A 5FYMA 4NIHA 1TMF3 4EN6B 4P5YA 3TYJA 3UGFA 1Z7S2 1JI6A 2QTWB 3OGRA 1LHNA 3P3PA 4Y4YA 4M01A 1XSQA 1RHI3 2DVGA 4A41A 4PI2A 2DVBA 1W2OA 1OLRA 2HWF2 2JX9A 4XOGA 5FZHA 4K20A 1QEXA 3OF1A 1JZ4A 4YG6A 1D4M1 1UY1A 1OQEA 1JYCA 4HKLA 3T1LA 5DMYA 2FD8A 3H1YA 1JZ2A 2VNOA 2WN3A 2ZA9A 4KQ7A 5EYYA 4DPNA 1BK0A 2R0FA 5FMBA 1UF2C 4LOTA 3OCPA 2JICA 1LOFC 5BNOC 1C57A 1Q56A 2BZDA 4AVAA 2E7TA 4BQXA 4KU7A 5LBFA 1H8VA 1SFNA 1DCSA 4I0WB 4IXLA 1J3RA 2XQRA 4JDMA 4MG2A 4EZHA 1TNFA 3I2GA 4ARYA 4RSUA 3OUHA 4IEXA 4XJ9A 4AI0A 2VQUA 3H1WA 3ORJA 5K7PA 4PF1A 4AEJA 1H8TC 3BALA 4Y5TA 3N7LA 1W2TA 1OA4A 5LWBA 3MZHA 1RUG1 2EIBA 2JG9C 5K9YA 2VMEA 5JXJA 1XRUA 5JR7B 3ZOIA 1D4M2 1PM7A 2HWE1 1CJPA 3JB8A 1TE1B 3MGUA 4N90A 5A7WA 1WMEA 2QNKA 3FFQA 4Q1PA 2CY6A 2GNDA 3JU9A 5A33B 3KM5A 5FYHA 1QH7A 3IDCB 3AKPA 4LHLA 2ZX4A 3BTZA 3VV1A 1IG3A 5FZOB 4COVA 2R7EB 5CIRA 1WA6X 1J1LA 3ZYIB 2D3PA 2FDJA 3H7YA 1OH4A 1WBFA 4FOWA 3DPRA 5FZ4A 5I8SA 4XACA 1NE4A 1JZ8A 5A7OA 3MICA 4MUVA 4YARA 4Y1VA 4AR2A 1BEV1 2KD7A 2Q30A 1HN1A 1RUG2 4LULA 1G9BA 1V0AA 1OPMA 4BQ5A 1AL0G 4I30A 5JVVA 2HWE2 1XU2A 1QH6A 2QQPA 5D8AA 1MS9A 3U75A 3ZYJB 1UIKA 4HVOA 5A7NA 2YMZA 4Q0VA 4YWAA 1FPN1 3OBRA 3PIJA 1PM4A 4R4ZA 4GD4A 4RGKA 2E7AA 2MPFA 1BXHA 4FSJA 1DQ6A 4CU6A 1AX2A 2ARXA 1CAVA 2QDRA 2QQLA 4KGQA 4XHBA 1NZIA 5KC6A 5GLUA 2DFBA 3L2HA 1QJX1 1RXGA 1BEV2 5JIAA 4QKBA 3VBUC 2HWD3 4QB6A 3AZXA 5FJHA 1IG0A 3SNMA 2VCBA 3WHTA 4XURA 5C3RA 5A1FA 4LBMA 3ZFEB 3K3NA 1H1MA 2Q8CA 3UT0A 1GYKA 3K4DA 4PDWC 3T4HB 1PIV3 2J1UA 1NX9A 3N7MA 5I0TA 1UAIA 5T5OA 2LALA 1V9U1 1FPN2 4D0QA 4ET7A 5JPMB 2PLV1 1I9RA 4N9IA 4DZGA 2PHDA 1RGSA 2VH9A 2VMCA 4Z92B 4EZ4A 1QJY1 3HN1A 2WNEA 1VBB1 1SDWA 2VO5A 3A7QA 3GZEA 5HXMA 1S2EA 3VL8A 1COV1 5AVPA 2GH8A 4Q4V3 1QJX2 4QB1A 1I1EA 3I2DA 4NHLA 3JD73 3ETQA 2HBUA 1NCQB 2WO3A 1GOFA 3RZLA 1VBC2 1QOOA 2W92A 1F15A 1RUC3 4XETA 3O12A 3BVCA 5FYVA 4XUQA 2OUJA 4CP9B 1VBE1 1ZYBA 1ZZBA 2ZGMA 5FO8B 3RWKX 1XBFA 1HJGA 5IK7A 3D0SA 4M3CA 1W6PA 2B45X 3AKTA 2WC2A 5FPVA 4CEYA 2PLV2 2JJ6A 2PXJA 3S30A 3VBFB 3QD6A 3C3VA 4Z8BA 1F8VA 2OX0A 5LK5A 1JHNA 3IIAA 3WXPA 5GLWA 4CUAA 4EN8B 2TEPA 4PJYA 2QQUA 5I0DA 1VBB2 4WVMA 2MNGA 5FKCA 1DFQA 3U1XA 3RI8A 5CEHA 3GBWA 5JR2A 5L36A 1QJU1 4DRVA 3MUY1 3VZJA 4XZUG 1RUI3 5CYYA 3V64A 3SCHA 5AC93 2BVVA 4KBBA 3WP4A 5JCTA 5FK8A 1VBE2 5FLHA 3LB9A 2QZ2A 3ES1A 4W4ZA 4QPIB 5JMOA 4Q27A 1AXYA 2LUWA 1PVC2 2NQYA 4HSLA 2BP6A 4UXAA 5JOYA 3OY8B 1TMF2 1VMHA 2AREA 3O7OA 4Q29A 3LEIA 4SLIA 4YM2A 1X9TA 3POWA 2RDNA 4DB5A 2QQMA 2TUNA 3KV4A 1RHI2 2VCCA 4AHXA 3DGTA 1MQTA 1DZQA 4KWKA 5FMOL 2P6HA 5GZFA 2EXKA 4AQSA 4CCLA 1W6OB 1AR61 3K48A 3SHRA 5I0RA 2IUWA 2ET1A 3VBOC 3H8OA 3D4KA 2XVGA 5C8CA 1SLIA 2W94A 4AYUA 1W3VA 3ECQA 4AG4A 3C7EA 4RQPB 1PGW2 1YHFA 1OXCA 1QNWA 2OZ6A 1UNBA 3AVRA 4IEYA 1Y7BA 4YSFA 3V56A 2QZ3A 1NA1A 2E9QA 4LBKA 1UOBA 3GHNA 4R52A 5LY2A 3WEZA 4Y33A 1ZRDA 4E4SA 2BNNA 3IT8A 1CAUA 3BPSA 5C8WA 3FLPA 3LSDA 4DUXA 5GZDA 3OGGA 3AKQA 3KB5A 1AZDA 3PUSA 4CXYA 4QMAA 4ZZ8A 1Q3EA 2JG8B 3H42B 1W39A 1K5MB 4AQTA 4MXWA 3ZKYA 1LGBA 2WA3A 4AEMA 2WAAA 2J22A 4GQ7A 4LIUA 4Y1UA 3SH5A 3WF2A 4AFCA 3IM0A 5FOJB 1W03A 3ACGA 1RJ8A 2Y38A 4GMP0 4Q4Y1 5DAXA 4JDOA 3MW4A 1OHFA 3TOJA 3WY6A 3WW4A 1UZYA 2WN2A 1G6NA 1PMIA 3AP5A 4HONA 5HCBA 2BGCA 2H6BA 5A7QA 4Q26A 4C1XA 3WDWA 1AL23 1FATA 1EV13 4L97A 4UFLA 2D7FA 2VQTA 5L9BA 4LORA 3EJKA 1V6NA 1UYYA 2NM1A 1NT0A 1UZVA 2GC1A 2Q8OA 3IDBB 2B42B 4XILA 4L0PA 3JZVA 1JH5A 4CCCA 5JXGA 1UKRA 3TN93 5LK7B 1EAH3 4DY3A 2W2IA 4YLZA 4NRMA 4E9KA 3O0WA 1DIWA 3KF3A 2JDHA 2YPDA 2VMGA 3T2PA 4IV1B 2SBAA 5BPXA 1R081 1GZCA 3F95A 4Q4X1 2LRPA 4LOSA 4Q4Y2 5C70A 2Y6KA 4Z82A 1GWMA 3GM8A 4QDQA
chains in the Genus database with same CATH topology
5FXWA 3AVSA 4QWNA 3K3OA 4QX7A 3OPTA 5CEHA 3N9MA 4UF0B 4URAA 3N9LA 5IVBA 5A7WA 4D6SA 5F2WA 4EYUA 3PU3A 2YBPA 3PDQA 5E6HA 3KV5A 5FYHA 4BXFA 3ZPOA 5FZKA 5FV3A 5F5CA 5FUNA 3N9NA 5FZOB 4UF0A 5FZMA 4QU1A 5FZAA 5FP3A 5FY5A 5FZ4A 5FYTA 5A80A 4CUGA 5F5IA 5A7OA 3KV4A 5F3EA 4IGOA 5FZ8A 5FZBA 2XDVA 4CCLA 4E4HA 5FZOA 3PU8A 4IGQA 3RVHA 3UYJA 2YU1A 3K2OA 5FPLA 5ISLA 4Y4RA 3PUAA 3PTRB 5FZLA 5IVCA 5FYIA 4LXLA 5IW0A 4BISA 2OS2A 5FZIA 5F3CA 5FZ3A 4QX8A 5LW9A 2OQ7A 4D6QA 2Q8DA 2GP5A 5FYCA 5FZ7A 3U78A 2YBKA 5FBJA 4NUBA 5A7NA 2OT7A 2P5BA 4CCJA 3NJYA 5F3IA 4GD4A 5FUPA 2XXZA 5ANQA 5IVFA 5LWBA 3AVRA 4CCOA 3AL5A 5FY0A 2VD7A 5A7PA 4XDOA 5FXXA 4AAPA 2WWUA 3PUQA 4GJYA 5LY2A 5A3PA 4Y33A 5F37A 4LITA 5FZCA 4LIVA 3OPWA 3AL6A 5FYUA 3N9PA 2YBSA 3KVAA 5A1LA 2GP3A 5FP8A 3KV6A 4V2WA 5FJHA 2YU2A 5KR7A 5FP7A 5A1FA 3PUSA 3LD8A 3K3NA 5IWFA 2Q8CA 2OQ6A 5FY7A 4QXHA 5FXVA 5FYMA 4CSWA 4XDPA 2XMLA 5IVEA 5A3TA 5FPAA 4LIUA 5FZ1A 5A3NA 5FPBA 4GAZA 5FJKA 5LY1A 5F2SA 2Q8EA 5IVJA 3KV9A 5FP4A 4HONA 4EZ4A 5FZHA 3KVBA 5A7QA 5F39A 3N9OA 5F3GA 4IGPA 4C8DA 3LDBA 5IVYA 3PURA 4DIQA 4DO0A 5FWEA 5FY4A 4CCKA 4HOOA 5FZ9A 5FYYA 5FY9A 4BU2A 4CCMA 5FYVA 5FY8A 3DXTA 5FZ6A 4CCNA 4AI9A 5A3WA 4D6RA 3U4SA 5A7SA 5FZ0A 2W2IA 5FZEA 4GJZA 5FP9A 5FXZA 5IVVA 5F5AA 5K4LA 2YPDA 5FZFA 2WWJA 4Y3OA 5FYZA 5FZGA 5A7WB 4EZHA 5FPUA 5FPVA 2XUEA 2PXJA 4QXCA 1VRBA 4TN7A 4V2VA 5F32A 5FYSA 2OX0A 4QXBA 3ZLIA 5FZDA 5FY1A 4ASKA 5FYBA 5FWJA 3N9QA 3DXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FXW A;  3AVS A;  4QWN A;  3K3O A;  4QX7 A;  3OPT A;  5CEH A;  3N9M A;  4UF0 B;  4URA A;  3N9L A;  5IVB A;  5A7W A;  4D6S A;  5F2W A;  4EYU A;  3PU3 A;  2YBP A;  3PDQ A;  5E6H A;  3KV5 A;  5FYH A;  4BXF A;  3ZPO A;  5FZK A;  5FV3 A;  5F5C A;  5FUN A;  3N9N A;  5FZO B;  4UF0 A;  5FZM A;  4QU1 A;  5FZA A;  5FP3 A;  5FY5 A;  5FZ4 A;  5FYT A;  5A80 A;  4CUG A;  5F5I A;  5A7O A;  3KV4 A;  5F3E A;  4IGO A;  5FZ8 A;  5FZB A;  2XDV A;  4CCL A;  4E4H A;  5FZO A;  3PU8 A;  4IGQ A;  3RVH A;  3UYJ A;  2YU1 A;  3K2O A;  5FPL A;  5ISL A;  4Y4R A;  3PUA A;  3PTR B;  5FZL A;  5IVC A;  5FYI A;  4LXL A;  5IW0 A;  4BIS A;  2OS2 A;  5FZI A;  5F3C A;  5FZ3 A;  4QX8 A;  5LW9 A;  2OQ7 A;  4D6Q A;  2Q8D A;  2GP5 A;  5FYC A;  5FZ7 A;  3U78 A;  2YBK A;  5FBJ A;  4NUB A;  5A7N A;  2OT7 A;  2P5B A;  4CCJ A;  3NJY A;  5F3I A;  4GD4 A;  5FUP A;  2XXZ A;  5ANQ A;  5IVF A;  5LWB A;  3AVR A;  4CCO A;  3AL5 A;  5FY0 A;  2VD7 A;  5A7P A;  4XDO A;  5FXX A;  4AAP A;  2WWU A;  3PUQ A;  4GJY A;  5LY2 A;  5A3P A;  4Y33 A;  5F37 A;  4LIT A;  5FZC A;  4LIV A;  3OPW A;  3AL6 A;  5FYU A;  3N9P A;  2YBS A;  3KVA A;  5A1L A;  2GP3 A;  5FP8 A;  3KV6 A;  4V2W A;  5FJH A;  2YU2 A;  5KR7 A;  5FP7 A;  5A1F A;  3PUS A;  3LD8 A;  3K3N A;  5IWF A;  2Q8C A;  2OQ6 A;  5FY7 A;  4QXH A;  5FXV A;  5FYM A;  4CSW A;  4XDP A;  2XML A;  5IVE A;  5A3T A;  5FPA A;  4LIU A;  5FZ1 A;  5A3N A;  5FPB A;  4GAZ A;  5FJK A;  5LY1 A;  5F2S A;  2Q8E A;  5IVJ A;  3KV9 A;  5FP4 A;  4HON A;  4EZ4 A;  5FZH A;  3KVB A;  5A7Q A;  5F39 A;  3N9O A;  5F3G A;  4IGP A;  4C8D A;  3LDB A;  5IVY A;  3PUR A;  4DIQ A;  4DO0 A;  5FWE A;  5FY4 A;  4CCK A;  4HOO A;  5FZ9 A;  5FYY A;  5FY9 A;  4BU2 A;  4CCM A;  5FYV A;  5FY8 A;  3DXT A;  5FZ6 A;  4CCN A;  4AI9 A;  5A3W A;  4D6R A;  3U4S A;  5A7S A;  5FZ0 A;  2W2I A;  5FZE A;  4GJZ A;  5FP9 A;  5FXZ A;  5IVV A;  5F5A A;  5K4L A;  2YPD A;  5FZF A;  2WWJ A;  4Y3O A;  5FYZ A;  5FZG A;  5A7W B;  4EZH A;  5FPU A;  5FPV A;  2XUE A;  2PXJ A;  4QXC A;  1VRB A;  4TN7 A;  4V2V A;  5F32 A;  5FYS A;  2OX0 A;  4QXB A;  3ZLI A;  5FZD A;  5FY1 A;  4ASK A;  5FYB A;  5FWJ A;  3N9Q A;  3DXU A; 
#chains in the Genus database with same CATH topology
 3R05 A;  4QX5 A;  4AED B;  1EY2 A;  5GM0 A;  5G04 L;  4MOA A;  2B7Y A;  3V0A B;  2DVA A;  4URA A;  3A22 A;  2LTN A;  5JMC A;  2CGP A;  4A6S A;  1W8Z A;  4MHR A;  4FPF A;  2B46 X;  4X6Q B;  2HWD 2;  4XFA A;  2GH2 A;  2ZGL A;  3WG3 A;  4CP2 A;  4DQA A;  2NP0 A;  1JOJ A;  1U0A A;  3DCQ A;  1ZRI A;  3VKL A;  2EAA A;  5LAT A;  1V6L A;  5JOZ A;  2LW8 A;  3C7H A;  1NCR C;  3POY A;  4CEW C;  1WMF A;  1S55 A;  2WO2 A;  1BYH A;  1N1Y A;  2XH6 A;  1XNK A;  3PHM A;  4PQQ A;  5FUN A;  3ZFF C;  3RMY A;  3H9A A;  1PIV 2;  3RPQ A;  4CU8 A;  3NV1 A;  2A73 B;  3O0V A;  4K8F A;  4F7Z A;  3VD4 A;  3SEE A;  3VKF C;  5FRE A;  2G9F A;  1R08 2;  3WOG A;  5A33 A;  2DU0 A;  4Q4X 2;  3ZN5 A;  3WF4 A;  1OQD A;  4J6G A;  3VBR C;  5FZ8 A;  4AHZ A;  1H9W A;  1UD1 A;  3H8R A;  2XDV A;  4CDX A;  3ABZ A;  2XBO 3;  3I3D A;  5FZO A;  5DXD A;  3ZFG B;  4IGQ A;  1PNF A;  1Y9M A;  2R16 A;  3T1M A;  4A3X A;  4Q4V 2;  1JYT A;  1WW5 A;  3PTR B;  4YZ4 A;  1Y4W A;  3JD7 2;  2QQI A;  2WRA A;  1RUI 1;  3LGR A;  1AYM 3;  4OMD A;  2ZKL A;  1L7L A;  5FYC A;  1RUC 2;  1NKG A;  1JW6 A;  4AVC A;  1TEI A;  1S0G A;  2D97 A;  2GSY A;  2WDB A;  2WZR 1;  4L2N A;  2FCV A;  4GB3 3;  4NUB A;  5GKA C;  3IKW A;  3FL7 A;  4HL0 A;  1QJF A;  2JDA A;  1W3X A;  4UW5 A;  5FUP A;  5C7G A;  4FBF A;  4QPY A;  4GH4 C;  3VD5 A;  3CL1 A;  3J8F 3;  5L7O C;  5KXD A;  3WF0 A;  5KXB A;  3ITQ A;  2OYZ A;  3VUO A;  4TLF A;  3ZX7 A;  1GQG A;  2ZZJ A;  3PVB B;  2ORZ A;  4N7U A;  2WNU B;  4YYO A;  2VAU A;  3CJI B;  1YI9 A;  5EFU A;  5BNO B;  3RZG A;  4BCU A;  2NYY A;  2RJL A;  4COY A;  3VBH C;  1UXX X;  2PAE A;  3MLJ A;  1NQD A;  3OUI A;  4UFJ A;  1RUI 2;  5FY7 A;  2YC2 A;  5FKB A;  4E2Q A;  1E5I A;  4AVS A;  5JIU A;  1NXD 1;  2A6Y A;  2Z4F A;  2A6V A;  2R04 3;  3IBM A;  1AX0 A;  4UFM A;  4FXG B;  4FAG A;  1LOC A;  2QDN A;  2VUA A;  3ZFE A;  3ASI A;  5ABJ B;  3KVB A;  1SLB A;  2R30 A;  3UKV A;  2CGO A;  2VG9 A;  2ZMN A;  3N9O A;  3VKO A;  2X8K A;  5KBF A;  4DIQ A;  1R09 3;  1ENR A;  1N3Q A;  2FBE A;  5F6K A;  5FWE A;  3GCX A;  3RZK A;  5I91 A;  3T0A A;  3M70 A;  4BU2 A;  4CXX A;  4FPH A;  5CKM A;  1AJO A;  1V6I A;  4IND A;  3VKN A;  3AYE A;  1NAE A;  4UFI A;  3O1R A;  4IV3 C;  1US2 A;  4PT6 A;  3RS6 A;  1UIJ A;  1WW6 A;  1J58 A;  1SCS A;  4GKX A;  1G9C A;  3QH6 A;  5HCF A;  2G9G A;  3KT1 A;  4ZY9 A;  2XWB B;  1NCQ A;  4L11 A;  4UW3 A;  3SCF A;  2GC3 A;  3KS7 A;  4OHW A;  4QQL A;  5T5J A;  1O3R A;  4CDW B;  1YYN A;  4TN7 A;  4XJ8 A;  2QCS B;  2VBP A;  4CP9 A;  4EV0 A;  4QPG B;  5CVR A;  4ASK A;  1S4C A;  1B35 C;  1DBN A;  1T6B X;  2XJQ A;  2ZCW A;  1I5P A;  4W6X A;  2WFF 3;  3I3Q A;  3SLI A;  1CX4 A;  1ZZ8 A;  1EV1 1;  2JDY A;  1RVF 3;  3LSE A;  2BYV E;  4BJ0 A;  4A6O A;  1JZ5 A;  4AFA A;  1LB2 A;  2Z79 A;  3PU3 A;  2WA4 A;  2YRO A;  4PLO A;  3VBF A;  2XHN A;  5I8Y A;  1UWW A;  2P3K A;  3K4Z A;  1I3H A;  1UU6 A;  1XJA A;  3H3Z A;  2XJT A;  2O1Q A;  4W8J A;  4DMI A;  2E7Q A;  2I45 A;  2VCA A;  3Q8E A;  5A6Y A;  2XB6 C;  2HLE A;  2YZ4 A;  4S2D A;  3PVE A;  5LA1 A;  1JTZ X;  1UOG A;  3VBS C;  1E5S A;  2GC0 A;  4YW7 A;  4CUG A;  1KFU L;  1WLC A;  1A8M A;  1YFY A;  5L73 A;  5ACA 1;  3A21 A;  5HPO A;  4ISQ A;  4QPI A;  1ASJ 3;  1RUF 3;  2ADD A;  1OLM A;  2ZEZ A;  5JOW A;  2K0G A;  2ZMK A;  3HQX A;  3OY8 A;  1AL2 2;  1ZX5 A;  1EV1 2;  4GMP 3;  5FBZ A;  1N47 A;  3W5M A;  1VIW B;  2GDF A;  4Y4R A;  3AFK A;  5FYI A;  1LU1 A;  1MZ5 A;  3B3Q E;  5FZI A;  4B7E A;  5JZG C;  1HRI 3;  4D3W A;  3BTA A;  2WSV A;  4J1X A;  1XPW A;  3ACL A;  5EV7 A;  3NAP C;  4H7M A;  1X8E A;  3CJX A;  1W6O A;  4IDZ A;  1IS4 A;  1DLC A;  3IWZ A;  4JKL A;  1GZ9 A;  2E53 A;  1XU1 A;  3TN9 2;  5JXI A;  3GBG A;  1OOP B;  2W3J A;  4LKE A;  3ST7 A;  2ZGK A;  3AL5 A;  3S0M A;  1DDL A;  1WKY A;  1EYB A;  3OUJ A;  1PK6 B;  5A7P A;  1OPO A;  3MFA A;  4W65 A;  5BNN B;  2FMD A;  2HYK A;  3U14 A;  3WG4 A;  4XF1 A;  1O8S A;  4RQP A;  1LCL A;  4YW2 A;  4BH9 A;  3H8X A;  4KG0 A;  1LAJ A;  3H1M A;  2PHX A;  3MDP A;  2WLQ A;  3MLK A;  4LA2 A;  4HBN A;  4L8Q A;  3VZN A;  4R8H A;  3UJQ A;  3FX3 A;  4EN7 B;  3BPZ A;  1DGR N;  4UWD A;  3B94 A;  1HV1 A;  1Q8V A;  4AF9 A;  4CDQ C;  2EXI A;  3IN9 A;  3FBY A;  4YVW B;  2B9U A;  4QQ2 A;  4Z07 A;  2MEV 1;  5J7M A;  1ND2 C;  1X33 A;  3AZV A;  3FHQ A;  3J8F 1;  1C5I A;  2R07 1;  3DKW A;  1RXF A;  2BNM A;  2PA7 A;  2JG8 A;  5IAX A;  1K5M A;  1O4Y A;  1IKP A;  3O1P A;  4I02 A;  1E57 A;  1G86 A;  2XBO 2;  2G9Z A;  5T5L A;  1UYX A;  3T3Y A;  4B4Q A;  2YXS A;  3M7A A;  1ZBE 1;  2IVI B;  2R06 1;  1IPK A;  2OUH A;  1W90 A;  3FHI B;  4WM8 B;  4M3C E;  1REF A;  4BPZ A;  3BB6 A;  3D0J A;  1C3H A;  3PIG A;  5FFO C;  2PHW A;  1UYP A;  2YGM A;  4OCT A;  3WNO A;  5KWR A;  1JBC A;  1AYM 2;  3CDZ B;  2ZHL A;  1ND3 B;  1UQX A;  1WW7 A;  2XUM A;  5FYZ A;  3TEY A;  1XQN A;  2R04 1;  3E97 A;  3GCW A;  5JUV A;  3T09 A;  2B39 A;  1JYI A;  3B02 A;  2MEV 2;  3BU7 A;  3HN3 A;  4QXB A;  3WDV A;  2BUK A;  3VD7 A;  4FPG A;  4ZHN A;  3J8F 2;  2XVK A;  1CON A;  2ZML A;  1PX3 A;  2XJV A;  5A6Q A;  4CUC A;  1GMM A;  3M1H A;  1AF9 A;  2W47 A;  2QBX A;  4FT8 A;  1RJ7 A;  3USS A;  2RMU 1;  5IVB A;  1O91 A;  2A3X A;  2P17 A;  1LNS A;  4GWM A;  1W6P B;  4IV1 A;  2ZTN A;  1AR8 1;  2ORX A;  1GUI A;  2Y0O A;  3NNM A;  2IXJ A;  3KMH A;  5C3Q A;  3I2F A;  1EUT A;  2D6O X;  2R06 2;  1VBD 3;  4LBQ B;  3IDE A;  4XAB A;  5IK5 A;  1DQ2 A;  1JMU B;  1IOA A;  1X7N A;  4AED A;  1W04 A;  5F1R A;  1LOE A;  3KGL A;  3NRU A;  4JRL A;  4KL1 A;  3V0A A;  4D8M A;  3K77 A;  2VVD A;  1F35 A;  1W6N B;  3WP3 A;  3OGS A;  4NII A;  1OT5 A;  3AMH A;  2R04 2;  4HFS A;  1XND A;  2JIJ A;  4MH0 E;  4NOT A;  4XQW A;  4MGI E;  4Z2W A;  1BEV 3;  1GWK A;  1G9D A;  2RV9 A;  1YQ6 A;  2RG4 A;  3VHN A;  4JGY B;  5EWS A;  4AGR A;  2L9L A;  3POF A;  2D98 A;  3DEC A;  4JAA A;  3WUC A;  1YFU A;  2PHT A;  3GYD A;  2RR1 1;  3LPG A;  2XQX A;  1HQL A;  2AEN A;  1LEC A;  3HEI A;  1R09 2;  3UYJ A;  3ACH A;  2PHF A;  2V09 A;  4LJH A;  3V65 A;  4Z2A A;  5IVC A;  2UWA A;  3MHZ A;  1H30 A;  3JBG 3;  5HXV A;  2B9V A;  2IVJ A;  1DYK A;  4D69 A;  2P3J A;  3RZH A;  5J37 A;  1HIX A;  1VBA 1;  3N7J A;  5FO7 B;  5IK4 A;  3ZFG A;  3JUU A;  4X6R B;  1LHV A;  3KCX A;  2DCZ A;  3BI3 A;  4XJA A;  4RFR B;  3O1S A;  1UPS A;  2ERF A;  2XJS A;  5CFC B;  4FPE A;  2DBI A;  5A32 B;  3WW1 A;  2RS1 1;  4LO7 A;  3AXE A;  3QLQ A;  4IE7 A;  3VN4 A;  1LR5 A;  4L92 A;  1J3P A;  1HJF A;  1RIT A;  2A71 A;  4QHZ A;  4RS5 B;  4XF4 A;  1ASJ 1;  4E4D X;  3VZM A;  3MW3 A;  1B09 A;  1I5Z A;  1H2M A;  1H6Y A;  2BQP A;  2RR1 2;  2WFF 2;  1ST8 A;  5FP7 A;  4D94 A;  1ZBA 1;  1RVF 2;  2QQV A;  3X29 B;  4QD2 A;  2WNU A;  1CAW B;  3CJI A;  4FQZ A;  4FXK B;  4GKY A;  1UX6 A;  1V9U 3;  5FPA A;  4I2O A;  1H9P A;  1UCX A;  3FLT A;  5BNO A;  5BNP C;  5FPB A;  4CU9 A;  4B7K A;  5J98 B;  3R4D B;  5T3N A;  1QJY 3;  3E6B A;  2A1X A;  2RM2 1;  4JGZ B;  1AYN 1;  3I4I A;  3WQ0 A;  1J59 A;  1COV 3;  1BBT 1;  4QQH A;  3LFI A;  2GC2 A;  4UI9 L;  4WM7 C;  4HOO A;  5FZ9 A;  1GKB A;  1JZ6 A;  4FTE A;  1ASJ 2;  1RUF 2;  1S0I A;  2JXA A;  2QQW A;  3GGL A;  1IQD C;  1CGP A;  3GHM A;  1GV9 A;  4HK8 A;  5LA2 A;  4RGA A;  3CIH A;  5ABJ A;  4WVV A;  2PYT A;  2A75 A;  3CBN A;  3PMS A;  2YDE A;  4OZO A;  5FLJ A;  3WG2 A;  4QDS A;  1FNZ A;  3V0B A;  5DG2 A;  4Y1Y A;  1HRI 2;  1WCS A;  1UZ0 A;  4QM9 A;  4UFH A;  1W0N A;  5K4L A;  2WWJ A;  5GLZ A;  2ADE A;  2IWG B;  3TNQ A;  1HN0 A;  2BEO A;  4XBL A;  3HNY M;  2ZAH A;  5FYS A;  3IB3 A;  4BQY A;  4XEZ A;  1S0C A;  4YZ1 A;  5A1A A;  4FFF A;  2ZGN A;  4COW A;  2ZHN A;  2RM2 2;  3WQ7 A;  5KHJ A;  4HVR A;  4E4Z A;  1WBL A;  4S2H A;  4CP1 A;  1QJU 3;  1P8J A;  2WR9 A;  1W8U A;  3ILR A;  3H50 A;  4P9L A;  4BQ3 A;  5I93 A;  5BV6 A;  4CDW A;  4WV8 A;  2CDO A;  3BKZ A;  4QPG A;  1QOT A;  4PBP A;  2VZT A;  3APB A;  2VBB A;  1FAY A;  3OJB A;  1HKD A;  5ANN A;  3VGI A;  4FOY A;  1JOD A;  4O61 A;  1HXS 3;  5A3O A;  3ZXL A;  4CDU C;  4LKD A;  3UKT A;  2A5Z A;  4YGB A;  4BZ4 A;  3EYP A;  1W99 A;  2RVA A;  2P37 A;  5T50 A;  4HK9 A;  2XON A;  4ATE A;  1PZ8 A;  2PTM A;  4Q0U A;  4UT5 A;  5F5I A;  3W5N A;  4LBJ A;  2ARC A;  5FZB A;  1V00 A;  3VDA A;  2H0B A;  1AR6 3;  2DUQ A;  1BK1 A;  3SXW A;  4I0B A;  4E2S A;  3PU8 A;  4H2A A;  4KMQ A;  4MV2 A;  5ISL A;  2EF6 A;  4AK3 A;  1KQR A;  3SEP A;  5FOB B;  3S57 A;  1SHW B;  3WF1 A;  3VBU A;  4OI1 A;  3TEZ A;  2ZHM A;  1W6M B;  2OS2 A;  1FNY A;  4D6Q A;  4AFB A;  2Q4S A;  3O1O A;  1ZA4 A;  1ENS A;  1VBD 1;  2OT7 A;  2WNV C;  1LED A;  2H0V A;  4K7J A;  4LLF A;  3UKN A;  4CDX B;  5C4W B;  5L19 A;  3TRS B;  4YGC A;  1WW4 A;  3MO4 A;  4XIO A;  4JV4 A;  5LCW L;  5GAL A;  4PDW A;  3J7M A;  1UY2 A;  4KGG A;  3NV2 A;  3LEM A;  5FRA A;  1YIF A;  4DXT A;  3PUH A;  1NLR A;  5K0U C;  2E26 A;  4PLN A;  1T6G C;  3D82 A;  3LA7 A;  3AXD A;  5C3S A;  2VXJ A;  3O5S A;  4N43 C;  1U12 A;  5FYU A;  1LGN A;  2LM3 A;  1DHK B;  5HV4 A;  3V0B B;  1Z0H A;  2HH9 A;  3GZU C;  3KV6 A;  1OOP A;  5LEJ A;  5CG9 A;  3RYR A;  4DEV A;  3S5A A;  2UYB A;  3DKQ A;  1XYP A;  4Y20 B;  4LT5 A;  1PK6 A;  5IWF A;  2HEV F;  3SQO A;  1S1A A;  2AUY A;  2VZS A;  5BNN A;  1Q8P A;  2G1M A;  3JBG 1;  3K51 A;  5KHK A;  3RNS A;  3OEB A;  1BQP A;  4UW4 A;  1VBD 2;  4DRR A;  4A4A A;  4OI2 A;  3HBZ A;  3ZM8 A;  4ASL A;  4JDN A;  2BRT A;  2Q1Z B;  4GAZ A;  4OUM A;  1RC6 A;  4BA6 A;  4Q4Y 3;  2RDR A;  1UN1 A;  1M4W A;  4O65 A;  5BNQ A;  4GZ9 A;  1UPI A;  4M0H A;  4RR3 B;  3ZXG A;  4M00 A;  4IES A;  4AGV A;  5A70 A;  3VD9 A;  2IC1 A;  5F8P A;  3RYP A;  2AGS A;  1OC1 A;  5I0S A;  1QNY A;  2WT0 A;  4NHY A;  3WDY A;  2WII B;  3NMB A;  4YVW A;  1NLQ A;  3HJR A;  4BQ2 A;  5HCH A;  1W8O A;  1RED A;  2BFU S;  4LBO A;  4HLT A;  5JSO A;  4QX3 A;  3KGZ A;  3U4S A;  4MSV A;  3JBG 2;  1RUN A;  4JX0 A;  3RJ2 X;  1YQ5 A;  2UUR A;  3KQ4 B;  1W8H A;  4B4R A;  5FTT C;  1R08 3;  3POE A;  4Q4X 3;  2AYH A;  3ETP A;  4WM8 A;  3AZZ A;  3VLB B;  3FN9 A;  1OD3 A;  1H4G A;  3KCY A;  1E5H A;  4FPK A;  4G3Y C;  1ZRE A;  2J1V A;  3UL2 A;  2Z5W A;  4TWT A;  5FYB A;  5FWJ A;  1IPJ A;  2ID4 A;  5FXW A;  2VC9 A;  1X82 A;  3KLS A;  4BWO A;  3IAQ A;  1GZW B;  1ND3 A;  2HJI A;  1APN A;  3RQ0 A;  2VQ0 A;  2ZEX A;  3LZZ A;  5F2W A;  2C9K A;  2YBP A;  2XLF A;  3ROU A;  1LU2 A;  1N1S A;  4XVH A;  3ZPY A;  1PO2 1;  2RJK A;  3O1M A;  2VOW A;  4OUL A;  2FDI A;  2RE9 A;  3DPR C;  4PLM A;  4Q8L A;  4YVS B;  3O1U A;  1QGL A;  1Y9Q A;  1W8W A;  4C0H A;  5CFD C;  4QU1 A;  2ZX3 A;  2O14 A;  3MIB A;  1V9U 2;  4XPV A;  4YW6 A;  3M4F A;  3CU7 A;  1OLM E;  3VDD B;  4EWA A;  4LUK A;  1DU3 D;  1PZ7 A;  4LBQ A;  3CHX A;  1EP0 A;  4CPB A;  4OQ8 A;  1QJY 2;  2HKX A;  5BY5 A;  1XSR A;  2VGD A;  5D8A C;  2AR6 A;  3PVO A;  1COV 2;  4PCR A;  2YGL A;  1W6N A;  3M3O A;  1FV3 A;  3PNA A;  5CIS A;  1JZ3 A;  4D7S A;  2YC4 A;  4JRA A;  2XL9 A;  3D5O A;  3URF A;  4ZXK A;  4Q4W 3;  3U10 A;  3Q8C A;  4B1L A;  5DAP A;  4CDQ B;  5F9T A;  3M2M A;  2WZR 3;  2ENR A;  3A0N A;  1YJK A;  5FBJ A;  3AB0 A;  3INA A;  4JGY A;  2WNO A;  3NJY A;  4PIX A;  3I2H A;  1AXZ A;  1CZS A;  4XBN A;  5AVA A;  4BQW A;  2W0X A;  2WJS A;  2VE1 A;  4LKF A;  5DQ0 A;  1HXS 1;  5KC5 A;  2W1S A;  5JXH A;  5LAS A;  3R4U A;  2Q1F A;  2XJP A;  5EIY B;  2XHK A;  1KIT A;  2VW0 A;  2ZGU A;  3ZDV A;  4XDQ A;  1H1I A;  2D43 A;  2VOT A;  2P2K A;  2BDR A;  1MR5 A;  2GP3 A;  1OUR A;  3NKG A;  2WL1 A;  2VR4 A;  1QJU 2;  1VAM A;  5CFC A;  4AXO A;  1LKN A;  2A3W A;  3MPP G;  5A32 A;  4FOQ A;  4CRQ A;  5LZ6 A;  2W9X A;  1DQ5 A;  5FXV A;  2Y8K A;  4HAN A;  4P14 A;  4RS5 A;  2J7M A;  2I2S A;  1CZT A;  1RUE 3;  1H1A A;  5FZ1 A;  4TZD A;  3WP5 A;  4LHK A;  1BZW A;  1HXS 2;  4XFH A;  2W1Q A;  5DAQ A;  4LUM A;  2A6Z A;  3LEK A;  5J36 A;  3E1F 1;  3L9J T;  3DV8 A;  5IAT A;  4EN9 B;  3I49 A;  1CAW A;  1JOP A;  3PUR A;  3AKR A;  5E8A A;  2IXK A;  4IEQ A;  5FY4 A;  2GZW A;  3BGA A;  1D0G A;  1UX7 A;  1WGP A;  2NLR A;  3W58 A;  2PMW B;  2VXR A;  1BVV A;  4ASM B;  3CEW A;  1AR6 2;  4KG8 A;  2D6M A;  1POV 0;  3PME A;  3ZYG A;  4XJW A;  5FY8 A;  4AI2 A;  1RUJ 1;  4IEW A;  4JGZ A;  2VMF A;  2VTX J;  2DUR A;  4MVT A;  5DZG A;  4CEY C;  1ZRC A;  1O8P A;  2OPK A;  1HDK A;  3LEG A;  3NV3 A;  3TAY A;  4Y3O A;  4BQ1 A;  4AFD A;  5A6X A;  4A42 A;  1SCR A;  1YQ8 A;  3B00 A;  2XPJ A;  1Z78 A;  3I59 B;  2DWR A;  3ZFF A;  4B4P A;  1ULP A;  2WZP P;  4J1W A;  3I54 A;  4LBN A;  4KU8 A;  1MS0 A;  2XL7 A;  1D2Q A;  1GSL A;  2HEW F;  2VZ1 A;  4P5H A;  4UF0 B;  3H3U A;  2JD4 A;  5SV8 A;  1LOD A;  2XR4 A;  3PDQ A;  3U07 A;  4BOW A;  3P5B A;  4TYS A;  1NG0 A;  3GJA A;  3THP A;  3I2I A;  5F5C A;  2R1D A;  4IE6 A;  4NHM A;  3I8T A;  4ONU A;  5FZM A;  3THT A;  5F6L B;  1MQT C;  1WLT A;  2GAL A;  3AZY A;  5D1I A;  1G7Y A;  2GMM A;  4GIQ A;  2BOJ A;  1H2N A;  2EIG A;  3CQO A;  4GWI A;  1W2A X;  1BVP 1;  1W05 A;  2BGP A;  4IE0 A;  3LIH A;  3ACI A;  4HPK B;  5ACA 3;  5C8C C;  3MW2 A;  1YO8 A;  4AI3 A;  1SPP B;  2R49 A;  5BUV A;  1L7Q A;  1RMU 1;  4AVT A;  5CA6 A;  3UJO A;  1C4R A;  3MBW A;  4K1Y A;  5KXE A;  2DBN A;  2HWC 3;  2Y6F A;  3PUA A;  1O4T A;  1Q8Q A;  3W9A A;  5IW0 A;  4BIS A;  3R4S A;  1A78 A;  4XF3 A;  2BGO A;  1MS4 A;  3KT7 A;  3U78 A;  3O0X A;  1A8D A;  1QIQ A;  1VLN A;  4LEJ A;  2E32 A;  2YY1 A;  4NIA A;  3VB9 A;  5CAD A;  2C4X A;  1AXK A;  4KI5 M;  4WBB A;  2WO7 A;  4N53 B;  5FQ0 B;  3SKJ E;  1H6X A;  5C9A C;  5LBC A;  1PZ9 A;  3L2Y A;  1VJ2 A;  1LEM A;  1SBE A;  3ZDS A;  1FYU A;  2DFC A;  2JDK A;  1W6M A;  3B9I A;  3K4A A;  3B69 A;  3UK9 A;  1ULE A;  4GJY A;  4I09 A;  4QGN A;  5C4W A;  2P6C A;  4MLO A;  4A45 A;  2WT2 A;  1RMU 2;  1PX4 A;  3EO6 A;  4PIY A;  4GWJ A;  5EP9 A;  1FXZ A;  1LJ7 A;  1RUD 1;  1SFY A;  3WX5 A;  3ZN4 A;  3ZYH A;  5IT6 A;  1CES A;  1SBD A;  2VEC A;  1CVN A;  2RS3 3;  4I0A A;  4XXA A;  2OQ6 A;  1O3S A;  1O7F A;  4Q4W 1;  4QXH A;  2X05 A;  3S7E A;  3POG A;  4YPJ A;  1U5Y A;  2OW4 A;  3S5Q A;  3GF6 A;  4CSW A;  2D3S A;  3T4V A;  4FPL A;  1QXJ A;  1QQP 1;  4HKW A;  1J1T A;  4WVZ A;  4DXR A;  2MEV 3;  4N9H A;  2AEY A;  4YRD A;  2VNG A;  4K9S A;  2DCT A;  4Y20 A;  5IVJ A;  3KV9 A;  3BUC A;  2FDF A;  3BTY A;  2OZJ A;  2R07 3;  4BK5 A;  3AZW A;  5BYN A;  3D6E A;  4LE4 A;  3HBK A;  1CQ9 A;  1UY4 A;  3S6P A;  5EJ1 B;  4IGP A;  5I8T A;  3WLU A;  2PQS A;  1NLS A;  3ENR A;  3WP6 A;  1IQA A;  4OUE A;  4H55 A;  1DYP A;  1ZBE 3;  2R06 3;  4UFK A;  2FQP A;  2ATF A;  3CZU A;  3O1V A;  1TG7 A;  1RUD 2;  1UL9 A;  3RJR A;  3W21 A;  2FZ2 A;  1WCK A;  3LIG A;  4RR3 A;  4CCN A;  3PTY A;  3ZR6 A;  1ALY A;  3BU0 A;  5FZ0 A;  3WF3 A;  4NE9 A;  4K8R B;  4Q4W 2;  2F17 A;  4QHO A;  2XWJ B;  4G9S B;  4DIN B;  1SLL A;  2WZR 2;  1REE A;  1H8T B;  1RUH 1;  1YI7 A;  1RUE 1;  1QQP 2;  2ZBJ A;  3J7N A;  2JE8 A;  2VW2 A;  2ZGS A;  1VRB A;  4MET A;  2JG9 B;  4KWJ A;  5IJR A;  1Q5O A;  4OFG A;  2Q5T A;  4ARX A;  1CPM A;  2HEY F;  3DXU A;  3I3B A;  4XF0 A;  2N7G A;  4MX3 A;  3K46 A;  3HAG A;  5C71 A;  1K42 A;  2RMU 3;  5GZE A;  4I3P A;  4U36 A;  2YFU A;  4D6S A;  1AR8 3;  2OVU A;  2VUL A;  2WAO A;  3BOW A;  1CZV A;  1IS3 A;  4JHT A;  3ON7 A;  1YNA A;  1BCX A;  3ES4 A;  5GLV A;  5JWP A;  2VM9 A;  2OKX A;  3B01 A;  4IET A;  2BJS A;  4YW4 A;  2UWB A;  4JQR A;  1GP6 A;  1ENX A;  1GZW A;  3N9N A;  4WZF A;  3QH7 A;  2PN5 A;  3FJS A;  3Q8F A;  1HV0 A;  3I2J A;  4LO4 B;  3NAP A;  4NO4 A;  4HN0 A;  4YGE A;  1GOH A;  1RUE 2;  3VDC A;  4BMB A;  5IK8 A;  1E5R A;  3NVC A;  1O6U A;  4UAP A;  4HKO A;  4IGO A;  5AFE A;  4YVS A;  5KHH A;  2RR1 3;  3K75 B;  3MIG A;  3N36 A;  4FO9 A;  4J25 A;  2YU1 A;  1UMH A;  1AR9 1;  3ALQ A;  4NPL A;  5FK7 A;  3AKS A;  3N35 A;  4IEP A;  5FPL A;  1MZE A;  3GZT B;  3OD4 A;  3WR0 A;  5F5Q A;  3VDD A;  2E6V A;  3T0B A;  2AAC A;  1ENQ A;  2CHH A;  2Z69 A;  4YM0 A;  3LDR A;  1VBA 3;  5IUQ A;  4HVQ A;  4CXW A;  2XG3 A;  4MHU A;  4URT A;  3N7K A;  3DN7 A;  2XXZ A;  4YZ2 A;  1HQN A;  1POV 3;  1TME 1;  3N3H A;  3RMX A;  4DXS A;  2ZAB A;  5DG1 A;  2VUD A;  3RYK A;  1MZ6 A;  2X5I C;  3VBU B;  2IXH A;  4CDQ A;  4MXV A;  4QQP A;  2RS1 3;  1CAX A;  3PUQ A;  3C2U A;  4ZZ5 A;  2F4P A;  3WCR A;  2YBS A;  2BWA A;  4IW3 A;  2WZ8 A;  4YGD A;  2YG0 A;  3LWC A;  4V2W A;  3J7L A;  4YFZ A;  3MF9 A;  2D6L X;  3OPZ A;  2D40 A;  4PDW B;  1ZBA 3;  3C8X A;  4YG3 A;  2HWC 1;  5T52 A;  3LAG A;  4LHN A;  4LKS A;  1W9T A;  4D7T A;  5LA0 A;  3ZFE C;  1MVQ A;  1F4H A;  3AP9 A;  4OLL A;  4YZ3 A;  1M06 G;  4XTP A;  1UXZ A;  1AJK A;  1K5J A;  4G4F A;  4NWV A;  2WWS A;  1ZRF A;  4R9D A;  1TME 2;  2BER A;  2VZR A;  2RM2 3;  4HN1 A;  1KS5 A;  1AYN 3;  1VR3 A;  4QGL A;  1BBT 3;  4FOV A;  4XFG A;  5JSP A;  3WHU A;  2BBA A;  3H3L A;  4DUW A;  5ACA 2;  3I2O A;  4K21 A;  5EYX A;  3HOB A;  5BXX A;  3AJY A;  3AFG A;  3KD4 A;  4AGG A;  1K45 A;  3WQB A;  1C8M 1;  3DEM A;  5JI7 A;  2B4K A;  3KSC A;  5CFD B;  1PGL 1;  2NMO A;  1NCQ C;  4QAW A;  4XE9 A;  4ZS3 A;  1URX A;  1FOD 1;  2CU5 A;  1W9S A;  2HWC 2;  2RS3 1;  2WYS A;  3E5U A;  5JDB A;  5FP9 A;  4AAX A;  1JUH A;  2VMD A;  4GAL A;  2WAB A;  3POI A;  2RDQ A;  3HR9 A;  4NRQ A;  4OZX A;  1JYV A;  2Y33 A;  2CGN A;  3ZLI A;  1SEF A;  1DQ4 A;  5FY1 A;  3WD5 A;  3VBF C;  2VTF A;  1OLQ A;  1QDC A;  1YQC A;  1AUY A;  3FFZ A;  3K3O A;  4QX7 A;  3WNN A;  3N9M A;  3AX4 A;  3N9L A;  4DOU A;  1CR7 A;  3HQR A;  4HT1 T;  1OQ1 A;  4H3W A;  2CL2 A;  1UZZ A;  2OA2 A;  3I59 A;  1MS1 A;  4QB2 A;  3MIE A;  4BXF A;  4CCD A;  1PGL 2;  2DCK A;  5B4N A;  5L9R A;  3ZYB A;  2RS3 2;  1OBN A;  4JTO A;  2GU9 A;  4MGS A;  1HB2 A;  4UF0 A;  4YW5 A;  4LBL A;  4F8A A;  4S2G A;  5FZA A;  3HNB M;  4QPI C;  5T55 A;  3RZZ A;  4HSJ A;  3GDB A;  5EZW A;  1J3Q A;  1UKG A;  2WKK A;  3P6B A;  3SH4 A;  3WG1 A;  1TNR A;  2VQA A;  2ES3 A;  2BFU L;  2R07 2;  3VBO B;  3TWI A;  1WLW A;  2C9A A;  3KCC A;  3RVH A;  3ZSJ A;  5C3O A;  4FFH A;  5A3U A;  1YUD A;  2VVE A;  3KHB A;  4RL7 A;  4ZU7 A;  3BOP A;  4LBQ D;  1OFS A;  1ZBE 2;  4HPK A;  4CPB D;  5HCA A;  2YBK A;  4CE8 A;  4XMI A;  3MV0 1;  1HB3 A;  1SPP A;  3EQE A;  3KF5 A;  1HX6 A;  2WQ8 A;  1W9F A;  1XYN A;  2HYX A;  1GR3 A;  1GU3 A;  1YC6 1;  1OKQ A;  2AZ5 A;  2VZQ A;  3POS A;  1JHJ A;  3SCG A;  3FE5 A;  2DF7 A;  5FY0 A;  4RQP C;  1YQ2 A;  2ZGT A;  4BB3 A;  3SC7 X;  4Y1X A;  1DZR A;  1JYW A;  4FAH A;  1WD4 A;  2A3Y A;  3UV9 A;  4KBZ A;  3J9S A;  3O14 A;  3WCS A;  4XTM A;  3AYC A;  3I3M A;  4N53 A;  5EJZ B;  4FPC A;  5LB6 A;  5FQ0 A;  2V4V A;  1ACC A;  2RMU 2;  1QY4 A;  2E51 A;  3WW2 A;  4COU A;  1BJQ A;  1AR8 2;  4K1Z A;  2DCY A;  3VZO A;  3NNL A;  5D21 A;  4UOJ A;  2YB7 A;  3VL9 A;  1D7P M;  3RWN A;  3MV1 1;  3T08 A;  3NST A;  2H6C A;  4OUS A;  3KHC A;  4Y5S A;  1DGW X;  2VVF A;  5CNA A;  2ZAC A;  4BYY A;  2ZEY A;  4LA3 A;  4ES8 A;  3AP4 A;  3HPN A;  1NY7 1;  1MPX A;  1LOB A;  3ZYP A;  4Q0P A;  4PBO A;  5JPN B;  2JDN A;  4YW3 A;  2VW1 A;  1POV 1;  3VZK A;  3PL0 A;  1DF0 A;  2BNO A;  3B5L B;  4XIK A;  2QQO A;  4MGT A;  4OI0 A;  3HVD A;  3D8C A;  3MUZ 1;  2V73 A;  1ULG A;  2GN7 A;  1O5L A;  5L9V A;  3JQW A;  4FP2 A;  5FYY A;  1LOA A;  1XYO A;  2TBV A;  4P9Y A;  5DUU A;  1WA4 A;  4M0N A;  2JIG A;  2IXL A;  3MLL A;  4UYB A;  5H9P A;  3ZSK A;  3ZSE A;  3DF0 A;  1SLT A;  1U5X A;  3NW4 A;  1KDM A;  1GFF 2;  5CG8 A;  3WZ1 A;  1VBA 2;  1LOF A;  5ERL A;  1YFW A;  4QPW A;  1JYX A;  1RL3 A;  1WZX A;  1NY7 2;  3C7F A;  3OBT A;  4QXC A;  2X29 A;  2E31 A;  4IV1 C;  5IAV A;  3N9Q A;  4P02 B;  4AL9 A;  2UY9 A;  4BM8 A;  3ILN A;  2CAV A;  2RS1 2;  3LOB A;  1DGR A;  3RZJ A;  4LTA A;  1H8T A;  2HWB 3;  4XQ4 A;  4AED C;  1K3I A;  2IFW A;  4UBG A;  1NCR B;  4CA9 A;  4LO8 A;  2JG9 A;  3POB A;  1PO2 3;  5E6H A;  3ZFF B;  4CEW B;  4C90 A;  1VP6 A;  2J1T A;  1ZBA 2;  1GNH A;  1Z7S 1;  2IFR A;  3EXU A;  3J7H A;  5TSW A;  2PHR A;  3WNX A;  5FPU A;  2RS5 1;  4BK4 A;  4O9E A;  4P08 A;  4IL7 A;  4NVP A;  4P9G A;  3VBR B;  3AP6 A;  4ZPI A;  3R6S A;  4NID A;  5EXO A;  3VHP A;  5F3E A;  5C5T A;  1YCI A;  2NN8 A;  4OHY A;  3UGG A;  4OQ9 A;  3SKV A;  4MGQ A;  2ZPX A;  1AYN 2;  1XE8 A;  3WNM A;  2ZGP A;  4JCK A;  3FUQ A;  3ZXD A;  1BBT 2;  4E8D A;  1UY0 A;  5KHG A;  5IFT A;  1O3Q A;  3K2O A;  3TNP B;  4E2G A;  5FZL A;  2DTW A;  2ZEW A;  4OHZ A;  2LRO A;  4W6W A;  5A6Z A;  5F3C A;  1UU5 A;  2XGX A;  4W50 A;  3CO2 A;  3BYW A;  3UNP A;  1AVB A;  1OA2 A;  1V6M A;  1ZZ9 A;  3GBF A;  2JKB A;  4N8M A;  4AVV A;  1C8N A;  4GH4 B;  4CCJ A;  5L7O B;  1K12 A;  2RS5 2;  3D3A A;  5GZC A;  4EWE A;  4QQO A;  4HET A;  1HQW A;  2J1R A;  1CN1 A;  2B5H A;  2VL4 A;  1XC6 A;  5FXX A;  3IAP A;  4HMZ A;  3MI8 A;  1MAC A;  2MHF A;  3ZXF A;  5GZG A;  4A7Y A;  1QJE A;  2ZS6 B;  4LR4 A;  3N9P A;  4P00 B;  1HB4 A;  1OD5 A;  2X53 S;  4FFG A;  4QM8 A;  5DAW A;  2Y34 A;  3VBH B;  3RSJ A;  1LUL A;  2WNU C;  3CJI C;  3J26 N;  4AWD A;  5JLV A;  3P1I A;  1ZRR A;  3OB8 A;  1OH3 A;  3NQH A;  4BHP A;  3M3C A;  3T30 A;  5J09 A;  2C26 A;  1WWY A;  1X36 A;  3SH3 A;  4OVE A;  1UU4 A;  4XDP A;  5IVE A;  1SQ4 A;  1V70 A;  5FO9 B;  2R0H A;  1UZW A;  1BHG A;  3J4U H;  3FMG A;  3III A;  5F2S A;  3ZYR A;  4ES9 A;  4L99 A;  3SIS A;  2W46 A;  5FP4 A;  3USU B;  4QDR A;  2P4E A;  2R32 A;  4ISR A;  5F3G A;  1D2S A;  3I97 A;  1A6C A;  2BU9 A;  4C8D A;  5ABJ C;  3IPV B;  5DPN A;  1W8F A;  1KJL A;  1UY3 A;  1NOV A;  2D5F A;  2GME A;  3FLR A;  4QHB A;  4BE3 A;  4XUT A;  4OI4 A;  2BV4 A;  3C7G A;  4IV3 B;  4XHX A;  1Q43 A;  1TVG A;  1RUJ 3;  4Y24 A;  4YW1 A;  2CWM A;  5FZ6 A;  4AOC A;  4AI9 A;  4AEK A;  1XB9 A;  5LBE A;  1NYW A;  2V72 A;  3A23 A;  2XLG A;  4MZU A;  1F4A A;  2E63 A;  5F5A A;  5FZF A;  4XJZ A;  3FHA A;  2ETE A;  3UGH A;  3B93 A;  4XJU A;  2XUE A;  5FR3 A;  2VMI A;  1B35 B;  3ZIX A;  1VE0 A;  1GQP A;  1ULF A;  1JS9 A;  4N7I A;  2J1A A;  5CFD A;  2EAL A;  2NZ9 A;  5A80 A;  4CDW C;  3AVS A;  4RD7 A;  4QPG C;  4XZP A;  3TB0 A;  5A3L A;  2ZX1 A;  1DLL A;  3W20 A;  2ILM A;  3NNJ A;  1IHM A;  3LF7 A;  4XF9 A;  4CVU A;  4LHS A;  1W8T A;  5E16 A;  5DZF A;  4AQ6 A;  3HD8 B;  5I0U A;  1CX1 A;  1ODM A;  5APA A;  5K8S A;  1JUI A;  2AH2 A;  2DVD A;  2V5D A;  2VTX A;  2VUC A;  3SMH A;  2AC1 A;  2X5I B;  1DQ0 A;  3VBS B;  1LRH A;  4DY5 A;  3ZSM A;  4BLJ A;  5A3M A;  4EN0 A;  5FY5 A;  1FMD 3;  1PMJ X;  2WLP A;  1ZZC A;  4XC9 A;  1QWR A;  4K6B A;  2SLI A;  4OHV A;  1POQ A;  3CF6 E;  1Y9G A;  3OYW B;  3CMG A;  4A44 A;  4AI8 A;  4Z1V A;  5C5U A;  1F5F A;  1S2B A;  1DP0 A;  4YM3 A;  4GA9 A;  3ZYF A;  1RMU 3;  4E4H A;  1VBC 1;  4NN0 A;  1SLA A;  2ZAA A;  4NHK A;  1TQ5 A;  2Y6L A;  2VUJ A;  5JZG B;  2OII A;  1W9Y A;  1KFX L;  2HWB 1;  2IXI A;  3NAP B;  4CUB A;  3DUI A;  2OQ7 A;  3WNP A;  1HRV 3;  2GP5 A;  5FZ7 A;  2IZW A;  4EWD A;  1CD3 G;  4XAE A;  2ARB A;  3VBO A;  3WV6 A;  3OEA A;  4JC1 A;  4I3G A;  1IKQ A;  3R0R A;  2W68 A;  3WDX A;  3UES A;  2FDK A;  5T5P A;  2JE7 A;  5CKQ A;  1QDO A;  2I74 A;  1D4V B;  2A6W A;  3PJQ A;  4XDO A;  4AHW A;  4XFC A;  1OOP C;  4YZ5 A;  2C6S A;  1XOY A;  2WWU A;  4BLI A;  2W39 A;  2R1B A;  5CBL A;  4TSV A;  5F37 A;  5FZC A;  1PK6 C;  1SFP A;  5T54 A;  4F83 A;  1I6X A;  4P9X A;  5BNN C;  4FQ4 A;  4OHX A;  4A2U A;  4RN5 A;  2PEL A;  1NUK A;  1OI6 A;  1RUD 3;  2D44 A;  2YU2 A;  3H7J A;  5B2G B;  4COZ A;  2Z42 A;  1W9W A;  2Q0A A;  3LD8 A;  3WDU A;  1V6J A;  2HWB 2;  4ZU5 A;  1VB4 A;  2AEZ A;  5EQU A;  1Y3T A;  4LO6 B;  2QQJ A;  3PUI A;  1CAX B;  1NE6 A;  1PO2 2;  1PVC 1;  3AMM A;  1TMF 1;  2EXJ A;  5A3T A;  2CAU A;  4EE2 A;  1ND2 B;  1G9A A;  1H0B A;  1QQP 3;  4P9W A;  3NO8 A;  5A3N A;  1VMJ A;  5FJK A;  2PQQ A;  2Q8E A;  3U37 A;  1RHI 1;  3BN6 A;  4RYD A;  1WUV A;  1N1T A;  3ME2 A;  1O5U A;  1W6Q B;  4YVW C;  1DGW A;  2B8M A;  2Y0I A;  1OVS A;  1CIY A;  1ZM1 A;  3LDB A;  5IVY A;  5CAZ A;  2G4I A;  2LS6 A;  4H7L A;  1GNZ A;  1NXM A;  5DUW A;  3IMM A;  3KWV A;  1S0E A;  4LPL A;  2D6N A;  4PI0 A;  3DXT A;  3CZJ A;  2PHL A;  3AJZ A;  4CP0 A;  4Q0Q A;  5JAX A;  5IVV A;  4WM8 C;  1UOF A;  1PGW 1;  5FZE A;  5FIX A;  3AK0 A;  4Q1R A;  2A7A A;  1C1F A;  1GWL A;  2GAU A;  1S0F A;  1RUH 3;  3OG2 A;  2JDZ A;  4OYU A;  2KA3 A;  1HLC A;  2CV6 A;  1ND3 C;  3NJZ A;  3DL3 A;  1IS5 A;  1G8W A;  1WMD A;  3NL1 A;  1PO1 3;  3ZXE A;  3BIE A;  4LO5 B;  4DS0 A;  4QWN A;  4SBV A;  2WSU A;  1FT9 A;  5DAV A;  4AVB A;  3VHR A;  4UW6 A;  3GZA A;  1GOG A;  5IHR A;  1CIW A;  4A3Z A;  3HT2 A;  4LMF A;  3VZL A;  2KM2 A;  1GQH A;  3RRD A;  1ONA A;  1HB1 A;  3A4U A;  1ZNP A;  4MGK E;  4YM1 A;  4AQ2 A;  4TLG A;  3LCP A;  5HV0 A;  5DZE A;  4S2F A;  4NAO A;  2EIE A;  5D2A A;  4X8N A;  1ZZ7 A;  5FV3 A;  4B1M A;  4OMC A;  1ULO A;  1C1L A;  1XE0 A;  4P9J A;  2C5D A;  2BBV A;  4RGG A;  1OKO A;  1ULC A;  1OMI A;  4GUL A;  3U0Z A;  1VAV A;  2YUE A;  4A7K A;  1NCR A;  2QFE A;  4CEW A;  1FV2 A;  4JVA A;  4ORF A;  1AHS A;  5FPZ A;  2FDH A;  2JEC A;  4HZF A;  3DYO A;  5DAB A;  5C9A A;  5LA9 A;  5KXC A;  5CKN A;  1LGC A;  2DDU A;  2VOK A;  4BIF A;  3OD0 A;  2VZ3 A;  1MEC 3;  2GMP A;  3ZN6 B;  3NKT A;  1AR9 3;  5J96 B;  4LE3 A;  4JGY C;  3VBR A;  5C6C A;  2WUH A;  2Z2S B;  1QXR A;  4RHV 3;  1OF4 A;  1YXW A;  4NRP A;  2QE3 A;  4AZZ A;  3U4X A;  2GNB A;  3T2T A;  1WCD J;  3KZ4 C;  4ZKT B;  5CZK A;  1RYY A;  4X8P A;  1RUJ 2;  2YYO A;  2D93 A;  4NPM A;  2P5B A;  4JKM A;  5DDJ 3;  3H8U A;  1V6K A;  4NIG A;  2Y6G A;  1TME 3;  1KS4 A;  2JDM A;  5H9Q A;  1DYO A;  1EUU A;  2WS9 3;  2FCT A;  2DYC A;  1GP5 A;  3OOX A;  5F7U A;  2VD7 A;  1FMD 1;  1HW5 A;  4QT6 A;  4AAP A;  2WZE A;  4XUO A;  1ULD A;  1UW8 A;  2ET7 A;  1W0P A;  3ZXJ A;  4D7Y A;  5CFC C;  1WMX A;  3OPW A;  1GIC A;  3EMR A;  4GH4 A;  3VKM A;  3WT3 A;  4AI1 A;  5L7O A;  2UY8 A;  3LDK A;  2HWD 1;  1N3P A;  2X10 A;  2V5Y A;  2TNF A;  2EID A;  2EXH A;  4RS5 C;  5IFP A;  3GAL A;  2JDP A;  3MPB A;  5GLT A;  2JKX A;  5BNP B;  1YIP A;  4JKK A;  1VMF A;  1PIV 1;  1HRV 1;  1XNT A;  2EIC A;  3I2K A;  3IMN A;  4TTG A;  3WDT A;  1NA1 C;  4AFM A;  3AM2 A;  4Y1Z A;  1H4H A;  3VBH A;  1PVX A;  5LY1 A;  2R6Q A;  1JZ7 A;  2P3Y A;  2D6K A;  4KWL A;  1Y43 B;  1N3O A;  3FUO A;  1KD7 A;  5FDB A;  1SG3 A;  2WIN B;  2F4L A;  1QJZ A;  3CLP A;  1YJL A;  5SV5 A;  1FMD 2;  3FBM A;  3LPF A;  4WM7 B;  3E6C C;  5F39 A;  3QAC A;  2WFP A;  5J48 A;  4BXS V;  3NNG A;  4GXL A;  4JGZ C;  4Q4V 1;  4CCK A;  1VAL A;  1F31 A;  1R64 A;  2KXL A;  1YFX A;  3JD7 1;  2J42 A;  2YFZ A;  1R1Z A;  5FY9 A;  3KT4 A;  4CCM A;  1C8M 3;  2BPA 2;  5LRR A;  3C7O A;  1KRI A;  1RUC 1;  3FWE A;  4PF5 A;  3FZ3 A;  4IUG A;  1WCU A;  1XNC A;  3USU A;  1FOD 3;  2D3R A;  2ZGR A;  2Q1M A;  4XQD A;  5FXZ A;  5A7S A;  1L7R A;  4GJZ A;  3RGB A;  2P34 A;  3ELN A;  1CJD A;  5FAX A;  3ZKU A;  1HRV 2;  3IPV A;  3WW3 A;  2WYF A;  1N1V A;  5HI0 A;  1JXN A;  4QX2 A;  1VPH A;  4PHZ A;  5FUI A;  3ZVX A;  1LTE A;  4IV3 A;  1RTV A;  4MYE A;  5F32 A;  4V2V A;  4BME A;  4WVW A;  4CU7 A;  5FZD A;  2EVX A;  2J1S A;  4NPR A;  3MID A;  3OTF A;  3AMN A;  4XYX A;  4XMA A;  2RJ2 A;  1KGY A;  1OUS A;  3M3E A;  1VB2 A;  1Q8S A;  1LHU A;  4YG0 A;  1W8N A;  4EYU A;  1AR7 3;  3POJ A;  4FPJ A;  1B35 A;  2QQN A;  1O59 A;  3OGV A;  4LK6 A;  3LE0 A;  5AC9 1;  4NWW A;  4Q8K A;  2VMH A;  3GXU A;  4CDU B;  1KXG A;  3PLQ A;  2EAK A;  4A7Z A;  2VZU A;  3M3I A;  1PNG A;  2DV9 A;  2JE9 A;  1XXN A;  4K40 A;  4Q2F A;  2D5H A;  3MF6 A;  2VZV A;  2J1E A;  1KEX A;  1SDD B;  1X50 A;  5FYT A;  1QXP A;  1CPN A;  1W06 A;  2QVS B;  3RFR A;  2JEN A;  4MAD A;  3WNK A;  1ODN A;  3ZXA C;  4IQP A;  1F5J A;  1LOG A;  1QF3 A;  4QX0 A;  4MO3 M;  3E5Q A;  1PO1 1;  3CNA A;  2DUP A;  2X5I A;  2UU8 A;  4DFS A;  5FMC A;  3VBS A;  3MFC A;  3M3Q A;  1GNY A;  4IEZ A;  2WNV B;  1RB8 G;  5CB7 A;  4NHX A;  3OYW A;  4UBH A;  1OVP A;  2Q8D A;  5AC9 2;  1T2X A;  1OUX A;  4XFF A;  2W95 A;  5H9R A;  4BDV B;  3M8L A;  3FC0 A;  3ILF A;  4QKD A;  4CCE A;  5K0U B;  5ANQ A;  1VAK A;  3G7D A;  5JZG A;  5C4W C;  4CDX C;  1MS8 A;  2FMY A;  4Y22 B;  3S7I A;  1C28 A;  1RUH 2;  4N43 B;  2CSG A;  2FHR A;  4QGM A;  5C3P A;  1MS3 A;  1MZF A;  4FI9 A;  4C1W A;  5A3P A;  2Y64 A;  3T2Q A;  2ZZQ A;  4XBQ A;  3AL6 A;  2CTV A;  2ARA A;  3KVA A;  5E88 A;  5A1L A;  1PO1 2;  1OSG A;  3BTX A;  3GNE A;  3GJB A;  3BIW E;  2XVL A;  4M4P A;  1MEC 1;  4LNV A;  5KR7 A;  1J83 A;  3IZO A;  4NRO A;  2K2S A;  2C1F A;  3B7M A;  3ZSL A;  3ZMN A;  1SAC A;  2O8Q A;  1JN2 P;  4RHV 1;  1S0J A;  1YRZ A;  2GN3 A;  2W08 A;  1NQJ A;  3P3N A;  4JQT A;  3CKH A;  3ACF A;  1QKQ A;  4CTE A;  3AYA A;  1FX5 A;  4XCA A;  5DDJ 1;  1OA3 A;  2UWC A;  5FMD A;  3VHO A;  1RIR A;  3I7D A;  5IYY A;  2NMN A;  2ZX2 A;  2WS9 1;  3I3E A;  5C33 A;  1WD3 A;  2VOX A;  4Q5O A;  1R1A 3;  2I07 B;  3WIN E;  1AL2 1;  4XFI A;  4RR3 C;  1H2K A;  4HG6 B;  1ND2 A;  2Y60 A;  4TXW A;  2VCM A;  3AP7 A;  4NMI A;  1UOJ A;  1MEC 2;  3NNF A;  5FMO S;  4NR1 A;  3G6J B;  1AR9 2;  1W6Q A;  1UO9 A;  2WT1 A;  4D6R A;  4H14 A;  4P9I A;  4EJR A;  1IGO A;  2VOV A;  2W1U A;  4RHV 2;  3TN9 1;  1YWK A;  1EAH 1;  4PQ9 A;  3WUD A;  4BIO A;  2O8O A;  4B8E A;  5J1X A;  1VRH 3;  3Q9O A;  5A7W B;  5DUV A;  1KDK A;  3MIH A;  4R4X A;  5DDJ 2;  1SZB A;  1WLD A;  2VZO A;  4V1P A;  2GNT A;  3T2O A;  3ZR5 A;  1UMZ A;  4B3N A;  3TEW A;  1O4Z A;  3B9C A;  3DYM A;  3NJV A;  3LQC A;  4KWU A;  2V4A A;  2WS9 2;  2ZKN A;  4WZC A;  4IE5 A;  4LLO A;  3RDI A;  2WO1 A;  2ZGO A;  4FTB A;  2YC0 A;  4GWN A;  5FPX A;  2XOM A;  1LHW A;  1CWP A;  3DPR B;  4YFW A;  3OGJ A;  4DXZ A;  3KV5 A;  3WQ1 A;  1XNA A;  3VD3 A;  1Z7S 3;  3RI9 A;  2CDP A;  1F2N A;  5FZK A;  4E8C A;  4RFT 0;  3ZXK A;  2JDU A;  4QXK A;  2G19 A;  2RS5 3;  3AC0 A;  2D6P A;  4JZR A;  5LBB A;  1EAH 2;  1GLH A;  2JEM A;  2GNM A;  2VNV A;  2VY0 A;  4XW3 A;  3ZO0 B;  4EQV A;  3T0D A;  2XJU A;  4IER A;  3OBA A;  2WQ4 A;  1LEN A;  2VNR A;  4YVS C;  2HWF 3;  2Y26 A;  5JOX A;  3DYP A;  2XLA A;  1J84 A;  2OXB A;  1MVE A;  5CU1 A;  3MEP A;  3SIT A;  2PHU A;  3THC A;  5J3U A;  5D8A B;  4W6Y A;  4JHZ A;  3BOD A;  1PGS A;  3VDD C;  5KHI A;  2XBO 1;  2XJR A;  3ATG A;  4DUV A;  2W91 A;  2BWC A;  3A0K A;  3EHK A;  1O3T A;  4AW7 A;  2EA7 A;  2Y6J A;  2DVF A;  4R9C A;  2XKP A;  1CAV B;  1S0B A;  1EPW A;  4O7X A;  1XNB A;  1AR7 1;  1SBF A;  1BLZ A;  2C24 A;  4QX8 A;  3RG0 A;  1AYM 1;  1C8M 2;  1LHO A;  2QJV A;  2RDS A;  4K3U A;  4XAA A;  4XUP A;  4ITC A;  3IDA A;  1FOD 2;  5F3I A;  2ZJC A;  4GB3 1;  4DEQ A;  3ZN6 A;  4MGY E;  3UET A;  4F3J A;  2OPW A;  2BOI A;  1GAN A;  1V6O A;  1YEW A;  4FP3 A;  4M3C F;  4NAM A;  3QOP A;  4Q0S A;  4CCO A;  3O1T A;  5LRS A;  2QQK A;  3AYD A;  1D4M 3;  3WSO A;  5M0T A;  1GZT A;  4FTS A;  1GP4 A;  4FPO B;  5FLI A;  3E5X A;  5EJ3 A;  2KR2 A;  4RA0 A;  3OBZ A;  4U2A A;  1TZO A;  1JYN A;  2K46 A;  3NJX A;  4BQ4 A;  2RHP A;  4KH9 A;  1Q8O A;  3JB4 C;  1FI2 A;  5AFB A;  1AR7 2;  1DZT A;  5E1R A;  1IS6 A;  3THD A;  2XML A;  4CYD A;  5HBA A;  1IPS A;  4GB3 2;  4FCA A;  2JB8 A;  4FPY A;  4LQR A;  3LA3 A;  2IXC A;  2YHJ A;  3AMQ A;  4AHY A;  1S2K A;  2C0Z A;  2ZX0 A;  1RUG 3;  1W2N A;  1PMH X;  2CNA A;  1NZC A;  2DUO A;  2VU9 A;  4E27 A;  5BNP A;  5JSR A;  3HT1 A;  2HWE 3;  1QOS A;  3LOI A;  4DO0 A;  1R09 1;  4M3C B;  5DUX A;  2A6X A;  2P3I A;  2JWP A;  1PHM A;  2PAK A;  1JU4 A;  4NJ4 A;  1QHD A;  4QKN A;  4YNI A;  3ZIW A;  4CEY B;  1MS5 A;  4AE2 A;  1X9P A;  1OFN A;  1F9K A;  2ZOE B;  4HXC A;  3MIF A;  1YLL A;  5A3W A;  3EB7 A;  5JI9 A;  2DU1 A;  4WM7 A;  4IE4 A;  5E89 A;  3HWJ A;  4WVM B;  4XFB A;  1X8M A;  2YV8 A;  1W28 A;  3LFM A;  3EBR A;  4PIZ A;  2K9Z A;  1D0H A;  5FZG A;  1DG6 A;  1OF3 A;  2X09 A;  2ZGQ A;  3LA2 A;  4I01 A;  2HBT A;  2JG8 C;  4QKF A;  1STM A;  4QU2 A;  4R9B A;  4XCB A;  1K5M C;  4L9B A;  2DTY A;  4Y5Z 0;  5H9S A;  5LEK A;  4Y26 A;  3OSD A;  1H2L A;  1UYZ A;  1W0O A;  2FZ1 A;  2JB4 A;  5G05 L;  4JTN A;  1RUO A;  4IEU A;  4IEV A;  1R1A 1;  3OPT A;  4ZU4 A;  2JD9 A;  2VPV A;  2WFF 1;  1AX1 A;  3PVN A;  1BKZ A;  1C5H A;  1RVF 1;  1SMV A;  1A3K A;  2WBK A;  3N4M A;  1EPZ A;  2YPJ A;  2VZP A;  3KQR A;  4ATF A;  3ZMO A;  2UYA A;  3HMY A;  1XE7 A;  4ZXE A;  1QU0 A;  2P1B A;  4KNC A;  1DQ1 A;  1MQT B;  3ZPO A;  4ERO A;  1FPN 3;  3WVJ A;  2Y6H A;  1BMV 1;  2E33 A;  2PFW A;  4ZON A;  4R9A A;  4M4R A;  1WCQ A;  2BTV C;  4LK7 A;  1JU3 A;  3TEX A;  3HIF A;  5FP3 A;  1QMJ A;  1ZA7 A;  4FFI A;  2W52 A;  1VRH 1;  4QX1 A;  5C8C B;  4IEO A;  5GJ6 A;  3NWK A;  2DCJ A;  3E6D A;  3QBQ A;  1QJX 3;  1GBG A;  4ZS2 A;  4C0B A;  4CDU A;  3LKJ A;  1UMI A;  3BCW A;  3H0O A;  4O9G A;  1U5Z A;  4B29 A;  4C91 A;  1W2U A;  1RUF 1;  1VBC 3;  2NPI A;  2W5F A;  1R1A 2;  2W1W A;  3PJY A;  1L3J A;  4GMP 1;  3W59 A;  2CYF A;  1LES A;  3AMP A;  2PAM A;  3NV4 A;  1NA1 B;  3Q8B A;  4LXL A;  5LW9 A;  2O0O A;  3WNL A;  5FZ3 A;  4DNY A;  2QUO A;  2VJX A;  1DGL A;  1HRI 1;  3VDB A;  1ZZ6 A;  2W87 A;  5EPA A;  5C9A B;  3HQU A;  1SLC A;  3JCI A;  1ZVF A;  3RZM A;  1A34 A;  1US3 A;  1BMV 2;  1CAU B;  1KJR A;  2PLV 3;  5B4X A;  2BVB A;  2VBD A;  3Q8A A;  2FDG A;  2BW8 A;  2WNV A;  2HWF 1;  1VRH 2;  5FCC A;  1VBB 3;  2FCU A;  4CZS A;  4N53 C;  3JQX A;  3QCW A;  1U5I A;  1G9F A;  1S0D A;  4LIT A;  2F6B A;  4LIV A;  3TBD A;  4MXW B;  5IVF A;  2CWS A;  2WQZ C;  4XXP A;  5FP8 A;  5K0U A;  3U11 A;  1JOB A;  3HNM A;  2ZXQ A;  5EHD A;  1VBE 3;  1IZ3 A;  2A70 A;  2QKD A;  4Y22 A;  2ZHK A;  4N43 A;  4XUN A;  3F2Z A;  3ZFG C;  4MGZ E;  3JXS A;  2XKO A;  1PVC 3;  3MYX A;  4FVV A;  1RIN A;  5DN2 A;  5FYM A;  4NIH A;  1TMF 3;  4EN6 B;  4P5Y A;  3TYJ A;  3UGF A;  1Z7S 2;  1JI6 A;  2QTW B;  3OGR A;  1LHN A;  3P3P A;  4Y4Y A;  4M01 A;  1XSQ A;  1RHI 3;  2DVG A;  4A41 A;  4PI2 A;  2DVB A;  1W2O A;  1OLR A;  2HWF 2;  2JX9 A;  4XOG A;  5FZH A;  4K20 A;  1QEX A;  3OF1 A;  1JZ4 A;  4YG6 A;  1D4M 1;  1UY1 A;  1OQE A;  1JYC A;  4HKL A;  3T1L A;  5DMY A;  2FD8 A;  3H1Y A;  1JZ2 A;  2VNO A;  2WN3 A;  2ZA9 A;  4KQ7 A;  5EYY A;  4DPN A;  1BK0 A;  2R0F A;  5FMB A;  1UF2 C;  4LOT A;  3OCP A;  2JIC A;  1LOF C;  5BNO C;  1C57 A;  1Q56 A;  2BZD A;  4AVA A;  2E7T A;  4BQX A;  4KU7 A;  5LBF A;  1H8V A;  1SFN A;  1DCS A;  4I0W B;  4IXL A;  1J3R A;  2XQR A;  4JDM A;  4MG2 A;  4EZH A;  1TNF A;  3I2G A;  4ARY A;  4RSU A;  3OUH A;  4IEX A;  4XJ9 A;  4AI0 A;  2VQU A;  3H1W A;  3ORJ A;  5K7P A;  4PF1 A;  4AEJ A;  1H8T C;  3BAL A;  4Y5T A;  3N7L A;  1W2T A;  1OA4 A;  5LWB A;  3MZH A;  1RUG 1;  2EIB A;  2JG9 C;  5K9Y A;  2VME A;  5JXJ A;  1XRU A;  5JR7 B;  3ZOI A;  1D4M 2;  1PM7 A;  2HWE 1;  1CJP A;  3JB8 A;  1TE1 B;  3MGU A;  4N90 A;  5A7W A;  1WME A;  2QNK A;  3FFQ A;  4Q1P A;  2CY6 A;  2GND A;  3JU9 A;  5A33 B;  3KM5 A;  5FYH A;  1QH7 A;  3IDC B;  3AKP A;  4LHL A;  2ZX4 A;  3BTZ A;  3VV1 A;  1IG3 A;  5FZO B;  4COV A;  2R7E B;  5CIR A;  1WA6 X;  1J1L A;  3ZYI B;  2D3P A;  2FDJ A;  3H7Y A;  1OH4 A;  1WBF A;  4FOW A;  3DPR A;  5FZ4 A;  5I8S A;  4XAC A;  1NE4 A;  1JZ8 A;  5A7O A;  3MIC A;  4MUV A;  4YAR A;  4Y1V A;  4AR2 A;  1BEV 1;  2KD7 A;  2Q30 A;  1HN1 A;  1RUG 2;  4LUL A;  1G9B A;  1V0A A;  1OPM A;  4BQ5 A;  1AL0 G;  4I30 A;  5JVV A;  2HWE 2;  1XU2 A;  1QH6 A;  2QQP A;  5D8A A;  1MS9 A;  3U75 A;  3ZYJ B;  1UIK A;  4HVO A;  5A7N A;  2YMZ A;  4Q0V A;  4YWA A;  1FPN 1;  3OBR A;  3PIJ A;  1PM4 A;  4R4Z A;  4GD4 A;  4RGK A;  2E7A A;  2MPF A;  1BXH A;  4FSJ A;  1DQ6 A;  4CU6 A;  1AX2 A;  2ARX A;  1CAV A;  2QDR A;  2QQL A;  4KGQ A;  4XHB A;  1NZI A;  5KC6 A;  5GLU A;  2DFB A;  3L2H A;  1QJX 1;  1RXG A;  1BEV 2;  5JIA A;  4QKB A;  3VBU C;  2HWD 3;  4QB6 A;  3AZX A;  5FJH A;  1IG0 A;  3SNM A;  2VCB A;  3WHT A;  4XUR A;  5C3R A;  5A1F A;  4LBM A;  3ZFE B;  3K3N A;  1H1M A;  2Q8C A;  3UT0 A;  1GYK A;  3K4D A;  4PDW C;  3T4H B;  1PIV 3;  2J1U A;  1NX9 A;  3N7M A;  5I0T A;  1UAI A;  5T5O A;  2LAL A;  1V9U 1;  1FPN 2;  4D0Q A;  4ET7 A;  5JPM B;  2PLV 1;  1I9R A;  4N9I A;  4DZG A;  2PHD A;  1RGS A;  2VH9 A;  2VMC A;  4Z92 B;  4EZ4 A;  1QJY 1;  3HN1 A;  2WNE A;  1VBB 1;  1SDW A;  2VO5 A;  3A7Q A;  3GZE A;  5HXM A;  1S2E A;  3VL8 A;  1COV 1;  5AVP A;  2GH8 A;  4Q4V 3;  1QJX 2;  4QB1 A;  1I1E A;  3I2D A;  4NHL A;  3JD7 3;  3ETQ A;  2HBU A;  1NCQ B;  2WO3 A;  1GOF A;  3RZL A;  1VBC 2;  1QOO A;  2W92 A;  1F15 A;  1RUC 3;  4XET A;  3O12 A;  3BVC A;  5FYV A;  4XUQ A;  2OUJ A;  4CP9 B;  1VBE 1;  1ZYB A;  1ZZB A;  2ZGM A;  5FO8 B;  3RWK X;  1XBF A;  1HJG A;  5IK7 A;  3D0S A;  4M3C A;  1W6P A;  2B45 X;  3AKT A;  2WC2 A;  5FPV A;  4CEY A;  2PLV 2;  2JJ6 A;  2PXJ A;  3S30 A;  3VBF B;  3QD6 A;  3C3V A;  4Z8B A;  1F8V A;  2OX0 A;  5LK5 A;  1JHN A;  3IIA A;  3WXP A;  5GLW A;  4CUA A;  4EN8 B;  2TEP A;  4PJY A;  2QQU A;  5I0D A;  1VBB 2;  4WVM A;  2MNG A;  5FKC A;  1DFQ A;  3U1X A;  3RI8 A;  5CEH A;  3GBW A;  5JR2 A;  5L36 A;  1QJU 1;  4DRV A;  3MUY 1;  3VZJ A;  4XZU G;  1RUI 3;  5CYY A;  3V64 A;  3SCH A;  5AC9 3;  2BVV A;  4KBB A;  3WP4 A;  5JCT A;  5FK8 A;  1VBE 2;  5FLH A;  3LB9 A;  2QZ2 A;  3ES1 A;  4W4Z A;  4QPI B;  5JMO A;  4Q27 A;  1AXY A;  2LUW A;  1PVC 2;  2NQY A;  4HSL A;  2BP6 A;  4UXA A;  5JOY A;  3OY8 B;  1TMF 2;  1VMH A;  2ARE A;  3O7O A;  4Q29 A;  3LEI A;  4SLI A;  4YM2 A;  1X9T A;  3POW A;  2RDN A;  4DB5 A;  2QQM A;  2TUN A;  3KV4 A;  1RHI 2;  2VCC A;  4AHX A;  3DGT A;  1MQT A;  1DZQ A;  4KWK A;  5FMO L;  2P6H A;  5GZF A;  2EXK A;  4AQS A;  4CCL A;  1W6O B;  1AR6 1;  3K48 A;  3SHR A;  5I0R A;  2IUW A;  2ET1 A;  3VBO C;  3H8O A;  3D4K A;  2XVG A;  5C8C A;  1SLI A;  2W94 A;  4AYU A;  1W3V A;  3ECQ A;  4AG4 A;  3C7E A;  4RQP B;  1PGW 2;  1YHF A;  1OXC A;  1QNW A;  2OZ6 A;  1UNB A;  3AVR A;  4IEY A;  1Y7B A;  4YSF A;  3V56 A;  2QZ3 A;  1NA1 A;  2E9Q A;  4LBK A;  1UOB A;  3GHN A;  4R52 A;  5LY2 A;  3WEZ A;  4Y33 A;  1ZRD A;  4E4S A;  2BNN A;  3IT8 A;  1CAU A;  3BPS A;  5C8W A;  3FLP A;  3LSD A;  4DUX A;  5GZD A;  3OGG A;  3AKQ A;  3KB5 A;  1AZD A;  3PUS A;  4CXY A;  4QMA A;  4ZZ8 A;  1Q3E A;  2JG8 B;  3H42 B;  1W39 A;  1K5M B;  4AQT A;  4MXW A;  3ZKY A;  1LGB A;  2WA3 A;  4AEM A;  2WAA A;  2J22 A;  4GQ7 A;  4LIU A;  4Y1U A;  3SH5 A;  3WF2 A;  4AFC A;  3IM0 A;  5FOJ B;  1W03 A;  3ACG A;  1RJ8 A;  2Y38 A;  4GMP 0;  4Q4Y 1;  5DAX A;  4JDO A;  3MW4 A;  1OHF A;  3TOJ A;  3WY6 A;  3WW4 A;  1UZY A;  2WN2 A;  1G6N A;  1PMI A;  3AP5 A;  4HON A;  5HCB A;  2BGC A;  2H6B A;  5A7Q A;  4Q26 A;  4C1X A;  3WDW A;  1AL2 3;  1FAT A;  1EV1 3;  4L97 A;  4UFL A;  2D7F A;  2VQT A;  5L9B A;  4LOR A;  3EJK A;  1V6N A;  1UYY A;  2NM1 A;  1NT0 A;  1UZV A;  2GC1 A;  2Q8O A;  3IDB B;  2B42 B;  4XIL A;  4L0P A;  3JZV A;  1JH5 A;  4CCC A;  5JXG A;  1UKR A;  3TN9 3;  5LK7 B;  1EAH 3;  4DY3 A;  2W2I A;  4YLZ A;  4NRM A;  4E9K A;  3O0W A;  1DIW A;  3KF3 A;  2JDH A;  2YPD A;  2VMG A;  3T2P A;  4IV1 B;  2SBA A;  5BPX A;  1R08 1;  1GZC A;  3F95 A;  4Q4X 1;  2LRP A;  4LOS A;  4Q4Y 2;  5C70 A;  2Y6K A;  4Z82 A;  1GWM A;  3GM8 A;  4QDQ A; 
#chains in the Genus database with same CATH homology
 5FXW A;  3AVS A;  4QWN A;  3K3O A;  4QX7 A;  3OPT A;  5CEH A;  3N9M A;  4UF0 B;  4URA A;  3N9L A;  5IVB A;  5A7W A;  4D6S A;  5F2W A;  4EYU A;  3PU3 A;  2YBP A;  3PDQ A;  5E6H A;  3KV5 A;  5FYH A;  4BXF A;  3ZPO A;  5FZK A;  5FV3 A;  5F5C A;  5FUN A;  3N9N A;  5FZO B;  4UF0 A;  5FZM A;  4QU1 A;  5FZA A;  5FP3 A;  5FY5 A;  5FZ4 A;  5FYT A;  5A80 A;  4CUG A;  5F5I A;  5A7O A;  3KV4 A;  5F3E A;  4IGO A;  5FZ8 A;  5FZB A;  2XDV A;  4CCL A;  4E4H A;  5FZO A;  3PU8 A;  4IGQ A;  3RVH A;  3UYJ A;  2YU1 A;  3K2O A;  5FPL A;  5ISL A;  4Y4R A;  3PUA A;  3PTR B;  5FZL A;  5IVC A;  5FYI A;  4LXL A;  5IW0 A;  4BIS A;  2OS2 A;  5FZI A;  5F3C A;  5FZ3 A;  4QX8 A;  5LW9 A;  2OQ7 A;  4D6Q A;  2Q8D A;  2GP5 A;  5FYC A;  5FZ7 A;  3U78 A;  2YBK A;  5FBJ A;  4NUB A;  5A7N A;  2OT7 A;  2P5B A;  4CCJ A;  3NJY A;  5F3I A;  4GD4 A;  5FUP A;  2XXZ A;  5ANQ A;  5IVF A;  5LWB A;  3AVR A;  4CCO A;  3AL5 A;  5FY0 A;  2VD7 A;  5A7P A;  4XDO A;  5FXX A;  4AAP A;  2WWU A;  3PUQ A;  4GJY A;  5LY2 A;  5A3P A;  4Y33 A;  5F37 A;  4LIT A;  5FZC A;  4LIV A;  3OPW A;  3AL6 A;  5FYU A;  3N9P A;  2YBS A;  3KVA A;  5A1L A;  2GP3 A;  5FP8 A;  3KV6 A;  4V2W A;  5FJH A;  2YU2 A;  5KR7 A;  5FP7 A;  5A1F A;  3PUS A;  3LD8 A;  3K3N A;  5IWF A;  2Q8C A;  2OQ6 A;  5FY7 A;  4QXH A;  5FXV A;  5FYM A;  4CSW A;  4XDP A;  2XML A;  5IVE A;  5A3T A;  5FPA A;  4LIU A;  5FZ1 A;  5A3N A;  5FPB A;  4GAZ A;  5FJK A;  5LY1 A;  5F2S A;  2Q8E A;  5IVJ A;  3KV9 A;  5FP4 A;  4HON A;  4EZ4 A;  5FZH A;  3KVB A;  5A7Q A;  5F39 A;  3N9O A;  5F3G A;  4IGP A;  4C8D A;  3LDB A;  5IVY A;  3PUR A;  4DIQ A;  4DO0 A;  5FWE A;  5FY4 A;  4CCK A;  4HOO A;  5FZ9 A;  5FYY A;  5FY9 A;  4BU2 A;  4CCM A;  5FYV A;  5FY8 A;  3DXT A;  5FZ6 A;  4CCN A;  4AI9 A;  5A3W A;  4D6R A;  3U4S A;  5A7S A;  5FZ0 A;  2W2I A;  5FZE A;  4GJZ A;  5FP9 A;  5FXZ A;  5IVV A;  5F5A A;  5K4L A;  2YPD A;  5FZF A;  2WWJ A;  4Y3O A;  5FYZ A;  5FZG A;  5A7W B;  4EZH A;  5FPU A;  5FPV A;  2XUE A;  2PXJ A;  4QXC A;  1VRB A;  4TN7 A;  4V2V A;  5F32 A;  5FYS A;  2OX0 A;  4QXB A;  3ZLI A;  5FZD A;  5FY1 A;  4ASK A;  5FYB A;  5FWJ A;  3N9Q A;  3DXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...