5A4IS

The mechanism of hydrogen activation by nife-hydrogenases
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
264
structure length
264
Chain Sequence
KPRIPVVWIHGLECTCCTESFIRSAHPLAKDVILSLISLDYDDTLMAAAGTQAEEVFEDIITQYNGKYILAVEGNPPLGEQGMFCISSGRPFIEKLKRAAAGASAIIAWGTCASWGCVQAARPNPTQATPIDKVITDKPIIKVPGCPPIPDVMSAIITYMVTFDRLPDVDRMGRPLMFYGQRIHDKCYRRAHFDAGEFVQSWDDDAARKGYCLYKMGCKGPTTYNACSSTRWNDGVSFPIQSGHGCLGCAENGFWDRGSFYSRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrogenase-1 large chain
publication title Mechanism of hydrogen activation by [NiFe] hydrogenases.
pubmed doi rcsb
source organism Escherichia coli str. k-12 substr. mc4100
molecule tags Oxidoreductase
total genus 80
structure length 264
sequence length 264
chains with identical sequence T
ec nomenclature ec 1.12.99.6: Hydrogenase (acceptor).
pdb deposition date 2015-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
S PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 5a4iS01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 5a4iS02
1WUKS 3AYZB 1UBOS 1CC1S 4U9IS 3ZE8A 4UPVA 4UQPA 4UCWA 5JRDS 4UCQA 1E3DA 4TTTS 4KL8S 4KO3S 3ZE7A 5ADUS 1UBMS 3MYRA 3UQYS 5A4IS 1H2RS 3ZE6A 1UBKS 4KN9S 4IUBS 5JSYA 4KO2S 5JSUA 3USCS 1FRFS 5JT1A 1UBRS 1WULS 4UE3S 4C3OB 1WUIS 4IUCS 5D51S 3CUSA 1YQWA 1UBTS 3ZEAA 3RGWS 2FRVA 3USES 1H2AS 1UBUS 4KO4S 5A4MS 3H3XA 1YRQA 4IUDS 5JSHA 1WUJS 4GD3Q 4KO1S 1YQ9A 5A4FS 4OMFG 4UQLA 4CI0B 4UEWA 3ZE9A 4U9HS 4UE6A 2WPNA 4UPEA 3AYXB 3CURA 1UBHS 4UE2A 4UEQA 4UCXA 1UBJS 1UBLS 4UD2A 1WUHS 4UD6A 1FRVA 5JSKA 4URHA
chains in the Genus database with same CATH superfamily
3R7BA 2IXTA 1YE8A 2Q4EA 2OV3A 4QDUA 2X0DA 1VL0A 2C82A 2W6ID 3P2MA 3R7SA 2GZRA 1PVVA 4EF5A 4RTNA 4ENTA 1R3UA 3UKDA 2E89A 3L8HA 3ILSA 4BDTA 3GLKA 4XIYA 3EGDA 3RTDA 3C24A 4EEKA 5C7OO 2ZIXB 3GRRA 2QLNA 4EVRA 3HYNA 4I3GA 1W85B 4PRYA 4Y6QA 4IS3A 3Q2IA 3GMIA 4FR5A 9LDBA 2W48A 4C4OA 1NA5A 2XWQA 1T3TA 3AK4A 3DT9A 3TOCA 3C3MA 1H23A 1NVAA 1WDTA 3LL7A 4IW3B 3U9LA 1J1UA 2RHWA 2R8EA 4WQMA 5E3JA 2PKCA 3PFCA 1LY1A 4HOYA 6NULA 4I7EA 4G0VA 2W6OA 3G49A 2DKOA 4INOA 4HYYA 1OKKA 5DGCA 1QQ6A 2XCRB 1UC8A 3VSCA 4BASA 3MLAA 4UBIA 3GJQA 3IPLA 3E3NA 4JDPA 4AKGA 3V4PB 1X7ZA 4Y2GA 3DFZA 3PD0A 1U02A 4IO0A 1CRPA 1SBQA 4L50A 5KTRA 4J8PA 4EKEA 3LP5A 1E1RD 2V7UA 3BCHA 3K0EA 4UAJA 3AR8A 4TRNA 1OHHD 1MRNA 2X3UA 4OCZA 4I5FA 4U7GA 2I91A 3HM9A 1YNSA 4IKEA 3QMVA 2JIRA 1RJWA 3WHLA 4TLEA 2R62A 2YBEA 2FSSA 1G41A 2DPLA 4JROA 3BGDA 4S1WA 1AZLA 3EMVA 3WJAA 1J5XA 2H7XA 4L27A 3GL9A 4O4HA 4RANA 1PTJA 3MS2A 1CXZA 1E7SA 1J9ZA 1DC8A 5B4VA 2OKGA 4AMZA 4U6QA 5TDHA 1UJ2A 1P31A 4FBMA 3DAFA 5CAEB 1QANA 1PJZA 1AK9A 1IIRA 4NOLA 2IYYA 4BJ6A 8MHTA 3I9OA 1L5QA 3Q3VA 4QGBA 4DV5B 3WP0A 2GBIA 1SEPA 3E9NA 5DT2A 2PNJA 5JR3A 3RS5A 1ID1A 3OP4A 1EJ2A 1JE1A 1OX4B 4CKCA 2PLRA 4XWTA 3VISA 2YHAA 5SY9A 4AN0A 1A8PA 3KZNA 4ZANA 4JYMA 1G5RA 1RE1A 4IDDA 3KR2A 2H1OA 1UJ5A 2OFPA 4RPIA 4EPRA 3ZV7A 1DB3A 4MIYA 3WIBA 2PJZA 5HQ3A 4TYYA 2OO7A 2ACVA 5M3BA 4J3JA 3RQIA 3S2YA 1FY2A 4GM4A 1CIPA 4H4CA 4RVFA 3WL5A 2AJTA 1FYVA 1C30A 5G3ZA 2IX3A 3D2BA 4CIVA 1TVMA 1FXUA 3SPXA 4NBSA 5KNLA 3AUAA 5TR9A 4XD7D 4CW7A 5HUHA 3M9XA 3TF5A 1OBFO 4MOWA 1F1BA 4Y0AA 4QTUB 3ZWVA 1T3GA 4Y2YA 3FCEA 2XCIA 4B7ZA 5BUQA 4U2BA 5GV7A 1A98A 3W7VA 2GN2A 1CQIB 1OFHA 1WX1A 1YFKA 3EIXA 4I4TA 4M21A 1M1NA 2NUPA 4O2AA 4TPKA 2IS6A 4REMA 2P79A 3M5DA 4GWGA 4IGEA 2OG1A 4MJXA 3TZKA 3AVTA 4ZZIA 3FSGD 1H3FA 3D2AA 1LK5A 4PC3A 1IUKA 1M33A 3O74A 3NM5A 4P2GA 5EXPA 3ZZ1A 3SX4A 2O2JA 1PEDA 2G8NA 1KAQA 4P3XA 3Q1LA 4W5JA 1NXSA 1DC5A 3IAM1 3PICA 3TQIA 4RTLA 5DEIA 1PR0A 3I61A 1JT2A 1KMHA 4WNYA 5KCMA 4GX2A 3U4AA 3PUZA 5FPTA 2CD9A 3OA0A 4ZWNA 2ZTLA 1U5CA 2NQ2C 2ODQA 2J0UA 3WWZA 2VDRB 5LU8A 1NF3A 2IYOA 1YIDA 3FDXA 3OJFA 1V8DA 2XIJA 3VO1A 1MX5A 2B0JA 2HCJB 2YHIA 1ZS9A 2HV9A 1X2BA 1WL8A 4KSYA 4XEUA 2ATIA 2IEGA 5LB4A 1TJ3A 4PAWA 2QRJA 1JHZA 3VV3A 2J0EA 3IDSA 3PXEA 3KE9A 1EXNA 3CEMA 2MMCA 1UZNA 1GZSA 1MTZA 3ORSA 4FN5A 5EVCA 3UW1A 5BMVB 4V24A 1KEWA 1WSWA 1WCIB 3PGKA 4ZV7A 1YFJA 2V8OA 2FE1A 3IELA 2YWGA 5DM2A 1JA9A 1MPXA 5J5VA 1RSZA 2PZGA 1HDCA 4DC1A 2GVDC 1ZRHA 3NHYA 4H0FA 2FP4A 4OAPA 1WPRA 2XE4A 4WN9B 4WZAB 3VVBA 2F43A 4AUKA 4FOOA 3ESBA 4CQNA 2NP6A 2V7EA 3ANTA 3TNFA 2OP0A 3LX8A 2P77A 1NY6A 1HFWA 2AEFA 4J4TA 2FQ1A 2R5FA 3C4VA 1NI4A 4J76A 4EA8A 3OQHA 4PZ0A 5KX5A 3W8FA 3P0HA 4ZVMA 2ZJ3A 1NMXA 5KNBA 3TD2A 2WMYA 1W0KA 5DN6D 3W77A 4LX8A 2X9LA 4QOFA 4OX9B 4U00A 1OJ7A 1G6HA 3RRNA 5D01A 3BAFA 1UZLA 3DV9A 3MJ4A 4ND5A 1VKNA 2VQ6A 5KJ6A 3MS4A 4RMHA 4QDJA 4QWWA 5FUBA 3WYFA 1SQ5A 2WIBA 1FFEA 4LRQA 1TIBA 3M89A 5A3VA 2I1LA 2UVPA 3CKLA 5G0UA 3AHEA 1GQRA 1SCDA 1UWLA 1R9NA 1P1CA 4UM7A 4FLEA 3ONFA 4UQOA 3ZKWA 4JZYA 4DNQA 4F72A 3O2QB 4ZGGA 2BFAA 4J1TC 4HT3B 5KKCA 4CEHA 3OCWA 2PX8A 1H5UA 1J2TA 4XM1A 2WG2A 1CY4A 1YACA 2AJLI 2FMXA 1HQDA 2VDWB 3CX8A 1OYVA 1E2KA 1GDHA 1L4NA 2CVHA 2O2EA 4EJSB 1OV4A 2QTAA 4HAXA 1CJMA 1NC3A 2ONYA 2UZ0A 3U4GA 4BVFA 3H3FA 2WINI 1OBCA 3DE0X 3K9QO 2CXXA 1U7DA 5G4KA 3ME5A 4RY8A 5DM0A 1G8FA 3B85A 1W76A 2JANA 5JXHA 1U3GA 1LSSA 1ZINA 1D1PA 3R6DA 1XALA 2ZRHA 5HRAA 1QUFA 1XI2A 2SKEA 2Z3WA 2J9FB 3L02A 5LZ7A 3RJMA 4P31A 1N3BA 4HAWA 2PJRA 1XHEA 1V4BA 3NRCA 1VKRA 1CUHA 3K6SA 4M0EA 2IS4A 1H5NA 5A71A 2HRZA 1USWA 2W22A 1ICEA 3QUQA 4FIZA 4IHJF 3RK1A 4DG8A 3E61A 4E4TA 5CA0A 1DC7A 3MXOA 1UKZA 4G5OA 1ITZA 2ZRPA 2YNMA 2VBGA 3G8BA 4OSOA 4QXPA 1F2UB 4RYDA 4YYZA 3T3OA 5FBWB 2XNSA 4ETWA 5IBCA 4ZVKA 3FOFC 1JJ7A 1KKMA 5ECYA 5AOAA 3W5UA 3K0HA 3ZD6A 2A94A 3ANSA 1G8GA 3OJOA 4D9MA 1NLFA 2IYQA 5FDFA 4DTIA 2D5IA 4JP8A 4HN2A 4LIPD 5LA6B 4TV9A 4BV2A 2V3CC 1Z5VA 1FE8A 1KC3A 4J91A 5AJHA 1BW9A 1Z07A 3F97A 4FNOA 4PHGA 2PGLA 3F5SA 4WZBB 4WE3A 4CM1A 3CB4A 3UV6A 1M2GA 4UUAA 1VYTA 2ANCA 5F7JA 2NSYA 1C8LA 3SVLA 1QJ4A 3N8HA 1X3LA 4P7KA 4TS9A 2L18A 3OFNA 2EGGA 4I1IA 1Z2EA 3H2SA 4Z54A 2F1JA 1ANKA 5BYKA 2A8YA 3QEJA 1CS4C 3UOGA 3B2NA 1D4FA 1SC1A 1U0RA 3PC4A 4XYGA 4BAUA 4C04A 5ULLA 2HQBA 3G1WA 2R6CA 4B40A 4DANA 4DJTA 5ERGB 4BNZA 2C7PA 1QIHA 1SCIA 3IQGX 1NOIA 2BBWA 1GGKA 4ALMA 5LR6A 4L9SA 3RJ5A 2RGYA 4P54A 1PJLA 1BU8A 5CK4A 3FB4A 4QYWA 3R74A 5AVVA 1N7IA 1IATA 2V3VA 2HK8A 2XDQA 3I8OA 1MO2A 2W11A 5FOUA 1XK7A 2HJSA 2RB5A 3ANNA 5A0TA 2X4GA 5ALHA 2RIRA 1XD2A 3F1LA 3ILVA 2HSDA 2CLCX 1GTJ1 3DNPA 2GVZC 2VDVE 2RHLA 3FHLA 1MIHA 4QASA 4D56A 5DF1A 2YZMA 4XUDA 3OECA 5K6RA 3EGXB 3S2ZA 2FN4A 1NQXA 5L3RA 4GBGA 2C3MA 3CR7A 4EHBA 1U90A 4QC2A 1K5DA 3O8OA 1T3LA 4P83A 2OZKA 1JR3E 1ST2A 2J3JA 3O38A 4E70A 4KSCA 5LLSA 2WVHA 3TOSA 5KB3A 3HA3A 1TO6A 5JI2E 2NV2B 5CEFA 3COJA 3QVXA 2FB9A 2D5BA 4NCHA 3WGHA 5K3SA 4AP6A 4DE5A 1DC6A 4NV0A 1IWOA 2P27A 1JDNA 1Z7EA 1NJ6A 2DY0A 5DBHX 5DYGA 3VPDA 5L4LA 1W2GA 3V7NA 3DUWA 2QP9X 2ET6A 4TTAA 2R4QA 1IJBA 3L7IA 2B4KA 4QU0A 1M8PA 1C3OB 4DSTA 4YPOA 2Q9BA 4DLTA 4KRGA 1A9OA 3FH0A 3OUTA 3G0IA 1FW8A 4CTOA 3M49A 4EATA 2P9EA 3GROA 3S81A 2VUIB 2L69A 4DGQA 5BSEA 4AUNA 4WVFA 4XJTA 5JJ5A 1DDOA 4H3SA 3W04A 5KS2A 4DVJA 2CVOA 1WDLA 1VBMA 2OWDA 3ZDZB 3QYFA 4N8SA 1VGRA 2Z5VA 3GLUA 1Z0KA 1P1FA 3ESQA 5GY7A 4ZK6A 4DWOA 2EARA 5JS7A 2PT9A 1QKJA 2G1UA 4R2IA 1S2DA 3ZDRA 4AW9A 1GP2A 4DHEA 3LECA 5K51A 1I13A 1KK2A 2AYXA 1NXPA 3QFRA 5L3SB 1L4FA 3BRWA 3GFBA 4D44A 3DEHA 3HK2A 1C4KA 4MZXA 3C5WP 4B6GA 4IIYA 1AA6A 3AP1A 3SYMA 5KVVA 3GLTA 1E62A 2GPSA 5CIWA 4EA9A 4DDKA 4TWBA 3NUGA 3RSZA 3C1UA 4DSOA 1HFJA 4P3OA 4ISBA 3QU2A 5ENZA 4TLLB 4F2DA 2E1PA 3U4QA 1UUFA 2AMJA 2LKDA 1YOVA 2WICA 5JSFA 5K05A 2IF0A 2BHNA 3Q0EA 3QVSA 4URHA 4WK0B 4EYKA 2WOJA 4I6GA 1P75A 1W4RA 4LMPA 2BP7A 4M0CA 1WPGA 3THYA 2W2MA 3M3HA 3GYBA 4FFOA 1XCJA 3WNBA 4CKEA 2O8CA 4HRYA 3MT8A 2YXPX 4DWVA 5CYGA 1J06A 4FFRA 5LSAA 5LXTB 2A2ZA 2PMFA 4Q19A 5E4YA 4F1JA 1Y9DA 1PIWA 4MR9B 1XZAA 1K6XA 2ORVA 3FVTA 1BG6A 3R8XA 1BDHA 2O8BB 2GF2A 3AC0A 1AURA 1C1XA 3OD1A 3M6AA 1AA9A 1EHYA 1YRHA 1RFLA 1PQPA 2QOEA 3L8EA 3RAJA 5ALLA 3S70A 4QPDA 1E5TA 4ZCPA 2NXCA 3D6MA 1VPLA 4I1SA 1G8YA 2QKYA 3Q41A 4OYHA 3CLTC 4RJKA 3RS4A 3UT5A 4D80A 2Z8YM 2B6HA 2QRGA 3D54D 4IQ4A 4TV8A 5EUBA 3V1UA 2I65A 4G1BA 1Z4MA 3T1HB 1X39A 1RYMA 4G5GA 4E31A 3WNQA 4US2R 4QOSA 5DWQA 5JMPA 1ABBA 5L51A 5F1OA 4ZKDA 5AW0A 1W1IA 3N9IA 1KE2A 3L1UA 1ZUNA 1GRCA 5ESDA 2ENUA 2JI8A 1SOMA 2NVWA 4MHOA 2AQIA 3BRSA 2PKQP 3C5VA 3OAAD 3ISVA 3RHFA 3WDMA 3QI7A 5IABA 3WYNA 1US8B 3SEQA 1GVHA 3KB6A 3UTCA 5LB2A 4W7HA 4RIEA 2EP8A 5K1ZA 3KQNA 4OXIA 4BP9A 1XQVA 2YFHA 4GI3A 4NATA 2H2WA 1W5BA 3HJHA 4AWBA 4QQRA 3CG0A 1XU7A 3MD9A 5JXIA 2KWIA 1KVRA 1VJTA 2X5JO 3W3AA 4MV4A 1WXQA 4PLVA 5E9WA 4B87A 3B51X 4PGFA 4KUEA 5CJPA 1FDVA 4P4SA 1RI4A 1T6YA 5HK9A 3TG8A 1C4WA 3FFBA 1V2HE 1NYTA 2DBVO 1C7IA 1T9GR 4XX1A 2QTTA 2F3PA 3FKSD 5CB8A 2ZUVA 5DU2A 4CU2A 1QIJA 1ULBA 1W5EA 4LZOA 4TQGA 2A92A 5KREA 2WKSA 3MMXA 3RC7A 1GNQA 4FFVA 2XUAA 3WGVA 3P32A 3RR2A 1U94A 4I9NA 4BFTA 4OQYA 2CKMA 4B3HA 2Q45A 1Z3CA 2WWGA 2XMGA 4CIAA 4JVSB 3GFRA 1AKUA 3IQXA 4MDYA 4AYXA 3CGGA 3FPKA 2AN1A 3K0CC 1TO1E 4PN3A 4D5GA 3I2JA 1XZFA 3K0BA 3FUXA 3HC7A 1TT5B 2PLAA 5C1IA 3T38A 4AT1A 3GOHA 3WIOA 3GCGA 4LEIA 1V1MB 1LI4A 1YBMA 2CMFA 4P53A 4DQVA 2IU3A 5LQSA 1ULZA 4B3BA 1HTBA 1B26A 2B4TO 4I5IA 4LXQA 3WLAA 3SDBA 2QW1A 3RYFB 1ZAYA 2Y0DA 2YJNA 3HLYA 4N0MA 2FEMA 2IPMA 3C74A 4NRDA 4YXFA 1N57A 4E30A 1FP1D 4F3YA 4KOAA 1M66A 1G20A 1T4BA 2YJTD 2GZSA 3CZPA 2XE7A 3QBVA 1SPXA 2B5WA 2GBCA 4KIWA 4ZA2A 5FL3A 1UIRA 4HNHA 1RPNA 2ATEA 4KQ6A 4ZN6A 1CY2A 3BJMA 4EGAA 3SE7A 3EXFB 2VYQA 4C2TA 3AR2A 3QTLA 4YP1A 1DKOA 3X1YA 5LMZA 4YONB 1ZLXA 2LUOA 3V5NA 4WDQA 2O2CA 4X60A 5IC4A 3NFYA 1C41A 3OWOA 4FCVA 5B4UA 1H94A 3PZBA 3RWBA 4DRXA 4CL2A 1TC1A 4WOBA 1F4PA 4DS3A 1DIBA 2ZB3A 1JLMA 3I37X 3O91A 3M4XA 1GKIA 3VOBA 5GTDA 1FDOA 1ZY2A 1Z6QA 3ZBTA 5FQOA 1OE0A 1MAVA 1Z0SA 2PZBA 1TVKB 5DXJA 5JPCA 1EFCA 4GZMA 1J39A 3JQEA 2NG1A 1GGNA 4DLLA 4TRMA 2H4JA 2H5LA 1EFUA 4PYJA 5A0FA 4YVFA 4LOJA 1MPTA 2LKCA 4GVXA 4I5EA 1U7PA 1GKKA 4DVGA 5CDYA 2FR0A 2HMSA 4YRNA 2IDKA 4KNYA 1J5EB 4HAOA 1BS2A 1Z2AA 2QG9A 1N3YA 3J81A 3R5TA 5DNDA 4R1MA 3PL5A 3AEKB 5TS3A 2JBAB 5EJEA 2MIIA 4BKRA 3TLCA 2FFQA 2J9RA 3RK4A 1RC8A 4LTMA 4CEIB 1Z18A 4X9XA 1VLLA 1RNLA 3VNAA 4YJ2A 1SMKA 4N40A 5T4FA 3HNPA 4CM8B 1DIGA 3C14C 3KZXA 1SVWA 3MJHA 3NP7A 4AJHA 4K6HA 3FZGA 1ZUWA 5BQFA 2XCLA 4HTAA 5AESA 2V7PA 1N2CE 2OZLB 2RHRA 5EJGA 4BO4A 3GA5A 5ANRB 1H2YA 2R751 3PS9A 1W29A 4CTKA 2BI7A 2MTBA 4DSUA 1ZU5A 4HB0A 4IR7A 2QLBA 1OI3A 3EB9A 3FWHA 1HDYA 1YQXA 3I6YA 4HSEA 2Y0BA 1Y8QA 2WG1A 5IF3A 4MVYA 1WPXA 1NBWB 3W5HA 3HVHA 1YGPA 1F2DA 2QX4A 5FI3A 3R20A 4MA0A 1DKUA 1GCUA 2SKDA 2WMOB 5KWSA 3LDGA 1PL8A 3R9XB 1YRWA 1I0LA 1U3TA 1CKEA 4F8EA 2B4QA 4ZEMA 1JQKA 1M1YE 5KU7A 3AI7A 4QDTA 4U7JA 3T3PB 1VZ2A 4FSHA 2WIKA 5AT1A 1CWUA 1HBJA 3N8KA 4J0KA 1YBAA 4M55A 2G6BA 4RQBA 1KH2A 2NPIA 3B78A 1WUTA 4DAEA 5KOYA 1BZYA 3Q2KA 5EZ6B 1E8NA 4U2CA 4FQ8A 4BE7B 3ND5A 1E63A 1U28C 2P9HA 3DP9A 4HWTA 1DIHA 1Y0BA 2ZPAA 5DIZA 1FZQA 4DQLA 1Q7RA 4IIXA 2BFEB 3WS7A 3LCMA 2HZ7A 3ZJ4A 1Z39A 3EF0A 1KYYA 1ZN9A 1KFCB 2J41A 2P7IA 3FI9A 3IAHA 4Y1RB 1X7XB 2EQAA 1YQQA 3TB6A 1TMKA 1JXQA 3EODA 3FZQA 4FC6A 1CEQA 1QYXA 3HWWA 4K28A 5HF9A 4MYRA 5IBRA 1ACLA 3F0TA 2IOQA 4FSXA 4IILA 1ZAKA 4OBBA 2O8DB 3ERCA 4L8GA 1O95A 3BSWA 2WHPA 2BI4A 1VYUA 4Q3NA 3FGOA 1E2FA 2IHZA 2O7VA 1RHQA 2B35A 2C78A 5G2OA 4TWAA 1USUA 2FH5B 3L0SA 3S2UA 3SCZA 2RC6A 4PG6A 3SIXA 4DUZB 1ORVA 1F17A 5HIMA 3KHSA 4DILA 1S89A 1UJMA 3TW6A 1DELA 4IIEA 3BJRA 5HCUA 4GMHA 3MM4A 5CU7A 5IEJA 2GARA 1X87A 4IX1A 5DVZA 3T7KA 4JBXA 5ALZA 4RLFA 2WDZA 2BI8A 3EZ6A 4CKYA 1W0CA 1U0JA 3GPDG 2Z6VA 1T9HA 3FMPB 2F9FA 5BSRA 3MZ0A 4I1PA 3WGQA 5AKLA 1CVIA 1O94D 2Z95A 2MOKA 1WJGA 1BMFA 2XUKA 3PGLA 3CZQA 1UM8A 2PBFA 2QNRA 4NJOA 1P2SA 2VDMB 4K05A 5TE9A 4NH4A 2VCYA 2X8JB 1E3WB 2JBWA 2FJ0A 2NVOA 4NNJA 5GAJA 1RP1A 1YASA 1BE1A 1ES9A 4DCMA 2I6GA 1HI9A 1I3MA 3TLKA 4RF4A 3CNOA 4IDNA 4HN4B 1T5LA 1PJ4A 3FAZA 4MO9A 5ELMA 3WGMA 4DA0A 4MIOA 4MCHA 4AG3A 5JNRA 4DV7B 3PDIB 1C4XA 1ZCBA 1UQTA 1OQAA 2X58A 5JMOA 5DM1A 1YFZA 4U2KA 1JR3D 1K27A 2C4UA 4EL5A 2Y05A 2VH5R 1ULUA 1PQUA 2R79A 4OV6B 3LYAA 4W1PA 3T9AA 4AXBA 2D2XA 1P1JA 4FDMA 4FHZA 3AOEC 5ICSA 3PQFA 1EGMB 4KYUA 4DIFA 3EDQA 4JMPA 2FUG6 2B92A 1YQDA 1VBKA 4GPIB 4YV7A 3C7KA 2QN2A 5TIIA 1DXQA 1WVMA 1X8JA 4L2IB 1L7EA 4UTOA 4P38A 3RVSA 5I9BA 4DC9A 3LBYA 3RNOA 5CBKA 2PUVA 3P5BA 3OLZA 1COZA 4JC5A 1XV5A 3E05A 2PX0A 3S2SA 5JDCA 1ECFA 4NYIQ 3TE7A 2AEMA 1ZVQA 2G9ZA 3GJ6A 3OC6A 4KXMA 4R81A 5EESA 3S99A 2R8RA 1KI1A 1QZTA 1KEZA 1R8QA 1NTOA 4KPUB 3OQMA 1M2HA 4N49A 1H3NA 1T4CB 2REQA 4Z7NB 1VIMA 3M33A 5E3HA 4Z0NA 1DO8A 3GUUA 2DPYA 4RPLA 3GLFA 2PS1A 1WW3A 3GT0A 1TPZA 4UUBA 4ITVA 4AJKA 3WBKA 1E3JA 2PA3A 4KXFB 1U04A 1WCXA 1T1IA 1V8FA 1MX1A 3CG4A 3JAWA 4OH1A 4Q9DA 5G1PA 1QSGA 5KTKA 4Q3BA 3L0CA 3BFXA 2X42A 3NEYA 1FNCA 4M9QA 5CNMA 3MJVA 2A9JA 1J00A 3PKIA 1ISIA 4U39A 1X6VA 1ARZA 2CJWB 4GHWA 3KVRA 4WINA 1L5LA 4ZI2A 4F84A 1Q0PA 4BXOB 3GFOA 5LA6F 4UUQA 3AVQA 4HX2A 2YVUA 3EAQA 4BJ1A 5MN6A 3FCCA 4QICA 2NNWB 4NY1A 2G63A 4LYEA 1XZEA 5G0WA 1Y7LA 3WYEA 4ERNA 4WBSA 2J67A 1Q50A 1RZ3A 2ONKA 3PNYA 2XECA 5IF9A 1U9YA 4RD1A 4BVGA 1R6VA 2GCNA 2XAUA 3NIBA 3QK7A 4IRUB 1H0RA 5KQRA 1TJ5A 5KO2A 2BUBA 5IM5A 3D6UA 2R1VB 4E4RA 3FWPA 4Z99A 3TLJA 2ZKLA 1SUBA 3W9SA 2QBYA 4OFBA 2IH4A 1OZ0A 3C15C 5CVTA 3CM0A 4Z2YA 1DCTA 2XB2A 5CYFA 5JC1A 1NY5A 4CT4B 2JLRA 4ZAGA 4OQXA 3JAKB 2WA1A 1JR2A 3D64A 3F9RA 1UJCA 1WMAA 3LUPA 1GADO 1QHNA 1E99A 3OQVA 4N8DA 4OA8A 3HI6A 2CDBA 4MP6A 1S2GA 4A2QA 4CLEA 4UNSA 3OA2A 1RXYA 1YB2A 3PWZA 3DDNA 1LFAA 3QBJA 1DLJA 4TMVA 2YYAA 4B2IA 1VL2A 1VDMA 3F5MA 5REQB 3I9V6 4B81A 1JZSA 3R9IA 2F00A 4ZDWA 2D3TA 2C7QA 1S0UA 2FSFA 4DIUA 3EYAA 4RY2A 2B1QA 4X66B 3T99A 1R7RA 2PL5A 5GM1A 1TAGA 5K3FB 5D3KA 3VH2A 4P22A 1MX9A 3ZY2A 4BQPA 4BX3A 3M34A 4FCCA 4AMBA 1UC5B 2J3KA 1E5QA 1T2AA 1E96A 3VC7A 3DD1A 1AHHA 1E89A 3KTDA 3LCUA 1OXKB 1LBIA 3NUQA 4V0SA 2H08A 5EKSA 2ACEA 3MJTA 2FW6A 2JGEA 1Z82A 4KL8S 3AL0C 1AXEA 1O87A 3F74A 4LJ6A 1U2DA 4X95A 1R8SA 3DW3X 3JD1A 5DULA 4RZXA 5FAKA 1MAAA 1ZA1A 2VAMA 2W0MA 4Q47A 3RANA 3OT1B 3E7XA 1AUXA 1JKFA 3I12A 4KN9S 1C1HA 4M9XA 1GRQA 3I1IA 5CA1A 4FR0A 2ZLBA 4L7VA 4R2XA 1U8ZA 1T1RA 1I80A 3SC6A 1RJDA 2A5YB 2WF9A 1DAHA 1K68A 3ONEA 4GKBA 3DTVD 2VQ3A 5DHAA 1E6LA 4L76A 2V9ZA 4NV1A 5TS2A 1RWQA 1G55A 2B7BA 3CSDA 4UU7A 5IHPA 1UFRA 2CYAA 4G56A 3RU2A 4IFIA 3OX1A 4FEAA 1YMVA 4A0QA 2YYZA 4BNYA 1D3AA 4XM0A 2NU7A 2P6MA 1S7GA 1SIWA 4URZR 2H59A 1FLVA 2QRNA 2ZIAA 1SCUB 3SOPA 5DWVA 2UZIR 4KIUA 1F7VA 1ZISA 4IL5A 2WU3A 1WM1A 4M0PA 4X7MA 1RKXA 5B7QA 1JEDA 5ESRA 1KEUA 4KNWA 5DHTA 1BYIA 3D2LA 4E1AA 2O0HA 3K0FA 1YZHA 1W2WB 3NIDB 1J1ZA 3R0ZA 4YREA 5CLLA 3ODGA 4WCFC 1Y1RA 5EMLA 4AD8A 1YZFA 4KLNA 4X0EA 1G0OA 1QS0A 2ZYIA 3LX5A 3U19A 2OZPA 2HA4A 5IVHA 1Z4PX 1J42A 3IOYA 5LBIA 2CK3A 4EHAA 3TVTA 1P77A 1XL0A 4WA8A 1TPYA 4DYHA 1K63A 1U5BA 2NYVA 3CUVA 5A9SB 3QEBZ 5ALKA 3L0YA 3EDOA 3LH5A 3NB0A 1REQB 4MLZA 4J0DA 1JN0A 2DB3A 4V0QA 4DDUA 1EFRA 3AFOA 3OU6A 4HB3A 4XRRA 4K86A 1A3CA 2ZJ0A 1E6MA 3IUEA 3LA8A 1JEOA 4YC7A 2CHVA 5LXTF 1XJ5A 5J2TB 5IBPA 4EYOA 4ZC1A 3BICA 3T5CA 4NQRA 4X20A 3EOZA 2I6UA 2W5UA 3CT6A 2WQZA 2BFWA 2PR2A 2ZVQX 1IOVA 3JQ8B 5ALYA 2VUSA 1TU4A 2WWRA 5TMPA 1JMVA 2Q0HA 3FGZA 3M6WA 4E12A 3W5SA 2VTKA 2H65A 4X6XA 1L5MA 2IZ6A 4XA8A 5J5AA 4N39A 2HU7A 1E59A 3I83A 1EQAA 2GNOA 4K6KA 4M87A 3L7LA 2RGNC 3FHCB 2HJWA 3ZY5A 4C88A 1S96A 1S1CA 2I80A 4UEJA 4NVRA 5C5IA 4LUCA 1CUXA 3FPLA 1M7BA 3IAS1 3K1AB 2EDAA 3QUAA 1YS2X 1AE1A 4FKBA 4JGBA 2M1XA 4RZSA 4AWXA 4ZOQI 4A15A 3PR1A 3NJ8A 1JYFA 1M34A 2BKAA 2QTVA 1ZJ6A 3GUCA 4OMUA 3ROEA 5AVRA 4U8HA 4Q4AB 3U16A 4EX7A 2NMVA 1F9EA 4FMCF 2X13A 1R27A 4HTFB 3E35A 2I1QA 3GLIE 3FYUC 1S8OA 2P91A 3VXKA 4KIJA 4TTTS 4UUPA 2X3FA 1Q3TA 3JRNA 4A8HA 1BDJA 2ZANA 4Q93A 2IZOA 1QORA 2ZSIA 1A1VA 4GE0A 4FK8A 4L5JA 4YAEA 2XI4A 1CLEA 1IULA 1H8HA 3A3KA 5BN5B 2JC3A 3CPHA 4QUIA 3SLRA 1O96B 3FHTA 5CLQA 3KJNA 3L0IB 1JAZA 2B8WA 4RY0A 1GTG1 1KR5A 3CV3A 4HG2A 1GQOA 4WFKA 4CIXA 4DR3B 3L49A 2V1UA 3ODPA 1LBTA 3NP9A 1Q0RA 3PTLA 3OLCX 3HH8A 5KNCD 3MJDA 1B42A 1C3LA 3I9MA 1N0HA 2X8BA 3WMGA 2F1OA 1Y8AA 4WXMA 1CJKC 5BNIA 4QHYA 2IW1A 1QR6A 3V1LA 4MS3B 2FCAA 2IIPA 3ZJ5A 2BF4A 1L6IA 3SC3A 5F2NA 4NMLA 4Q9LA 3D3EA 4TKUB 3RYIB 4B74A 4RPHA 1EWQA 3OJEA 2DTXA 3LUKA 5TQ2A 2GN6A 4G0ZA 1WCWA 5T41A 3WB1A 4DR2B 1YDMA 3ZVKA 1UBTS 4ZDJA 1E2UA 1EZ1A 1F6BA 3QE2A 4FGUA 4WERA 3I04A 3ZIUA 1LPAB 4NFYA 1WOYA 3EVZA 1IN1A 4NJMB 3A4NA 4CL0A 2HA6A 3DHEA 3HJTA 4DLZA 4IHJA 2AF4C 3WTBA 4R8RA 3JQGB 4WCVA 5AKGA 2EBWA 5KDDA 4UBOA 4AN4A 1IL0A 2UKDA 3A58B 1HT0A 1RXIA 3KQMA 3O3OB 2GO7A 3DMTC 1A2KC 1TNDA 1DOAA 1HY3A 2ZW9A 3H0CA 4JN6B 1YA6A 2H9IA 4MQ4A 4RNCA 2GTPA 4KQCA 2FW9A 3OP1A 4OHFA 4CQJA 3RVNA 1HT3A 1P4JA 2QUJA 4ZK2A 4PHCA 2XZTA 1G3QA 4G65A 3IUMA 1FTGA 1LPOA 1LNZA 1O6GA 1HA3A 4KJZA 3WNCA 3RYTC 2QE7D 3HKCA 3DYBA 2ZJ4A 2OQVA 1RYZA 1TA9A 4OOEA 5AHWA 5A03A 1T9DA 4KZKA 3W8RA 2QN7A 3Q0IA 4EG5A 4MPPA 5JYEA 1YR9A 2GD0A 4KFTA 5DTEA 3AV3A 5FLXA 3GBVA 4RQTA 3VKGA 6REQB 4F5WA 4R1UA 1Y7PA 2EJWA 3LT1A 4YCBA 1ZIXA 1QIMA 2HRDA 2JGLA 2K4MA 4R1NA 3OE5A 3QXGA 2YBDA 4QUJA 1YZGA 1E79D 1X14A 4MUIA 2BFFB 3Q7IA 4PIPA 1PL7A 2ZB7A 2J3LA 3WNZA 3B82A 2NU8B 4A6PA 4Z0PA 4UMFA 4BNFA 1D7AA 2V7VA 2FR8C 1VCHA 1KDOA 4F04A 4AF8A 2QROA 5HA5A 3ITEA 2PXAA 1L5WA 5CD9A 1VM6A 3I34X 2CLOB 3ASUA 3IGFA 3ANYB 2H3HA 3FTFA 3TLAA 4CPDA 3IAM6 3OPMA 3VC3A 2OFFA 5HQTA 3G9TA 1X7DA 4G26A 3PEEA 1L5VA 1YIOA 3ESRA 4ZPXA 3KQKA 1OVGA 1Z75A 2RGCA 1E7MA 3K35A 4NDZA 4ZZ2A 3ZNQA 5I6DA 4KOEC 5FWYA 4MRMB 2BEVA 3H04A 4RV4A 4AECA 4F4JA 1W35A 2H4HA 4DKXA 5BWCA 3M9LA 2DFPA 3A6HA 3OBBA 1CUBA 2OM2A 2KBFA 1VPWA 2QJTA 3ORQA 3QFTA 5JZOA 2W9XA 2MINB 2CNWA 1E0AA 4RIGA 1KK3A 1FSFA 3D0QA 2QM0A 4LE0A 2IX9A 4RKFA 1RKVA 3ENNA 2QRKA 1V6AA 1DS6A 3QKUA 5BO5A 1H1TA 3CPEA 4JSTA 4LXIA 4ALIA 4B33A 4BJHB 4N01A 4M36A 3EEFA 3HCNA 4IMIB 1KDYA 1Z7GA 3C70A 3HYSA 3IBCA 1YH3A 4JA2A 1U99A 3MWEA 2IS2A 2AFIE 3ZBUA 1Y4SA 5SZKB 3QMPA 4IIUA 3G2LA 3SC4A 3GZTB 1W8DA 1YDWA 3F2VA 4HXGA 5AW1A 4R8VA 4LDRA 5K9ZA 1X80B 1MB4A 1T91A 3L3BA 3LUDA 3ROTA 3NJ4A 3EGEA 4CIYA 5KTTA 2PUGA 1Q7BA 4JWTA 2VWPA 3UAYA 1BEEA 1R6XA 3CQ9A 3C3DA 3MPOA 5LMNB 1CUIA 2R8ZA 2RAUA 2R7AA 4Y2XA 1AIPA 3H4TA 4BUZA 5F9MA 1LX6A 2WAYA 4J90A 1F3OA 2DOKA 1JIJA 4GXTA 1BD4A 3UENA 3PHIA 4DPLA 1OLOA 2B30A 3HSYA 1NM5A 3ZZMA 4CQLA 3KEMA 1XRLA 2XYRA 3BL6A 3BGVA 3DF7A 4FGKA 4ND8A 4UUMA 4UU0A 4A92A 3MBKA 1GZ7A 3RVPA 3FDIA 4YRIA 3KU4A 4NAHA 3W2GA 2Q5HA 2GB4A 1Z8FA 2VDQB 3BERA 2ZRCA 4Q4JA 5JAMA 2FPRA 1NMSA 4F8JA 5BWMA 2GBLC 3OQIA 4IGIA 4I46A 3A2NA 3GJRA 1PZFA 3ORFA 4UQLA 2ZSBA 4L8VA 1U3WA 4HRVA 3SM9A 1TIPA 4BQNA 3RCBA 3PC8C 4LRWA 4NR0A 4FFSA 3THXA 1ODSA 4H1VA 2JFVA 1AMOA 3ZI4A 2DR0A 1K2VN 1R0YA 4AJLA 4E6EA 4MVJF 3B8HA 1R5JA 2XMBA 1W5SA 4I8DA 4LGMA 1GSAA 3HJAA 2G9RA 1UKVY 2C61A 1IHYA 1UKYA 2BZ0A 4EHLA 1L4YA 2AKAB 3ZVNA 2YDYA 1M6VB 2CV1A 3E5MA 4JBLA 1DBSA 3JQCA 3NJRA 4JLAA 5JROA 1H69A 1VIYA 5CGQB 4HQRA 3ZLUA 4AJ2A 2V9CA 3R7FA 1WG8A 2QI9F 4POOA 4MYCA 2EGHA 3WKAA 4QT4A 1YKSA 1ZJZA 2PGJA 1N4AA 1JIUA 4QXOA 3R9KA 1WHSB 2PO5A 1SCBA 1LDNA 4M8LA 2QD3A 4IJUA 2Z3VA 4KLZA 4M9SA 4ND6A 4ZT7A 4E3WA 1MZPA 4N3AA 4Q4DA 4AF6A 1G4HA 4FILA 3UXMA 4ZHQA 1KI3A 3DCJA 4Q3DA 2FOXA 3KZCA 3NTVA 2ZM5A 4YI3A 4Q7JB 1XQXA 1Z73A 2QGZA 1CR2A 1PD1A 4L0DA 5K0ZA 3QVVA 3UFXA 4C4YA 3DC2A 3G79A 3GJZA 1WZCA 3IEUA 1T0JB 2ASEA 4JQCA 3FYUB 1FYWA 1ZGGA 1MMFB 4KC0A 5BT9A 1YUBA 5CB4F 2CF6A 4B2PA 1N8NA 1EEXB 3CEHA 4RXTA 2HR1A 1BFKA 4ETNA 2HU8A 2V7QA 1DBIA 1M67A 2G9UA 2JAHA 3MTBA 5AI5A 2QX7A 2QLFA 4XQ9A 2HA7A 5F1KA 4AJ1A 1RAEA 1NLMA 3THRA 1PYDA 3BE6A 5J2UF 5J43A 1GFIA 1OPXA 2IITA 3CXUA 1K8RA 1ZO8A 5JO9A 3HYCA 1J0DA 1Y5NA 5AKJA 1DCMA 1PI3A 3TXXA 2H29A 2BR3A 3NWEA 4AJOA 1AV6A 3O8CA 4ACBA 4AFNA 3MHTA 4NHEA 2X8AA 4JP2A 4WSOA 4CT0A 4B0PA 4D81A 5K20A 2VHTA 2ZROA 1C1YA 1SQFA 3K8YA 2TRSB 5FRDA 3LKVA 1N6LA 3IDZA 3NVDA 5AOCA 3WDLA 1WXEA 2F8TA 2EIXA 1YZKA 4PRZA 5BRNA 1Z16A 4DNXA 3A37A 4TKZA 4WEQA 3R23A 1FA9A 1XVAA 2C59A 2NXEA 3C7AA 4HD8A 4M0FA 4LHYA 3MYYA 1XXHA 1CE8A 2ZREA 1PX0A 4EUNA 2PQ6A 3TQOA 3MMPA 4JI2B 3TZEA 1U80A 3ZDDA 3HCDA 1C9DB 3MT0A 1G4AE 5BN4A 4XGIA 4X1IA 1WTAA 3D4BA 2A6PA 2LV8A 2OV6A 3CGWA 3LZ6A 4PFQA 3NALA 1X7WA 1DJNA 1W0JA 2Z2IA 4FUTA 2N1BA 4O4JA 3X2EA 1J70A 3A0UA 1ZL0A 3DEIA 3P2KA 4LC0A 1XZBA 2IFTA 4JOCA 4QAJA 5CVEA 3HXPA 2MWMA 1TDJA 2BEUB 1EFLA 2GJSA 4BYMA 4L4RA 1DX6A 3MXTA 4KE9A 2ZAOA 3GEEA 3A06A 3E3MA 1ECLA 2FQQA 1D0SA 2HWYA 4P3YA 3V8MA 1FFHA 1E9BA 2ZJ1A 3K5IA 4KLAA 4GPTA 3EK2A 4P5EA 3PD1A 4OQ4A 5CIYA 5CP8A 4KIFA 4WKPA 5MGNA 3ZCPA 3DOUA 2W2OA 1ZRMA 3S8MA 2BFBA 1PO7A 1ODCA 4X71A 2XUZA 3G82C 5TB5A 3ENVA 4EVQA 2H85A 2J3EA 2VWQA 3X2SA 2NGRA 2YFQA 1IVNA 1VKJA 3CX3A 3H5NA 4OHPA 1QYWA 4TGLA 3GFFA 4O5OA 1KEEB 4YLYA 3ZJYA 2BE9A 2HJGA 4OHCA 1Z5WA 5NLLA 1GWNA 1G4UR 3DBHB 3FX2A 3LQKA 1HZZA 1WUHS 4QLOA 3UC9A 1EG2A 1ZGZA 3TPCA 4XIIA 1YDEA 2YWXA 1KL7A 4MARA 5FHQA 1YULA 4OUDA 2AZ4A 3E9DA 4Q9NA 5LOVB 3DM5A 1FNMA 3NDRA 4E1BA 1XK6A 3KCQA 3SNHA 3TVDA 3QBEA 2O3UA 2EKDA 4MV9A 4NICA 3UCXA 1V0JA 2R68A 2V03A 3G0OA 2FI1A 4BBPA 4MVXA 4BATA 5DM4A 1Y6ZA 5A02A 1WETA 3UMYA 4W82A 2PUFA 2HA0A 3QNUA 1C2YA 1N8KA 4ISCA 4CVNA 1QRTA 1T4DA 2W8BB 1KBOA 2IT1A 1R00A 4YRKA 3HYRA 2GCEA 1GFZA 1PS0A 1SCQA 2JK1A 5FPPA 1DDGA 5IJAA 3UF0A 1KSGA 4IFTA 1XEWY 3S7ZA 3TLMA 2I3ZA 1SRQA 5JJCA 3FVVA 4LJKA 4BRZA 5B55A 1O6BA 1GRNA 1KAHA 2GD1O 2HTFA 4CDMA 2JLVA 1E2DA 1QGYA 2R6AA 1SQ6A 3E9YA 2O19A 4C2AA 1CUFA 3RARA 1NXOA 4F3RA 1TLLA 2WV7A 1U7TA 5EG5A 4EGJA 1YJXA 8ABPA 2MHCA 2YX1A 1KR2A 1SM4A 2A4KA 3EWIA 3VOSA 3GUVA 2ZCJA 2FQXA 2O3JA 1UOEA 2IGBA 5ALRA 5AHRA 2MJLA 2X5OA 2WB4A 4N8EA 3EFOA 3HY3A 1RAAA 3CNLA 4F7DA 2MR6A 5FNVA 1I6LA 4Y30A 2JI4A 1LDYA 2ID4A 2FG7C 3CEAA 3OWHA 3LF1A 1W47A 2C84A 2Y66A 1MIOB 5L7TA 2I62A 5TNXA 3HJUA 2IKSA 1BHQ1 2P5UA 3GEGA 1ISFA 2J3MA 2HLDA 4LBWA 3ICWA 2I2WA 4C08A 1DTWA 1JHXA 3V9PA 5JAUA 3E9CA 3EZGA 1KVTA 1UAGA 2Q8NA 2CYCA 2QZJA 3D43A 4MUNA 3CFYA 2JAPA 3PXUA 5BXQC 3VTFA 1KSJA 4BRWA 3KDPA 2A3NA 1YA8A 4EKGA 3ZQ4A 3C8DA 3E7FA 5LPNA 4YB8A 2VP9A 3PJGA 1TZKA 1RKBA 5CG1A 3BJEA 4RFSA 3V4OA 3ZCSA 3NXKA 3EHEA 4MTLA 3DLPX 3ZYCA 3H1BA 2R3SA 1ZM3A 3A7EA 3I1YA 2XZDA 3H13A 4UEKA 2GXUA 1N6KA 1OOEA 4OMCA 1HPLA 3RU9A 3VI3B 4RLQA 5J2TF 1G20E 4GO1A 2HJ9A 1DWUA 2AFHB 4Y2TA 3MWKA 4C9BA 1V3UA 4B85A 4LS3A 3KQVA 4KAFA 5A6VA 3H18A 1E1QA 2WT9A 4KWEA 4UBMA 3FOZA 1DFHA 4ZIRA 3LCCA 1PEAA 1L6RA 3DNFA 4J3NA 3U9SA 4RQUA 3H75A 1F8XA 1Z83A 3C2QA 1GNSA 1J2YA 3NBQA 8AT1A 2HDHA 1JH8A 2P65A 5IN5A 1PWYE 2ZATA 4P4NA 5BW8A 1AMUA 5A4JA 4GICA 2PAFA 1ONPA 1GEEA 3H1EA 3KLNA 4UM8B 4JLBA 3G7SA 5SYNA 3EFEA 5KNDA 3KSBC 3L92A 4YA6A 3PWKA 1PW5A 5E6SB 3BMNA 3WLSA 1CEEA 4RJ2A 4DLWA 4WOPA 1HLPA 4B83A 1POXA 5DB4A 5DLQC 4BX0A 3NWJA 2WLTA 4GS5A 4BX8A 1D1TA 3UWOA 4C4RA 4F9FA 1U2GA 1JZQA 4L15A 1Y1TA 2EJVA 3PITA 3N3BC 4I9UA 3FGPA 2DPXA 1E69A 1FTYA 4DLBA 3V46A 4N5MA 1OROA 1U0HC 2I3DA 1B8NA 3NM4A 3N59A 3AHDA 1CF2O 3I72A 3NWOA 4GMGA 1MGPA 4OO3A 3OU7A 2ZE6A 4O29A 1T5HX 2JVIA 4MQFB 5AVUA 1A9ZA 4FGSA 4WNIA 5D7BA 3A25A 1PNTA 3EY4A 2ILTA 3SE0A 4A91A 4KXVA 1T5BA 2IW3A 4FLFA 1P3Y1 1YJCA 4LE2A 5DM60 3OOJA 3ZGNA 2QT0A 4RE6A 2WYIA 5HP4A 1WMSA 2JKVA 3T0FA 1PD0A 1W0KD 1TTHA 1UXIA 2C97A 3GDGA 3IO3A 3TMKA 3TM4A 5BUCA 3BIWA 1FRZA 2PBRA 1G6KA 3CLKA 5KI6A 2RI6A 3AF5A 1G0NA 2VT2A 1D0IA 3F3YA 3NBYC 4C7OB 5HCNA 2J0VA 3UAZA 1U0NA 3T5TA 4QELA 1G3IA 1H6AA 2MDTA 7GPBA 1HV8A 5E7QA 3U6KA 1LQTA 1T5TA 3FUVA 2I2XB 3I32A 3BGWA 3KQPA 4X45A 5JNVA 1XF9A 2O54A 3U62A 3MYRA 2IF2A 3U4CA 2MCFA 2X0EA 2FWRA 2JI7A 3EG5A 1O7JA 4J2TA 2X7XA 3C7TA 3I0NA 3LNTA 4NCXA 2HAEA 3IKLA 3VVMA 1MVLA 2IUTA 4MQUA 1LVHA 1QHGA 1U9IC 3A9CA 3ZXXA 4YCCA 1B1CA 1Z6AA 5KYVA 4ZJYA 2ETXA 3DZKA 521PA 4M53A 1LUAA 1BKDR 4NOKA 3OOSA 1EX9A 4WPGA 1EA7A 2D8AA 4JA0A 5AUPB 3WYCA 1QVRA 4GPZA 4NCNA 2WU4A 3WFJA 5GONB 2BISA 4YCNA 1MG0A 2I99A 3OZTA 1KBZA 1KZGB 1U2EA 4JLDA 3TI7A 3INTA 3SVTA 1MHTA 1NQWA 2X40A 5DCWA 5DLDA 3C43A 3G2QA 2IPAB 2OXEA 2ONZA 5THQA 5AW7A 4N3BA 1WHTA 3GZ4A 4JLUA 4JQOA 5AK4A 3TD9A 2GSWA 3KJQA 3UCFA 5IWCA 5IZCC 4YRQA 5ED4A 4FDLA 4FX2A 3PNQA 4C21A 4JP3A 3ESZA 4MVJM 3EPRA 1N2OA 3G23A 3TLYA 2ZETA 4B4KA 5LQMA 4B3IA 4FE4A 721PA 2PCJA 3RH0A 2PXXA 2R7NA 1X42A 4I2NA 3H19A 3IP8A 1V4NA 3ZHTA 4MUJA 1Z6PA 2XRMA 2HZBA 3JALA 4JBNA 4QFBA 3T1QA 4BNHA 3KQHA 4CCWA 1KYXA 3KEQA 3UB4A 4UJ3A 2OG2A 3PNPA 3TYXA 1KKLA 1T0UA 2FZKA 1JQEA 2XIQA 3T41A 3ZCXA 3ZZTA 4R1SA 3N2LA 1KSHA 3LUGA 4HAUA 1NTRA 1BX1A 5DHUA 4PYKA 2YV3A 4WBXC 3HKBB 3T9FA 5F52A 3ZW7A 3OZVA 5JQGB 2OC4A 1L5GB 4NV3A 1I32A 5HW0A 2OBFA 4CMHA 3RYHA 1YKGA 1IB6A 2P6RA 3L6BA 1XF1A 5ER9A 1QV9A 3K70B 1E6EA 1FVOA 2D2VA 2JCGA 3DZIA 3C5EA 4FJ0A 1QTIA 1KI9A 4KODA 3H99A 1FFSA 1XLTA 1B6RA 3QXXA 1XZKA 3MCUA 4HB2A 1E2LA 1VHTA 3K05A 1QOZA 5F3RA 4CUZA 3KSAC 5DX8A 1ZC4A 1KMNA 2EEZA 1ONNA 1PR3A 3G17A 4QIHA 4YP9A 2QVYX 3CLVA 4EYEA 2P3SA 4HNUA 4V38A 2KMLA 1KWGA 2P2GA 2OPBA 1Z68A 1XYVA 3QLJA 3K9WA 3RHZA 3B3QA 4MI1A 5B3KA 4PBSA 3EW7A 1N2ZA 3D8TA 4TS1A 1E60A 2APJA 1V9SA 3A4TA 1SUCA 4TZKA 4ZO7A 3CVXA 3LSYA 1Q6YA 4ND4A 1G6Q1 3DUFB 5IARA 2CNOA 3MAGA 3P9ZA 4PPFA 3BUSA 3SSNA 5I5EA 2AMFA 3BX1A 3SC2B 4L9AA 4E51A 5KTYA 2XA1A 3A7DA 2FWAA 1SXJA 4OGFA 3RF6A 3KM0A 2QL7A 4DV0B 1LLQA 2LP4Y 4BLQA 2Y1EA 3U7QA 1I9CA 1NPDA 4JI1B 3SHWA 4ESVA 3NWPA 1TAQA 3GCWA 1M2VB 2H54A 4WGGA 5EXTA 4YCLA 1L2TA 2HWKA 5J4HA 2HCBA 1D2AA 4FOLA 1GG5A 2WAOA 3DAHA 4ZEOA 4HBGA 2X9NA 1E4EB 2B8JA 3KUKA 1UEIA 2YWRA 4HS9A 4RVUA 4CM9D 3OIGA 4IF6A 2HT6A 2GYWA 4Z7QB 1ZITA 2XKBA 4UOQA 5EXXA 1AUQA 1ZM9A 2QMEA 1J2RA 3AERA 4DRYA 1FIUA 3DCNA 1UFVA 2PA0A 1W46A 1ZOSA 3C3KA 4F6LA 3LZCA 2H4ZA 1H2RS 5K8TA 1FYDA 2AG0A 1O5OA 3COYA 3JD3A 4KXXA 4MULA 3SJAA 2QUIA 3VR6H 4BFLA 5AUQA 2E21A 5ELLA 2LCFA 2OV8A 3B6JA 1IN7A 3ACDA 2HJRA 1BWSA 4FZRA 3SX0A 5K4GA 2EFDB 3AXSA 3SMVA 2Y1CA 4O1IA 2AYYA 2QM7A 4F92B 1UXOA 1WMBA 3C4JA 3LRXA 4U2DA 2PZLA 2GZDA 5JS2A 2PX2A 4IQ8A 1K66A 5J1SB 1UK8A 1JQBA 2MSCB 2VJOA 3AG5A 3EDMA 4HO1X 4J4BA 4L6IA 3BRWD 5DHQA 3FG9A 4FOPA 4G2TA 2CXNA 1ZCAA 2GKOA 4K46A 4YT5A 4FFNA 4MRSA 3PDUA 3T4UA 3RK0A 1TLTA 1PR6A 1NOJA 2PM8A 3WJ1A 5AW3A 1X7GA 5KVSA 2CDAA 2AJBA 5CYPA 2W37A 4N0PA 1AGPA 1A9RA 3HBMA 2UZAA 4C20A 4YY3B 2WHYA 1OZHA 2JJ2A 3SI7A 3WLHA 1FJHA 4RPGA 4B4WA 1U0GA 1G1MA 5TEVA 2ONJA 1GZ5A 1M1ZA 2LCIA 1RHUA 3B7GA 3PHLA 4JODA 3WSWA 3OKFA 3HJBA 2ZVDA 5CLIA 1NP6A 3EXIA 5GOZA 3RFUA 1F1JA 1QC5A 4JJ6A 3S0JA 4ZEVA 3ADBA 3KWMA 1D0VA 4IMJB 1HQYE 1KRWA 5EIOA 4H1WA 4ZYVA 4M6WA 4HLNA 2Z98A 2AOTB 1D2GA 1EG7A 3I64A 4BNUA 4V03A 1F3LA 1Q84A 1X74A 4RTOA 2PX6A 3TECE 3TOVA 5BPHA 5EQJB 3I3SR 1DEHA 4IOJA 4YMUA 1JVNA 3HN2A 3ZIAA 4DMGA 1I4TD 1ZRNA 3FMFA 4X41A 2LRHA 2NO5A 5C1OA 5EINA 2YWBA 3ICPA 1M54A 1BXKA 1MX3A 2MMGA 5TX7A 4RV9A 2QLJA 4YRMA 2JHCA 1O9HA 5EWMB 5SV2A 3E2IA 4DQ0A 2C2GA 1HT2E 3VOTA 5MN4A 3L43A 4WLOA 1RIFA 9MHTA 5AI9A 4DM7A 4OG2A 5HZGA 5K3DA 4HJRA 3H5AA 1S3FA 2UZ1A 1NP7A 4UHEA 5C4IA 5ES3A 2YL2A 2CLFB 2HCFA 4GYKA 4WUTA 1T8UA 1BC5A 2OCBA 3NIWA 1T6NA 3L8MA 4EKNB 4F5YA 5J5CA 1V43A 4MB6A 5IAAA 4RORA 3IKJA 4HVTA 4ZYXA 2PEYA 2X2PA 1PNVA 3IJRA 4WKBA 4G1VA 4Q6WA 4YT8A 2XV1A 4OL9A 1B7GO 3A4YA 3ICVA 2CT8A 1AG9A 3ROGA 4ZAZA 2Z4SA 3R3VA 5LYJB 1BD3A 4ZOBA 5FTWA 1E92A 1GL7A 1NUTA 2BHLA 3AUYA 3AKEA 1MAHA 4K26A 4TYPA 2XUDA 5YASA 3CW2A 1T8SA 2YVAA 2CC2A 4RGYA 2B9VA 1VFNA 1PKEA 5E6RA 3D1VA 3MTQA 3L06A 3RS8A 4XWOA 1XA0A 1JI3A 4XFDA 1XRQA 1UMBA 3AEYA 4EW3A 2QAGC 1B23P 3R44A 1OI2A 2RB4A 5LQDA 3O8DA 2J4DA 4MKIA 2YUIA 1UBKS 5C8YF 2C9CA 3SF8B 2CUKA 2E49A 4NABA 1U31A 1RRPA 2GPWA 2H7CA 2P1DA 1QO7A 2ZYWX 1DC3A 3GVXA 2ZIZA 3OZSA 4RIIA 4WNAA 3VH4A 3BE8A 3I4CA 2W00A 2FRDC 3CCCA 4RF3A 1KVQA 4MQBA 3DE3X 3ZWKA 4ZOLA 2XQJA 4R71A 1UODA 4HNTA 3B36A 3EEQA 3KS9A 1XJQA 1VIVA 4PHFA 5EQDA 3ETNA 1YU6A 3UWPA 4WLNA 2E6KA 1JXMA 4R69A 2BGMA 1A95A 4YDHB 4BUCA 4EH1A 1JTEA 1JTVA 1K7SN 4CQMA 2Y1OA 3T12A 4LECA 4PPYA 4TL6A 4PIVA 4GE3A 4QOIA 4Y7CA 3ND8A 4AMYA 5J4VA 2HWUA 4QU5A 5H68A 2IV2X 1DO0A 1CR1A 2YXLA 3R5JA 3RUIA 2HRCA 3DMYA 1II8A 1NATA 3LOPA 4HNQA 4IGFA 4DIEA 2P62A 2OLJA 5BR7A 5I7WA 2FEPA 3O1HB 4P4UA 2R48A 5E9AA 1WF3A 2P2CA 1CYEA 1SUFA 5JO0A 4RDXA 4MPRA 3I05A 3PXBA 5K4HA 3D81A 4E2YA 3EWAA 1KOFA 3H11A 4FJ1A 4WJKB 3WLIA 1UK6A 2WUGA 4CNQA 1TM4E 4BU0A 5LOVF 1M0SA 5ELXA 1X8KA 3H7AA 2Z8ZA 3NTUA 1RU3A 5AVZA 2WZQA 1SC9A 3QENA 4K81B 4KVAA 3AIIA 5DFAA 4ZVOA 1CR6A 4UPEA 4PNPA 3WXMA 1J20A 1O89A 4FDTA 4LGCA 3W2TA 3DGFC 3AWIA 4LY0A 2WHXA 4U6SA 1CUYA 3MUEA 5DGXA 1YZTA 4HH4A 4JIMA 4ZYWA 4JNKA 1UCFA 1Y1QA 2Q6LA 3DTVB 1VSQA 3EZNA 4RYLA 2AC2A 3R40A 2AFVA 3BIFA 3B9BA 3GIWA 3E3LA 3MLEA 4OHWA 1SA0A 3RS9A 4X7RA 1P2BA 2GPJA 4C6TB 4ID3A 2IEZA 1J8FA 4HZGA 1Z56C 3JTMA 4OJQA 3VZQA 4M98A 4GXQA 1J33A 1QAMA 5KYGA 4GOND 4Y2HA 3WQBA 1HG0A 4NYJR 5DK4A 2M98A 4XX0B 1P0FA 2OBMA 2VH1A 2WPDD 3O8QB 3OTWA 3NDBB 1E9DA 1D2NA 4PQFA 1OT5A 2CXTA 3SJ7A 1NYQA 5HGXA 4WK2B 3WFZA 1W88A 5ITZA 3Q3CA 4KUHA 4HUQA 4BO6A 3OSZA 1BDIA 4M9RA 1BH6A 4F1WA 4XAQA 2BSQA 2Q4DA 3LQRA 3I2IA 3U31A 4FEEA 4A0SA 2GCOA 4OJMX 1TF2A 1EB8A 1GV1A 1W30A 1BJTA 1ZICA 1WU7A 2YCBA 3SDZA 4DV3B 3IAS6 3H5OA 3PTAA 5H16A 2LR0A 4CLDA 5AKYA 3F5QA 2YQ4A 4F86A 1M1XB 3TS1A 2J9YB 4LSWA 2ZR9A 1T8PA 3LGAA 3W8DA 1RBYA 1ZXBA 1TKBA 2I6XA 2W71A 2BM8A 3C45A 4W5HA 3A2MA 3PP8A 1P6UA 4Y2UA 1HZJA 2Z0MA 5EMJA 2BOVA 2V54A 3REGA 3BJIC 3R6WA 5P21A 3DKRA 2PMWB 4DCOA 2YWEA 4ZGWA 3HDTA 4NULA 4R0VA 3NBFA 4PYMA 1NVBA 1EU1A 2V1XA 3KZOA 3L8DA 2M6RA 4ESHA 2NZXA 1PS9A 1IM8A 5T64A 1ZD2P 1ZKMA 1WA5A 3BA1A 2BDUA 2BTOA 3EULA 2GDJA 2QPAA 3VPFA 1NBIA 5EI5A 1A27A 1M2NA 1P0MA 3A9RA 3H9JA 4JBYA 4PAMA 4HSGA 4Q3KA 1F6WA 1FS5A 4U7HA 3PQ6A 4LYDA 1Z2DA 2F8LA 5B58T 5CFPA 4BTVA 5C51B 2VQEB 1SHKA 4COOA 2E85A 2W83A 6CHYA 3S2IA 3LY5A 2JF0A 2ZCUA 1J0CA 2H06A 2VNAA 3TSAA 1M75A 1XTRA 3DULA 4GDMA 3OO0A 1XHLA 5H9WA 4KFCA 4RTPA 5IFLA 2TMYA 1U8TA 1B43A 1SR8A 3IQHX 5AVJA 1AY0A 2Y27A 4GC9A 4LZNA 4OK6A 4V0KA 1NGSA 2CNBA 3DOHA 3A27A 3TXAA 4G0UA 2PH5A 1APBA 4PO1A 3DQQA 4HDAA 1O95D 1OA1A 1JQDA 4OUKX 3ADOA 1QK3A 1ZN8A 5TGTA 2WSSD 4LRSB 2D74A 5JFOA 3N75A 1T6BY 3A1VA 4P36A 5H82A 5CB0A 5IANA 1N33B 1LFDB 4CLHA 3H8VA 3PEVA 3TUJC 1KKUA 1GCIA 5C31A 3E27A 1IN8A 3TXYA 1I6MA 1FS4A 2Y3IA 3FETA 2QF7A 2VAPA 3O0DA 2CJPA 4GEGA 4N6OA 2ZZMA 3KVOA 3CJRA 1XEAA 1PR9A 4BNVA 3KELA 1PJ8A 3OHMA 1ECCA 2W98A 2IYNA 1N1GA 1EM8B 1SUDA 2A9RA 2R1TA 2JFPA 4EVSA 4FZVA 4GBED 1ZL2A 2O5EA 1UQUA 2P8JA 2Y67A 1R2QA 1E1LA 2CL6X 3HSSA 5AM1A 1GGVA 3NC4A 4ESEA 4DOMA 2XVXA 2G4LA 1BGWA 1XTJA 3KDAA 3ZWAA 2Q07A 2QENA 5HR5A 4DM4A 4LF7B 1E5XA 2CCJA 4MPTA 3OKAA 3RTEA 1U0FA 1WXXA 3MHPA 1B14A 4JKOA 2FPGB 3U61B 3QWFA 3G59A 5CB4A 3MW8A 5FFFA 1NVFA 5AIAA 1XDUA 3A36A 3UC5A 1B0ZA 1FU7A 4BMZA 4Q4CA 1NP3A 4PO9A 2Z58A 1CUSA 3ZLJA 1RQXA 3OX4A 5J2UA 2OD9A 1C0IA 3KYIB 2H2HA 3IMFA 1BWQA 3WMWA 3NAQA 1ACJA 2CXPA 4Q1BA 5JNWA 1BMTA 1TC2A 3NV7A 4HY3A 4BMVA 3HJFA 4BBAA 1M1YB 1P73A 1K7YA 2BR4A 1K7CA 2OB2A 2Y4OA 5G53C 4JI0B 3LUBA 3WP1B 1K4KA 2AC4A 4I4TB 3TEFA 4D9JA 4QECA 4CBVA 3GP5A 5DX1A 2ZB8A 3EBPA 3FMVA 1E3QA 1I36A 5TXGA 5HKKA 1DV2A 1SQ0A 1Z38A 4GOOD 3RUAA 2NYAA 3TJRA 5C2JB 1BVHA 2G70A 3SEFA 4MROA 1EKXA 1FXWF 3LCRA 3KX2A 4I9GA 5F1PA 3WLQA 5EZYB 5JANA 1DUSA 2EJCA 1TM7E 3COWA 4Q5IA 2IDZA 4OIFA 1Q7TA 4EWLA 2GXSA 5DLPA 5IYZA 1ATIA 3I5MA 2Q2WA 1TMGE 2VUHB 2JZNA 2QG6A 2ZS7A 3NONA 4QQ8A 3ZD8A 1I01A 5B4TA 4HWRA 4PC1A 5BSVA 5M7EA 5T7BA 3MSXA 2CL0X 4YRFA 1SU7A 2RAPA 5C81A 5JW6A 4G0QA 5K8IA 2OKCA 4A27A 3P26A 2P6OA 3DOFA 5FTNA 4KRXA 1X3SA 1PTKA 3GJXC 2I8AA 4CI9A 4JXJA 3D6JA 4P4GA 3QV2A 2QY9A 3TGLA 1PJAA 3M0EA 3VVLA 2IQIA 2OV2A 3EGOA 5TT1A 3L1IA 1KS2A 3Q7RA 5EWJB 5IAGA 4L3VA 2IUSA 2QZSA 1NRJB 3IXQA 4WDRA 4M1QA 3D3WB 2FLVA 3LHIA 5HF8A 4YIKA 3PUKA 3L8FA 2EZ8A 1Y4ZA 2REOA 2H1RA 2X6QA 1I1NA 2HF8A 3A4LA 4MS1A 1AB6A 3P97A 4HQLA 4LVCA 4O25A 4I08A 1EUDA 1VB5A 2EKQA 1L5SA 1JG1A 1QAQA 3JATA 3NHUA 3ZJUA 3CMCO 2HBQA 2DR2A 2P9BA 2I71A 3DMNA 2M2IA 2PRYA 1Z34A 3HA2A 3EZLA 2ZR8A 3TZBA 4NNOA 4HRXA 5JQGF 4LYAA 1SC6A 1O0BA 3SSAA 4KGDA 1ICIA 1SOVA 3WB9A 2XA2A 3WMXA 4BB9A 4KGVA 3VPSA 4RO0A 1QE5A 3HB1A 4D42A 1ZVKA 1M72A 4Q3EA 4AKSA 1NW4A 3ZBQA 1Z0FA 3ITKA 5EP4A 4F91B 1PTJC 2CYBA 3KKZA 7ABPA 1PT5A 2B4RO 4UBLA 1UZMA 5JE8A 4J16A 5E2AA 4N54A 5JWHA 3QEMB 3QTBA 3T0IA 4LJRA 4B2YA 4U1RA 1VI2A 2I66A 3MOIA 4IM7A 3BN3A 2YIDA 3KTOA 3E9ZA 2GK6A 1MVNA 2Q7DA 3JQ7B 3G8CA 3NHPA 3RFFA 3W6ZA 1IZ0A 1MO4A 1VE7A 3BMQA 4PLZA 5C35A 5E38A 1XZPA 1Z4LA 3TIXB 3VR3A 3UMJA 4W9RA 2QT1A 2IV3A 5B3JA 5ICFA 1NUUA 1UKAA 1TM2A 5P8WA 2DRIA 4MJ7A 3ZQKA 2NZYA 3LBAA 4UEQA 4GXNA 5THXA 2F4VB 2LWIA 5BQXA 3PJEA 4A2CA 1ORIA 3KOYA 4B3SB 4DXDA 3OEEA 2Z6UA 4EZIA 1ECGA 1RPJA 4Y1GA 2NAFA 4PZZA 3N0VA 2FUEA 2R7LA 2YQZA 4TVOA 4EM6A 3FOCA 1U6JA 4Q1EA 3JQFA 1GARA 2YW9A 4RKWA 2QMHA 5E1MA 5CDGA 1AJEA 1RD4A 5AJXA 3E0QA 3F5DA 1KU6A 1KYVA 3C0KA 4LV6A 1H8ED 2CF5A 2QQGA 2Y8EA 3VAAA 3H1FA 1JX6A 2XLBA 1BCRA 3HCFA 1PJCA 4YRGA 4ZU1X 3HHEA 4QLAA 5KVQA 2VF4X 3UWKA 3K30A 2QAIA 1NNUA 2FJPA 2QX6A 5AI6A 4WXYB 1I7QB 5FHRA 3TCXB 2HU5A 2L17A 3WIEA 1LBEA 1NZJA 2PT7A 4LISA 1K0UA 2K5UA 3NGMA 3BWMA 3BZUA 3NANA 3LRPA 3GUYA 4W8OA 2H16A 5H3HA 3L7OA 4HB4A 4R6XA 3X2FA 2P1RA 3J81k 3JTEA 4G0XA 5JHHB 4EK9A 2OA0A 4FOSA 5KKAA 5KDOA 3SZ3A 1ND6A 2BM0A 3OMLA 1W59A 3AFHA 4YCMA 5I7VA 1XVLA 1TKRA 2ZRMA 5D5QA 4OA5A 3V7UA 4AG6A 2BFCB 2IELA 1W44A 1W4AA 3PVSA 3R3YA 4IOKA 2H9AA 3H17A 2BFNA 4YQYA 4MUEA 3AFMA 1ORRA 3E22A 3E5HA 3NCHA 4FONA 3S8YA 1RZRA 3DOOA 3IULA 1IBSA 1DJLA 2Z2KA 3H83A 1C2TA 1NF8A 3LTEA 2J5KA 2POCA 2CK3D 3AXTA 1NJSA 1K6IA 2HEIA 2VYFA 4NS1A 4N76A 3EVGA 4EHNA 3OFSA 3QNMA 1TZBA 1XKLA 4R4JA 1TD1A 2BT4A 1KO7A 4JWKA 1GVNB 3H9EO 1EP3B 3R7DA 2UUCB 1EFRD 4PQGA 2B2XA 1CUJA 3UT0A 3LO8A 2OXIA 4G3XA 5JIBA 2XDWA 2CFCA 4JH0A 2KLHA 3CW8X 1SIOA 3RVJA 1UFQA 2XEXA 2UYCA 1EX7A 5FOTA 3NG1A 3PUWA 4GLJA 3IPXA 4F56A 3DAPA 1U6IA 1KJQA 2W6JA 4LWZA 4H6XA 1ULSA 3K31A 2O2YA 3TTUA 1YZQA 1I3LA 2RK4A 3WLPA 5L3QA 1FP4A 1R15A 4W7IA 3PE3A 3NVAA 1SK8A 2P9TA 4P86A 3PJRA 1B4DA 2Z8YA 1XEXB 3KSRA 1N2HA 3A1UA 1EVYA 3IVGA 1HDIA 4AUMA 1JIXA 2XKJE 4W1SA 1JQ3A 4BVJA 1YWGO 2I4TA 3P94A 2LE0A 4LI3X 1N2EA 4YROA 3TUIC 1IN4A 1UPAA 2XSZA 3JASA 3LY8A 1H65A 4LYHA 1VJDA 4RZHA 4E5KA 3WRWA 3HRKA 3N2GB 1QH8A 2P9YA 2BDTA 2QT9A 4MWEA 4EJ2A 4JJIA 2JGAA 4EA7A 3PHBE 1OFIA 4KPYA 1JE0A 3DVAA 5DSXA 3SQMA 3AJEA 3L77A 2V6FA 1Y8RA 3DFUA 3E9RA 3FZNA 4N3NA 5EWLB 3UYKA 1L7QA 4R1QA 2G82A 4H15A 1IHOA 3RRXA 3WQRA 1QIFA 5K8UA 2HA2A 5CX1B 1DHRA 1N2JA 1V6CA 2ERCA 2GBGA 3DQPA 1WUKS 3HG7A 3HWX1 2H0RA 1H8HD 4OM7A 4RTMA 5HX7A 3NBXX 3PFWO 3HCEA 4BS9A 3LT0A 4F12A 5IU6A 5KEIA 3A1DA 2W6IA 3KYCB 4C0AC 5LYJF 2B37A 1KMQA 2DQYA 3WLRA 4EMUA 1CC1S 3N74A 4M38A 4YGXB 1OTYA 3EIQA 5D3MB 2C5SA 3G2MA 2IYUA 5BV8A 5KC9A 2I4LA 5AM5A 3E84A 3LVFO 4MCIA 5FYQA 1WNFA 3VBCA 1YVDA 4LKRA 4RK6A 5KYYA 1HH4A 1M2OA 3ZWWA 1YDHA 1AKEA 4Y2PA 3OLYA 1A5AB 2OENG 2Z9DA 4WADA 2PRSA 4XDZA 2I4RA 2VRBA 4LXTA 2IKQA 3GJ5A 5LZ8A 5HJ7A 3L5KA 2AI1A 1RAGA 2GK4A 2C29D 1ZOLA 2O7RA 3EGDB 3V8PA 1SHUX 2KSQA 4TKVB 3ROZA 2O0JA 4H3VA 1B0PA 4RK0A 5E2IA 1D5WA 4N82A 1ZIPA 4WW0A 1IG3A 1CJTC 2P3OA 1SOWA 1MB9A 4EG7A 1BAPA 3S1SA 4XWWA 1N2IA 1Q7GA 1OF1A 3GPBA 2AN4A 1Z9BA 3OM0A 4AC9A 5AJWA 4ARVA 3SG0A 4FVTA 4MCJA 4EVIA 1D04A 1TVCA 3QJYA 2GK7A 3GR6A 1LVGA 2VL7A 1D4AA 1TM5E 4MVCA 3UXEA 1AGNA 4AJJA 1KAMA 3U5TA 4H16A 4MUHA 2FPLA 3IR6A 2AOWA 3KTAA 4L28A 5LQJA 3PX7A 1FFCA 1ZNZA 2OB1A 2OHOA 2R2AA 3FPFA 3OCVA 5FNZA 5KSWB 1VA4A 2Q4TA 3WRXA 2BMJA 4MKRA 2NTVA 2BKUA 5F21A 1DPGA 4P98A 3P0JA 1KFEB 1X7ZB 3CISA 4R83A 5JXJA 1AQUA 1HOTA 3C97A 5J23A 1CNEA 4MWCA 4J7AA 1XJCA 2GEJA 1XRNA 3IBFA 2W42A 1P2VA 1Q0QA 1TK9A 3FLBA 2EZTA 4K3VA 5C0OE 3VHRA 1XX6A 4DDVA 2YJ4A 2C7VA 5IJZA 1L5FA 3QE9Y 3IIEA 4IQFA 1VLHA 2FF7A 1IY2A 1NU8A 2XMRA 2YR0A 3K6RA 2B0CA 4YQEA 5KOJA 1IPHA 1ZRSA 2ECPA 1IK6A 3M5WA 3S3TA 4IUDS 1ENPA 4O4HB 3OI7A 4TWZA 3IRVA 1BS9A 2WM3A 2AK2A 2QE6A 3P45A 1H2XA 3X1WA 3RVDA 5CITA 3CNQS 3L6RA 3S44A 1OFUX 4UKDA 4EPVA 1E2BA 2RGRA 5IXJA 1TF7A 3Q88A 4TSKA 3IRUA 2XWBF 5HS6A 1WNTA 2FN7A 3JCZA 4WK4B 5CMLA 2CCGA 3FTPA 3Q1KA 4RLSA 4EYQA 3TSWA 3VAYA 1E7QA 5KSYA 3OE7D 3TMYA 4J0IA 1NV9A 2JZOA 4US1R 3EDCA 1KI7A 4XD7A 2HN9A 1F2TA 3LUFA 3PT9A 3BIJA 5HQ3B 1QP7A 2PGNA 3P9XA 4ITUA 4QBIA 1CHNA 2K2WA 4TLDA 1GGFA 2NTNA 2P67A 4LXHA 5LQCA 2XZPA 3CXRA 2UUAB 2XF2A 3VH1A 5EC8A 1R6UA 1C30B 2O50A 1JU3A 2GJ9A 5EIXA 3K7EA 2CVPA 1YVRA 4N4AA 3ZLVA 1OY1A 3GGJA 4XDYA 2O8EA 3W2EA 3DZJA 4PRLA 3ZWXA 5LJLA 5KCZA 4GI7A 4LRUA 6ADHA 3BSYA 1ZLYA 1HSZA 2GUWA 3UFBA 4J0GA 2HI0A 3AG6A 1LW7A 1I6WA 1PGQA 1IXKA 3DT6A 1M1NB 2NUPB 3EFBA 3PCRB 3JWJA 4H4DA 3QFHA 4ZOCA 1T3ZA 2JVJA 3DAOA 5F3DA 3ILHA 3TINA 3ILXA 1QQTA 1XMSA 2VWGA 3PJFA 4D8TA 3D3JA 2YTZA 3EGVA 3UG7A 4BEJA 1IBRA 1ZG3A 2V5AA 2X41A 2DJIA 4KK4A 4MLCA 4P5PA 3AY7A 4OI1A 4AL4A 4WCFA 3TBFA 4B6PA 2FX3A 1KMHB 3PU6A 4EGQA 5JFGA 1JHRA 1E3EA 1PP4A 3F6RA 1Q1EA 3OFKA 5EIEA 1NDQA 9LDTA 3IE1A 2HMVA 4XPZA 4X44A 1KJJA 2J0UB 5JASA 4WLVA 4ZCQA 3Q9UA 5B30A 3MFQA 4TLMB 1N2SA 1ZH2A 3BXPA 4M54A 1OX5A 4OP2A 2YHIB 3P2YA 1P1BA 4R2WA 4XGQA 5KYXA 3WB2A 3WOVA 4PVCA 2VUTA 1JHOA 2F62A 1UDCA 2O9JA 1XVIA 1AGXA 4G97A 4Y67A 1WQ1R 2N9UA 5DCLA 3U49A 2GQ0A 5HJEA 1L4GA 2Q1YA 2VNIA 4EO7A 1U2ZA 1JSCA 2C7GA 2JL1A 2QR5A 1JJFA 1QG2A 1ZBDA 5HVNA 3AU8A 2C2ZA 4OF4A 1G63A 2PKWA 3LU1A 2F67A 3M2PA 5EE9A 4CKXA 1B8VA 2XBMA 4IAOA 2CBXA 5DYTA 1OXTA 3PLNA 2OFWA 2ZRJA 2RSLA 3OZFA 2CCKA 3KQLA 5CCBA 1L5HA 2C5FA 3KWJA 3NBAA 1UBFA 2FP4B 4AMUA 1KZ4A 2F43B 2FXVA 4IP0A 1MG5A 4MUXA 3DKIA 2NACA 1NSTA 3UZUA 5CW2A 1SK9A 5I3ZA 1DNPA 1YQWA 1NT4A 5CRIA 2MYTA 4B7CA 3WNDA 2RGEA 1HE1C 1NI4B 5KX5B 1MF7A 2Q4RA 2VPXA 3JRWA 3O94A 4Y6OA 1PUJA 3Q5GA 3WZLA 4OHYA 3H05A 4NH0A 1XCGB 5ENVA 4AY4A 5IKMA 4E2WA 3GGSA 3ITNA 4ZU6X 2YYSA 3U44A 5AK0A 2FWNA 1JKJA 1YUNA 3R09A 3IR7A 5EJ8A 5LQKA 2UVPB 3ETCA 1ODTC 2H7VA 3WMEA 4OKSA 4N9WA 2ADOA 3ZKWB 3KXDA 3VAZA 1GG2A 3WVNA 2X4LA 2WJJA 4LE1A 5LD2B 3O6VA 3IV7A 4CEHB 2DQ4A 4ZOAA 1XTZA 1SIUA 4UZFA 5EHNA 1V11B 1PV4A 4CFYA 1KXJA 1QIDA 2E5WA 3PI7A 5LZ2A 1JXAA 3NX4A 4ZT5A 2I7VA 3F67A 3IOCA 2IP1A 4Q1DA 4GM1A 5FR1A 5K0TA 3CE9A 1X19A 1F5NA 1SXJE 2IHJA 1CZNA 4OATA 3ZK7A 1CB0A 2O14A 3PUHA 2RBEA 3HY6A 3IS3A 2AZMA 5G4KB 2J85A 1PWXA 2X2OA 1YK1A 3EUFA 2Y9PB 1N1DA 1NE7A 3GAMA 1KK0A 1JAIA 3P4XA 1U7XA 2WU1A 3T5MA 3O1LA 4ZQHA 1DBRA 3K6SB 4JU8A 4ZO6A 5EZYF 2I7DA 3EVCA 1F4VA 1NXVA 3QKSA 3HV2A 3GMTA 4M0MA 4NZPA 2QN9A 5AUOB 5DIFA 5CA0B 3T94A 5AOBA 3V1NA 5B6IA 2C7BA 2Z3ZA 1SRRA 1LPMA 4FGLA 4O2AB 4I3HA 4YRRA 3OJWA 4ZVRA 2QY6A 4GH5A 3DTNA 3VR4H 4YRZA 5C8YA 4ZI7F 2Z57A 1EJ6A 4EQ6A 3CTPA 4HEHA 5KQSA 5LP1A 1XPJA 2VS1A 1LRJA 2YWFA 2FK8A 2IGTA 3PRHA 2VHQA 4QM7A 3FD8A 4DR4B 4TV9B 4B84A 2J45A 5CEEA 4R8KA 1CQPA 3BL8A 3SR3A 1BW9B 5JTTA 2BSXA 3BK7A 3OURA 4YMHA 1V9LA 2NTJA 2JW5A 1C8VB 3BCSA 3JU3A 5DYNA 3WSVA 4AZ3B 2ZE5A 1SB9A 1U9CA 3UOWA 1B76A 2N3ZA 4JYPA 4LXUA 5IMSA 2AG1A 2GI4A 3OUZA 1W0JD 5FA5A 1YR7A 1TCUA 4NENA 3AR4A 2BD0A 2GOYA 4MO2A 4TROA 4N5DA 1RC0A 4U4AA 5ED0A 3PGA1 3T4XA 3R4CA 1WW8A 1YZNA 2C5BA 2OCIA 1NNI1 4XWGA 5U4XA 3QKIA 4IDFA 4WIAA 2XA9A 1QKIA 1XTPA 4MQEA 4HLDA 2JGFA 3AB7A 1L1FA 2WWHA 4MWSA 1QQ5A 2ZI9A 1F2VA 4N1AA 3MILA 1M6NA 4JJEA 2XDQB 1Y5MA 1L7MA 1K7EB 1EFKA 2AB0A 3PWTA 2AHOA 2EX0A 3AR3A 4H0NA 4LRTB 1NW9B 2QIPA 3JVDA 4B0OA 2IH5A 4RVGA 4FB4A 2ALJA 1XD2B 3ETHA 3SIWA 4XUGB 5AOVA 5JS1A 1M8GA 3VZRA 2CJXA 3WO1A 3VUFA 1UFOA 1EFPA 1XKTA 2CFOA 3T15A 3X1DA 2JCVA 1YB7A 3KWLA 1OGIA 1XNJA 2DUMA 3F1KA 1H9CA 2DYKA 1PNQA 4X8HA 2IL1A 3WGJA 4ZMBA 1WEKA 3AM4A 3BYZA 1E2IA 3NBMA 4IIBA 3GFSA 2NM0A 1G2IA 1ZGHA 3O8OB 1EWYA 4NU6A 3IJ5A 2QDKA 3ROFA 3SYKA 2ENWA 4MVJH 1Q1NA 1XYGA 4B47A 1FFXA 1JB9A 2VDKB 2ECKA 2ZBQA 3ZK9A 2HKIA 1XGKA 4WOJA 1YTUA 4PPGA 4LDNA 4PX5A 1EE9A 3T5DA 2JDIA 1F14A 1WXGA 3NRJA 3ZXUB 1DMRA 3W06A 1ZHOA 5JAHA 2C7OA 2VZ9A 1CVLA 4IQ0A 3VU3A 5TPZA 1UJNA 2C1EA 1Y8ZA 4FWIB 1CT9A 3HFSA 2NX2A 4TSFA 1H4QA 4I9FA 3B9RA 2GEDA 3L7NA 1DAKA 3JYHA 4XRGA 4N9QA 4X8OA 2PSJA 1J1IA 3OTGA 1J0XO 4K1XA 4R2HA 2Z8XA 1TZ2A 4MV7A 4RA6A 4DNFA 2AF3C 1PT6A 2GLTA 4LFCB 1QGZA 2MSLA 2WJWA 1DAOA 2LIVA 3BF8A 3UICA 4DC0A 2BCJQ 4FMPA 3V8QA 4ENRA 2CLLB 4QGSA 3EHDA 3IVAA 3VHQA 5KYUA 4IY1A 3ZK8A 4DDMA 4IDBA 4OI4A 1DHTA 3UXYA 1QG0A 1T6ZA 3KZKA 4J0JA 4Z4EA 4O63O 2AS0A 4KN8A 3TZCA 1V5EA 1E5LA 3FTEA 3FWYA 2AT1A 2WMNB 3BTSA 2W2VA 5AKKA 2VHVA 3FWKA 3RIMA 1I4DD 1I4WA 2H4XA 5DTIA 4AO7A 1VMAA 1EDDA 4FDUA 3B6EA 4G86A 3REQA 3GLGE 1T10A 2R6DA 2VJPA 2P90A 3FUWA 3IODA 1BEUB 2BBOA 2PD6A 4XJVA 4WBNA 1QYVA 3U4QB 3BE4A 1YOVB 1TQDA 4RD0A 2CB0A 3VZCA 2NXWA 2XE6A 4AZ0A 2X7JA 4LYFA 2WJHA 1V45E 1W34A 4QBHA 1O95C 5CFLA 4UXIA 3THYB 1XTSA 1RJGA 2BP7B 3T1OA 3HEBA 1GNLA 1P33A 4CKEB 2O8CB 3QU9A 2UYOA 4I1OA 2WE8A 4GNRA 1CRWG 3DMDA 4RHFA 4L0CA 2PSSA 5BUSA 2A0UA 3DT8A 2V97A 4BAZA 1G3RA 3VNVA 4BMNA 4RL6A 3T4PA 1E0JA 3D7KA 1QRUA 1C1XB 1NDHA 3C1AA 1VCNA 1CP3A 4V3BA 3EZ7A 3VHXA 4AK9A 5FUXA 2D06A 2IZ0A 3PC8A 1R0KA 2R5WA 4XVCA 4B3RB 3NOOA 1HG1A 3V6MA 3WHIA 4GOJA 2E55A 1UIMA 1YAHA 4G5FA 5HMLA 1VECA 3Q3JB 3TW4A 3UT5B 4DCSA 4Z3KA 4LQLA 1XMQB 1Z8HA 5L7YA 1XEWX 4TV8B 2IODA 1PCXA 3K4QA 3OAAA 1SHJA 3HA5A 4OK3A 4A10A 1E1QD 1YD7A 4GBJA 4ILEA 4CM3A 1YCGA 3H4IA 4UBKA 3RRJA 3KQTA 1DPFA 4F3KA 3ZDAA 4OBWA 2JLAA 2FR1A 2O8NA 3AESA 2FVYA 2ZCVA 3NYWA 4R1TA 5DNYB 3QX8A 1ZUNB 1Q0UA 3GDOA 1JG2A 1OW3B 5SICE 2XOKA 1N1MA 3BILA 3ZCVA 4F7WA 4JXZA 3FGNA 1R3DA 1KY5A 1VQ1A 1U0EA 2FG6C 2ZWVA 3HM2A 2QSYA 1HT1E 3IUQA 4LCEA 1Z4KA 4C30A 3AFNA 3GVPA 4JBWA 3J7TA 3IA2A 3WISA 5J4YA 5I4KA 3MOGA 4KX3A 5DSZA 2DFVA 4KN6A 3DFFA 1ETHA 1F0NA 2OT3B 2WTBA 5CXXA 5A9RA 2I4MA 3FKSA 2XGGA 4RE5A 2DR3A 3P9RA 2SCUA