5A4BA

Mutations in the calponin homology domain of alpha-actinin-2 affect actin binding and incorporation in muscle.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
223
structure length
223
Chain Sequence
AWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGTEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSWKDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN ALPHA-ACTININ-2
publication title Hypertrophic Cardiomyopathy Mutations in the Calponin-Homology Domain of Actn2 Affect Actin Binding and Cardiomyocyte Z-Disc Incorporation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 92
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00307 CH Calponin homology (CH) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.10 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Calponin-like domain 5a4bA02
1.10.418.10 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Calponin-like domain 5a4bA01
2WFNA 1AOAA 2VZIB 2WA6A 1TJTA 5A36A 4Q57B 5L0OA 1WYRA 2QJXA 5A4BA 1P5SA 1RT8A 3REPB 1SH6A 3CO1A 2D89A 4Q59A 3JAKM 1P2XA 2L3GA 2D87A 4B7LA 2R8UA 2D88A 2EYNA 2K3SA 2VZGB 2RR8A 2WA5A 4TXKA 3I6XA 3FERA 3HOCA 1WIXA 5J8EA 3F7PA 2D85A 4Q58A 1UJOA 1MB8A 2QJZA 2EE7A 1QAGA 4TXIA 1VKAA 1WYLA 3KMUB 1WYNA 1SH5A 5A38A 1WJOA 2E9KA 4EDNA 1H67A 1WYMA 3HORA 1WYQA 2R0OA 1PXYA 3JALM 4EDLA 2VZCA 1BKRA 3HOPA 3JARM 5A37A 1WYPA 1AA2A 1BHDA 2K2RA 5BVRA 1PA7A 4EDMA 2DK9A 3KY9A 1WKUA 3KMWB 2JV9A 1DXXA 2EYIA 2D86A 1V5KA 2YRNA 2VZDA 2WA7A 1WYOA 1UEGA
chains in the Genus database with same CATH superfamily
2WFNA 1AOAA 2VZIB 2WA6A 3VP7A 1TJTA 5A36A 2HL8A 4Q57B 5L0OA 1WYRA 2QJXA 2HKPA 5A4BA 1P5SA 1RT8A 3REPB 1SH6A 3CO1A 2D89A 4Q59A 2HL9A 3JAKM 1P2XA 2L3GA 2D87A 1EUVA 4B7LA 2R8UA 2D88A 2EYNA 2K3SA 2VZGB 2RR8A 2WA5A 4TXKA 3I6XA 3FERA 2EQOA 3HOCA 1WIXA 4LVPA 5J8EA 3F7PA 2D85A 2WE6A 4Q58A 1UJOA 1MB8A 2QJZA 2EE7A 1QAGA 4TXIA 1VKAA 1WYLA 3KMUB 2IGPA 1WYNA 1SH5A 2VE7C 4LVRA 5FMTA 5A38A 1WJOA 2E9KA 4EDNA 2WDTA 5FMUA 1H67A 1WYMA 3HORA 1WYQA 2R0OA 3JALM 1PXYA 4EDLA 2VZCA 1BKRA 4DDPA 3HOPA 3JARM 5A37A 1WYPA 2VE7A 1AA2A 1BHDA 2K2RA 5BVRA 1PA7A 4EDMA 2DK9A 3KY9A 1WKUA 3KMWB 2JV9A 1DXXA 2EYIA 2D86A 1V5KA 2YRNA 2VZDA 2WA7A 3EAYA 1WYOA 1UEGA
chains in the Genus database with same CATH topology
2WFNA 1AOAA 2VZIB 2WA6A 1TJTA 5A36A 4Q57B 5L0OA 1WYRA 2QJXA 5A4BA 1P5SA 1RT8A 3REPB 1SH6A 3CO1A 2D89A 4Q59A 3JAKM 1P2XA 2L3GA 2D87A 4B7LA 2R8UA 2D88A 2EYNA 2K3SA 2VZGB 2RR8A 2WA5A 4TXKA 3I6XA 3FERA 3HOCA 1WIXA 5J8EA 3F7PA 2D85A 4Q58A 1UJOA 1MB8A 2QJZA 2EE7A 1QAGA 4TXIA 1VKAA 1WYLA 3KMUB 1WYNA 1SH5A 5A38A 1WJOA 2E9KA 4EDNA 1H67A 1WYMA 3HORA 1WYQA 2R0OA 1PXYA 3JALM 4EDLA 2VZCA 1BKRA 3HOPA 3JARM 5A37A 1WYPA 1AA2A 1BHDA 2K2RA 5BVRA 1PA7A 4EDMA 2DK9A 3KY9A 1WKUA 3KMWB 2JV9A 1DXXA 2EYIA 2D86A 1V5KA 2YRNA 2VZDA 2WA7A 1WYOA 1UEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WFN A;  1AOA A;  2VZI B;  2WA6 A;  1TJT A;  5A36 A;  4Q57 B;  5L0O A;  1WYR A;  2QJX A;  5A4B A;  1P5S A;  1RT8 A;  3REP B;  1SH6 A;  3CO1 A;  2D89 A;  4Q59 A;  3JAK M;  1P2X A;  2L3G A;  2D87 A;  4B7L A;  2R8U A;  2D88 A;  2EYN A;  2K3S A;  2VZG B;  2RR8 A;  2WA5 A;  4TXK A;  3I6X A;  3FER A;  3HOC A;  1WIX A;  5J8E A;  3F7P A;  2D85 A;  4Q58 A;  1UJO A;  1MB8 A;  2QJZ A;  2EE7 A;  1QAG A;  4TXI A;  1VKA A;  1WYL A;  3KMU B;  1WYN A;  1SH5 A;  5A38 A;  1WJO A;  2E9K A;  4EDN A;  1H67 A;  1WYM A;  3HOR A;  1WYQ A;  2R0O A;  1PXY A;  3JAL M;  4EDL A;  2VZC A;  1BKR A;  3HOP A;  3JAR M;  5A37 A;  1WYP A;  1AA2 A;  1BHD A;  2K2R A;  5BVR A;  1PA7 A;  4EDM A;  2DK9 A;  3KY9 A;  1WKU A;  3KMW B;  2JV9 A;  1DXX A;  2EYI A;  2D86 A;  1V5K A;  2YRN A;  2VZD A;  2WA7 A;  1WYO A;  1UEG A; 
#chains in the Genus database with same CATH topology
 2WFN A;  1AOA A;  2VZI B;  2WA6 A;  3VP7 A;  1TJT A;  5A36 A;  2HL8 A;  4Q57 B;  5L0O A;  1WYR A;  2QJX A;  2HKP A;  5A4B A;  1P5S A;  1RT8 A;  3REP B;  1SH6 A;  3CO1 A;  2D89 A;  4Q59 A;  2HL9 A;  3JAK M;  1P2X A;  2L3G A;  2D87 A;  1EUV A;  4B7L A;  2R8U A;  2D88 A;  2EYN A;  2K3S A;  2VZG B;  2RR8 A;  2WA5 A;  4TXK A;  3I6X A;  3FER A;  2EQO A;  3HOC A;  1WIX A;  4LVP A;  5J8E A;  3F7P A;  2D85 A;  2WE6 A;  4Q58 A;  1UJO A;  1MB8 A;  2QJZ A;  2EE7 A;  1QAG A;  4TXI A;  1VKA A;  1WYL A;  3KMU B;  2IGP A;  1WYN A;  1SH5 A;  2VE7 C;  4LVR A;  5FMT A;  5A38 A;  1WJO A;  2E9K A;  4EDN A;  2WDT A;  5FMU A;  1H67 A;  1WYM A;  3HOR A;  1WYQ A;  2R0O A;  3JAL M;  1PXY A;  4EDL A;  2VZC A;  1BKR A;  4DDP A;  3HOP A;  3JAR M;  5A37 A;  1WYP A;  2VE7 A;  1AA2 A;  1BHD A;  2K2R A;  5BVR A;  1PA7 A;  4EDM A;  2DK9 A;  3KY9 A;  1WKU A;  3KMW B;  2JV9 A;  1DXX A;  2EYI A;  2D86 A;  1V5K A;  2YRN A;  2VZD A;  2WA7 A;  3EAY A;  1WYO A;  1UEG A; 
#chains in the Genus database with same CATH homology
 2WFN A;  1AOA A;  2VZI B;  2WA6 A;  1TJT A;  5A36 A;  4Q57 B;  5L0O A;  1WYR A;  2QJX A;  5A4B A;  1P5S A;  1RT8 A;  3REP B;  1SH6 A;  3CO1 A;  2D89 A;  4Q59 A;  3JAK M;  1P2X A;  2L3G A;  2D87 A;  4B7L A;  2R8U A;  2D88 A;  2EYN A;  2K3S A;  2VZG B;  2RR8 A;  2WA5 A;  4TXK A;  3I6X A;  3FER A;  3HOC A;  1WIX A;  5J8E A;  3F7P A;  2D85 A;  4Q58 A;  1UJO A;  1MB8 A;  2QJZ A;  2EE7 A;  1QAG A;  4TXI A;  1VKA A;  1WYL A;  3KMU B;  1WYN A;  1SH5 A;  5A38 A;  1WJO A;  2E9K A;  4EDN A;  1H67 A;  1WYM A;  3HOR A;  1WYQ A;  2R0O A;  1PXY A;  3JAL M;  4EDL A;  2VZC A;  1BKR A;  3HOP A;  3JAR M;  5A37 A;  1WYP A;  1AA2 A;  1BHD A;  2K2R A;  5BVR A;  1PA7 A;  4EDM A;  2DK9 A;  3KY9 A;  1WKU A;  3KMW B;  2JV9 A;  1DXX A;  2EYI A;  2D86 A;  1V5K A;  2YRN A;  2VZD A;  2WA7 A;  1WYO A;  1UEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...