5A4IS

The mechanism of hydrogen activation by nife-hydrogenases
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
264
structure length
264
Chain Sequence
KPRIPVVWIHGLECTCCTESFIRSAHPLAKDVILSLISLDYDDTLMAAAGTQAEEVFEDIITQYNGKYILAVEGNPPLGEQGMFCISSGRPFIEKLKRAAAGASAIIAWGTCASWGCVQAARPNPTQATPIDKVITDKPIIKVPGCPPIPDVMSAIITYMVTFDRLPDVDRMGRPLMFYGQRIHDKCYRRAHFDAGEFVQSWDDDAARKGYCLYKMGCKGPTTYNACSSTRWNDGVSFPIQSGHGCLGCAENGFWDRGSFYSRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of hydrogen activation by [NiFe] hydrogenases.
pubmed doi rcsb
source organism Escherichia coli str. k-12 substr. mc4100
molecule tags Oxidoreductase
molecule keywords Hydrogenase-1 large chain
total genus 80
structure length 264
sequence length 264
chains with identical sequence T
ec nomenclature ec 1.12.99.6: Hydrogenase (acceptor).
pdb deposition date 2015-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
S PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 5a4iS01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 5a4iS02
1E3DA 3AYZB 5JSUA 1FRVA 1YQ9A 1H2RS 4IUBS 4OMFG 4UD6A 4URHA 1YRQA 4UD2A 3USCS 1YQWA 3ZE6A 4UCQA 1UBRS 2FRVA 4C3OB 4CI0B 5A4IS 5A4MS 5JSHA 4UEWA 4KL8S 3ZE8A 4UPEA 5JRDS 4KO1S 4IUCS 1H2AS 1UBOS 1FRFS 4KO2S 4TTTS 4KN9S 2WPNA 4UE6A 3ZE7A 3CUSA 1WUHS 1WUIS 4UCXA 3USES 1UBJS 4UEQA 4U9HS 3AYXB 4UPVA 5D51S 4UE2A 4UQPA 3MYRA 1UBLS 5JSKA 4KO4S 3H3XA 4GD3Q 4UE3S 5JSYA 3RGWS 1WUJS 4UCWA 1UBTS 5JT1A 5ADUS 5A4FS 1UBUS 4U9IS 3CURA 1UBHS 4KO3S 3UQYS 3ZEAA 1CC1S 4UQLA 1WUKS 3ZE9A 1UBKS 4IUDS 1WULS 1UBMS
chains in the Genus database with same CATH superfamily
2OUKA 1PTJA 1OU0A 2E4UA 1J9EA 3JZFA 1QIFA 1U2QA 2YNMD 1M2VA 2QVBA 2GRJA 2ZP1A 1YBAA 3WA6A 3WWCA 2EKDA 3PGJA 1Y42X 3O93A 3UMRA 3VGJA 4GBMA 3ZVRA 3GDOA 1MB0A 3E3NA 3PD1A 4K46A 3DDWA 3CUWA 1LDEA 1O95D 2H1CA 3AJ9A 1Z4IA 3CZ9A 1GU0A 3AI2A 3GYGA 4IFTA 4WFKA 5FOXA 3CLTC 1KKMA 2Y93A 4YDRA 4ZRDA 3L7LA 3CF0A 3AEQA 3PQCA 2O8EA 2GN6A 2MMCA 4KZPA 1L9XA 1WVGA 1ESCA 4NEHB 1P0QA 1IEXA 5C5EA 1TK2A 3NHLA 2EXXA 4BNDA 2FPIA 4HNGA 1JR6A 1DX4A 3DW3X 3IAHA 4J29A 4JMPA 3K5HA 1T0PA 3DL2A 4UU1A 5H3HA 1E3DA 1GA1A 2XDQB 4YJKA 1KJWA 4YJ3A 4RIIA 1U9YA 3HFGA 1LDYA 4WT7A 3OEHA 3KT3A 3TZCA 4EVSA 1E6CA 1E6MA 3Q40A 5B7NA 5IBQA 2NO1A 2X2PA 3OFNA 4C21A 5JALA 3P0FA 1PGPA 1FFGA 1HFKA 2DBVO 2ZTUA 4JGGA 4G0WA 3NUQA 1E20A 1V37A 2DSTA 4Z9FA 5EN4A 1BQ4A 3H83A 3T1VA 1UM9A 3OESA 4DCNA 5LQCA 2B7CA 3O8QA 5EJ6A 4CGZA 5IEJA 2Y9PB 1IM8A 4Y6RA 4LY6A 4CDNA 5L51A 2CVQA 2X4IA 1KEVA 3FE2A 2BWJA 1FUKA 2HJGA 3QVOA 4D02A 3M6LA 3AW9A 1W7AA 3HCWA 2FG7C 1UKYA 4IH4A 5BWOA 1ODLA 1N0VC 1RVV1 4EP1A 1KO4A 4H6PA 1YK1A 4RZUA 4A6EA 1GCIA 4BFUA 2J41A 3OTOB 4N54A 1ZOOA 3ZCPA 3A6LA 4L8FA 4HFNA 2XMDA 2WHPA 1F0KA 1G6Q1 4UVGA 1K1EA 1R8YA 4NYJR 3BIOA 3ZWNA 4D98A 4TV8A 4V39A 5CFRA 1GAEO 1H4SA 3HNRA 3HVKA 4K6KA 5H81A 1PYGA 2I8AA 4DCPA 1VC2A 2VSFA 3RUDA 4ZC8A 4PAMA 5K05A 3DGFC 2VNIA 1EVQA 2FJPA 4HZGA 3B6ZA 4NBVA 2QT9A 3AZPA 4EGSA 1AA6A 2ZTLA 3GJRA 5GVSA 2CVZA 4CEIA 4U9HS 2JLZA 2V54A 4M9CA 2OMEA 3O4IA 1E18A 1UBNA 3RHTA 4FYKA 4DC0A 5H9VA 2I5PO 3WI7A 1PK9A 1XMOB 2AG0A 3BSSA 2R48A 1QYXA 2QU8A 2OV3A 2W6OA 4NK5A 4TZTA 1SZPA 2WABA 2R8XA 1EJ0A 3NP9A 3RYCA 1X3LA 4F4UA 2D5BA 4L85A 5FQOA 4RTJA 4PC6A 3SLGA 3H5VA 1T4CA 1ZHHA 2O2CA 2W2XA 4PY2A 4HYEA 4RJTA 2N3ZA 1NQAO 2DU8A 2HU2A 3WTCA 1I9GA 1PD0A 1V11A 5GV7A 1CUXA 1IY8A 3OC0A 5HDBB 1ADJA 3F6YA 1KNQA 3PWSA 3GUZA 4UAJA 2I2BA 5BOSB 5BNZA 4L08A 1G3IA 3FKSD 1LRKA 2QXUA 5GVRA 3UOAB 4K3UA 4MGYR 4TGLA 2IYPA 3FLAA 3K0CC 1EWTA 1YB6A 5FYDA 2OFPA 4A4DA 1DG3A 4Y2UA 1NI3A 3WY9A 1OAKA 3HQ4O 1MB3A 1MJGA 2QUAA 4KGDA 5DCLA 3W77A 3MG9A 2EVWX 3G6KA 5I7AA 4B6RA 2SNIE 4C1NA 1RXWA 1DCTA 3VR3A 4CG0A 3D6NB 3G2LA 2YZNA 1SVIA 2ZSJA 2RKWA 3Q7IA 1J99A 2VOEA 5CHEA 3SXJA 1N34B 3P2OA 1KWGA 3U4MA 2NIPA 4FHEA 4ZVUA 1COWA 1EWVA 2W2NA 2YMMA 4QEDA 4HFRA 3QVTA 3A1UA 1E0AA 4DQUA 3AVYA 3TGPA 4YJHB 1ZCJA 4D8TA 3G2MA 1K4KA 1SVMA 1TW3A 4O4LB 2IH2A 1JIVA 2R85A 2XQGA 3ZCRA 2A86A 2YYYA 3CX8A 1HYBA 3MB8A 2G9ZA 3DPUA 1BAPA 1YKGA 4BMNA 1N3IA 3CEPB 4OU4A 3VYTB 4KU4A 3I6IA 2HLDD 3TBHA 2AWNA 5AUPB 4DAEA 3C4QA 4WN3A 4BQIA 4AZVA 2ATCA 2YOGA 3R0VA 4HNAB 4MEJA 3FZEA 3TECE 3UAZA 3A06A 4K8RB 3KSDO 2VFAA 3FETA 3WIDA 1R6XA 4F9GA 1FFDA 1BS1A 3UB3A 4YV7A 4HC4A 3TLZA 5L40A 3LX5A 2JGKA 3KWJA 3I01M 3D8TA 2GAIA 1JT2A 1I1QB 2RCYA 1QQ7A 4AL4A 1VFNA 3OMXA 3BA1A 1CZRA 3OZVA 3U17A 1IULA 2HF2A 3JD0A 3S8YA 3JU3A 1PWXA 1FSPA 4N7BA 4BN5A 1NBOA 3WLFA 2AUTA 2PZEA 2Q41A 1EUDA 5DP2A 3EEOA 4RTMA 3AG5A 2FX3A 3R5TA 3V8VA 4UE2A 4IXWA 1DBVO 3PPXA 4HG2A 1S3IA 3LHFA 2AW5A 4WXPA 4AJ4A 1WPGA 3CE9A 3HCFA 3A9SA 3V8EA 4CMKA 2F48A 2YWXA 3R7LA 5FWAA 4U4AA 3Q6MA 3WWYA 1KS2A 1B74A 4NJOA 4LDNA 4UC0A 1JLRA 3MWDB 2IWHA 1H2RS 1NXVA 2JAUA 4U2EA 3F46A 3R4VA 1LCIA 1PVDA 2YJTD 3OH8A 4N9QA 3VTFA 4D8UA 2BZGA 3NGXA 3WRYA 1EEHA 1GV1A 3T3DA 2O9JA 3BORA 3BHMA 4YT4A 5JRDS 3TW0A 3UF0A 4XIGS 3F78A 5EIXA 5EKUA 1EXWA 1NTOA 1ZCAA 2O3TA 4RY8A 5DF1A 4DTCA 2B34A 2I0FA 3H4IA 2WHYA 1H6CA 3GJ7A 3IEKA 5BV8A 5I7RA 3T1HB 4Y2VA 2EJCA 5J5VA 1M2NA 4NENB 1L5HA 1ABBA 4MWCA 3TO5A 4E88A 2BFDB 4NBRA 1LBIA 2P2NA 5BV0A 1NQ5A 4G8JA 3AVWA 4PO3X 4BWVA 1Y9ZA 1NW9B 3LVBA 3I4LA 1BG6A 1NJ6A 5E0KB 1CK4A 2WTEA 2V6BA 3NZEA 2Y77A 4OM8A 5ENZA 2FWAA 5F4ZA 1MV8A 1JXMA 1O54A 1O6GA 3T5CA 5AJUA 4WCVA 5LQAA 5GJCA 4F71A 4YPOA 3GGCA 4FOLA 4YRTA 5EUCA 2J30A 5JXGA 5CD1A 3OKPA 2RGUA 3D7RA 2VWQA 2OO7A 4RHXA 3W3AD 4E4YA 1JG2A 1O94A 5JY1A 2B21A 2FZ4A 4CKEA 2D7CA 3GZTB 2P9QA 3EXAA 4LQ4A 3DYVA 2C7QA 2JLUA 2EFHB 2XLCA 5HA5A 1E92A 2YJ5A 3CC8A 5DV9A 4ICIA 2ZAOA 5LR6A 1PR1A 3UNXA 4Q37A 3LO8A 4HAVA 1RYDA 1TIBA 1XAJA 4YUWA 2EBHX 1ID1A 3H9EO 2VSOA 3IR6A 4BNGA 3LQFA 5IASA 3VR3D 4BGIA 4TTJA 4Q39A 3RANA 3B9PA 3Q98A 3FMGA 3BL6A 1RBZA 3TLEA 2E9SA 5KNDH 2ZI5A 4YY3B 4DEYA 3EULA 5CCXA 1E4EA 5EHIA 5D87A 4UTRA 4YRMA 4ZJUA 4KXWA 4GUDA 3TLBA 1NMSA 2PMDA 2GILA 1QJ4A 5REQA 1UFKA 3OQ6A 3Q0IA 5HCNA 3IKLA 3FB1A 1XZIA 2C2XA 2O2SA 3LHKA 3VNAA 4CG2A 3TRFA 3WOVA 1P1FA 1FRNA 221PA 4MI3A 5HEKA 4TMZA 5AJTA 3IUNA 3Q15C 3RVLA 3OEWA 5H8WA 2QENA 5B4UA 1M5RA 5BN5A 2AX3A 4JK3A 1WCWA 2GJKA 1YAJA 4W8OA 2CV2A 1X19A 2PQ6A 4YRQA 1I24A 3DDSA 1G8FA 1GZ3A 2X6TA 4JI3B 1ZJWA 3K70B 1UM8A 3SZ3A 1JIIA 2UYOA 4B48A 1XQ9A 1HNZB 4QU0A 4LJYA 3C8ZA 1KOGA 1DQYA 1E2LA 1RWVA 2JNWA 2JHPA 2VHZA 2R4TA 1STOA 2XNSA 2J4DA 4YYZA 4YVFA 5C35A 5C8ZA 2JI4A 3E9QA 2F8TA 4KUGA 2VAWA 1VZ2A 2Y76A 5I51A 1V4VA 1I80A 1X8XA 3X0DA 2AZXA 1SHZA 1ZU5A 1P0FA 4Q1EA 2GVDC 5JCJA 4FQ7A 4GD3Q 3GG9A 1I3MA 3CCBA 4K26A 4JSYA 4KRGA 2C3MA 5L45A 1G8MA 3BERA 1W35A 4AAYA 3K6SB 4X1IA 4WFIA 1P1JA 4H7PA 4UQOA 4RQBA 2OZLB 2RGBA 4P0TA 4G65A 4EFLA 2XMRA 2W11A 4IHJB 4BE9A 4LX0A 5MFPA 5FFFA 4AG3A 4XM2A 3VPGA 2EAUA 4QPDA 2QZ4A 4WGFA 2NVWA 5DRTA 4IG4A 3KLNA 2VP4A 5G3YA 3RTAA 6ABPA 2F00A 1E5DA 2GS9A 3PF9A 3PC8C 4XFKA 4EO4A 4GECA 5BXQC 3S70A 5ALOA 4ZYUA 2XTZA 2J6HA 3QPVA 1NSYA 1EA5A 4YJGB 2JKYA 4NEGA 5D86A 5TF4A 2O1WA 3O2QB 3PNVA 3QXCA 1OUMA 5D00A 3MYYA 3SC2B 1X94A 1CQPA 1WCIA 3OTGA 1OGIA 1O3YA 3GRZA 3A6GA 3CXUA 3C3KA 1WW2A 4FT2A 3CO5A 4E5UA 3DTYA 4KC0A 1I36A 4MW0A 1JHUA 3BHIA 4DMRA 4F97A 1E3WA 5HQ3B 5LLDA 1P0CA 1P17A 2J33A 4FFPA 3C5HA 3SEFA 1PX2A 1HZZC 1TUGA 3DLCA 1ADCA 1DLIA 1U0TA 2ZI9A 2M6RA 3OU6A 4RKWA 4F6RA 2WQ6A 1E5TA 5KHOC 4D0RA 5CNIA 2P27A 1E2IA 3ND9A 1CQIB 1KZGB 2BRUC 3PG5A 4UUQA 1VJCA 1GCOA 1LVHA 3ANSA 4GKAA 6REQA 3WHPA 2JI8A 1BWRA 3EA5A 4P4TA 1LLDA 3AZQA 2AA3A 4OH7A 2Q6LA 4QOJA 1XLVA 3QE3A 3QI7A 3FTQA 2Z2KA 1W88A 4N5IX 2GA8A 3I45A 4XUGB 4D80A 1I32A 1PDWA 1RCUA 1YJ5A 2HD4A 4PHTA 4Y2TA 5EJ4A 1N0WA 2O6HA 3FCAA 2CXTA 3ROEA 3TBKA 4ABYA 1OF1A 3COVA 1PT7A 2QLMA 4QNNA 1UR5A 3ID6C 3O4HA 2CMGA 4EM6A 5HGXA 4CV3A 4Q4LA 5B1SA 3PRYA 4DANA 1GAJA 2HMUA 1GPYA 2B25A 1JQBA 2H16A 1ADFA 2KWIA 3EGDA 4MWBA 3C7DB 3ZDYB 4HAOA 4IX9A 4IV5A 5GIOE 1PGJA 1D2NA 5TPWB 4NOMA 2C57A 3H8JA 1N9GB 2Z0MA 3AOGA 3AY3A 4TX1A 4RF5A 1M2HA 1AQUA 1COZA 2YWDA 1M8PA 4HSEA 1XUOA 3AG6A 5HS4A 3OZXA 2CUTA 4M3NA 5EXPA 3LGAA 2O48X 1Q84A 4POOA 5E1DA 3QQPA 1GSIA 1F14A 5CA1B 2NW6A 3GH1A 2VDWA 3IA2A 4WINA 1O77A 4B80A 3QENA 3JRNA 3A8TA 4DC9A 2C94A 2JEOA 2J7PA 1RBYA 4KDEA 3MK31 4LRXA 4BUCA 2ZQ5A 2GEVA 4O6VA 3ZGYA 4DCJA 4B5LA 2Q7XA 3HCNA 4LJ4A 5JQWA 2EYQA 2NU6B 1O0BA 3A1FA 4UHEA 3TLAA 4DPLA 2AN1A 2NSLA 2FW1A 3IDFA 4I5IA 1NSTA 3IUEA 4CF5A 3P26A 1NFRA 3G8YA 4TPKA 5HIMA 5IK2A 3TH5A 1K6XA 4RH3A 1L4GA 1AS2A 1YDWA 2CB9A 5AW9A 4RPCA 1Z73A 4IJ5A 2G6BA 2DWQA 4B45A 3OY2A 2FJ0A 4D4HA 3O92A 2PLRA 5IJ0B 3G2OA 1IBKB 1L5FA 3KVYA 2XQFA 4ONEA 3S5UA 2ZWIA 4IO1A 1PO7A 4E7OA 1USUA 4PCAA 3HA5A 1HKUA 2VN8A 3HXKA 4JEIA 5DSZA 4BZQA 4F3CA 2Q2VA 4LRTB 4Q3NA 1R4NA 2I62A 3B1WA 4QODA 3CLVA 3IT2A 5TQ0A 5I48A 2I2AA 4PTLA 5TNXA 1TD1A 1VDMA 5JFTA 2YBEA 4CCSA 4BBJA 1OSNA 1R0SA 4W9MC 1G0OA 4TS1A 3WLTA 1UOOA 1ZKDA 4G4IA 1RZRA 4UREA 4D26A 2O7NA 2QV0A 2ZVPX 1R8JA 3FRHA 1JAXA 2PXXA 4IZOA 2PS0A 2WKWA 4IVNA 2ORIA 2HM7A 3R0XA 4FEAA 521PA 5IN5A 5K51A 3VH2A 1H2FA 3CKLA 4YJFB 1I2ZA 1T5OA 1ZIOA 4GNKA 3SHTA 3UWOA 1AKRA 4CM8B 4YJDA 2TSYB 5LSAA 2VAXA 5HQTA 5K8UA 4RD6A 3NBZC 4O4JA 3N7AA 5DYGA 3CWQA 3KK0A 3P8ZA 3ROXA 1DAFA 2GYVA 2V3WA 5ALFA 1GV0A 4RNDB 5CX1A 1VRCA 4JLMA 2E21A 4BNVA 4UMEA 2PKQP 2Z9DA 4KO2S 2PZJA 5LM3A 2FHSA 4A8PA 3R5SA 3I5AA 3WGTA 2W90A 5B57C 2AYXA 5H9WA 2EU8A 2QX9A 4N5LA 4JOBA 5TQ2B 3O4VA 1NUSA 3RODA 2XE6A 4NFLA 4P83A 3T9CA 4KP7A 4GI7A 1UMCA 3L77A 4JIMA 4MR9B 3M9XA 2D54A 1NKSA 2OAP1 3EVDA 4D4GA 1VLJA 4DA8A 4FMPA 2BMDA 5A2QA 4TSKA 2YCLA 2XCOA 1CUWA 3PI6A 2JAPA 3HB0A 5B1EA 3G0HA 2C9BA 2VBIA 4MR9A 2BRUA 5E9AA 2O59A 3ESBA 2QG9A 1KEPA 2XUDA 3ANLA 1ISIA 4NCJA 1XPOA 1DEHA 1VG0B 1GZSA 2ECPA 1CY2A 4MQLA 1EVYA 1ZMBA 1DAEA 2E49A 2OSVA 4HRYA 1OTYA 1Q50A 1JLLA 1Q77A 3DD5A 3K8QA 3MXOA 4MEBA 1VHDA 1CR4A 4KN9S 4MGKR 2ODTX 1E4OA 2DKNA 1GUYA 1IQPA 1QFJA 4HDRA 3JARB 1VJ0A 5KDLA 1SGWA 5LD2C 4IICA 2G9VA 4IMJB 3EWAA 3R8XA 4YNBA 3GRUA 2I1QA 3SZLA 3HN2A 2IYYA 2DCMA 3BCHA 1YR3A 2HJHA 2ZVQX 3CUEF 2TS1A 3P9ZA 1QCYA 5T4BA 2Q9CA 2VXBA 3PITA 1ODKA 2ZXUA 1O89A 2GZ1A 5CT5A 2I33A 4M1YA 3DH0A 5JFOA 4KFRA 4MIKA 5KAPA 3Q3CA 4YRCA 1BMDA 3GT7A 1P80A 3FYUC 4XD7D 3GEIA 3UC9A 1P4RA 4U3JB 1T4MA 1DXYA 2P11A 2CXUA 3BRQA 3DHVA 4OXYA 3OE7D 4LDJA 2ISQA 3ZCTA 4RVFA 4XH9B 4M0CA 5CJPA 2J5QA 2YJ3A 5ICEA 4G0MA 1PL8A 2YQ4A 1JH9A 1E94E 1SQGA 2QNRA 3G2QA 3IILA 4CLOA 1YHYA 2UZ0A 3SJUA 1F8XA 3HCRA 1WXGA 4GLLA 1HX7A 2W6QA 1EQ2A 1ZGCA 2PPVA 3K15A 4YCBA 5DGXA 2FMFA 4MR8B 3ROKA 3LF2A 3LAWA 2OPHA 1FVHA 2PVSA 2X7HA 5JJ5A 3PXCX 4BU0A 2OWDA 1TDJA 1JDBB 1D4AA 1NP3A 2Z1MA 2DVMA 1US8B 2R6ZA 5K1ZA 1CEEA 1TK3A 1JF8A 4JKOA 1JKFA 3QVKA 1XCBA 1SUCA 5ERXA 1ATIA 2MSCB 3GN1A 2ROQA 5A1TA 1NVVR 3BWEA 3K92A 3UHJA 4BGDA 2NYRA 1FXWF 2WSYB 3PI7A 1BXZA 3A3OA 3ZW8A 5LMNB 2PX0A 1QANA 1LA2A 2O8NA 2W8BA 2C31A 1FVOA 4HH1A 1GQYA 4DR3B 1N5IA 3HR7A 1EAMA 4A1FA 1NL3A 3BMQA 2WJGA 3U81A 5B6IA 2FW9A 1J70A 3I0MA 1QM5A 5EXTA 4CQLB 1RJGA 2H29A 4H7EA 3E7FA 4UCXA 5DB4A 4ZO4A 5IH7A 4YRLA 5H1YA 1WQ1R 3UT5B 4GX5A 4G0VA 4P82A 1G8HA 4QDKA 3PDUA 3EGCA 3QNMA 1ML4A 4QDJA 5IBPA 1IXYA 2Z3VA 1TJ5A 2DQZA 1FJGB 2X5OA 1X8JA 4WKCA 4ZVNA 1A72A 4D1YA 2ATIA 2XKBA 1Q6YA 3BSWA 3BA6A 2WYVA 3C6YA 1MNAA 2JZCA 3EH1A 3ESCA 1N2OA 1R0ZA 2AOXA 2AX4A 3F96A 1MOZA 1Z16A 4ZU6X 3W8DA 2Y1DA 3T3OA 1MH9A 1O6FA 2HV8A 2Y2VA 1C9YA 2WAXA 4AN1A 3TTWA 1GTJ1 1NMEA 4BO3A 3VTKA 4YUVA 2X5NA 1NMQA 1DBIA 1EFRA 1PVVA 4OXRA 1KEUA 1KZHA 4TMXA 3AW8A 1HT2E 4X54A 1WMSA 1XNGA 1XN4A 4L3WA 1RJDA 4XX0B 3IOEA 4M8NE 3GEBA 2IP2A 1OJ7A 3I0NA 3U40A 4BWYA 2OM6A 4OQMA 1X6VA 3ABQB 3KHTA 4BAUA 3FVWA 4RJKA 5BWBA 1DKNA 1ZRNA 2RGNA 1ZUHA 1BXRB 4TWAA 4KTTE 3UBTA 4DG8A 1NATA 4W9RA 3V2UA 3A6EA 3HWRA 5TIIA 4AO7A 4CM4B 4Z1MA 2WW8A 3IUJA 3RAFC 4EABA 1JSXA 3GNSA 1DCMA 2XF8A 4IZIA 5CG1A 3S6JA 2P8SA 2I7VA 4Z53A 1B16A 3G49A 3FXAA 4GVPA 5BMVF 5AI6A 3TTTA 1P9LA 2CNOA 2VUIB 4HMQA 4ZOQI 1OLUB 2CYBA 2Q2WA 2BEWB 4A6PA 2YUIA 1Y9JA 2VZ0A 4MARA 4CNBA 3OJOA 1UZUA 3PEFA 1Z2DA 4MPRA 5KNDA 4UOEA 1Q57A 5EXDA 1KQFA 4O63O 3S5JA 1CY1A 1OB5A 1S02A 2IHUA 1JMVA 3ANMA 4PYOA 1WUTA 5TF0A 1PE0A 3EHEA 2DOKA 3MTQA 4NMLA 3UYLA 1P6XA 2PUVA 5J4HA 1JDBC 4JJFA 2ILVA 2XUOA 3H16A 1E1LA 4BB9A 2GQ0A 2GSWA 5DTMA 1PL6A 2B36A 5TQVA 1U2EA 2SCUB 2WYHA 3BIXA 2HRBA 2NGRA 5DM70 3NMUF 4JU9A 1WXEA 1C0LA 3SIPA 3LVRE 4UMVA 2Z56A 1RBQA 3OSUA 5BQFA 2PEYA 2PNJA 2AB0A 3F73A 2WV9A 4DLAA 5IH3A 1IG3A 1U8XX 2IITA 3QJYA 1UC5B 2VNAA 2Q6KA 3C3JA 2A1IA 4U6SA 3NWJA 4KRXA 3QIAA 3U3ZA 3ZXUB 1QYRA 2NZJA 1T2CA 1VIMA 2PSFA 1UMBA 2RMKA 4HBZA 4R1OA 5IU6A 2C2HA 1V41E 3IAAA 3LH5A 1X2EA 1HQDA 2V74B 5CH8A 3CEMA 5L3SA 3GR6A 3HV0A 5HUJA 5K8VA 2FY8A 3UQYS 1L5YA 2Y9MB 1Z4OA 2UZ1A 3D6TB 3N2NA 4PZAA 3WLMA 4EITA 1WXXA 3VYUB 2QLNA 2NP6A 1ENOA 4ND6A 1Y1RA 1JZSA 1YASA 1QHSA 4QQKA 4TZ0A 4F0JA 1QK3A 1KP9A 4HTAA 4WTOA 5HMMA 1S2LA 2VTVA 1LBHA 3MCTA 2E82A 3P94A 3KTFA 4EMUA 3GGJA 1PHRA 4J0FA 3PQ3A 4G0ZA 5DNAA 1QORA 1D6NA 1NN1A 3LXUX 4M9UA 1U0SY 3DVLA 4Q4JA 1ACLA 5BXYA 2PUWA 5JXWA 2PSHA 2YKGA 3GAZA 4BLPA 2CZGA 3IAS6 3KDAA 4UMFA 3SY8A 2HF8A 2X0JA 1AY0A 4O2LA 2WSBA 4B5KA 1TCBA 1V95A 1KYVA 3JRWA 3L8CA 4ND2A 3P97A 1SKBA 1D8TA 1IJKA 1I5RA 1M2WA 1NQXA 2FRDC 4E30A 3BHJA 3UPUA 4GSLA 5F1OA 4MPJA 1NI4B 2HSEA 3ENVA 3R77A 3SFZA 5EMMA 1LKZA 5JWOA 4UCQA 1UQRA 1GL3A 6CHYA 3GLFB 4LDRA 5K3FB 1Q44A 4XPZA 2LDBA 4PO9A 4PG6A 4JEHA 1QVVA 2O3UA 3U37A 4RENA 1JR4A 4FOOA 4YMSA 3GD5A 1JQDA 3OX2A 5KNCD 4KMOA 1GZVA 1OZHA 3WJ1A 5LDDC 1UODA 5IW8A 1G7SA 1EWKA 1RHKA 1XBTA 1G5RA 2K6GA 3WIBA 3HU5A 3K94A 2WRZA 4W7IA 4J1TA 4AT1A 2WOJA 4QU8A 1B2RA 1VYHA 4QUIA 4EMTA 1UANA 4OMDA 5AYVA 2I6GA 2ONJA 3WGJA 2IUYA 1QQAA 3KEQA 4CETA 2F59A 5J58A 1YC5A 1CZNA 1TEZA 4BEVA 3JATB 2QUIA 2IOFA 4HVCA 4RULA 4KE9A 2HQRA 4KNWA 4OGLA 1QXSA 2GZ3A 3OCVA 3OCXA 2Y1LA 4NYIR 1L5GB 1RAHA 1RM5A 2ZRKA 4U2BA 2F1IA 2Q9UA 5CLQA 3GGSA 4NMHA 2ZSHA 3P5BA 4XWWA 1GSOA 5CCEA 4WECA 3GBPA 4TV9F 3QV2A 1W5AA 3CGWA 1PR6A 4HWRA 4KNVA 3V8MA 2F9LA 5FPHA 2QSZA 1EE9A 1WZUA 721PA 3AKZA 2R6AA 4F5EA 2P2SA 4CFSA 2PUAA 2O52A 5THKA 2BYTA 4YPVA 5BSMA 3OPMA 1OPXA 1F2TA 4HDNB 4CF4A 4LF9B 3I05A 4YLGA 2O0LA 3IXLA 3HB5X 4LXTA 5C0OE 5JOQA 5E6UB 2Z09A 3WKBA 4JQOA 5BRAA 1SCIA 1F2TB 1KO7A 2C5LA 2PWPA 3NR2A 5FPPA 1LD3A 1M6NA 3STHA 2HU8A 2F1RA 2WG0A 3F74A 3FPHA 4D0SA 3PICA 1PKXA 3IESA 3T3EA 1GKKA 1S8FA 3UQZA 3C39A 1PR2A 2AOUA 3DCNA 3ZZUA 5A7HA 5JS8A 3H6KA 1YZ3A 1E6LA 2R8ZA 4MS3A 5AKZA 4YPFA 2C5FA 1O8CA 2J32A 1JS1X 1PEKE 3HEAA 1PDOA 2WA1A 4WZAA 3KJHA 5JJCA 3F3YA 3WWOA 2YMLA 4BLRA 1VLMA 4JYCA 2HADA 2YVUA 1S6YA 1Y1KE 2EFDB 2NUPB 1PT6A 4WNAA 5AW5A 4FQ8A 1TZKA 2OBLA 5A3VA 3NKFA 1C0KA 1LQ2A 4Q1BA 4DUGA 4QC2A 1FFHA 1FPMA 2QS9A 2WZDA 4JLVA 2IHNA 3CF4A 4M8KA 3FHJA 4RIHA 1T15A 4Y1FA 1NBMD 1HL7A 2W22A 3BCUA 5DBGA 3TFQA 4QDZA 3TKYA 5I5EA 1KDPA 3N3BC 3VDRA 4J3NA 3FLBA 1UIMA 2RC6A 4A91A 3FFTA 4P5DA 4TMFA 3B5IA 3M5DA 2BR3A 4YMGA 5BVGB 4EA7A 1KNXA 1DJOA 5T5QA 3UK2A 3ZGOA 3E4DA 1WP9A 3JQEA 4WQMA 2XH8A 1ZONA 2NO6A 2E5WA 1J06A 2ZOSA 3B89A 1KBZA 3DEJA 1JI3A 2D1RA 3MB5A 1FDOA 3PTZA 4PTZA 4QNMA 4RHYA 4TWJA 5H82A 4YIHA 1RBMA 1OVMA 4Q3CA 5BNTA 1M34A 4KDRA 3K9BA 4IYRA 4WESB 4ADSG 4MUNA 1RE1A 4ZV9A 2BC9A 1C4KA 3HXQA 3AM1A 1RP1A 4IXMA 4ZKEA 1SVNA 4YR7A 3KPUA 5ICSA 2FGKA 2WMDA 4CMJA 5JH7F 1X1QA 2VKQA 2AMFA 1SCUA 2FA9A 1Z0JA 2NU8B 2C9MA 5F2EA 3N9IA 5H3CA 1LLCA 4EH1A 3EVCA 3DBOB 2XXBA 3T3MB 2EFGA 5IZ4A 3TLMA 1X86B 5IS2A 2J3MA 4D99A 1JQLB 1GNSA 1IB6A 1WWKA 4GMFA 4J4BA 4P31A 5I01A 3DC7A 4WUVA 1WW8A 4LXYA 1PGOA 1E0KA 4FOPA 2GETA 3QPWA 2VF8A 4MWTA 2ZRFA 4IPTA 4BJHB 5K3AA 2O8DB 3LPNA 1N2CE 1P3Y1 1RKBA 5B3JA 4P53A 5B12A 5DNDA 5JC8A 4KLNA 4CLHA 4DRZA 1BMTA 2F3TA 4H08A 1HK7A 4D43A 1YGYA 4CTOA 1HUQA 1LU9A 1M75A 1W75A 4H2DA 1F8FA 2DY1A 3C97A 3STWA 3BD7A 1Q0QA 2C9CA 2ZTHA 4WJZA 3PUKA 1G5FA 3DNFA 3PXBA 1I4LD 3QLVA 4R1QA 4N0MA 2J08A 4RDIA 2FMHA 3EVZA 4AN0A 4XRGA 4YP7A 1DWPA 3I37X 4LJSA 1YZLA 5TB5A 1H9CA 1SCKA 5EIHA 3AHIA 4GZLA 2P3OA 4PRKA 4IHQA 2BD0A 1E3LA 4RH0A 1QV9A 2FZKA 2GN9A 3OTQA 2X1MA 1Z74A 1AV7A 2Q7OE 2DC1A 5FEUA 4OX9Y 4R01A 3CWZA 3IUBA 2X0FA 3AUXA 3BWMA 1P31A 1W9MA 2B61A 3U6BA 4RL6A 1MUUA 3U3XA 3ZHTA 4II7A 4LZLA 2J0SA 1L5VA 1XZJA 3FAKA 2WTXA 4G5FA 2W7TA 1Q0LA 1WU7A 2FUCA 1XLTA 4GI5A 4UZFA 5ADWA 5KNCH 1Z2EA 2D7JA 1VI2A 1F06A 1Y8QA 1J0AA 1EBFA 2EQ5A 1RCTE 4QTUB 1ONBA 1GRVA 2I3GA 2WKQA 1TZMA 5THXA 4NQRA 4A0RA 4DBLE 5IKEA 1IHYA 4IYJA 3ETDA 5DNCA 4C76A 3EVBA 3ULKA 1IOLA 3WXMA 3G8CA 4YMTA 2WM2A 4V3BA 1Y80A 2AUNA 4F45A 5EJ5A 3MUEA 5LB2A 2H2WA 3ILVA 1K27A 3C48A 3SICE 3GA0A 2F8LA 2J3QA 1RYFA 2AG8A 2PS1A 1MW9X 3QEMB 4FKZA 3TOZA 1T3SA 2BMEA 6Q21A 1LH0A 4X7MA 2WF5A 2ZIWB 3DOEA 1GTZA 2FSHA 4MYRA 1TRHA 5I3ZA 5KTTA 1ZUIA 2AS0A 2G83A 4Q00A 2I2DA 1R4MA 3DSRA 1JAYA 1GGHA 1Z5WA 4NJMB 1NF8A 2FKAA 4LCBA 1KZ1A 1NBMA 3CF2A 1DG1G 4MHTA 5DX0A 3TLJA 2NVOA 2PUDA 1XZQA 3ZXIA 5CNMA 5FWYA 4X90A 4LYEA 4ESOA 2XKJE 1IIRA 1ZI8A 5JPCA 1HNXB 2GF9A 3M3HA 1QE0A 3NALA 3SKXA 2IIVA 3NV7A 5EMNA 1CFJA 4KWIA 1W2HA 1MIOA 3GZNA 1U81A 1XD2B 3LI2A 4MV3A 4P7FA 5EQTA 1RXYA 4FILA 3VHRA 2N1MA 3EQ7A 4IW3B 3X1JA 1FSFA 1IH8A 1Y5NA 2H08A 1WPQA 1E5LA 1YO6A 2AR7A 4MWOA 3U7IA 3TKAA 3LWDA 3K5IA 2IQIA 1Z34A 4GSYA 4K86A 4UHDA 3ZIAD 4DLXA 3U5ZB 4UEKA 3EPPA 3FGOA 3RS2A 2OV8A 3PHBE 1SZJG 2L2QA 4V1CI 1CQJB 3GK3A 3SYLA 4HP8A 5J59A 3TQRA 4RD0A 2XZOA 3FCOA 4JHXA 4ENRA 5CHYA 3FYUB 4QPJC 4J8PA 4REOA 1V9CA 3OCCA 2WM3A 5FDFA 1YULA 2JC3A 2AFHA 2QT1A 4Q12A 4P3NA 2JLQA 4MQFB 3I92A 2VCYA 3E0XA 3DQZA 5AKYA 5FWXB 5J47A 3WADA 1AZSC 3I83A 5F76A 1XSEA 3EYWA 5JRZA 2QMQA 5TGZA 4NE2A 1VE7A 3N58A 1Y9AA 4W1PA 2EP5A 3QKRA 4BO0A 1FP4A 2VG8A 5SICE 4I1VA 3B5JA 1O2DA 4Q9JA 1ZM9A 3EEIA 4UBLA 2PX3A 1MN6A 1WXIA 1C1XA 4BGVA 2XW6A 4KEAA 5JDCC 3MELA 4K81B 5TX7A 4AX8A 7REQB 1DQNA 2W42A 3KTOA 4ZYWA 2G40A 3GL9A 1B6GA 2XQIA 5EIBC 5TQ0B 1M83A 4TWRA 4BN0A 1AJEA 4FYWA 2P90A 3W9YA 3ZNOA 2I54A 3QBTA 1E1CB 4C3UA 3SZGA 4WBNF 3EXHC 3ZXXA 2ZRCA 2AJ8A 2B6HA 2FSIA 3ET5A 3J81k 2VTBB 2W37A 3SJ7A 4QYXA 4JNCA 3O74A 1NP6A 2QX6A 1TO1E 2VDQB 1IEVA 1AO3A 1T6YA 3G17A 5FADA 4W5TA 1XA4A 2R7MA 1ZR2A 4YT8A 4ESVA 4IIXA 5AW4A 1PZEA 3EODA 2KLHA 4HR7A 4OHCA 1S2NA 1SKYE 3PV0A 3RUHA 3RU9A 1Q91A 3DQPA 3LZ6A 4DCUA 4O2AF 3ZXYA 1W85B 4ES6A 2F6RA 1XEWX 2PL1A 3LKVA 1EBUA 2D0OB 4ZOBA 3RRJA 1NUUA 3NWOA 4EZEA 4FWBA 2AL7A 4ZI3A 5T4FA 4CEHB 1KGDA 1KRXA 2YIVX 2XEXA 3V7NA 1HYEA 4BMSA 5AW7A 2H00A 2A9PA 3ZWQA 1JLHA 2EL9A 3OM8A 2ZT7A 3BTOA 1MF7A 1U8TA 1O6CA 2I76A 4XIYA 3V42A 3EAQA 4TV9A 5A02A 5KOHB 1W8IA 2ZPAA 4LRSB 5D1NA 3S1AB 3T9EA 5A4DA 1IY1A 4IDPA 2A78A 3JYLA 5IVDA 2C7PA 1LPMA 2GSDA 3L4EA 4OQDA 3ZWCA 1HDZA 4G4SO 2FQYA 1X9HA 4QM6A 2KS6A 1Q2XA 2X6RA 1R18A 2MMGA 3C3MA 1ZZGA 2O3SA 1RI5A 3L04A 3C5WP 4W7HA 5CTAA 3IQXA 1R0CA 3N05A 3ZY3A 2IC5A 3ER9A 1WPRA 2YN4A 4GU5A 1LNSA 5F21A 1TF2A 2FDXA 2P1DA 4MQ5A 1NMYA 3GLTA 3WK8A 2GLXA 4RAQA 5CVVA 2YHAA 1VRWA 4TLEA 1EDOA 4R6WA 5ENDA 2PKCA 3DNPA 4DFDA 5CCBA 2GEDA 4OFWA 1VOTA 3KD2A 4WI1A 3AV3A 1ZVKA 1QB8A 3OF5A 1RXSA 3PPVA 2PSSA 3NOQA 1QC5A 4KE8A 2YDYA 5GONB 3O8NA 5U4QA 4RVOA 1BHQ1 4EENA 3IMEA 4DA9A 4D3ZA 2JKVA 3PWTA 2RCNA 2PG3A 1B41A 1I7PA 1PV2A 3PKIA 3QVLA 1G6OA 4HNSA 5FTMA 3U7EB 2OR3A 3CW2A 3GQBA 2EW8A 4BZWA 3HJNA 4ZOLB 4LW8A 2YXNA 4IJWA 3WZMA 4L51A 5G0SA 4DSOA 3GUUA 3PYLA 1T3LA 1MA3A 3RBAA 1MD9A 4ARZA 1EVKA 2O8BA 3WSTA 1O9GA 2GKSA 2ODNA 2PANA 3C85A 2NADA 2DYKA 2IS6A 5FLEX 2ZJ0A 5AXBA 2IXBA 1XYVA 3HHPA 2BFCB 1DI0A 3PHCA 4IP0A 4ZEXA 2IWRA 3W8RA 5C7OO 1F8GA 4JBLA 3BE4A 4BFVA 2NPIA 2ZROA 1XF9A 1YZTA 3CT4A 2B1RA 2JCGA 4MXDA 1DSSG 2RK3A 4RPJA 4C06A 1AK1A 2FZ5A 2CJFA 4E2ZA 2Q3EA 4WXHA 4JODA 2W48A 4ZYTA 3H9UA 1G55A 2PVPA 4PBTA 3JWJA 4RESA 5DGDA 5AW1A 2L19A 5IDVA 3QVGB 5B7GA 4GOLD 3EB9A 4NAUA 3DLPX 2FMTA 4MRVA 4N48A 3E22A 2OGZA 3K8OE 2XD9A 1FOEB 4PINA 1XVIA 1XHFA 4ML3A 1V43A 3VUFA 3OQPA 4CU5A 1WL8A 3VC3A 4PPFA 5E38A 1BE1A 4C7MA 4DLRA 3U1TA 4EX6A 4L5BA 1LSJA 2ZS9A 3QX3A 2ZTMA 1E32A 1H69A 1USVA 3R9KA 4BNHA 3A1TA 2PE5A 4JJ7A 4HDSB 4N0QA 4XX1A 2R5WA 5ARDA 3S44A 1ML3A 2V6IA 4B31A 1T2UA 1QDUA 5SYNA 4YMUA 4AG6A 3CISA 2F1KA 2Y3IA 3EZLA 1P4GA 2WIKA 3LTEA 1PV4A 2UYQA 4IJUA 1TPZA 2XJ4A 4XE5A 5KMGB 4H1VA 3VPAA 1CJTC 2RG1A 1W4CA 5TQJA 1JDVA 5IJ9B 1VXRA 4ZCPA 2H1SA 2E6UX 3V33A 4L0CA 1QR6A 3S2EA 3VVBA 4IHJF 2AFVA 4I9GA 1T6NA 1GJRA 1CB0A 5INTA 4NU8X 1GL7A 2JEZA 2Q46A 1H05A 2WM9B 5JANA 2WAMA 3LPAA 1KIAA 1OU4A 4PSAA 1DC5A 2CFOA 4M46A 4P4NA 3NHSA 1QTNA 2IGBA 4P7JA 5LYJF 2HQBA 2H4FA 4XYBA 4GPIB 3DOOA 1JAZA 4S1WA 8ADHA 5EIEA 3TOVA 1QH8B 3KD3A 1X7YA 5TGTA 2FFBA 1ECFA 1GP2A 5EY5B 4KO4S 4X8LA 2CXOA 4Y6SA 2PUBA 1T9BA 4BU1A 1M76A 3NBKA 2QKYA 3RR2A 1A9XA 2JLYA 1X7YB 2OOSA 2XUZA 4BO5A 4FDAA 2ZIXA 3F1KA 1K8YB 4NPCA 2YICA 4F2HA 1F60A 4H7DA 1K7SN 1T8RA 1QH1A 3C74A 3NYQA 5FFMA 2Z2ZA 2VPWA 4O1MA 4B6SA 4MW1A 1TLTA 1D0SA 2Q0SA 4CJXA 3THXB 3T1TA 3I9KA 1Z7WA 1ZEMA 5C7LO 3SKYA 1A2OA 2JA2A 2OSBA 4D4JA 2OFXA 1IY9A 2D1QA 1ZGBA 3KVVA 1JHVA 2WSLA 3N2GB 3ORRA 3L01A 5C4MA 1Z7YA 4DV6B 4PYRA 2XUAA 5CIYA 4MCHA 4XWAA 5KJ1A 3OBBA 1UJMA 5E1BA 3N2GA 5F98A 1BE6A 4ZRMA 4YJGA 4DBLC 2B4QA 1T5DX 1DMSA 8ATCA 4CKEB 2F3PA 4HTFB 4RTNA 3OP1A 1TZCA 2X0IA 1Y3BE 4XEUA 5JSQA 1OIVA 4OYLA 3VOBA 2VHWA 4I55A 4JJIA 3DFIA 3JWPA 3PHLA 3A1EA 4HD8A 4KQWA 5AI8A 2IVZA 3PX3A 1ZD2P 2NTJA 2QN9A 3CCFA 2GK4A 3DDCA 3MWFA 1HH4A 2VR1A 3VR2A 4LRWA 3K2BA 2QMUA 5CFQA 3KXLA 1I2MA 1I51A 2H5EA 5M3BA 4RKEA 1UOPA 4R8SA 1FMCA 3INYA 3VPHA 1D1TA 5ITZB 5AI5A 4HEA1 5I8ZA 4E0BA 4WBNA 4L6CA 4UBOA 3H5WA 3L7YA 1PR5A 2ZUCA 5DGTA 5ALHA 5C1OA 1GYPA 4CM9D 1H5NA 4NARA 5F52A 3ZDDA 1YAHA 3LUAA 4WOJA 3PVSA 2MCFA 2QW1A 3FB4A 3KUKA 2F4VB 2VQFB 3TQOA 1D2CA 3B1VA 1KDYA 2V7WA 3HP1A 2H85A 2D1TA 2HK9A 7ABPA 1NGSA 2DETA 1DJPA 1UMDA 1OCEA 4JC5A 4XCQA 1ECJA 2ZXFA 4F8YA 3S4YA 2YZMA 1MP0A 3KHKA 3GGGA 3CUKA 4KKXB 1DO0A 4KVFA 1WY5A 5F5XA 4JJAA 4MVXA 1LLUA 1E2UA 2NZYA 2XE7A 4G09A 4LF5B 1FUUA 2PL9A 3ZWDA 1XALA 1NJFA 1XE3A 1ZYUA 4XM0A 4Y2XA 3SBDA 5LP6A 1D5WA 4DMKA 4TRJA 5IAOA 2C8JA 3Q9UA 2R25B 3D0QA 2AYZA 3UGJA 5EHQA 2R11A 4XTRA 1TTTA 2SBTA 5TPWA 1JP7A 1T4GA 1SAYA 1QFYA 4W8HA 3VPDA 2ZANA 1H4TA 2G25A 1X7WA 1GEGA 4L8WB 4OV6B 3UHOA 1YDEA 2VDWB 5C52B 1YCDA 3HDTA 5FX2A 2WJIA 3BX1A 5JIBA 3PEWA 1TXGA 1EFVA 3E5MA 3T3HA 4NX2A 3KUUA 2DR0A 4QT0A 4QM7A 3EGVA 3HADA 3I42A 3FCYA 4MJ3A 1MG5A 3OWOA 3VO2A 3WIOA 3ZJYA 4QARA 4FGSA 2J48A 4TKMA 2F67A 1H2ZA 2UZ3A 3E27A 4MI9A 4JIGA 1V6CA 4QHTA 4I4NA 4G56A 1ADGA 3PPWA 4G0QA 2PS9A 1DMRA 2C2YA 2GM5A 2VDJA 2JFZA 4X97A 4UNIA 1N2IA 2P5UA 4W7SA 1WM1A 3GAAA 4QD3A 1EXVA 3ZS9A 2PQMA 5FBQB 2IV2X 4B84A 1UEXC 1EHCA 3LFHA 3KV1A 4J75A 4OHWA 1JIQA 1WVMA 2HZ7A 2OD2A 4FIDA 3NHUA 5JZMA 4LF6B 3U19A 1SULA 1WHTB 1VP9A 3W0LB 1P2FA 2BI8A 3NTRA 1V4BA 3HFRA 1IUKA 4MUHA 2VDOB 1M0EA 4LYGA 2Y0EA 3RS3A 1ZSVA 5CFPA 1ISGA 1EM8B 1K4YA 2D5IA 4OJTA 5B1YA 1M0SA 4NHEA 4D3SA 2PZFA 2YY5A 2JGIA 2UVDA 1S89A 5LCXA 2J87A 4X8OA 1JZQA 3FWYA 3NBXX 4LK3A 3FMFA 4IILA 4V3CA 4EW6A 5LP6F 1WNTA 1RKVA 1I6LA 2CFSA 2W6IA 4FTWA 4C0LA 1W52X 2HZBA 1VCIA 2P4HX 4PYJA 4UTNA 5JNLA 1K9SA 4MVJI 1W88B 1G59A 4GICA 2EGGA 3CTPA 2EJWA 3FX2A 3NTQA 4AJLA 1LPNA 3G0IA 4A73A 4P3OA 2WJVA 3HU2A 3K09C 3KQVA 3N2IA 3UENA 2A5DA 4A10A 4HMPA 2ZWPA 2QW0X 4AZSA 1PZNA 1T1GA 5THQA 4JJ6A 2VF5X 1QCCA 2ZUFA 1ABFA 2B4RO 2FKNA 3AETA 4TSFD 2OKGA 2V97A 3GRFA 4JJ8A 3NONA 4QREA 1GUBA 3OUZA 1K3TA 4C01A 4JZKA 5TQ2A 4Z4EA 1Z2NX 4YN3A 1SCQA 4DDTA 3RF7A 1CQXA 4HH4A 1U8AA 2E55A 2Y99A 2ZYSA 2A5YB 3K20A 3UT6A 5LOVF 2NO9A 1PVOA 1TCCA 3QJ5A 1UZLA 2QDXA 2GXQA 3D8NA 4F2GA 2GBCA 3HNOA 1EK1A 3F8TA 1AXGA 4CKWA 4XA8A 2Z9BA 3NIFB 1Z9BA 1KDOA 2BMWA 3L1IA 4OI4A 4YJ2F 3VU9B 1NJ1A 5J43A 1QAMA 1VA4A 1RC8A 3Q0EA 4RJ2A 5IDQA 5C5CA 2DB3A 3DKKA 1I6WA 3WR5A 3IAUA 2P79A 2ZYIA 4PC3A 3V9PA 5I4CA 4ZTUB 1NVWQ 2WHRA 3PGKA 7AT1A 4PONA 2C59A 4R83A 1VL5A 2RKOA 1I10A 2V55B 4Q3AA 4UXIA 3V97A 4D74A 2JGDB 1R88A 3TTVA 2G0AA 2R1VA 4NVRA 4NY1A 5K2MA 4DWOA 5J2TA 4EKGA 3NC4A 5A9TA 2MSEB 4COKA 4QBKA 1R9MA 1HG1A 3FAZA 2XUJA 3BJIC 4HRVA 5ILQA 5LPNA 1D0IA 4XKJA 2JCSA 2D00A 2R1VB 3CLUD 4GXNA 4TLBA 3GEMA 4CEJB 2R1UA 2D2EA 2OL4A 3ACBA 3ZE8A 5KNCA 1X42A 1UKCA 2GEJA 5A5GA 1B3BA 1WB9A 4BS9A 2V98A 3ZXSA 1IZYA 3OQVA 2UUOA 3RIHA 3SC4A 4O8CA 1XQVA 2VP2A 3EA0A 1BDMA 4WKGA 5A5EA 2F9FA 3K9FC 4DC1A 3ZQ6A 4DV4B 4CEJA 3MINA 3RRBA 5KZMB 1ISRA 3V2HA 1AHHA 1ZH8A 4NNPA 1SCUB 2P75A 5LZ2A 5TT0A 1WB4A 3T7RA 4BL5A 3VHXB 4JQYA 1XQ1A 4BCCA 3OZGA 4JDUA 3FGNA 3NNNA 3A4IA 4L07A 2X8LA 3I04M 1MZPA 2ZE7A 1FIUA 2BGMA 5JD4A 2HK6A 1BHSA 2VHTA 1XAIA 3KBBA 4YUXA 2WILA 5FT9A 3P2YA 3QMPA 4DNQA 3W34A 2QUHA 4TMTA 1GL6A 1KEWA 1XPJA 5C8YB 2DHQA 4C6SA 5KKNB 3MWGA 2HSZA 1MV5A 2RH9B 4AWAA 3KT8A 4JY7A 4WOBA 4YCSA 2V7TA 2OM2A 4C08A 4JEUA 1GU7A 1WD7A 4B0PA 5K45A 1ZGHA 1L3CA 1NYLA 1XP8A 4ZAXA 2VAPA 5B1DA 2R5FA 1N1GA 3BBLA 2FMUA 4MP8A 4MWSA 3VYVA 2VBCA 1M1ZA 3ICCA 3DJFA 4K1LA 2PYIA 5CVEA 2ONZA 3CY6A 2YWEA 2PZBA 1K8XB 1XDSA 4P4LA 4JI8B 2A1TR 3I04A 4OVKA 4F6LA 1A7JA 4CMBA 2JLBA 4JP5A 4AD8A 1TIPA 2HA4A 3V1UA 3COJA 1P4SA 1PR4A 3FWNA 1PZFA 2RGCA 5I8WA 1KY2A 2W6ID 2ZYHA 3B8EA 4KR6A 3JAKB 1F0PA 2GN1A 2NTYC 3R7DA 5CT8A 1UWLA 1X7GA 2G7MC 5TY0A 4CTNA 4CMEC 4E5YA 1NXQA 1NAIA 4MRMB 2UYHA 4URUR 1WRBA 2Y1EA 2BCGY 1DKLA 3RF6A 3DDNA 3DL0A 1HRDA 1KRHA 2HSJA 4KTVE 2C4UA 3OLWA 3WMFA 4YCMA 1JB9A 2QJFA 3KWMA 3F4KA 4YJ3B 3V3TA 5PNTA 1SQ0A 3MD0A 1BQ3A 3D3JA 821PA 4DCTA 2OO5C 4U7DA 4ZO6A 1KAQA 4X3OA 4KZKA 4XW2A 4JXXA 1V3TA 4TXHA 2ZIUB 1Y8CA 4C4AA 4RIFA 4HN4B 1NPDA 2NM0A 3OCUA 2R2AA 5B7PA 1RFLA 4BNDB 4JJZA 2HEIA 1NYQA 2FH5B 3AI1A 5CBPB 2UUAB 1OXTA 3DYBA 2C84A 1AMUA 2ZE6A 2Q1YA 5A4AA 4WLOA 4YECA 2FQXA 1D9ZA 3TCXB 3NM4A 3LRXA 3BKXA 5AK6A 4RZXA 5LBIA 1CS0A 2W8ZA 3GCDA 4Q4HB 2WV7A 2CXSA 4ZHQA 3ZIUA 3LD9A 3GPBA 1CSEE 5KYYB 1KSFX 1ZD8A 5AKEA 1A3CA 3JAMA 3CH4B 1IEQA 1DJMA 4TS3A 4U7HA 1M7GA 1BHJA 3LK6A 5EKSA 3NS7A 3WFZA 1WDTA 4GGOA 1NULA 4IUDS 4WY2A 3WHLA 1G5HA 1C14A 4AS3A 4ROTA 4HJRA 3RT7A 2WFLA 4ACAA 3QI2A 3RS4A 3PUHA 2QLLA 5LJLA 1O95C 5L3QA 1LF0A 5FP0A 4YT2A 4XB2A 3AUUA 4YRIA 2NU7B 2CNLA 1A27A 2D59A 3GN2A 4XWTA 2LGJA 5BSHA 1ILEA 1XB2A 2CZCA 5AUOB 1QRSA 4TV8B 5I4KA 2Q29A 4RK4A 3SJAA 1DBSA 3CPHA 1CVRA 1YS4A 3DQQA 2Q5IA 4QPPA 2F3RA 2IZ5A 3KSRA 4Z4QA 5KI6A 3WZLA 4KPYA 4S12A 4PX2A 4I9NA 1QYCA 3BAFA 3CRZA 4Q47A 4PRYA 1BGVA 1Y3FE 2XGOA 4AUKA 1E79D 5DXJA 4DIOA 4AQ7A 1B8NA 2ECKA 1TIKA 1D6MA 2O2HA 3HB4X 1NIJA 3THYB 4BHTA 3R9XA 1XCLA 4O2AA 1E3SA 1OLSB 2JFHA 3GRRA 2PXHA 4NIMA 3PTAA 2PIDA 3QE0A 4X63A 3H1PA 4ZOLF 1TE2A 3C6ZA 2BJWA 4PFJA 3SDBA 5HNKA 1OFIA 1KZ6A 2ZAMA 5KAMA 1KHHA 1Z4JA 2OWEA 3JALB 3MMNA 2GTHA 1XEFA 3PIIA 3TLYA 1KDVA 3U2QA 1GZDA 1EFHA 3KQQA 1LPAB 1Y3AA 4FFNA 2QR3A 3BILA 4Z9XA 3RVKA 2DQKA 3HCCA 3SCZA 3T4UA 4C6RA 4JEMA 3B1YA 2IELA 4R8VA 1CB7A 1NBHA 2WPDA 4KJZA 4G41A 1A5SB 4Y9RA 3AMVA 3RWMB 3I5XA 8LDHA 3AM3A 1MLDA 3NTVA 1DFHA 2O5VA 3DONA 3WDLA 5JAIA 5JRJA 4KX5A 1XZGA 3FUVA 4I46A 5TVKA 1B7GO 3Q7SA 5ECGC 1NE2A 1GGVA 5AHRA 3RYHA 3RUCA 2MSNA 5L6MB 1SCAA 5ARCA 4XYLA 3T1YB 1G98A 4L5YA 1F7VA 2NAFA 1M66A 1Z88A 3Q8LA 1L7QA 1JBEA 1F20A 1B1CA 5ALLA 2NP7A 5AI0A 3JVIA 3LECA 3BXZA 3QE2A 5CVDA 4NG5A 1BCRA 3DOCA 1TMKA 2VSNA 1UBFA 3EZYA 4LGMA 1R16A 4K5QA 2C9ZA 2QM7A 3U1BA 3A4MA 2C8LA 2P5TB 3AWDA 4FSDA 3JTMA 1Y6JA 3THOA 2JZOA 3GLVA 1GGJA 1KZ4A 2BEWA 5JDIC 4DWJA 1NU6A 3LDUA 3O0TA 3GJ8A 4FYYA 1UDAA 4LC1A 4MS1B 1O6BA 5FLKA 3TIGA 2C83A 3I6QA 2FPMA 4ZCTA 5CH3A 1PFQA 1W25A 3IQHX 1I4TD 2BN4A 4CEHA 3DKIA 1FFCA 2F2TA 5H3LA 3SE7A 4A6XA 2ZWOA 3ABIA 2ZM5A 1ZD3A 1FMFA 3I9FA 4RXMA 4R8MA 2Z3ZA 3W3ZB 5LJIA 3MQ2A 5LZ7A 4QO7A 2YJGA 2OCPA 1XOIA 2FDCA 4FBGA 4TQGA 5JVDB 1XZ8A 1CS4C 1W0KD 3F5FA 4QGGA 3G02A 5EHZA 1IDOA 3K1ZA 3KQMA 3AEZA 2XUGA 1CPYA 2DBZA 4QXOA 2VRWA 2FYTA 3MMZA 4NS4A 4FMBB 3DXFA 3BUSA 1TM2A 3UK7A 3IHWA 3IUQA 3K4QA 1SD1A 3N2KB 3OG9A 4QECA 4R3WA 1P1KA 1F6BA 2RARA 2WF9A 3MJRA 1L1EA 2X9VA 1GQSA 1V3UA 3MCAA 5ERYA 1X92A 4OHPA 5ALWA 3IQEA 1L5WA 4DIDA 2WYWA 4KITB 4E5MA 5ENVA 4MB6A 5DSXA 1B23P 4QGAA 2IS2A 2J7PD 3GLQA 1RAAA 4HDAA 4DN6A 1W36C 1DPGA 3CZCA 2WTBA 2EBWA 3EZ7A 4LY0A 3G5UA 3T3IA 4BX9A 4DM4A 1PG5A 1VE3A 5SZJA 4WJKB 3TSZA 3ZIAA 4Q9IA 1R64A 1TVKA 4MITA 1C81A 4ENVA 2PR2A 1U28A 2ZB7A 3FVQA 4PFKA 4OQQA 3MRSA 4O02B 2WWWA 5JADA 3DEZA 3PUZA 2YWRA 4V0ME 2Z5VA 4NAVA 4S3MA 1WU8A 2DCUA 3AKDA 5DFAA 1ZD9A 1TYZA 9MHTA 1AV6A 2C7VA 4ZDJA 1HYGA 1AXRA 1XVTA 3TL2A 4M86A 4MUAA 3KAKA 1JR3A 1PJQA 3GFQA 3H8SA 4M1SA 4PYQA 1K89A 4OHVA 5CTJA 5ER9A 4Z54A 3WFIA 5KINB 3SHVA 2XUHA 3GLFE 2A33A 2OOKA 1Y8AA 4JC0A 3AF4A 4C4RA 4L16A 2ZB3A 4Z4GA 3E9NA 3MCZA 4JYBA 4LDAA 4UU8A 4RZQA 1ZNWA 2BGJA 4KPUA 1JU4A 4ZT6A 3RAGA 2F64A 5KYXA 1ZK4A 5K5EA 2QOEA 1GGEA 4HQKA 4YRSA 1EUQA 2R4QA 3IB3A 5CA0B 3ILYA 2RHWA 4EMBA 2H1RA 3BQ9A 2FFAA 3LC7O 1R66A 4YV2A 4Q0MA 4HAUA 4FS3A 3PL5A 3HDGA 3QVMA 5G0UA 2X9GA 1I01A 1TT5A 1NW3A 3ZYCA 3DGEC 4ZZ3A 1EGQA 4A8JA 3TDKA 1U2DC 4IO0A 1S4MA 3CW9A 3L1HA 4GYKA 3EUEA 4EUFA 2HMWA 3IEMA 2PWYA 4J9UE 5D7NA 1SVUA 3QXXA 4BX3A 5K0FA 1HTWA 5EJEA 1AB6A 2CCJA 3G3EA 4GQAA 1Z36A 5BNIA 2I87A 3L0ZA 1XPUA 2CDNA 1CHNA 1N25A 3BEOA 5CT9A 3HKEA 4HADA 3WSVA 4B3SB 1O96B 1C9JA 2ZJ2A 1OH5A 1MAHA 5E2IA 2PK3A 2XHZA 3PEVA 4IDEA 3N70A 5DM4A 3UMFA 2H2IA 3A11A 3PC4A 2D2VA 4OJQA 3HSKA 3KVNA 2OCDA 4E5DA 2QTGA 2XMBA 3RAPR 1Q5PA 1WSBA 4NKRA 1T5SA 1NURA 1A5TA 3D4IA 3IAXA 4P93A 3PD7A 3ZEAA 5EFOA 1YA6A 4BVEA 2C77A 4E70A 2BGKA 4JLPA 2C0PA 3I3SR 4RS4A 1WIWA 3GC6A 2J9FB 2QVYX 3DPSA 3BMOA 1GUFA 3ELWA 4LTNA 4B8WA 1ZK0A 4N76A 4N41A 1Y7TA 3PENA 1U94A 3N0XA 1NWCA 4IHAA 3C6XA 3LY5A 2HBZA 5LBUA 1MHPA 3AR4A 1SHLA 3VMFA 1ECLA 3F7NA 4UEQA 5U4XA 3T7IA 2CSUA 3IPRA 4ZYXA 4XIFA 3IR5A 4M0MA 1A98A 1Y4UA 2GHIA 4AQYB 1IN1A 2AKAB 3GEHA 1WMEA 1V47A 2O7SA 3STUA 4AKGA 1U0FA 4I9UA 2NYUA 2BHSA 2BEUA 4BNZA 2JJ2D 3QG5A 1RDFA 2VPXA 1Z0FA 3GU3A 3R3XA 1RPAA 1VXOA 1ORDA 4PYLA 1NF3A 2PVCA 1TI7A 1YVDA 4REMA 2OZPA 5D1HA 5HFNA 9LDTA 1AC5A 3WGZA 1RC1A 2BEUB 1Y0BA 4X1IB 4ZK2A 1D4OA 2JJYA 2ZT5A 1RMYA 1L5MA 2R8PA 3PQ7A 2WWHA 4P7KA 4XXHA 5M29A 2HV9A 1KSHA 2YW9A 4LJ5A 3N8IA 3T38A 3OE7A 4IHJA 5ES4B 2GAJA 3WB2A 1M7BA 1BQEA 5D85A 5YASA 4LMBA 4CMCA 1W1IA 4F1WA 5MN6A 1P60A 4DXHA 5LYJA 3WDSA 1SQ5A 3LXXA 4DZTA 1TO2E 3X1ZA 2NVUA 2W2QA 2CD9A 4XDZA 5ADUS 1HDGO 2V8OA 4ITVA 5CVUA 1QZ3A 1PK7A 4WA8A 2XECA 1ZIPA 1BFUA 4BIIA 3MBOA 1CVLA 1CUUA 1R15A 1KI9A 2ERXA 4QBFA 2HT6A 2YVQA 2CNNA 4AKHA 3FKQA 1RTTA 1GRRA 3ZBUA 8AT1A 3V4LA 1NPTO 4RK7A 2JD1A 3MIIA 4HGYA 1KI7A 2FR8C 3LTNC 4AO8A 3VKHA 4YQEA 1J24A 1G2OA 1QG2A 3KOMA 5DLYA 4YMVA 7YASA 4EUHA 3NAZA 1M2FA 2Q3MA 2ZCJA 1KI6B 4R2WA 1R9JA 3X1MA 1S7GA 1PRYA 3KWFA 3A14A 3Q41A 2QYHA 1RSZA 3REOA 1WZ2A 4J2OA 3OZCA 2V8BA 1TMOA 2NX2A 3LIPA 3BMNB 3ELDA 1L7RA 4FLEA 1YOVB 3P9YA 1KP3A 3FDJA 4KXYA 4MQMA 4G0XA 3M6IA 3VR4H 1QGUA 2PSDA 1SKAA 3NCTA 1S3SA 3D5QA 2QL5A 1PN3A 4F9EA 3RJ5A 2PIAA 3KJIA 1Y5LA 2QGNA 2O50A 3I23A 4OXNA 1A0OA 4M0LA 4EHAA 2VS1A 1E3MA 1U1CA 2QPOA 3EIWA 4MZDA 4CFYA 4WGGA 4K6MA 1X39A 4X1OA 1QTQA 1RADA 1B0AA 4FOSA 2XMSA 1PFUA 2BZ0A 4HGRA 3S2ZA 3VKWA 4DLPA 2Z58A 1TECE 3EC1A 1KAOA 1I7LA 1SXJD 3NDRA 4K28A 4XGRA 1YONA 1SXIA 2VT6A 3JQ8A 1J8QA 4UTXA 4FZRA 4HATA 4EUNA 3DM9B 3UKDA 2IKQA 5E6RA 2GHQA 3I8SA 1NW6A 3NHYA 3EHDA 1AX9A 4IH9A 3DAFA 3K1JA 1RWMA 1X70A 1CC1S 4Q1FA 4QDTA 2R7AA 1Z2OX 3ONDA 4UUPA 3TE6A 5HK9A 3MWEA 1LDGA 3CNLA 3M5PA 4HVAA 3B7PA 4C2AA 1JHAA 3BMXA 3ZBPA 4BP8A 1ESNA 3TNFA 3G0OA 1WY7A 1U0GA 3OM1A 5EP3A 3ROTA 3TR6A 3TZ6A 3QKWA 1YBMA 1RQPA 1NM5C 1YKFA 1DFIA 1ZISA 2UAGA 1O97D 1Q1BA 3EQ6A 1KOLA 2HNBA 3HYRA 3W4KA 1I30A 3ZTTA 4B44A 5HZKA 2D6FA 3JY6A 4UOZA 4KUHA 4FN4A 2CSXA 2OPBA 2XUKA 2Z08A 3BIJA 3N75A 5LNK6 2F43B 3D9QX 3M1YA 4R1MA 2YV4A 4WZAE 3WBFA 4Y2SA 4R69A 3UTCA 3EDCA 5I7HA 3LYUA 3R7NA 1FL9A 4FINA 4AZ3A 3B6EA 5ARBA 3QP9A 3D1VA 4BV8A 5FB3A 2H7YA 2FVYA 3SOPA 1CT9A 3QBDA 4RHFA 5D2CA 1IK6A 4HLUC 1C3EA 4I1SA 1C0IA 1YL5A 4KOAA 3OJLA 3E9DA 2RH4A 3DBRB 4HPWA 4W8GA 5ALMA 5KPJA 2JS7A 2VJOA 2JLXA 2ZPUA 1BD4A 4AZWA 1L4FA 1C1XB 2OO5A 2QRQA 4IVRA 4U7FA 5KYKA 1Q0HA 1SELA 2HWUA 3IQWA 1YZVA 3H5RA 4MDEA 1ZGAA 4ALNA 1L0BA 1AGNA 4DS3A 1KK2A 1W1WA 2YXBA 4O4IA 4QRHA 1W6UA 1A04A 1B43A 5DLEA 1VKNA 4YAJA 2CXXA 2FWIA 4MLPA 5HF9A 2YR0A 2J9XB 3GAFA 2RHGB 2CL5A 1NDQA 1XU7A 3GVPA 4J7XA 1E1DA 1FP7A 1E1MA 1ULTA 1C3XA 4QASA 1Q20A 3ENNA 2Q5QA 4FYHA 1FP1D 4B7ZA 4CV1A 4QTYA 3OE4A 2BIFA 3KYCB 3T5BA 2QTAA 4YWHA 3C45A 4CCAA 3K9HA 5T4HA 2OQIA 2XOKD 3B53X 3C15C 2OA0A 2YX1A 3EGDB 3WYBA 4NLLA 1MAVA 3KYCA 1EPUA 1YZUA 3RBXA 1SHKA 2LWIA 2P65A 1EXNA 1MQAA 3KLOA 3FPCA 4Q7MB 1RKQA 3ZH2A 3N28A 2N47A 1FBTA 1UMCB 3TSCA 3OOWA 1VIVA 1YOBA 5IFKA 1SA0A 4DB4A 5LQUA 1NQWA 4MUFA 1VSVA 1XD2A 2BISA 5CPFA 4AJKA 5GADl 1K92A 1PJTA 5L3VA 1KFEB 3TRDA 4RWEA 1XC7A 3TSWA 3IVXA 3PLAE 4YAOA 2J6BA 2A5FA 1JFLA 3WKCA 4MVCA 2CKMA 3LBIA 3IP8A 3UHFA 5A5VA 1GPBA 2NG1A 4J07A 4Z0NA 3SQOA 3TXAA 1TEXA 3FCEA 3L06A 3C1TA 2QQGA 3H4VA 3TIFA 4A5SA 2BZ1A 4NONA 3ONWA 4GYWA 1RYZA 1EJ6A 3FSGD 1EFPB 3MN1A 4OYRA 1NT2A 5GV8A 5BOSA 2VHVA 3ICOA 2PD6A 4R71A 1DOAA 4GOJA 5D5PA 4EGFA 1GITA 5K0LA 2WUEA 3FIJA 2ZJ6A 4YDSA 4OLJA 3HJFA 2AFIA 5AJVB 3PUXA 2F17A 4BLVA 2PKQO 4GO1A 1BFKA 1GPJA 1U7UA 3FOBA 2IU3A 3VV2A 1Z25A 4Q1DA 2BGRA 5BVHB 3G2IA 4S1PA 4MK4A 3WMEA 3IKMB 4UEWA 4UXHA 3PNPA 2ZRHA 3K0KA 2LCFA 4R41A 3RSZA 1GY8A 4ZVOA 1CV2A 1ZICA 2M2IA 3UO8B 1TFRA 3C3BA 4CN8A 2X9QA 4OBWA 4C0JA 1KVRA 2DH5A 4GWGA 1TC2A 4P5EA 3LFUA 3NDBB 1K63A 1ZHFA 4D82A 4RELA 5T3YA 2XCRB 3GG2A 2ZAYA 1KVSA 4QL3A 1YJCA 3ZHYA 4DMUB 4P8RA 4BY9E 3AP1A 5A1JA 2XXAA 3RYFA 4B7AA 3MSCA 2Y1WA 2J09A 4Y6LA 3COZA 3W5AA 3HN7A 4XM1A 2HF7A 4PCLA 3SE0A 2W8BB 2AN3A 1AK2A 1JHDA 5A71A 1SHUX 4JLNA 3E2IA 1B8OA 1AKYA 1TVCA 1ZD1A 4MJ7A 3ZHRA 2IE8A 4CKXA 2PV7A 1L7PA 2ZIZA 3OT1B 3UAOA 4CL2A 5LQRA 2ZRAA 3KSUA 3MTJA 4O33A 3O1JC 4NH0A 4EJSB 3IERA 3AESA 3OLYA 3LLMA 2I6FA 4G5XA 4TYYA 4YT5A 1UZMA 1ILWA 4K9DA 2GO7A 5COAA 3RB8A 5AD1A 1KTVA 3T06B 1JE1A 1XTKA 4EAAA 1CJMA 1RHMA 2PGIA 3W5SA 4F21A 5AOBA 1XU4A 3DZFA 3CPSA 3EA4A 3I3OA 4QEKA 5KTSA 1DX6A 5EQDA 1UJ2A 3KPYA 4TWZA 2NQ8A 3K1YA 2OECA 3PR1A 1U9IA 3NOXA 4QUDA 3MXTA 1ZG3A 2QSJA 4ZQFA 2I91A 1HDRA 1C7EA 5TSDA 3WO0A 2PUTA 5DMXA 3M5WA 2IH4A 1E2FA 1XDZA 1GPAA 5FPQA 3AVUA 2CNWD 1AGRA 1OWPA 2H4WA 3E70C 2WJPA 4DRYA 3C3AA 4W5QA 2Q99A 4LDPA 2GK7A 3GO4A 1I14A 3QUCA 5AVUA 4Z6KA 4ENWA 5FUVA 3HCAA 1SVLA 4P3PA 1Z08A 4Q6BA 1JDUA 1GGNA 1NE7A 3N5KA 1DEKA 1F5SA 5ANRB 1XT6A 3COYA 5IJXA 1ZWKA 4AP6A 3IAFA 3ZHOA 4D81A 2VIIA 3L7OA 4ZZ1A 4S1TA 3HXOA 2CNKA 2FZLA 3TPZA 4RSRA 4II2A 4YMWA 4CL0A 3DZBA 3WGIA 3L1UA 2FP4B 2ST1A 2RGAA 3FKJA 4J1NA 1G2IA 1ICEA 3L3BA 5L95A 1RKUA 3ZJ5A 4OMFG 1CULC 1BEZA 2X6QA 3EMDA 2FAXA 3F7OA 4LQCA 4M0EA 4RVSA 4LWZA 5KYWA 3H0KA 1E58A 2TYSB 2JRCA 1NRXA 4WPGA 3EW9A 4ZHQB 5BN1A 3D7SA 3GZJA 4YQZA 1MQ8B 3PJGA 4M0UA 1NLUA 2O3RA 2P4SA 2V59A 4M1OA 5IC6A 4J49A 1E98A 3CA8A 3PNKA 4EZIA 4L8GA 1SZDA 3AL2A 3S2GA 4XOUA 2QTWB 1ZMXA 2PMBA 4IJ6A 2O8BB 4L75A 4IIFA 1PD1A 1ARZA 3JYPA 4Q3LA 5JZBA 1I94B 1WXWA 2X9NA 4ZT7A 3EASA 5E7QA 1T8TA 3AK4A 1ND6A 5BP7A 2WHPB 1IUNA 3VKUA 3TNLA 3WIUA 5HYVA 1DKPA 1VA5A 2O57A 1OREA 1W4ZA 2DFPA 5TMEA 4PNZA 3I2JA 1EKXA 4RIGA 1F6DA 3SU8A 1YRQA 2IXAA 3X44A 4RA9B 1NLZA 1T36A 2FLVA 2NZXA 4UFOA 2V1XA 1E63A 4N7MA 1IVYA 1ORTA 5KU1A 2ZCVA 3EZ9A 5J4KA 5AKHA 4YP1A 5T8KA 5JZ9A 5FBKA 3IP5A 1A7AA 4IEIA 4QQ8A 1NJ8A 5IABA 4B81A 2X5JO 3IUYA 2AKEA 4UQPA 2ZSDA 1G8GA 3OIWA 1U80A 2X22A 3U13A 4ZVKA 1PL7A 3HBAA 3VNBA 3JQ7B 1Z0SA 1Z68A 2H51A 4JUAA 1G42A 1Z7BA 4K9QA 3A4LA 3BMCB 1XTZA 1T91A 3NPMA 1Q16A 4PLWA 1Y33E 4BN4A 4P4GA 2KMLA 4EA6A 2GARA 4BKPA 4NCIA 1MQ9A 4FK8A 1GDTA 1NFFA 2HBQA 4LX8A 1J0XO 2QRJA 3WLKX 4IUBS 2X7JA 4WKBA 5KMGA 3HRIA 1R0BA 4ZDIA 3UJHA 2UZ1B 2GRAA 1UBGA 2QMHA 2JI6A 4XX0A 4E08A 2W83A 4XSVA 3EXEB 1CD5A 3JALA 4IWNA 5EVCA 3KXDA 2PT7A 2RHHA 2JFFA 2IH5A 3TE7A 3GRYA 2CE2X 4RLHA 2K2QB 4CFZA 4YACA 3ZWOA 1JTEA 3DW1X 3H6GA 3PHIA 5A04A 3N86A 4M9ZA 2VJMB 4Q19A 4UCWA 4OJNA 1GPWB 1IAQA 1POWA 4NU0A 5AXDA 4C7BA 1QHFA 2JH8A 1DQZA 4K9SA 5EZSA 3SS7X 4NMMA 5J23A 1YR9A 4I5GA 1WZIA 1MC8A 1C8LA 1X7DA 4RZ3A 1UXJA 1U2GA 2G6TA 3LT1A 2YIDA 1TTQB 4FE4A 4H7IA 4I6GA 4E15A 1O0CA 1U5CA 3ND7A 4DZZA 2BEJA 3SBOA 3H5OA 1QS0B 3PE3A 5CU7A 4J0CA 1XNQB 1ZM2A 1X7WB 5KUTA 2ZYTX 3ZHUA 4NV3A 1OBHA 1YL7A 4H27A 1E3QA 1S2IA 3BKWA 4HV4A 1JQ3A 1NY6A 3W2FA 4F91B 5JPDA 5BR7A 3LCCA 5L9AA 5T41A 1VE1A 3SNHA 4HXEB 4JC8A 5AIAA 2ACVA 3AJEA 4QDXA 5M7EA 4IUYA 1BHO1 1QFSA 3FKSA 3NORA 3DMGA 4L73A 4RZ2A 5JSYA 4RCZA 3AR6A 3EN0A 2K87A 1JIXA 3FTNA 5LUBA 4ZEMA 1MHTA 6ADHA 4DA7A 1JEEA 2H31A 2AEJA 4GPEA 3LS2A 4W1QA 5DEOA 3EXG2 5AHXA 4CMEA 1JFVA 3GHHA 5ESWA 1E99A 1NR5A 1NW5A 4D41A 3QPDA 5KX5B 2CB0A 3LL7A 4PYMA 1ZOIA 4DYHA 3UVEA 1I4WA 4EHDA 4WV3A 3C3PA 4F38A 5EJFA 1PLJA 4TMYA 1U8EA 5DNVA 3RARA 5BT8A 2EWWA 1GSAA 1ZM7A 1E7WA 1TQ2A 5C53B 3G5TA 4JLKA 1MCZA 2JIZA 1HT0A 1N9KA 2CJWB 3EBPA 4DHWA 5DEIA 2GJ4A 5I8PA 1YRBA 3IQZA 1G3MA 1NU8A 4DXAA 1ULHA 4TTSA 4DSNA 5EWJA 1FCJA 4JN6B 4HDNA 4XDHA 4YGXB 3HCEA 4ZXPA 4WDRA 5G53C 4BQNA 4WBNB 4EJ2A 4GRIA 5EZYF 3ORSA 1NRJB 4BVHA 3KTDA 5G4LA 2TMYA 3KUDA 4FQ5A 3VU8A 1DAOA 1DIAA 2EEZA 2HDWA 2Q49A 4BDSA 2ZAIA 3G1UA 2R751 1JYSA 1MZVA 3H5TA 4TKVB 1VPVA 2Z4TA 3I2YX 1TVEA 3BDIA 4OLFA 3PXEA 1T8UA 1F1BA 2NOAA 4C7XA 3BT7A 2BFEA 2PAFA 4JJGA 3L4SO 4Y3UA 1O7JA 5DOZA 3RHZA 1RPTA 1JHRA 1J8YF 2W6NA 1ZI6A 2C5AA 3AEXA 4IF4A 3WLIA 1K86A 2L69A 5B3JC 3RSSA 1YL6A 3PEUA 2FW8A 2PTGA 3DPIA 3N76A 4G89A 3JQAB 4EHJA 1WUKS 1N4AA 1U98A 2QL7A 2NO0A 1GAQA 4INZA 4WNAB 1TYDE 1X7HA 3JPYA 3M4XA 3OA2A 5L53A 1E2HA 2FETA 4TLCA 5HRCA 1T4DA 1YR6A 2CF6A 2YRFA 3GMDA 4OHXA 4TKLA 4WY8A 3R7WA 5KSZA 3D2CA 4JOQA 3FSEA 1E9RA 2AT1A 4JS0A 1CUCA 1XYYA 3ONNA 2NYVA 4U00A 4HWTA 4PNEA 1M2EA 3U16A 1E1QD 4FFVA 4TWIA 5HZGA 1BXGB 5BN3B 3KJFA 5CA1F 2E2WA 3LL4A 4X1KB 1HEUA 5EWMA 3U1VA 4FC6A 3WSWA 1BKSB 2WPDD 4UATA 2TMGA 2HHJA 3MC1A 2OILA 2JKZA 2E37A 3RTEA 4I5FA 1LVGA 2H1VA 1OW3B 2VDVE 3EW7A 1WUYA 1XJQA 2R8RA 3BB1A 1NUQA 3DZDA 4DSTA 3WL7A 5AVXA 3MTEA 4JYMA 1XHEA 4PZUA 3KTAA 2M6SA 2FRVA 3UM9A 3YASA 3IDAA 1BTOA 2HCRA 3BZUA 3O73A 2H57A 3SM3A 2VP9A 1BA3A 1UL1X 4DQLA 3KTAB 4MGEA 2OC9A 2GGSA 1UF9A 4QXMA 3FOEC 1CUSA 1C9EA 4KLRA 3RKRA 4EO7A 2J6IA 2OBXA 3KL4A 5DI3B 1S96A 3TFOA 1E61A 3L7NA 4BYMA 2H4XA 2PEZA 2E4AA 4C4XA 2BFPA 1QB7A 2WAOA 2XWQA 4NV0A 2Q3FA 5DBOA 3WE7A 2HWWA 5B5SA 4TQ9A 5EGSA 1C7JA 4UDOA 4DQKA 4QG3A 1UJBA 1CP3A 4ETIA 4PW0A 2C3UA 1T2EA 2VHUA 2GBLC 2ZUDA 1BNCA 2FG5A 2H2GA 2KHZA 3MJFA 2Z5FA 5K3SA 3K09A 3ESQA 4UU7A 2VHXA 4FMCF 1VIDA 2O05A 3TSYA 2WJ4A 3W3AH 2DBQA 4BJ6A 2PA3A 1JHQA 2ETXA 3O38A 3JYQA 1WDLA 3TSOA 2Q8QA 4A92A 4PO8A 4AZ0A 3EDOA 4G24A 1BMFD 1E2PA 1W44A 3GCGA 4EF6A 3AY6A 3TW8A 1JFFA 4V0OA 4YMLA 1G9SA 3LXMA 1LNZA 1K66A 4PX9A 4YQYA 2J1LA 1ULAA 3RRFA 1ZVQA 2BKUA 3WGHA 9ABPA 2B1GA 1QP8A 4BKOA 1ZK2A 1BJRE 2ZPTX 3F4BA 4N3BA 4G0NA 2CBGA 1GKIA 1ORWA 2GFIA 4GYYA 4ILEA 4TM8A 3SF0A 4PN7A 3LQ4A 1RABA 4L1KA 5JATA 1Z8HA 4KQCA 2JIZD 2WJ6A 1XK6A 2ZBEA 2J0UB 2EARA 4Q7LA 3STTA 1XZBA 4N82A 4TYNA 3ZJTA 3KQHA 3G88A 4BX0A 2IY9A 1X77A 1W47A 4HLDA 1IQ0A 3K8YA 1EZ4A 2HDHA 3OPYB 1V4NA 1CKEA 3G2KA 4U39A 4I5DA 3SHOA 3L79A 4L7QA 1IWBB 4FBMA 4DYVA 2FSFA 4O3MA 2YWHA 5DBEX 2M98A 1MIHA 2CEAA 2AXPA 3F8SA 3EXHB 4HDOB 5HOEA 1L7AA 4IXNA 4LDQA 3ODGA 4JBWA 5CG2A 3V4ZA 5DLQC 1OBCA 3MMSA 1E1NA 1MOQA 2ZR8A 3MUOA 3HWX1 3GD7A 4MRMA 4J7UA 3UXMA 3ZI7A 4CLXA 5K8IA 1X80B 3RIGA 3IVCA 3OZWA 4CMHA 1KO5A 4ZO7A 3AEQB 5ECDA 3KUCA 2FG6C 2FPGB 2MOKA 1SIUA 3HDYA 4X20B 1TM1E 4GL2A 3KZNA 2WNIA 1N6OA 4G5HA 4PRZA 3NAMA 4XJVA 1TCVA 3HKBB 2TRSB 1OOEA 4B8ZA 1NDUA 1JJAA 4U63A 1AN0A 2VPQA 2BDUA 4BWFB 2G5PA 4OXXA 2D4AA 2QYTA 5G1OA 3T4EA 1IG0A 4KFTA 4ZDKA 2RHRA 3HA7A 4JENA 1OFUX 1JQKA 4FEEA 4ZJPA 3HCDA 1YZHA 3QM1A 2FK8A 1GCUA 2QM0A 3FFWA 3C5VA 3HVHA 3KFXA 3F5DA 4HGPA 5JQGA 2I7CA 3PYMA 3TEMA 4BRUA 1QGUB 4Q1VA 5MGBA 4JAVC 4HPJB 3NHKA 1ZJ5A 5H59A 4R31A 4EGQA 5C1BA 5HSGA 5BN4B 2C9YA 3JPWA 4AUMA 3MZ0A 4QFMA 4PQEA 1JEYA 1EFRD 1RLTA 2CCGA 1VZ3A 4BB5A 3OLXA 3OU2A 3H17A 3PFCA 4YX9A 4BTLA 3KX2A 4B43A 1XD9A 4LMRA 1E3JA 4EUSA 1H6AA 5LUAA 3T7CA 4P0PB 4GE0A 2J85A 3QVJA 4JLUA 4MUKA 4PLTA 4G3XA 4XDGA 5EMJA 1N36B 5EINA 4AJPA 2IIPA 3SIRA 1S2OA 2HJRA 1G20B 1Z3IX 1JFRA 2IYZA 3A0RB 4L8YA 1QUFA 3UWMA 3H4MA 3E82A 5J2UB 5HM8A 3QSGA 1KJYA 3OJFA 3F1LA 4CIYA 3D3NA 4BNTA 3HY6A 2EF1A 1NFQA 5C4IA 2AJTA 2IDMA 2RIRA 1R5JA 2Y1FA 3SBXA 3K70C 4FE7A 3ZOKA 3MHPA 3TIVA 4EG1A 4CLRB 1LFAA 1JPNA 3N0WA 2ZRBA 2H9YA 4LJLA 1KJQA 3K73O 3ZC3A 1V9SA 4DR1B 3T1NA 2QAIA 4F4DA 4IM7A 2B35A 2IXTA 1BS9A 2IP4A 1OX4A 2A59A 3BB3A 4FWIB 5C37A 5HKAA 4GZ6A 2ODPA 4KSCA 1IBRA 2WWVD 1EWRA 1NNEA 4IVPA 1S4QA 1OZ0A 3FRIA 4AC9A 1A4UA 1K08A 1OI3A 3F6PA 4FWTA 3GYBA 3R09A 5ALNA 2FEOA 2IS1A 2ZBRA 2HIAA 3PQ8A 2XCTB 2JGAA 3RSFA 2NUBA 3FIUA 4YRDA 2P8JA 4XSGA 1M10A 2MINB 1UKVY 4WKPA 2Z95A 1FUEA 4LE0A 3DEAA 1U1EA 3NASA 1EP2B 2VF2A 3O47A 1DIRA 1H0KA 1ZP6A 2B4KA 3E5RA 3QKRB 4C6TA 5HRUA 3SQWA 1GZ5A 1X0XA 4BVBA 1SXHA 4E2FA 1FTWA 5IXYA 1NHGA 2C92A 2O2ZA 1PFWA 4Q3KA 1KYYA 4JSRA 1Z5NA 2POQX 2G8NA 3P0RA 6AT1A 5FNVA 3HM2A 5CB4B 2D4HA 2JFYA 4ID9A 3HA2A 5EPEA 2DERA 2O1EA 1BFDA 2AMLA 1N3LA 2QY9A 4HRAA 4Y9UA 3WLSA 4C7OB 2HPAA 2Q2QA 1E0DA 4M22A 1CUIA 2A9JA 3O7WA 2FP3A 3O90A 1D03A 4OAQA 4OMCA 3BTUA 2AF3C 1QAOA 4RQAA 3SLRA 4B76A 1H8HA 3JQPA 3JQBA 1A9QA 3FYDA 1J1ZA 4REQA 4DQDA 4LTMA 1E0JA 3W9UA 4Q4HA 1BCRB 1NW4A 2O7QA 2PZAA 1YJQA 3K7EA 1DRVA 2PD4A 3O3OB 4KI0A 3SFTA 1G7TA 2X8BA 5DYIA 4DKJA 1AO0A 1E2BA 2WD7A 1R6VA 2YXDA 4X24A 4RK6A 3AUYA 3TZKA 1F2VA 1K98A 1B0ZA 1SU4A 3ZWAA 3GUYA 4TUYF 1JMKC 2A7XA 1O1YA 2P9YA 2GJ9A 1P29A 3L7CA 2WD7B 4RGBA 2QM8A 3UJCA 4MB2A 5KREA 3LQRA