5A4UA

Atgstf2 from arabidopsis thaliana in complex with indole-3-aldehyde
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
211
structure length
211
Chain Sequence
b'AGIKVFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKLFTERPRVNEWVAEITKRPASEKVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE F2
publication title Structural evidence for Arabidopsis glutathione transferase AtGSTF2 functioning as a transporter of small organic ligands.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 84
structure length 211
sequence length 211
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5a4uA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5a4uA01
1W4VA 3LYPA 1SJZA 3M8NA 3Q19A 4KNDA 1LBKA 1HD2A 3EWLA 2I1UA 2B7JA 4O32A 3Q18A 2KP2A 2YJHA 4JR6A 1T4ZA 1E2YA 4CDOA 3D22A 3ZVJD 4NAXA 2JADA 1H75A 2JU5A 1O73A 4I8BA 1LJRA 2C0EA 2RUEA 5G5FA 4YQVA 1GSUA 3H4KA 3HVXA 4PX1A 4Q5QA 3R3EA 5H5RA 3TOUA 2HE3A 1XW6A 5F8BA 2V6OA 2YOIA 3F0IA 4AF2A 1F6MC 4N11A 5GSTA 2IMFA 1DE1A 5AIXA 4ZL9A 1EGRA 1OYJA 5IMAA 3TKQA 4GSSA 1TK8B 4IP6A 3QMXA 2M46A 4TR1A 4KH7A 4TN8A 3D5JA 2CZ2A 4GSTA 4MMMA 1GUKA 1GSEA 2R6KA 3F4RA 4IS0A 4HU7A 4J2FA 5BMUA 2BJXA 5C00A 4HZ2A 2KLXA 3ZL5A 2VD0A 2UZ8A 3SWLA 1VRSD 2VL2C 2R3XA 3UMAA 2RUFA 3HD5A 4HEA2 3UOMA 2WULA 3H79A 2O85A 5IIZA 1YF0A 3P2AA 3I9V2 3RHBA 2EIQA 4KAEA 1BQ7A 2L4CA 2VOCA 3L0HA 1B48A 1GH2A 2H30A 1M9BA 4OCFA 3G7JA 3MDKA 5H5QA 3D4MA 2PPTA 4JEDA 1IYHA 1R5PA 5CO3A 2HLSA 2A2RA 4OMVA 1DBYA 1U88A 1TRWA 4NV2A 2I3YA 2LSTA 2H75A 1Z6NA 5EL8A 1TOFA 4XRDA 1T1VA 3ME8A 1A8LA 2O8VB 3KGKA 3UJ1A 4MF5A 5G30A 4ZL7A 2VL3A 5ECKB 2GSQA 3I6AA 3TOTA 1OC8A 2H70A 2FWFA 4EF0A 3G9BA 2A4VA 2JL4A 2K6VA 5L71A 3IC8A 2I4AA 2IMEA 2H71A 3GSSA 3O3TA 1FVKA 1FVJA 2HZEB 4QQ7A 3BD2A 1ABAA 3HJMA 4HQZA 4ZIJA 1SYRA 3QR6A 4QL9A 1AW9A 1MDKA 4MLYA 5IMFA 1ZGNA 3HJOA 3LXZA 3I43A 4USSA 3KH7A 2H6XA 3VLNA 1V57A 1HYUA 4POMA 3QDNA 2L6CA 4K7OA 3FYGA 4POKA 4ZB6A 2VM1A 3KM6A 5HR0A 2E2MA 4IQAA 4KCEA 5H5SA 1GNWA 5CRDA 3FR3A 1F2EA 3QFAC 1OC3A 4O7HA 4HU9A 2H74A 5KEJA 2MMZA 2OA7A 4MK3A 2DBCA 4FH8A 5ID2B 1EWXA 1JZRA 10GSA 1B8XA 2H76A 1S3CA 1Z9HA 3VK9A 4ZL8A 4MJAA 4G9HA 3N5OA 3TRXA 5ID2A 3KJYA 2KOKA 1OC9A 2ON5A 2P0GA 2WS2A 3US3A 2OE3A 2K9FA 2M80A 3GSTA 2YZUA 4HDEA 1THOA 2WB9A 5JWQB 1O7UA 2H72A 3KXOA 5DQSA 3BBYA 1ERUA 2GLRA 1K0BA 3A2VA 3L9SA 2HRKA 3TKSC 4BWSA 1GUHA 3K8NA 1WE0A 18GSA 1U3AA 3IPZA 4IW9A 1XPVA 4LL1B 1TU8A 5IOXA 1W89A 4ZB8A 1G6YA 2V1MA 1GP1A 1GWCA 4HZ4A 5IQYA 1K0OA 4OO5A 1XW9A 4IKHA 1AIUA 1THXA 3M0FA 1QUWA 2O87A 4ECIA 2C3TA 17GSA 2C3NA 3EYTA 3LG6A 4JRRA 1K3YA 4E8EA 1JFUA 4WBRD 1NHOA 4HQSA 4LMVA 2LQOA 1UVZA 3IHQA 4I6XA 4XTSA 5HFGA 3VURA 3P7XA 2PN8A 2B5EA 3EMPA 4XRAA 5ECIB 3GUSA 2LEGA 3ZMLA 4YH2A 4V1Ag 1DE2A 4PQHA 2DJJA 4MP4A 1X5CA 4PUFC 2GSSA 2DLXA 2GSRA 1SU9A 2F9SA 2IFQB 2H1DA 1MTCA 8GSSA 3A5WA 3VI5A 3LJRA 4XS4A 4WEYA 1FW1A 2LUSA 4IP1A 3UVHA 4K0GA 1FB6A 1ZMAA 2P5QA 5F0GA 4K2DA 4MH2A 4L5LA 4OO4A 1ST9A 3ZFLA 3FR9A 4KX4A 4K9ZA 1ZZYA 2DJKA 3P90A 3HA9A 3MWHA 2H1AA 3U5RE 3ZREA 2VCVA 3TJKA 3PR8A 3C7MA 1SK1A 3O76A 4EC0A 5D9VA 3MAKA 1XBSA 3EINA 1RW1A 1K0AA 1VF1A 3HYPA 2LTKA 4MZWA 4PGTA 2GZYA 3APOA 3RAZA 4ISDA 2LNTA 5J4UA 4TKYA 3VFIA 2HXKA 1PGTA 5AIVA 1ERVA 3TKRA 4BWQA 1GTUA 2RM5A 2FY6A 2DSAA 1B9XC 5KN2A 1G6WA 4IN0A 2ZUPA 5G1LA 3GH6A 3GKMA 3E9JB 5IMVA 3KP8A 4DSSB 1T3BA 3ZMKA 1WMJA 4LMWA 4KDXA 5KN3A 3TB2A 4FO5A 4F2IA 2CAIA 4DSSA 4JBBA 2LRNA 4ECCA 3IXRA 1AQWA 1GTAA 3GL3A 2JZSA 4GSNA 3R2QA 3WT1A 1K0NA 1SL2B 2GT5A 5EPFA 2DC5A 5J5NA 4L0UA 2GGTA 1K3LA 2IN3A 4O5RA 2CX4A 4EL1A 2OADA 1NSWA 3PPUA 4YQMA 4WXTA 1YY7A 5ELAA 5A4WA 5CAXA 3TJJA 4D73B 4BVXA 3UL3A 2YANA 1O81A 2P31A 1WIKA 3DEXA 5B7CA 3NZNA 4POLA 5DALB 5DAKB 3CSJA 2IPAA 4ZBBA 1GSFA 3D0ZA 1ZOFA 3SBCA 4BA7A 2I81A 5AGYA 4Z7XA 2VM2A 1T8EB 1TXXA 5E4WA 7GSSA 1XW5A 1M7TA 3ED3A 1R26A 1MEKA 4HJMA 1KTEA 2MZCA 1QXHA 4GRFA 2JSYA 1URMA 3ZFBA 2V6KA 2B5XA 5ECQB 3EU4A 3GH9A 2LNSA 5G5EA 2BTOT 3O6TA 2LV3A 2QGVA 3TRPA 22GSA 4GLTA 5EY6A 3HDCA 3V1WA 1IYIA 1ERTA 4KDYA 2OBIA 1X0RA 3F9UA 3WGDA 2FUG2 4GCIA 1V40A 3M9KA 2HRAA 1WP0A 3RDWA 3W6GA 5D8IA 2VAFA 1O8WA 4TR1B 2F8FA 4PQ1A 1A23A 2WJUA 4TXOA 5F05A 1HNAA 5COHA 1MD4A 3HZ8A 3ISOA 2AJQB 4ZXGA 3FHKA 3Q6OA 1PN9A 2XPDA 6GSYA 2HZFA 2GVPA 2JACA 3KD0A 4ML1A 2HFDA 2PUKC 1XOBA 3PINA 5J9BA 1RQMA 3DVXA 1XIYA 3F63A 5FHIA 3C71A 1XWKA 3OR5A 2GDRA 3IBHA 4MABA 1X9WB 4MCUA 14GSA 3GKXA 5IM9A 4K7NA 2XBIA 1Z7PA 5HFKA 1J08A 1XVWA 4ULXA 4V2NA 4ZB9A 3MSZA 4IGJA 2L4QA 1SJIA 1SENA 3VWUA 3LWAA 1F37A 4X43A 1FO5A 2JSZA 1ACVA 1FG4A 4CW9A 4KSMA 1GUMA 2ALBA 3VI7A 2DIYA 4MJBA 4RI7A 1ZYEA 1XWCA 4MA9A 3KTLA 4WF4A 2N5FA 1JZWA 4WKWA 1NHYA 3J7Yb 5CREA 2K8VA 3ME7A 2NDOA 2YPMA 4RI6A 4OCEA 1XCCA 2H1BA 4PNFA 4K7IA 5D96A 3D4TA 3DYRA 3GNJA 1K3OA 1BG5A 2JZRA 5DDLA 4GWRA 2GS3A 2FA4A 1F3BA 2H6YA 5D9TA 2LRTA 2IMDA 2L57A 4WETA 5HQPA 5CRWA 2CVDA 3FKFA 5JCUA 3MNGA 4YAPA 1ZCPA 2YV9A 1M2BA 2DJ2A 4DEJA 3RBTA 3NIVA 4POBA 5IPHA 1X5DA 4H86A 1AUCA 3QD9A 3LFLA 1AQVA 2VUPA 4OFNA 1GNEA 3A3TA 4KCAA 5AN1A 1PD21 2R37A 3F3RA 2L5LA 3APSA 1WWJA 2DIZA 4KF9A 4Q5RA 5GSSA 2A2SA 4N0VA 4ILFA 1Z6MA 4MZBA 3QPMA 5C04A 1PL2A 2IJYA 3GX8A 3PH9A 4GQCA 5ECPB 1OC9B 2E7PA 3TGZA 4GQFA 1R5AA 2K18A 3GURA 2IMKA 2GT6A 3FZ4A 4ZBAA 3LGCA 2LJKA 4IVFA 2YWOA 3KZQA 3C8EA 2H66A 1U87A 1FOVA 3WGXA 1YEXA 5KN1A 4TOPA 2HRKB 1U6TA 3GMFA 2YWMA 1G0TA 3QAVA 3GA4A 2VIMA 3L9VA 1E6BA 3ZIVA 2OE1A 3UBLA 1N8JA 4MJCA 12GSA 2MBSA 3Q74A 4HOJA 3EMXA 3DMLA 1AC1A 4BVYB 1QK8A 1R4WA 4NXIA 5A4VA 1X9SB 4HJ2A 2C0FA 3D6IA 2DJ1A 3GTUA 1PRXA 2IMIA 4RQXA 3VWWA 1SD8A 5E59A 4EVMA 4BVYA 4PUAA 4ZBDA 1VF3A 2WDUA 2WFCA 1EOGA 2GQKA 2VCZA 2O89A 2OJLA 2FWEA 4WR4A 2HSHA 4NV5A 1LU4A 2AYTA 3F6FA 5ECRB 1O85A 2LKUA 9GSSA 1A2JA 5IMCA 2D2ZA 2R4VA 1OVNA 2MMOA 5GAND 1A2LA 5IPGA 1YKCA 3A2WA 1GSQA 4XCSA 1OAZA 4QL7A 4HS1A 3ERFA 2EIRA 3U6VA 4XS4B 4OWYA 2GTUA 4NHZA 1A2MA 3F4TA 1GL8A 3GX0A 2HSYA 3JCML 4BPYA 5F06A 2DMLA 4EUYA 1F3AA 4G2EA 1TW9A 1GSSA 3M9JA 1M9AA 1I9DA 1TP9A 3RPPA 3QOUA 3CYNA 4AJ7A 2JZTA 1TI3A 4I97A 5G31A 3LYKA 3ZITA 3A2XA 3IDVA 2H19A 4TR4A 2E2GA 2HNLA 1XWGA 3IC4A 2J9HA 4AJ8A 3FK8A 1ML6A 4IBPA 2XPEA 1TK0B 3ERWA 13GSA 4JE1A 4FQUA 16GSA 4HI7A 1GRXA 3FR6A 3G7IA 1SJ6A 4ECJA 4PXOA 2C80A 1EP8A 3TKSA 1JHBA 3D21A 5J41A 5B6MA 2C1YA 1SK0A 1Z7RA 3DKSA 3W8JA 3TRQA 1KEBA 4IJ3A 2OE0A 5G2ZA 1Z5YE 2IWTA 1S3DA 2R5GA 2NPBA 2H01A 1S3AA 1QQ2A 1Q4JA 1VF2A 2CVBA 2H6ZA 3H93A 1VGLA 2NVLA 1PQNA 2RLIA 3M1GA 5A5KA 1K0MA 1XXUA 3DD3A 2ZCTA 3GKNA 1I5GA 2GZZA 4LA1A 2H0GA 1XVQA 2X64A 3APQA 1CQGA 4GTUA 4TR0A 1T00A 1GLQA 5CRHA 4KB3A 5D9XA 2FCHA 5DCHA 3M3MA 1EZKA 3DGQA 2CV4A 3UBKA 2ZNMA 4F82A 5LNKe 1PX7A 5D73A 2M72A 2G2QA 1GTIA 4GF0A 1EEJA 3HXSA 4KA0A 2F3MA 5J9CA 4DVCA 4ID0A 1YZXA 2GQLA 5ECMB 3UAPA 3WT2A 2L5OA 3C73A 1MDJA 2R2JA 2HT9A 2B1KA 2F51A 4BL7A 4BVXB 1A0FA 4PNGA 2K8SA 2IIYA 2VLUA 6GSUA 2NBSA 3BOAA 5DJMA 2CVKA 2LRCA 3CSHA 2VO4A 2FD3A 4IQ1A 4AJ6A 4L8EA 3VPTA 4GXZA 1SL0B 4XS1A 4XIHA 3BJ5A 3ZRDA 3NOFA 4KSOA 1BEDA 1Y6EA 1PKZA 4YAVA 4EKZA 4L0WA 1WOUA 2RIIA 1GULA 2YP6A 1TRSA 4TRXA 3ZZXA 4TW5A 3EVIA 4WF5A 3EURA 5D9WA 2CAQA 2OKAA 5AISA 3BCKA 4FYBA 3DWVA 1WJKA 3FZ9A 5J3RA 3HVVA 3HY2A 2EC4A 3ZTLA 1A24A 4K0NA 1DSBA 2VL9A 4X0XA 3H8QA 3UVTA 5JWOB 5ELGA 20GSA 2YJ7A 1MD3A 2KUCA 2B1LA 2HSMA 4LL4B 1DUGA 1RK4A 4TXVA 3LXTA 3H1NA 3HVSA 3QCPA 2YZHA 3E0UA 1XOAA 1C72A 1V9WA 4TXOB 1EOHA 2V41A 3BCIA 1H4OA 1M0UA 3IAS2 2OBKA 2C0GA 2YN1A 3IK9A 5JCGA 1PMTA 3KMOA 4OFMA 1Y25A 2VCXA 4EDZA 4IELA 4YQUA 2C8UA 2MBTA 2Z9SA 4EDYA 4MZCA 1G7EA 4PTSA 4MPFA 2X8HA 1CQHA 4OD7A 1O6JA 3F6DA 1F9MA 2C0DA 3TCOA 5LD0A 2F8AA 2AAWA 2PVQA 3CXGA 5A4UA 2CA8A 4PURA 1UA5A 2WCIA 5LCZA 1O8XA 4TR3A 2VLTA 3IE3A 4G19A 4RQRA 2FLSA 2TIRA 4F9ZA 2YV7A 1YKAA 4E8HA 5HR3A 1OE7A 5ENUA 2EIOA 3ZVJA 2AUVA 1JZDA 2V2GA 1SKSB 1B4PA 3CTGA 2VCQA 1ZYQB 2AHEA 3C1RA 3KMNA 3KTBA 3EE2A 1BAYA 2VCTA 4ACSA 2PBJA 2RM6A 1NM3A 5DVBA 1B9YC 3IOSA 3FZ5A 1PKWA 2GQMA 3IRAA 2YCDA 4IJIA 2PGTA 4WBJA 2IL3A 2P5RA 3FW2A 3VWXA 3CSIA 5IMZA 5JCWA 3FRCA 5DQYA 3N9JA 3GV1A 6GSTA 3WGEA 5GAPD 5ABRA 4G10A 4K6XA 5B8AA 1FHEA 3VPQA 4ZILA 2WRTA 1VF4A 1Q98A 3CBUA 3LQ7A 1NW2A 1YQ1A 1FAAA 3TJBA 3I69A 1B4QA 5CNWA 4MF7A 2AV4A 3HHVA 2PERA 3UARA 3CMIA 2B6MA 2B3SA 2AB6A 4Q5NA 4AGSA 2G0FA 1PSQA 2QKEA 3L78A 4I2UA 11GSA 5FWGA 4OFTA 2TRXA 1WPIA 2HZEA 3IV4A 4XHMA 5FT3A 2VLVA 1TDIA 3CRTA 1GSDA 4KW6A 3J7Yk 2DJ3A 3FEUA 1TTZA 3ERGA 3RHCA 5KN0A 3GFKA 2VL2A 4WR5A 2X8GA 2PU9C 1MDIA 4I5QA 4KUNA 2H1GA 3HJPA 5B8BA 4G0LA 5D93A 3PGTA 4ML6A 2I9HA 2BMXA 6GSWA 5GZZB 2H8LA 4DSRA 4MDCA 4I2TA 2GSTA 2FGXA 3HZ4A 1EV9A 2ES7A 5ECOB 5CYYA 5ECLB 2LS5A 4EO3A 3GIXA 5DJLA 3KEBA 1BJXA 2LJRA 4NPBA 2H0HA 2WZ9A 2E0QA 3E3EA 1V2AA 3KIJA 3GTUB 2MMAA 4EXJA 5DCGA 2WGRA 1YDKA 2VD1A 1T7PB 4FIWA 5ECNB 3ZIJA 4N10A 1SKRB 4FYCA 4NWYA 4V2MA 2N5AA 1GTBA 3GYKA 4DSQA 1QMVA 5JWRB 2XC2A 2HQTA 4MJEA 1SKWB 5G1KA 3LEFA 4J56E 3GL5A 6GSXA 1ZL9A 4KDUA 2ON7A 1HNCA 4KE3A 1A8YA 2LJAA 2LQQA 3CTFA 2NTOA 2DMMA 1R7HA 1AQXA 3WD6A 4NHWA 5F07A 1TKDB 3F4SA 4X1UA 2HSNB 1TI1A 1QGVA 1JZOA 1USBA 3LSZA 3EU3A 5IO2A 5ECSA 4P3YB 1EP7A 1K0DA 3TUEA 6GSSA 4RUVA 2QSIA 2OACA 2H73A 1SK2A 5HR1A 2X99A 2XHFA 3ZYWA 1SL1B 3GHAA 19GSA 4FYUA 3C1SA 3CRUA 3F3QA 1TK5B 2YNXA 3IR4A 1GLPA 4NMUA 4KGIA 4K1FA 2QC7A 2H0IA 1PL1A 3KP9A 1WRYA 3ZLPA 3IK7A 4MPGA 3UIWA 2HRNA 1XWAA 1PA3A 2IFQA 4CHSA 3VWVA 3TKPA 3HKRA 5IO0A 2YWIA 1V58A 4LLRA 2PVOC 2FA8A 4V1Ap 2HYXA 1KBNA 5HR2A 3GN3A 1U3IA 1YF1A 1YJ6A 1BX9A 5INYA 4TVEA 4V2LA 3TJFA 2C3QA 2J23A 1K0CA 3DRNA 3L4NA 3GRXA 1SYXA 1HNBA 1X5EA 1PX6A 5CRGA 1A0RP 3KH9A 1TRUA 1M99A 2FWHA 4F0CA 2REMA 1GSYA 2L59A 1TU7A 1ILOA 2CZ3A 1G7OA 1J9BA 1OE8A 4Q5FA 1SD9A 3RPNA 4L5OA 1FB0A 2L6DA 1JLVA 1BYEA 3TJGA 1TJDA 1X9MB 1XFLA 3P8WA 1M2AA 4MF6A 4ECBA 3FY7A 3IA1A 2FNOA 2HI7A 2HRFA 2MMNA 2O7KA 4MH3A 2B5YA 6GSVA 1ON4A 4BL7B 3FZAA 1HQOA 3AY8A 2FWGA 2GZPA 4G0IA 1Z3EA 3UEMA 2MYGA 1UN2A 2CX3A 5IMDA 5EVOA 4IHUA 1V98A 4J57E 1JLWA 2N5BA 4EE0A 2V32A 5HFIA 3TDGA 2X8CA 3DXBA 1ERWA 4K8MA 3WYWA 2VCWA 3DIEA 2XBQA 1N2AA 4F0BA 4PQIA 1T4YA 4HUAA 3DVWA 1M2DA 1XZOA 5IOWA 3W8SA 2CQ9A 3L9UA 1EGOA 2PMTA 3F8UA 2TRCP 5CP1A 4JR4A 5ECHB 1TRVA 2DJ0A 1KNGA 4O92A 3HCZA 3QFBC 4N0ZA 4G0KA 3S9FA 2KP1A 2B7KA 3IAM2 1YEPA 4JU5A 1AAZA 3LORA 5B6NA 1J0FA 5DBQA 4F03A 2C4JA 4D73A 1EEMA 3G7YA 3KCMA 1OKTA 3QAWA 2KHPA 3EC3A 1QFNA 3QAGA 1XWBA 3TKSE 2HSMB 2CT6A 2YWNA 4JZQA 1UC7A 3GKKA 1OKDA 2PWJA 5DALA 2FHEA 4N30A 4XS6A 1AXDA 1EV4A 5DAKA
chains in the Genus database with same CATH superfamily
1W4VA 3LYPA 1SJZA 3M8NA 3Q19A 4KNDA 1LBKA 1HD2A 1SVOA 3EWLA 2I1UA 2B7JA 4O32A 5A1NA 3Q18A 2KP2A 2YJHA 4JR6A 1T4ZA 1E2YA 4CDOA 3D22A 3ZVJD 4NAXA 2JADA 1H75A 2JU5A 1O73A 4I8BA 1LJRA 2C0EA 2RUEA 5G5FA 4YQVA 1GSUA 3H4KA 3HVXA 4PX1A 4Q5QA 3R3EA 5H5RA 3TOUA 2HE3A 1XW6A 5F8BA 2V6OA 2YOIA 3F0IA 4AF2A 1F6MC 4N11A 5GSTA 2IMFA 1DE1A 5AIXA 4ZL9A 1EGRA 1OYJA 5IMAA 3TKQA 4GSSA 1TK8B 4IP6A 3QMXA 2M46A 4TR1A 4KH7A 4TN8A 3D5JA 2CZ2A 4GSTA 4MMMA 1GUKA 1GSEA 2R6KA 3F4RA 4IS0A 4HU7A 4J2FA 5BMUA 2BJXA 5C00A 4HZ2A 2KLXA 3ZL5A 2VD0A 2UZ8A 4BIKA 3SWLA 1VRSD 2VL2C 2R3XA 3UMAA 2RUFA 3HD5A 4HEA2 3UOMA 2WULA 3H79A 2O85A 5IIZA 1YF0A 3P2AA 3I9V2 3RHBA 2EIQA 4KAEA 1BQ7A 2L4CA 2VOCA 3L0HA 1B48A 1GH2A 2H30A 1M9BA 4OCFA 3G7JA 3MDKA 5H5QA 3D4MA 2PPTA 4JEDA 1IYHA 1R5PA 5CO3A 2HLSA 2A2RA 4OMVA 1DBYA 1U88A 1TRWA 4NV2A 2I3YA 2LSTA 2H75A 1Z6NA 5EL8A 1TOFA 4XRDA 1T1VA 3ME8A 1A8LA 2O8VB 3KGKA 3UJ1A 4MF5A 5G30A 3LW9A 4ZL7A 2VL3A 5ECKB 2GSQA 3I6AA 3TOTA 1OC8A 2H70A 2FWFA 4EF0A 3G9BA 2A4VA 2JL4A 2K6VA 5L71A 3IC8A 2I4AA 2IMEA 2H71A 1XG8A 3GSSA 3O3TA 1FVKA 1FVJA 2HZEB 4QQ7A 3BD2A 1ABAA 3HJMA 4HQZA 4ZIJA 1SYRA 3QR6A 3CHXC 4QL9A 1AW9A 1MDKA 4MLYA 5IMFA 1ZGNA 3HJOA 3LXZA 3I43A 4Z2RA 4USSA 3KH7A 2H6XA 3VLNA 1V57A 1HYUA 4POMA 3QDNA 2L6CA 4K7OA 3FYGA 4POKA 4ZB6A 2VM1A 3KM6A 5HR0A 2E2MA 4IQAA 4KCEA 5H5SA 1GNWA 5CRDA 3FR3A 1F2EA 3QFAC 1OC3A 4O7HA 4HU9A 2H74A 5KEJA 2MMZA 2OA7A 4MK3A 2DBCA 4K5SA 4FH8A 5ID2B 1EWXA 1JZRA 10GSA 1B8XA 2DKIA 2H76A 1S3CA 1Z9HA 3VK9A 4ZL8A 4MJAA 4G9HA 3N5OA 3TRXA 3HVNA 5ID2A 3KJYA 4PI2C 2KOKA 1OC9A 2ON5A 2P0GA 2WS2A 3US3A 2OE3A 1I1IP 2K9FA 4AKIA 2M80A 3GSTA 2YZUA 4HDEA 1THOA 2WB9A 5JWQB 2EFEA 1O7UA 2H72A 3KXOA 5DQSA 3BBYA 1ERUA 2GLRA 1K0BA 3A2VA 3L9SA 2HRKA 2O36A 3TKSC 4BWSA 1GUHA 3K8NA 1WE0A 18GSA 1U3AA 3IPZA 4IW9A 1XPVA 4LL1B 4G01A 1TU8A 5IOXA 5J47A 1W89A 4ZB8A 1G6YA 2V1MA 1GP1A 1GWCA 4HZ4A 5IQYA 1K0OA 4OO5A 1XW9A 4IKHA 5J4YA 1AIUA 1THXA 3M0FA 1QUWA 2O87A 5A5HA 4ECIA 2C3TA 2OT3A 17GSA 4O5QA 2C3NA 4X4JA 3EYTA 3LG6A 4AKGA 4JRRA 1K3YA 4E8EA 1JFUA 4WBRD 1NHOA 2WW2A 4LMVA 4HQSA 2LQOA 1UVZA 3IHQA 4I6XA 4XTSA 5HFGA 3VURA 3P7XA 2PN8A 2B5EA 3EMPA 4XRAA 4ICYA 5ECIB 3GUSA 2LEGA 3ZMLA 4YH2A 4V1Ag 1DE2A 4PQHA 2DJJA 4MP4A 1X5CA 4PUFC 2GSSA 2DLXA 2GSRA 1SU9A 2F9SA 2IFQB 2H1DA 1MTCA 8GSSA 3A5WA 3VI5A 3LJRA 4XS4A 4WEYA 1FW1A 2R0CA 2LUSA 4IP1A 3UVHA 4K0GA 1FB6A 1ZMAA 2P5QA 5F0GA 4K2DA 4MH2A 4L5LA 4OO4A 1SVMA 1ST9A 3ZFLA 3FR9A 4KX4A 4K9ZA 1ZZYA 2DJKA 2WW3A 3P90A 3HA9A 3MWHA 2WVXA 2H1AA 3U5RE 3ZREA 2VCVA 3TJKA 3HMJG 3PR8A 3C7MA 1SK1A 3O76A 4EC0A 5D9VA 3MAKA 1XBSA 3EINA 1RW1A 4N3ZA 1K0AA 1VF1A 3HYPA 2LTKA 4MZWA 4PGTA 2GZYA 3APOA 3RAZA 4ISDA 2LNTA 5J4UA 4TKYA 3VFIA 2HXKA 1PGTA 5AIVA 1ERVA 3TKRA 4BWQA 1GTUA 2RM5A 2FY6A 2DSAA 1B9XC 5KN2A 1G6WA 2DKHA 4IN0A 2ZUPA 5G1LA 3GH6A 3GKMA 3CWGA 3E9JB 5IMVA 3KP8A 4PHZC 4DSSB 1T3BA 3ZMKA 1WMJA 2H1LA 4LMWA 4KDXA 4AI6A 5KN3A 3TB2A 4FO5A 4F2IA 2CAIA 4DSSA 4W66A 4JBBA 2LRNA 4ECCA 3IXRA 1AQWA 1GTAA 3GL3A 2JZSA 4GSNA 3R2QA 3WT1A 1K0NA 1SL2B 2GT5A 5EPFA 2DC5A 5J5NA 4L0UA 2GGTA 1K3LA 2IN3A 4O5RA 2CX4A 4EL1A 2OADA 1NSWA 3PPUA 4YQMA 4WXTA 1YY7A 5ELAA 2WW0A 5A4WA 5CAXA 3TJJA 4D73B 4BVXA 3UL3A 2YANA 1O81A 2P31A 1WIKA 3DEXA 5B7CA 3NZNA 4POLA 5DALB 5DAKB 3CSJA 2IPAA 4ZBBA 1GSFA 3D0ZA 1ZOFA 3SBCA 4BA7A 2I81A 5AGYA 4Z7XA 2VM2A 1T8EB 1TXXA 5E4WA 5A1NB 7GSSA 1XW5A 1M7TA 3ED3A 1R26A 1MEKA 4HJMA 1KTEA 1N25A 2MZCA 1QXHA 4GRFA 2JSYA 1URMA 3ZFBA 2V6KA 2B5XA 5ECQB 3EU4A 3GH9A 2WW1A 4YKGA 2LNSA 5G5EA 2BTOT 3O6TA 2LV3A 2QGVA 3TRPA 22GSA 4GLTA 5EY6A 3HDCA 3V1WA 1IYIA 1ERTA 4KDYA 2OBIA 1X0RA 3F9UA 3WGDA 2FUG2 4GCIA 1V40A 3M9KA 2HRAA 1WP0A 3RDWA 3W6GA 5D8IA 2VAFA 1O8WA 4TR1B 2F8FA 4PQ1A 1A23A 2WJUA 4TXOA 5F05A 1HNAA 5BMUB 5COHA 1MD4A 3HZ8A 3ISOA 4A5PA 2AJQB 4ZXGA 3FHKA 3Q6OA 1PN9A 5A34A 2XPDA 6GSYA 4QMKA 2HZFA 2GVPA 2JACA 3KD0A 4ML1A 2HFDA 2PUKC 2QA2A 1XOBA 3PINA 5J9BA 1RQMA 3DVXA 2QA1A 1XIYA 3F63A 5FHIA 3C71A 1XWKA 3OR5A 2GDRA 3IBHA 4MABA 1X9WB 4MCUA 14GSA 3GKXA 5IM9A 4K7NA 2XBIA 1Z7PA 5HFKA 1J08A 1XVWA 4ULXA 3RFRC 4V2NA 4ZB9A 3MSZA 4IGJA 2L4QA 1SJIA 1SENA 3VWUA 3LWAA 1F37A 4X43A 1FO5A 2JSZA 1ACVA 1FG4A 4CW9A 4KSMA 1GUMA 4O5UA 2ALBA 3VI7A 2DIYA 4MJBA 4RI7A 1ZYEA 1XWCA 4MA9A 3FMWA 3KTLA 4WF4A 2N5FA 4AKHA 1JZWA 4WKWA 1NHYA 3J7Yb 5CREA 2K8VA 3ME7A 2NDOA 2YPMA 4RI6A 4OCEA 1XCCA 2H1BA 4EIPA 3MYDA 4PNFA 4K7IA 5D96A 3D4TA 3DYRA 3GNJA 1K3OA 1BG5A 2JZRA 5DDLA 4GWRA 2GS3A 2FA4A 1F3BA 2H6YA 5D9TA 2LRTA 2IMDA 2L57A 4WETA 4PI0C 5HQPA 5CRWA 2CVDA 3FKFA 5JCUA 3MNGA 4YAPA 1ZCPA 2YV9A 1M2BA 2DJ2A 4DEJA 3RBTA 3NIVA 4POBA 5IPHA 1X5DA 4H86A 1AUCA 3QD9A 3LFLA 1AQVA 2VUPA 4OFNA 1GNEA 3A3TA 4KCAA 5AN1A 1PD21 4MNNA 2R37A 3F3RA 2L5LA 3APSA 1WWJA 2DIZA 4KF9A 4Q5RA 5GSSA 2A2SA 4N0VA 4ILFA 1Z6MA 4MZBA 3QPMA 5C04A 1PL2A 2IJYA 3GX8A 3PH9A 4GQCA 5ECPB 1OC9B 2E7PA 3TGZA 4GQFA 1R5AA 2O5VA 2K18A 3GURA 2IMKA 1M3JA 2GT6A 3FZ4A 1ZYNA 4ZBAA 3LGCA 2LJKA 4IVFA 2YWOA 3KZQA 3C8EA 2H66A 1U87A 1FOVA 4E68A 1YEXA 3WGXA 5KN1A 4TOPA 2HRKB 1U6TA 3GMFA 2YWMA 1G0TA 3QAVA 3GA4A 2VIMA 2EFCA 3L9VA 1E6BA 3ZIVA 2OE1A 3UBLA 1N8JA 4MJCA 12GSA 2MBSA 3Q74A 4HOJA 3EMXA 3DMLA 1AC1A 4BVYB 1QK8A 1R4WA 4NXIA 5A4VA 1X9SB 5A5HB 4HJ2A 2C0FA 3D6IA 2DJ1A 3GTUA 1PRXA 2IMIA 4RQXA 3VWWA 1TXUA 1SD8A 5E59A 4EVMA 4BVYA 4PUAA 4ZBDA 1VF3A 2WDUA 2WFCA 1EOGA 2GQKA 2VCZA 2O89A 2OJLA 2FWEA 4WR4A 2HSHA 4NV5A 1LU4A 2AYTA 3F6FA 5ECRB 4ZB7A 1O85A 2LKUA 9GSSA 1A2JA 5IMCA 2EFDA 2D2ZA 2R4VA 1OVNA 2MMOA 5GAND 1A2LA 5IPGA 1YKCA 3A2WA 1GSQA 4XCSA 1OAZA 4QL7A 1S4BP 4HS1A 3ERFA 2EIRA 3U6VA 4XS4B 4OWYA 2GTUA 4NHZA 1A2MA 3F4TA 1GL8A 3GX0A 2HSYA 3JCML 4BPYA 5F06A 2DMLA 2HSNA 4EUYA 1F3AA 4G2EA 1TW9A 1GSSA 3M9JA 1M9AA 1I9DA 1TP9A 3RPPA 3QOUA 3CYNA 4AJ7A 2JZTA 1TI3A 4Z2TA 4I97A 5G31A 3LYKA 3ZITA 3A2XA 3IHGA 3IDVA 2H19A 4TR4A 1YEWC 2E2GA 2HNLA 2WVXB 1XWGA 3IC4A 2J9HA 4AJ8A 3FK8A 1ML6A 4IBPA 2XPEA 1TK0B 3ERWA 13GSA 4JE1A 4FQUA 16GSA 4HI7A 1GRXA 3FR6A 3G7IA 1SJ6A 4ECJA 4PXOA 2C80A 1EP8A 3TKSA 1JHBA 3D21A 5J41A 5B6MA 1BG1A 2C1YA 1SK0A 1Z7RA 3DKSA 3W8JA 3TRQA 1KEBA 4IJ3A 2OE0A 5G2ZA 1S3RA 1Z5YE 2IWTA 1S3DA 2R5GA 2NPBA 2H01A 2O3EA 1S3AA 1QQ2A 1Q4JA 1VF2A 2CVBA 4CY6A 2H6ZA 3H93A 1VGLA 2NVLA 1PQNA 2RLIA 3M1GA 5A5KA 1K0MA 1XXUA 5KOWA 3DD3A 2ZCTA 3GKNA 1I5GA 2GZZA 4LA1A 2H0GA 1XVQA 2X64A 3APQA 1CQGA 4GTUA 4TR0A 1T00A 1GLQA 5CRHA 4KB3A 5D9XA 2FCHA 5DCHA 4AKXB 2UV8G 3M3MA 1EZKA 3DGQA 2CV4A 3UBKA 2ZNMA 4F82A 5LNKe 1PX7A 5D73A 2M72A 2G2QA 1GTIA 4GF0A 1EEJA 2X49A 3HXSA 4KA0A 2F3MA 5J9CA 4DVCA 4ID0A 1YZXA 2GQLA 5ECMB 3UAPA 3WT2A 2L5OA 3C73A 1MDJA 2R2JA 2HT9A 2B1KA 2F51A 4BL7A 4BVXB 1A0FA 4PNGA 2K8SA 2IIYA 2VLUA 6GSUA 2NBSA 3BOAA 5DJMA 2CVKA 2LRCA 3CSHA 2VO4A 2FD3A 4IQ1A 4AJ6A 4L8EA 3VPTA 4GXZA 2WVZA 1SL0B 4XS1A 4XIHA 3BJ5A 3ZRDA 3NOFA 4KSOA 1BEDA 1Y6EA 1PKZA 4YAVA 4EKZA 4L0WA 1WOUA 2RIIA 1GULA 2YP6A 1TRSA 4TRXA 3ZZXA 4TW5A 3EVIA 4WF5A 3EURA 1Y1UA 3MIXA 5D9WA 2CAQA 2OKAA 5AISA 3BCKA 4FYBA 3DWVA 1WJKA 3FZ9A 5J3RA 3HVVA 3HY2A 2EC4A 3ZTLA 1A24A 4K0NA 1DSBA 2VL9A 4HSCX 4X0XA 3H8QA 3UVTA 5JWOB 5ELGA 20GSA 2YJ7A 1MD3A 2KUCA 2B1LA 2HSMA 2R0GA 4LL4B 1DUGA 1RK4A 1ZYPA 2A2PA 4TXVA 3LXTA 3H1NA 3HVSA 3QCPA 2YZHA 3E0UA 1XOAA 1C72A 1V9WA 4TXOB 1EOHA 2V41A 3BCIA 1H4OA 1M0UA 3IAS2 2OBKA 2C0GA 1YVLA 2YN1A 1SVLA 3IK9A 5JCGA 1PMTA 3KMOA 4OFMA 1Y25A 2VCXA 5A34B 4EDZA 4IELA 4YQUA 2C8UA 2MBTA 2Z9SA 4EDYA 4MZCA 1G7EA 4PTSA 4MPFA 2X8HA 1CQHA 4OD7A 1O6JA 3F6DA 1F9MA 2C0DA 3TCOA 5LD0A 2F8AA 2AAWA 5KOXA 2PVQA 3CXGA 5A4UA 2CA8A 4PURA 5J40A 1UA5A 2WCIA 4K2XA 5LCZA 1O8XA 4TR3A 2VLTA 3IE3A 4G19A 4RQRA 2FLSA 2TIRA 4F9ZA 2YV7A 1YKAA 4E8HA 5HR3A 1OE7A 3CQFA 5ENUA 2EIOA 3ZVJA 2AUVA 1JZDA 2V2GA 1SKSB 1B4PA 3CTGA 2VCQA 1ZYQB 2AHEA 3C1RA 3KMNA 3KTBA 3EE2A 1BAYA 2VCTA 4ACSA 2PBJA 2RM6A 1NM3A 5DVBA 1B9YC 3IOSA 3FZ5A 1PKWA 2GQMA 3IRAA 5J4VA 2YCDA 4IJIA 2PGTA 2R0PA 4WBJA 2IL3A 2P5RA 2WZSA 3FW2A 3VWXA 3CSIA 5IMZA 5JCWA 3FRCA 5DQYA 3N9JA 3GV1A 6GSTA 3WGEA 5GAPD 5ABRA 4G10A 4K6XA 5B8AA 1FHEA 3VPQA 4ZILA 2WRTA 1VF4A 1Q98A 4YKFA 3CBUA 3LQ7A 1NW2A 1YQ1A 1FAAA 3TJBA 3I69A 1B4QA 5CNWA 4MF7A 2AV4A 3HHVA 2PERA 3UARA 3CMIA 2B6MA 2B3SA 2AB6A 4Q5NA 4AGSA 2G0FA 1PSQA 2QKEA 3L78A 4I2UA 11GSA 5FWGA 4OFTA 2TRXA 4EIQA 1WPIA 2HZEA 3IV4A 4XHMA 5FT3A 2VLVA 1TDIA 3CRTA 1GSDA 4KW6A 3J7Yk 2EFHA 2DJ3A 3FEUA 1TTZA 3ERGA 3RHCA 5KN0A 3GFKA 2VL2A 3A5IA 4WR5A 2X8GA 2PU9C 1MDIA 4I5QA 4KUNA 2H1GA 3HJPA 5B8BA 2VKZG 4G0LA 5D93A 3PGTA 4ML6A 2I9HA 2BMXA 1BF5A 6GSWA 5GZZB 4CY8A 2H8LA 4DSRA 4MDCA 4I2TA 2GSTA 2FGXA 3HZ4A 1EV9A 2ES7A 5ECOB 5BRTA 5CYYA 5ECLB 1FOHA 2LS5A 4EO3A 3GIXA 5DJLA 3KEBA 1BJXA 2LJRA 4NPBA 2H0HA 2WZ9A 2E0QA 3E3EA 2A4HA 1V2AA 3KIJA 3GTUB 2MMAA 4EXJA 5DCGA 2WGRA 1YDKA 2VD1A 1T7PB 4FIWA 5ECNB 3ZIJA 4N10A 1SKRB 4FYCA 4NWYA 4V2MA 2N5AA 1GTBA 3GYKA 4DSQA 1QMVA 5JWRB 2XC2A 2HQTA 4MJEA 1SKWB 5G1KA 3LEFA 3GL5A 4J56E 6GSXA 1ZL9A 4KDUA 2ON7A 1HNCA 4KE3A 1A8YA 2LJAA 2LQQA 3CTFA 2NTOA 2DMMA 1R7HA 1AQXA 3WD6A 4NHWA 5F07A 1TKDB 3F4SA 4X1UA 2HSNB 1TI1A 1QGVA 1JZOA 1USBA 3LSZA 3EU3A 5IO2A 5ECSA 4P3YB 1EP7A 1K0DA 3TUEA 6GSSA 4RUVA 2QSIA 2OACA 2H73A 1SK2A 5HR1A 2X99A 2XHFA 3ZYWA 1SL1B 3GHAA 19GSA 4FYUA 3C1SA 3CRUA 3F3QA 1TK5B 2YNXA 3IR4A 1GLPA 4NMUA 4KGIA 4K1FA 2QC7A 2H0IA 1PL1A 3KP9A 1WRYA 4FXYP 3ZLPA 3IK7A 4MPGA 3UIWA 2HRNA 1XWAA 1PA3A 2IFQA 4CHSA 3VWVA 3TKPA 3HKRA 5IO0A 2YWIA 1V58A 4LLRA 2PVOC 2FA8A 4V1Ap 2HYXA 1KBNA 5HR2A 3GN3A 1U3IA 1YF1A 1YJ6A 1BX9A 5INYA 2X4AA 4TVEA 4V2LA 3TJFA 2C3QA 2J23A 1K0CA 3EPTA 3DRNA 3L4NA 3GRXA 1SYXA 1HNBA 4GDFA 1X5EA 1PX6A 5CRGA 1A0RP 3KH9A 1TRUA 1M99A 2FWHA 4F0CA 2REMA 1GSYA 2L59A 1TU7A 1ILOA 2CZ3A 1G7OA 1J9BA 1OE8A 4Q5FA 1PN0A 1SD9A 3RPNA 4L5OA 1FB0A 2L6DA 1JLVA 1BYEA 3TJGA 1TJDA 1X9MB 1XFLA 3P8WA 1M2AA 4MF6A 4ECBA 3FY7A 3IA1A 2FNOA 2HI7A 2HRFA 2MMNA 2O7KA 4MH3A 2B5YA 6GSVA 1ON4A 4BL7B 3FZAA 4Z2UA 1HQOA 3AY8A 2FWGA 2GZPA 4G0IA 3TU3B 1Z3EA 3UEMA 2MYGA 1UN2A 2CX3A 5IMDA 5EVOA 1PFOA 4IHUA 1V98A 4J57E 1JLWA 2N5BA 4K5RA 3RGBC 4EE0A 1M3IA 2V32A 5HFIA 3TDGA 2X8CA 3DXBA 1ERWA 4K8MA 3WYWA 2VCWA 3DIEA 2XBQA 1N2AA 4F0BA 4PQIA 2WVYA 1T4YA 4HUAA 3DVWA 1M2DA 1XZOA 5IOWA 3W8SA 2CQ9A 3L9UA 1EGOA 2PMTA 3F8UA 2TRCP 5CP1A 4JR4A 5ECHB 1TRVA 2DJ0A 1KNGA 4O92A 3HCZA 3QFBC 4N0ZA 4G0KA 3S9FA 2KP1A 2B7KA 3IAM2 1YEPA 4JU5A 1AAZA 3LORA 5B6NA 1J0FA 5DBQA 4F03A 2C4JA 4D73A 1EEMA 3G7YA 3KCMA 1OKTA 3QAWA 2KHPA 3EC3A 1QFNA 3QAGA 1XWBA 3TKSE 2HSMB 2CT6A 2YWNA 4JZQA 1UC7A 3GKKA 1OKDA 2PWJA 5DALA 2FHEA 4N30A 4XS6A 1AXDA 1EV4A 5DAKA
chains in the Genus database with same CATH topology
1W4VA 3LYPA 1SJZA 3M8NA 3Q19A 4KNDA 1LBKA 1HD2A 1SVOA 3EWLA 2I1UA 2B7JA 4O32A 5A1NA 3Q18A 2KP2A 2YJHA 4JR6A 1T4ZA 1E2YA 4CDOA 3D22A 3ZVJD 4NAXA 2JADA 1H75A 2JU5A 1O73A 4I8BA 1LJRA 2C0EA 2RUEA 5G5FA 4YQVA 1GSUA 3H4KA 3HVXA 4PX1A 4Q5QA 3R3EA 5H5RA 3TOUA 2HE3A 1XW6A 5F8BA 2V6OA 2YOIA 3F0IA 4AF2A 1F6MC 4N11A 5GSTA 2IMFA 1DE1A 5AIXA 4ZL9A 1EGRA 1OYJA 5IMAA 3TKQA 4GSSA 1TK8B 4IP6A 3QMXA 2M46A 4TR1A 4KH7A 4TN8A 3D5JA 2CZ2A 4GSTA 4MMMA 1GUKA 1GSEA 2R6KA 3F4RA 4IS0A 4HU7A 4J2FA 5BMUA 2BJXA 5C00A 4HZ2A 2KLXA 3ZL5A 2VD0A 2UZ8A 3SWLA 1VRSD 2VL2C 2R3XA 3UMAA 2RUFA 3HD5A 4HEA2 3UOMA 2WULA 3H79A 2O85A 5IIZA 1YF0A 3P2AA 3I9V2 3RHBA 2EIQA 4KAEA 1BQ7A 2L4CA 2VOCA 3L0HA 1B48A 1GH2A 2H30A 1M9BA 4OCFA 3G7JA 3MDKA 5H5QA 3D4MA 2PPTA 4JEDA 1IYHA 1R5PA 5CO3A 2HLSA 2A2RA 4OMVA 1DBYA 1U88A 1TRWA 4NV2A 2I3YA 2LSTA 2H75A 1Z6NA 5EL8A 1TOFA 4XRDA 1T1VA 3ME8A 1A8LA 2O8VB 3KGKA 3UJ1A 4MF5A 5G30A 3LW9A 4ZL7A 2VL3A 5ECKB 2GSQA 3I6AA 3TOTA 1OC8A 2H70A 2FWFA 4EF0A 3G9BA 2A4VA 2JL4A 2K6VA 5L71A 3IC8A 2I4AA 2IMEA 2H71A 3GSSA 3O3TA 1FVKA 1FVJA 2HZEB 4QQ7A 3BD2A 1ABAA 3HJMA 4HQZA 4ZIJA 1SYRA 3QR6A 4QL9A 1AW9A 1MDKA 4MLYA 5IMFA 1ZGNA 3HJOA 3LXZA 3I43A 4Z2RA 4USSA 3KH7A 2H6XA 3VLNA 1V57A 1HYUA 4POMA 3QDNA 2L6CA 4K7OA 3FYGA 4POKA 4ZB6A 2VM1A 3KM6A 5HR0A 2E2MA 4IQAA 4KCEA 5H5SA 1GNWA 5CRDA 3FR3A 1F2EA 3QFAC 1OC3A 4O7HA 4HU9A 2H74A 5KEJA 2MMZA 2OA7A 4MK3A 2DBCA 4K5SA 4FH8A 5ID2B 1EWXA 1JZRA 10GSA 1B8XA 2DKIA 2H76A 1S3CA 1Z9HA 3VK9A 4ZL8A 4MJAA 4G9HA 3N5OA 3TRXA 5ID2A 3KJYA 2KOKA 1OC9A 2ON5A 2P0GA 2WS2A 3US3A 2OE3A 2K9FA 4AKIA 2M80A 3GSTA 2YZUA 4HDEA 1THOA 2WB9A 5JWQB 2EFEA 1O7UA 2H72A 3KXOA 5DQSA 3BBYA 1ERUA 2GLRA 1K0BA 3A2VA 3L9SA 2HRKA 3TKSC 4BWSA 1GUHA 3K8NA 1WE0A 18GSA 1U3AA 3IPZA 4IW9A 1XPVA 4LL1B 4G01A 1TU8A 5IOXA 5J47A 1W89A 4ZB8A 1G6YA 2V1MA 1GP1A 1GWCA 4HZ4A 5IQYA 1K0OA 4OO5A 1XW9A 4IKHA 5J4YA 1AIUA 1THXA 3M0FA 1QUWA 2O87A 5A5HA 4ECIA 2C3TA 2OT3A 17GSA 4O5QA 2C3NA 4X4JA 3EYTA 3LG6A 4AKGA 4JRRA 1K3YA 4E8EA 1JFUA 4WBRD 1NHOA 4LMVA 4HQSA 2LQOA 1UVZA 3IHQA 4I6XA 4XTSA 5HFGA 3VURA 3P7XA 2PN8A 2B5EA 3EMPA 4XRAA 4ICYA 5ECIB 3GUSA 2LEGA 3ZMLA 4YH2A 4V1Ag 1DE2A 4PQHA 2DJJA 4MP4A 1X5CA 4PUFC 2GSSA 2DLXA 2GSRA 1SU9A 2F9SA 2IFQB 2H1DA 1MTCA 8GSSA 3A5WA 3VI5A 3LJRA 4XS4A 4WEYA 1FW1A 2R0CA 2LUSA 4IP1A 3UVHA 4K0GA 1FB6A 1ZMAA 2P5QA 5F0GA 4K2DA 4MH2A 4L5LA 4OO4A 1SVMA 1ST9A 3ZFLA 3FR9A 4KX4A 4K9ZA 1ZZYA 2DJKA 3P90A 3HA9A 3MWHA 2H1AA 3U5RE 3ZREA 2VCVA 3TJKA 3HMJG 3PR8A 3C7MA 1SK1A 3O76A 4EC0A 5D9VA 3MAKA 1XBSA 3EINA 1RW1A 4N3ZA 1K0AA 1VF1A 3HYPA 2LTKA 4MZWA 4PGTA 2GZYA 3APOA 3RAZA 4ISDA 2LNTA 5J4UA 4TKYA 3VFIA 2HXKA 1PGTA 5AIVA 1ERVA 3TKRA 4BWQA 1GTUA 2RM5A 2FY6A 2DSAA 1B9XC 5KN2A 1G6WA 2DKHA 4IN0A 2ZUPA 5G1LA 3GH6A 3GKMA 3CWGA 3E9JB 5IMVA 3KP8A 4DSSB 1T3BA 3ZMKA 1WMJA 2H1LA 4LMWA 4KDXA 4AI6A 5KN3A 3TB2A 4FO5A 4F2IA 2CAIA 4DSSA 4W66A 4JBBA 2LRNA 4ECCA 3IXRA 1AQWA 1GTAA 3GL3A 2JZSA 4GSNA 3R2QA 3WT1A 1K0NA 1SL2B 2GT5A 5EPFA 2DC5A 5J5NA 4L0UA 2GGTA 1K3LA 2IN3A 4O5RA 2CX4A 4EL1A 2OADA 1NSWA 3PPUA 4YQMA 4WXTA 1YY7A 5ELAA 5A4WA 5CAXA 3TJJA 4D73B 4BVXA 3UL3A 2YANA 1O81A 2P31A 1WIKA 3DEXA 5B7CA 3NZNA 4POLA 5DALB 5DAKB 3CSJA 2IPAA 4ZBBA 1GSFA 3D0ZA 1ZOFA 3SBCA 4BA7A 2I81A 5AGYA 4Z7XA 2VM2A 1T8EB 1TXXA 5E4WA 5A1NB 7GSSA 1XW5A 1M7TA 3ED3A 1R26A 1MEKA 4HJMA 1KTEA 1N25A 2MZCA 1QXHA 4GRFA 2JSYA 1URMA 3ZFBA 2V6KA 2B5XA 5ECQB 3EU4A 3GH9A 4YKGA 2LNSA 5G5EA 2BTOT 3O6TA 2LV3A 2QGVA 3TRPA 22GSA 4GLTA 5EY6A 3HDCA 3V1WA 1IYIA 1ERTA 4KDYA 2OBIA 1X0RA 3F9UA 3WGDA 2FUG2 4GCIA 1V40A 3M9KA 2HRAA 1WP0A 3RDWA 3W6GA 5D8IA 2VAFA 1O8WA 4TR1B 2F8FA 4PQ1A 1A23A 2WJUA 4TXOA 5F05A 1HNAA 5BMUB 5COHA 1MD4A 3HZ8A 3ISOA 4A5PA 2AJQB 4ZXGA 3FHKA 3Q6OA 1PN9A 5A34A 2XPDA 6GSYA 4QMKA 2HZFA 2GVPA 2JACA 3KD0A 4ML1A 2HFDA 2PUKC 2QA2A 1XOBA 3PINA 5J9BA 1RQMA 3DVXA 2QA1A 1XIYA 3F63A 5FHIA 3C71A 1XWKA 3OR5A 2GDRA 3IBHA 4MABA 1X9WB 4MCUA 14GSA 3GKXA 5IM9A 4K7NA 2XBIA 1Z7PA 5HFKA 1J08A 1XVWA 4ULXA 4V2NA 4ZB9A 3MSZA 4IGJA 2L4QA 1SJIA 1SENA 3VWUA 3LWAA 1F37A 4X43A 1FO5A 2JSZA 1ACVA 1FG4A 4CW9A 4KSMA 1GUMA 4O5UA 2ALBA 3VI7A 2DIYA 4MJBA 4RI7A 1ZYEA 1XWCA 4MA9A 3FMWA 3KTLA 4WF4A 2N5FA 4AKHA 1JZWA 4WKWA 1NHYA 3J7Yb 5CREA 2K8VA 3ME7A 2NDOA 2YPMA 4RI6A 4OCEA 1XCCA 2H1BA 4EIPA 3MYDA 4PNFA 4K7IA 5D96A 3D4TA 3DYRA 3GNJA 1K3OA 1BG5A 2JZRA 5DDLA 4GWRA 2GS3A 2FA4A 1F3BA 2H6YA 5D9TA 2LRTA 2IMDA 2L57A 4WETA 5HQPA 5CRWA 2CVDA 3FKFA 5JCUA 3MNGA 4YAPA 1ZCPA 2YV9A 1M2BA 2DJ2A 4DEJA 3RBTA 3NIVA 4POBA 5IPHA 1X5DA 4H86A 1AUCA 3QD9A 3LFLA 1AQVA 2VUPA 4OFNA 1GNEA 3A3TA 4KCAA 5AN1A 1PD21 4MNNA 2R37A 3F3RA 2L5LA 3APSA 1WWJA 2DIZA 4KF9A 4Q5RA 5GSSA 2A2SA 4N0VA 4ILFA 1Z6MA 4MZBA 3QPMA 5C04A 1PL2A 2IJYA 3GX8A 3PH9A 4GQCA 5ECPB 1OC9B 2E7PA 3TGZA 4GQFA 1R5AA 2O5VA 2K18A 3GURA 2IMKA 2GT6A 3FZ4A 1ZYNA 4ZBAA 3LGCA 2LJKA 4IVFA 2YWOA 3KZQA 3C8EA 2H66A 1U87A 1FOVA 4E68A 1YEXA 3WGXA 5KN1A 4TOPA 2HRKB 1U6TA 3GMFA 2YWMA 1G0TA 3QAVA 3GA4A 2VIMA 2EFCA 3L9VA 1E6BA 3ZIVA 2OE1A 3UBLA 1N8JA 4MJCA 12GSA 2MBSA 3Q74A 4HOJA 3EMXA 3DMLA 1AC1A 4BVYB 1QK8A 1R4WA 4NXIA 5A4VA 1X9SB 5A5HB 4HJ2A 2C0FA 3D6IA 2DJ1A 3GTUA 1PRXA 2IMIA 4RQXA 3VWWA 1TXUA 1SD8A 5E59A 4EVMA 4BVYA 4PUAA 4ZBDA 1VF3A 2WDUA 2WFCA 1EOGA 2GQKA 2VCZA 2O89A 2OJLA 2FWEA 4WR4A 2HSHA 4NV5A 1LU4A 2AYTA 3F6FA 5ECRB 4ZB7A 1O85A 2LKUA 9GSSA 1A2JA 5IMCA 2EFDA 2D2ZA 2R4VA 1OVNA 2MMOA 5GAND 1A2LA 5IPGA 1YKCA 3A2WA 1GSQA 4XCSA 1OAZA 4QL7A 4HS1A 3ERFA 2EIRA 3U6VA 4XS4B 4OWYA 2GTUA 4NHZA 1A2MA 3F4TA 1GL8A 3GX0A 2HSYA 3JCML 4BPYA 5F06A 2DMLA 2HSNA 4EUYA 1F3AA 4G2EA 1TW9A 1GSSA 3M9JA 1M9AA 1I9DA 1TP9A 3RPPA 3QOUA 3CYNA 4AJ7A 2JZTA 1TI3A 4Z2TA 4I97A 5G31A 3LYKA 3ZITA 3A2XA 3IHGA 3IDVA 2H19A 4TR4A 2E2GA 2HNLA 1XWGA 3IC4A 2J9HA 4AJ8A 3FK8A 1ML6A 4IBPA 2XPEA 1TK0B 3ERWA 13GSA 4JE1A 4FQUA 16GSA 4HI7A 1GRXA 3FR6A 3G7IA 1SJ6A 4ECJA 4PXOA 2C80A 1EP8A 3TKSA 1JHBA 3D21A 5J41A 5B6MA 1BG1A 2C1YA 1SK0A 1Z7RA 3DKSA 3W8JA 3TRQA 1KEBA 4IJ3A 2OE0A 5G2ZA 1Z5YE 2IWTA 1S3DA 2R5GA 2NPBA 2H01A 1S3AA 1QQ2A 1Q4JA 1VF2A 2CVBA 4CY6A 2H6ZA 3H93A 1VGLA 2NVLA 1PQNA 2RLIA 3M1GA 5A5KA 1K0MA 1XXUA 5KOWA 3DD3A 2ZCTA 3GKNA 1I5GA 2GZZA 4LA1A 2H0GA 1XVQA 2X64A 3APQA 1CQGA 4GTUA 4TR0A 1T00A 1GLQA 5CRHA 4KB3A 5D9XA 2FCHA 5DCHA 4AKXB 2UV8G 3M3MA 1EZKA 3DGQA 2CV4A 3UBKA 2ZNMA 4F82A 5LNKe 1PX7A 5D73A 2M72A 2G2QA 1GTIA 4GF0A 1EEJA 2X49A 3HXSA 4KA0A 2F3MA 5J9CA 4DVCA 4ID0A 1YZXA 2GQLA 5ECMB 3UAPA 3WT2A 2L5OA 3C73A 1MDJA 2R2JA 2HT9A 2B1KA 2F51A 4BL7A 4BVXB 1A0FA 4PNGA 2K8SA 2IIYA 2VLUA 6GSUA 2NBSA 3BOAA 5DJMA 2CVKA 2LRCA 3CSHA 2VO4A 2FD3A 4IQ1A 4AJ6A 4L8EA 3VPTA 4GXZA 1SL0B 4XS1A 4XIHA 3BJ5A 3ZRDA 3NOFA 4KSOA 1BEDA 1Y6EA 1PKZA 4YAVA 4EKZA 4L0WA 1WOUA 2RIIA 1GULA 2YP6A 1TRSA 4TRXA 3ZZXA 4TW5A 3EVIA 4WF5A 3EURA 1Y1UA 3MIXA 5D9WA 2CAQA 2OKAA 5AISA 3BCKA 4FYBA 3DWVA 1WJKA 3FZ9A 5J3RA 3HVVA 3HY2A 2EC4A 3ZTLA 1A24A 4K0NA 1DSBA 2VL9A 4X0XA 3H8QA 3UVTA 5JWOB 5ELGA 20GSA 2YJ7A 1MD3A 2KUCA 2B1LA 2HSMA 2R0GA 4LL4B 1DUGA 1RK4A 1ZYPA 2A2PA 4TXVA 3LXTA 3H1NA 3HVSA 3QCPA 2YZHA 3E0UA 1XOAA 1C72A 1V9WA 4TXOB 1EOHA 2V41A 3BCIA 1H4OA 1M0UA 3IAS2 2OBKA 2C0GA 1YVLA 2YN1A 1SVLA 3IK9A 5JCGA 1PMTA 3KMOA 4OFMA 1Y25A 2VCXA 5A34B 4EDZA 4IELA 4YQUA 2C8UA 2MBTA 2Z9SA 4EDYA 4MZCA 1G7EA 4PTSA 4MPFA 2X8HA 1CQHA 4OD7A 1O6JA 3F6DA 1F9MA 2C0DA 3TCOA 5LD0A 2F8AA 2AAWA 5KOXA 2PVQA 3CXGA 5A4UA 2CA8A 4PURA 5J40A 1UA5A 2WCIA 4K2XA 5LCZA 1O8XA 4TR3A 2VLTA 3IE3A 4G19A 4RQRA 2FLSA 2TIRA 4F9ZA 2YV7A 1YKAA 4E8HA 5HR3A 1OE7A 5ENUA 2EIOA 3ZVJA 2AUVA 1JZDA 2V2GA 1SKSB 1B4PA 3CTGA 2VCQA 1ZYQB 2AHEA 3C1RA 3KMNA 3KTBA 3EE2A 1BAYA 2VCTA 4ACSA 2PBJA 2RM6A 1NM3A 5DVBA 1B9YC 3IOSA 3FZ5A 1PKWA 2GQMA 3IRAA 5J4VA 2YCDA 4IJIA 2PGTA 2R0PA 4WBJA 2IL3A 2P5RA 3FW2A 3VWXA 3CSIA 5IMZA 5JCWA 3FRCA 5DQYA 3N9JA 3GV1A 6GSTA 3WGEA 5GAPD 5ABRA 4G10A 4K6XA 5B8AA 1FHEA 3VPQA 4ZILA 2WRTA 1VF4A 1Q98A 4YKFA 3CBUA 3LQ7A 1NW2A 1YQ1A 1FAAA 3TJBA 3I69A 1B4QA 5CNWA 4MF7A 2AV4A 3HHVA 2PERA 3UARA 3CMIA 2B6MA 2B3SA 2AB6A 4Q5NA 4AGSA 2G0FA 1PSQA 2QKEA 3L78A 4I2UA 11GSA 5FWGA 4OFTA 2TRXA 4EIQA 1WPIA 2HZEA 3IV4A 4XHMA 5FT3A 2VLVA 1TDIA 3CRTA 1GSDA 4KW6A 3J7Yk 2EFHA 2DJ3A 3FEUA 1TTZA 3ERGA 3RHCA 5KN0A 3GFKA 2VL2A 3A5IA 4WR5A 2X8GA 2PU9C 1MDIA 4I5QA 4KUNA 2H1GA 3HJPA 5B8BA 2VKZG 4G0LA 5D93A 3PGTA 4ML6A 2I9HA 2BMXA 1BF5A 6GSWA 5GZZB 4CY8A 2H8LA 4DSRA 4MDCA 4I2TA 2GSTA 2FGXA 3HZ4A 1EV9A 2ES7A 5ECOB 5BRTA 5CYYA 5ECLB 1FOHA 2LS5A 4EO3A 3GIXA 5DJLA 3KEBA 1BJXA 2LJRA 4NPBA 2H0HA 2WZ9A 2E0QA 3E3EA 2A4HA 1V2AA 3KIJA 3GTUB 2MMAA 4EXJA 5DCGA 2WGRA 1YDKA 2VD1A 1T7PB 4FIWA 5ECNB 3ZIJA 4N10A 1SKRB 4FYCA 4NWYA 4V2MA 2N5AA 1GTBA 3GYKA 4DSQA 1QMVA 5JWRB 2XC2A 2HQTA 4MJEA 1SKWB 5G1KA 3LEFA 3GL5A 4J56E 6GSXA 1ZL9A 4KDUA 2ON7A 1HNCA 4KE3A 1A8YA 2LJAA 2LQQA 3CTFA 2NTOA 2DMMA 1R7HA 1AQXA 3WD6A 4NHWA 5F07A 1TKDB 3F4SA 4X1UA 2HSNB 1TI1A 1QGVA 1JZOA 1USBA 3LSZA 3EU3A 5IO2A 5ECSA 4P3YB 1EP7A 1K0DA 3TUEA 6GSSA 4RUVA 2QSIA 2OACA 2H73A 1SK2A 5HR1A 2X99A 2XHFA 3ZYWA 1SL1B 3GHAA 19GSA 4FYUA 3C1SA 3CRUA 3F3QA 1TK5B 2YNXA 3IR4A 1GLPA 4NMUA 4KGIA 4K1FA 2QC7A 2H0IA 1PL1A 3KP9A 1WRYA 3ZLPA 3IK7A 4MPGA 3UIWA 2HRNA 1XWAA 1PA3A 2IFQA 4CHSA 3VWVA 3TKPA 3HKRA 5IO0A 2YWIA 1V58A 4LLRA 2PVOC 2FA8A 4V1Ap 2HYXA 1KBNA 5HR2A 3GN3A 1U3IA 1YF1A 1YJ6A 1BX9A 5INYA 2X4AA 4TVEA 4V2LA 3TJFA 2C3QA 2J23A 1K0CA 3EPTA 3DRNA 3L4NA 3GRXA 1SYXA 1HNBA 4GDFA 1X5EA 1PX6A 5CRGA 1A0RP 3KH9A 1TRUA 1M99A 2FWHA 4F0CA 2REMA 1GSYA 2L59A 1TU7A 1ILOA 2CZ3A 1G7OA 1J9BA 1OE8A 4Q5FA 1PN0A 1SD9A 3RPNA 4L5OA 1FB0A 2L6DA 1JLVA 1BYEA 3TJGA 1TJDA 1X9MB 1XFLA 3P8WA 1M2AA 4MF6A 4ECBA 3FY7A 3IA1A 2FNOA 2HI7A 2HRFA 2MMNA 2O7KA 4MH3A 2B5YA 6GSVA 1ON4A 4BL7B 3FZAA 4Z2UA 1HQOA 3AY8A 2FWGA 2GZPA 4G0IA 3TU3B 1Z3EA 3UEMA 2MYGA 1UN2A 2CX3A 5IMDA 5EVOA 4IHUA 1V98A 4J57E 1JLWA 2N5BA 4K5RA 4EE0A 2V32A 5HFIA 3TDGA 2X8CA 3DXBA 1ERWA 4K8MA 3WYWA 2VCWA 3DIEA 2XBQA 1N2AA 4F0BA 4PQIA 1T4YA 4HUAA 3DVWA 1M2DA 1XZOA 5IOWA 3W8SA 2CQ9A 3L9UA 1EGOA 2PMTA 3F8UA 2TRCP 5CP1A 4JR4A 5ECHB 1TRVA 2DJ0A 1KNGA 4O92A 3HCZA 3QFBC 4N0ZA 4G0KA 3S9FA 2KP1A 2B7KA 3IAM2 1YEPA 4JU5A 1AAZA 3LORA 5B6NA 1J0FA 5DBQA 4F03A 2C4JA 4D73A 1EEMA 3G7YA 3KCMA 1OKTA 3QAWA 2KHPA 3EC3A 1QFNA 3QAGA 1XWBA 3TKSE 2HSMB 2CT6A 2YWNA 4JZQA 1UC7A 3GKKA 1OKDA 2PWJA 5DALA 2FHEA 4N30A 4XS6A 1AXDA 1EV4A 5DAKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W4V A;  3LYP A;  1SJZ A;  3M8N A;  3Q19 A;  4KND A;  1LBK A;  1HD2 A;  3EWL A;  2I1U A;  2B7J A;  4O32 A;  3Q18 A;  2KP2 A;  2YJH A;  4JR6 A;  1T4Z A;  1E2Y A;  4CDO A;  3D22 A;  3ZVJ D;  4NAX A;  2JAD A;  1H75 A;  2JU5 A;  1O73 A;  4I8B A;  1LJR A;  2C0E A;  2RUE A;  5G5F A;  4YQV A;  1GSU A;  3H4K A;  3HVX A;  4PX1 A;  4Q5Q A;  3R3E A;  5H5R A;  3TOU A;  2HE3 A;  1XW6 A;  5F8B A;  2V6O A;  2YOI A;  3F0I A;  4AF2 A;  1F6M C;  4N11 A;  5GST A;  2IMF A;  1DE1 A;  5AIX A;  4ZL9 A;  1EGR A;  1OYJ A;  5IMA A;  3TKQ A;  4GSS A;  1TK8 B;  4IP6 A;  3QMX A;  2M46 A;  4TR1 A;  4KH7 A;  4TN8 A;  3D5J A;  2CZ2 A;  4GST A;  4MMM A;  1GUK A;  1GSE A;  2R6K A;  3F4R A;  4IS0 A;  4HU7 A;  4J2F A;  5BMU A;  2BJX A;  5C00 A;  4HZ2 A;  2KLX A;  3ZL5 A;  2VD0 A;  2UZ8 A;  3SWL A;  1VRS D;  2VL2 C;  2R3X A;  3UMA A;  2RUF A;  3HD5 A;  4HEA 2;  3UOM A;  2WUL A;  3H79 A;  2O85 A;  5IIZ A;  1YF0 A;  3P2A A;  3I9V 2;  3RHB A;  2EIQ A;  4KAE A;  1BQ7 A;  2L4C A;  2VOC A;  3L0H A;  1B48 A;  1GH2 A;  2H30 A;  1M9B A;  4OCF A;  3G7J A;  3MDK A;  5H5Q A;  3D4M A;  2PPT A;  4JED A;  1IYH A;  1R5P A;  5CO3 A;  2HLS A;  2A2R A;  4OMV A;  1DBY A;  1U88 A;  1TRW A;  4NV2 A;  2I3Y A;  2LST A;  2H75 A;  1Z6N A;  5EL8 A;  1TOF A;  4XRD A;  1T1V A;  3ME8 A;  1A8L A;  2O8V B;  3KGK A;  3UJ1 A;  4MF5 A;  5G30 A;  4ZL7 A;  2VL3 A;  5ECK B;  2GSQ A;  3I6A A;  3TOT A;  1OC8 A;  2H70 A;  2FWF A;  4EF0 A;  3G9B A;  2A4V A;  2JL4 A;  2K6V A;  5L71 A;  3IC8 A;  2I4A A;  2IME A;  2H71 A;  3GSS A;  3O3T A;  1FVK A;  1FVJ A;  2HZE B;  4QQ7 A;  3BD2 A;  1ABA A;  3HJM A;  4HQZ A;  4ZIJ A;  1SYR A;  3QR6 A;  4QL9 A;  1AW9 A;  1MDK A;  4MLY A;  5IMF A;  1ZGN A;  3HJO A;  3LXZ A;  3I43 A;  4USS A;  3KH7 A;  2H6X A;  3VLN A;  1V57 A;  1HYU A;  4POM A;  3QDN A;  2L6C A;  4K7O A;  3FYG A;  4POK A;  4ZB6 A;  2VM1 A;  3KM6 A;  5HR0 A;  2E2M A;  4IQA A;  4KCE A;  5H5S A;  1GNW A;  5CRD A;  3FR3 A;  1F2E A;  3QFA C;  1OC3 A;  4O7H A;  4HU9 A;  2H74 A;  5KEJ A;  2MMZ A;  2OA7 A;  4MK3 A;  2DBC A;  4FH8 A;  5ID2 B;  1EWX A;  1JZR A;  10GS A;  1B8X A;  2H76 A;  1S3C A;  1Z9H A;  3VK9 A;  4ZL8 A;  4MJA A;  4G9H A;  3N5O A;  3TRX A;  5ID2 A;  3KJY A;  2KOK A;  1OC9 A;  2ON5 A;  2P0G A;  2WS2 A;  3US3 A;  2OE3 A;  2K9F A;  2M80 A;  3GST A;  2YZU A;  4HDE A;  1THO A;  2WB9 A;  5JWQ B;  1O7U A;  2H72 A;  3KXO A;  5DQS A;  3BBY A;  1ERU A;  2GLR A;  1K0B A;  3A2V A;  3L9S A;  2HRK A;  3TKS C;  4BWS A;  1GUH A;  3K8N A;  1WE0 A;  18GS A;  1U3A A;  3IPZ A;  4IW9 A;  1XPV A;  4LL1 B;  1TU8 A;  5IOX A;  1W89 A;  4ZB8 A;  1G6Y A;  2V1M A;  1GP1 A;  1GWC A;  4HZ4 A;  5IQY A;  1K0O A;  4OO5 A;  1XW9 A;  4IKH A;  1AIU A;  1THX A;  3M0F A;  1QUW A;  2O87 A;  4ECI A;  2C3T A;  17GS A;  2C3N A;  3EYT A;  3LG6 A;  4JRR A;  1K3Y A;  4E8E A;  1JFU A;  4WBR D;  1NHO A;  4HQS A;  4LMV A;  2LQO A;  1UVZ A;  3IHQ A;  4I6X A;  4XTS A;  5HFG A;  3VUR A;  3P7X A;  2PN8 A;  2B5E A;  3EMP A;  4XRA A;  5ECI B;  3GUS A;  2LEG A;  3ZML A;  4YH2 A;  4V1A g;  1DE2 A;  4PQH A;  2DJJ A;  4MP4 A;  1X5C A;  4PUF C;  2GSS A;  2DLX A;  2GSR A;  1SU9 A;  2F9S A;  2IFQ B;  2H1D A;  1MTC A;  8GSS A;  3A5W A;  3VI5 A;  3LJR A;  4XS4 A;  4WEY A;  1FW1 A;  2LUS A;  4IP1 A;  3UVH A;  4K0G A;  1FB6 A;  1ZMA A;  2P5Q A;  5F0G A;  4K2D A;  4MH2 A;  4L5L A;  4OO4 A;  1ST9 A;  3ZFL A;  3FR9 A;  4KX4 A;  4K9Z A;  1ZZY A;  2DJK A;  3P90 A;  3HA9 A;  3MWH A;  2H1A A;  3U5R E;  3ZRE A;  2VCV A;  3TJK A;  3PR8 A;  3C7M A;  1SK1 A;  3O76 A;  4EC0 A;  5D9V A;  3MAK A;  1XBS A;  3EIN A;  1RW1 A;  1K0A A;  1VF1 A;  3HYP A;  2LTK A;  4MZW A;  4PGT A;  2GZY A;  3APO A;  3RAZ A;  4ISD A;  2LNT A;  5J4U A;  4TKY A;  3VFI A;  2HXK A;  1PGT A;  5AIV A;  1ERV A;  3TKR A;  4BWQ A;  1GTU A;  2RM5 A;  2FY6 A;  2DSA A;  1B9X C;  5KN2 A;  1G6W A;  4IN0 A;  2ZUP A;  5G1L A;  3GH6 A;  3GKM A;  3E9J B;  5IMV A;  3KP8 A;  4DSS B;  1T3B A;  3ZMK A;  1WMJ A;  4LMW A;  4KDX A;  5KN3 A;  3TB2 A;  4FO5 A;  4F2I A;  2CAI A;  4DSS A;  4JBB A;  2LRN A;  4ECC A;  3IXR A;  1AQW A;  1GTA A;  3GL3 A;  2JZS A;  4GSN A;  3R2Q A;  3WT1 A;  1K0N A;  1SL2 B;  2GT5 A;  5EPF A;  2DC5 A;  5J5N A;  4L0U A;  2GGT A;  1K3L A;  2IN3 A;  4O5R A;  2CX4 A;  4EL1 A;  2OAD A;  1NSW A;  3PPU A;  4YQM A;  4WXT A;  1YY7 A;  5ELA A;  5A4W A;  5CAX A;  3TJJ A;  4D73 B;  4BVX A;  3UL3 A;  2YAN A;  1O81 A;  2P31 A;  1WIK A;  3DEX A;  5B7C A;  3NZN A;  4POL A;  5DAL B;  5DAK B;  3CSJ A;  2IPA A;  4ZBB A;  1GSF A;  3D0Z A;  1ZOF A;  3SBC A;  4BA7 A;  2I81 A;  5AGY A;  4Z7X A;  2VM2 A;  1T8E B;  1TXX A;  5E4W A;  7GSS A;  1XW5 A;  1M7T A;  3ED3 A;  1R26 A;  1MEK A;  4HJM A;  1KTE A;  2MZC A;  1QXH A;  4GRF A;  2JSY A;  1URM A;  3ZFB A;  2V6K A;  2B5X A;  5ECQ B;  3EU4 A;  3GH9 A;  2LNS A;  5G5E A;  2BTO T;  3O6T A;  2LV3 A;  2QGV A;  3TRP A;  22GS A;  4GLT A;  5EY6 A;  3HDC A;  3V1W A;  1IYI A;  1ERT A;  4KDY A;  2OBI A;  1X0R A;  3F9U A;  3WGD A;  2FUG 2;  4GCI A;  1V40 A;  3M9K A;  2HRA A;  1WP0 A;  3RDW A;  3W6G A;  5D8I A;  2VAF A;  1O8W A;  4TR1 B;  2F8F A;  4PQ1 A;  1A23 A;  2WJU A;  4TXO A;  5F05 A;  1HNA A;  5COH A;  1MD4 A;  3HZ8 A;  3ISO A;  2AJQ B;  4ZXG A;  3FHK A;  3Q6O A;  1PN9 A;  2XPD A;  6GSY A;  2HZF A;  2GVP A;  2JAC A;  3KD0 A;  4ML1 A;  2HFD A;  2PUK C;  1XOB A;  3PIN A;  5J9B A;  1RQM A;  3DVX A;  1XIY A;  3F63 A;  5FHI A;  3C71 A;  1XWK A;  3OR5 A;  2GDR A;  3IBH A;  4MAB A;  1X9W B;  4MCU A;  14GS A;  3GKX A;  5IM9 A;  4K7N A;  2XBI A;  1Z7P A;  5HFK A;  1J08 A;  1XVW A;  4ULX A;  4V2N A;  4ZB9 A;  3MSZ A;  4IGJ A;  2L4Q A;  1SJI A;  1SEN A;  3VWU A;  3LWA A;  1F37 A;  4X43 A;  1FO5 A;  2JSZ A;  1ACV A;  1FG4 A;  4CW9 A;  4KSM A;  1GUM A;  2ALB A;  3VI7 A;  2DIY A;  4MJB A;  4RI7 A;  1ZYE A;  1XWC A;  4MA9 A;  3KTL A;  4WF4 A;  2N5F A;  1JZW A;  4WKW A;  1NHY A;  3J7Y b;  5CRE A;  2K8V A;  3ME7 A;  2NDO A;  2YPM A;  4RI6 A;  4OCE A;  1XCC A;  2H1B A;  4PNF A;  4K7I A;  5D96 A;  3D4T A;  3DYR A;  3GNJ A;  1K3O A;  1BG5 A;  2JZR A;  5DDL A;  4GWR A;  2GS3 A;  2FA4 A;  1F3B A;  2H6Y A;  5D9T A;  2LRT A;  2IMD A;  2L57 A;  4WET A;  5HQP A;  5CRW A;  2CVD A;  3FKF A;  5JCU A;  3MNG A;  4YAP A;  1ZCP A;  2YV9 A;  1M2B A;  2DJ2 A;  4DEJ A;  3RBT A;  3NIV A;  4POB A;  5IPH A;  1X5D A;  4H86 A;  1AUC A;  3QD9 A;  3LFL A;  1AQV A;  2VUP A;  4OFN A;  1GNE A;  3A3T A;  4KCA A;  5AN1 A;  1PD2 1;  2R37 A;  3F3R A;  2L5L A;  3APS A;  1WWJ A;  2DIZ A;  4KF9 A;  4Q5R A;  5GSS A;  2A2S A;  4N0V A;  4ILF A;  1Z6M A;  4MZB A;  3QPM A;  5C04 A;  1PL2 A;  2IJY A;  3GX8 A;  3PH9 A;  4GQC A;  5ECP B;  1OC9 B;  2E7P A;  3TGZ A;  4GQF A;  1R5A A;  2K18 A;  3GUR A;  2IMK A;  2GT6 A;  3FZ4 A;  4ZBA A;  3LGC A;  2LJK A;  4IVF A;  2YWO A;  3KZQ A;  3C8E A;  2H66 A;  1U87 A;  1FOV A;  3WGX A;  1YEX A;  5KN1 A;  4TOP A;  2HRK B;  1U6T A;  3GMF A;  2YWM A;  1G0T A;  3QAV A;  3GA4 A;  2VIM A;  3L9V A;  1E6B A;  3ZIV A;  2OE1 A;  3UBL A;  1N8J A;  4MJC A;  12GS A;  2MBS A;  3Q74 A;  4HOJ A;  3EMX A;  3DML A;  1AC1 A;  4BVY B;  1QK8 A;  1R4W A;  4NXI A;  5A4V A;  1X9S B;  4HJ2 A;  2C0F A;  3D6I A;  2DJ1 A;  3GTU A;  1PRX A;  2IMI A;  4RQX A;  3VWW A;  1SD8 A;  5E59 A;  4EVM A;  4BVY A;  4PUA A;  4ZBD A;  1VF3 A;  2WDU A;  2WFC A;  1EOG A;  2GQK A;  2VCZ A;  2O89 A;  2OJL A;  2FWE A;  4WR4 A;  2HSH A;  4NV5 A;  1LU4 A;  2AYT A;  3F6F A;  5ECR B;  1O85 A;  2LKU A;  9GSS A;  1A2J A;  5IMC A;  2D2Z A;  2R4V A;  1OVN A;  2MMO A;  5GAN D;  1A2L A;  5IPG A;  1YKC A;  3A2W A;  1GSQ A;  4XCS A;  1OAZ A;  4QL7 A;  4HS1 A;  3ERF A;  2EIR A;  3U6V A;  4XS4 B;  4OWY A;  2GTU A;  4NHZ A;  1A2M A;  3F4T A;  1GL8 A;  3GX0 A;  2HSY A;  3JCM L;  4BPY A;  5F06 A;  2DML A;  4EUY A;  1F3A A;  4G2E A;  1TW9 A;  1GSS A;  3M9J A;  1M9A A;  1I9D A;  1TP9 A;  3RPP A;  3QOU A;  3CYN A;  4AJ7 A;  2JZT A;  1TI3 A;  4I97 A;  5G31 A;  3LYK A;  3ZIT A;  3A2X A;  3IDV A;  2H19 A;  4TR4 A;  2E2G A;  2HNL A;  1XWG A;  3IC4 A;  2J9H A;  4AJ8 A;  3FK8 A;  1ML6 A;  4IBP A;  2XPE A;  1TK0 B;  3ERW A;  13GS A;  4JE1 A;  4FQU A;  16GS A;  4HI7 A;  1GRX A;  3FR6 A;  3G7I A;  1SJ6 A;  4ECJ A;  4PXO A;  2C80 A;  1EP8 A;  3TKS A;  1JHB A;  3D21 A;  5J41 A;  5B6M A;  2C1Y A;  1SK0 A;  1Z7R A;  3DKS A;  3W8J A;  3TRQ A;  1KEB A;  4IJ3 A;  2OE0 A;  5G2Z A;  1Z5Y E;  2IWT A;  1S3D A;  2R5G A;  2NPB A;  2H01 A;  1S3A A;  1QQ2 A;  1Q4J A;  1VF2 A;  2CVB A;  2H6Z A;  3H93 A;  1VGL A;  2NVL A;  1PQN A;  2RLI A;  3M1G A;  5A5K A;  1K0M A;  1XXU A;  3DD3 A;  2ZCT A;  3GKN A;  1I5G A;  2GZZ A;  4LA1 A;  2H0G A;  1XVQ A;  2X64 A;  3APQ A;  1CQG A;  4GTU A;  4TR0 A;  1T00 A;  1GLQ A;  5CRH A;  4KB3 A;  5D9X A;  2FCH A;  5DCH A;  3M3M A;  1EZK A;  3DGQ A;  2CV4 A;  3UBK A;  2ZNM A;  4F82 A;  5LNK e;  1PX7 A;  5D73 A;  2M72 A;  2G2Q A;  1GTI A;  4GF0 A;  1EEJ A;  3HXS A;  4KA0 A;  2F3M A;  5J9C A;  4DVC A;  4ID0 A;  1YZX A;  2GQL A;  5ECM B;  3UAP A;  3WT2 A;  2L5O A;  3C73 A;  1MDJ A;  2R2J A;  2HT9 A;  2B1K A;  2F51 A;  4BL7 A;  4BVX B;  1A0F A;  4PNG A;  2K8S A;  2IIY A;  2VLU A;  6GSU A;  2NBS A;  3BOA A;  5DJM A;  2CVK A;  2LRC A;  3CSH A;  2VO4 A;  2FD3 A;  4IQ1 A;  4AJ6 A;  4L8E A;  3VPT A;  4GXZ A;  1SL0 B;  4XS1 A;  4XIH A;  3BJ5 A;  3ZRD A;  3NOF A;  4KSO A;  1BED A;  1Y6E A;  1PKZ A;  4YAV A;  4EKZ A;  4L0W A;  1WOU A;  2RII A;  1GUL A;  2YP6 A;  1TRS A;  4TRX A;  3ZZX A;  4TW5 A;  3EVI A;  4WF5 A;  3EUR A;  5D9W A;  2CAQ A;  2OKA A;  5AIS A;  3BCK A;  4FYB A;  3DWV A;  1WJK A;  3FZ9 A;  5J3R A;  3HVV A;  3HY2 A;  2EC4 A;  3ZTL A;  1A24 A;  4K0N A;  1DSB A;  2VL9 A;  4X0X A;  3H8Q A;  3UVT A;  5JWO B;  5ELG A;  20GS A;  2YJ7 A;  1MD3 A;  2KUC A;  2B1L A;  2HSM A;  4LL4 B;  1DUG A;  1RK4 A;  4TXV A;  3LXT A;  3H1N A;  3HVS A;  3QCP A;  2YZH A;  3E0U A;  1XOA A;  1C72 A;  1V9W A;  4TXO B;  1EOH A;  2V41 A;  3BCI A;  1H4O A;  1M0U A;  3IAS 2;  2OBK A;  2C0G A;  2YN1 A;  3IK9 A;  5JCG A;  1PMT A;  3KMO A;  4OFM A;  1Y25 A;  2VCX A;  4EDZ A;  4IEL A;  4YQU A;  2C8U A;  2MBT A;  2Z9S A;  4EDY A;  4MZC A;  1G7E A;  4PTS A;  4MPF A;  2X8H A;  1CQH A;  4OD7 A;  1O6J A;  3F6D A;  1F9M A;  2C0D A;  3TCO A;  5LD0 A;  2F8A A;  2AAW A;  2PVQ A;  3CXG A;  5A4U A;  2CA8 A;  4PUR A;  1UA5 A;  2WCI A;  5LCZ A;  1O8X A;  4TR3 A;  2VLT A;  3IE3 A;  4G19 A;  4RQR A;  2FLS A;  2TIR A;  4F9Z A;  2YV7 A;  1YKA A;  4E8H A;  5HR3 A;  1OE7 A;  5ENU A;  2EIO A;  3ZVJ A;  2AUV A;  1JZD A;  2V2G A;  1SKS B;  1B4P A;  3CTG A;  2VCQ A;  1ZYQ B;  2AHE A;  3C1R A;  3KMN A;  3KTB A;  3EE2 A;  1BAY A;  2VCT A;  4ACS A;  2PBJ A;  2RM6 A;  1NM3 A;  5DVB A;  1B9Y C;  3IOS A;  3FZ5 A;  1PKW A;  2GQM A;  3IRA A;  2YCD A;  4IJI A;  2PGT A;  4WBJ A;  2IL3 A;  2P5R A;  3FW2 A;  3VWX A;  3CSI A;  5IMZ A;  5JCW A;  3FRC A;  5DQY A;  3N9J A;  3GV1 A;  6GST A;  3WGE A;  5GAP D;  5ABR A;  4G10 A;  4K6X A;  5B8A A;  1FHE A;  3VPQ A;  4ZIL A;  2WRT A;  1VF4 A;  1Q98 A;  3CBU A;  3LQ7 A;  1NW2 A;  1YQ1 A;  1FAA A;  3TJB A;  3I69 A;  1B4Q A;  5CNW A;  4MF7 A;  2AV4 A;  3HHV A;  2PER A;  3UAR A;  3CMI A;  2B6M A;  2B3S A;  2AB6 A;  4Q5N A;  4AGS A;  2G0F A;  1PSQ A;  2QKE A;  3L78 A;  4I2U A;  11GS A;  5FWG A;  4OFT A;  2TRX A;  1WPI A;  2HZE A;  3IV4 A;  4XHM A;  5FT3 A;  2VLV A;  1TDI A;  3CRT A;  1GSD A;  4KW6 A;  3J7Y k;  2DJ3 A;  3FEU A;  1TTZ A;  3ERG A;  3RHC A;  5KN0 A;  3GFK A;  2VL2 A;  4WR5 A;  2X8G A;  2PU9 C;  1MDI A;  4I5Q A;  4KUN A;  2H1G A;  3HJP A;  5B8B A;  4G0L A;  5D93 A;  3PGT A;  4ML6 A;  2I9H A;  2BMX A;  6GSW A;  5GZZ B;  2H8L A;  4DSR A;  4MDC A;  4I2T A;  2GST A;  2FGX A;  3HZ4 A;  1EV9 A;  2ES7 A;  5ECO B;  5CYY A;  5ECL B;  2LS5 A;  4EO3 A;  3GIX A;  5DJL A;  3KEB A;  1BJX A;  2LJR A;  4NPB A;  2H0H A;  2WZ9 A;  2E0Q A;  3E3E A;  1V2A A;  3KIJ A;  3GTU B;  2MMA A;  4EXJ A;  5DCG A;  2WGR A;  1YDK A;  2VD1 A;  1T7P B;  4FIW A;  5ECN B;  3ZIJ A;  4N10 A;  1SKR B;  4FYC A;  4NWY A;  4V2M A;  2N5A A;  1GTB A;  3GYK A;  4DSQ A;  1QMV A;  5JWR B;  2XC2 A;  2HQT A;  4MJE A;  1SKW B;  5G1K A;  3LEF A;  4J56 E;  3GL5 A;  6GSX A;  1ZL9 A;  4KDU A;  2ON7 A;  1HNC A;  4KE3 A;  1A8Y A;  2LJA A;  2LQQ A;  3CTF A;  2NTO A;  2DMM A;  1R7H A;  1AQX A;  3WD6 A;  4NHW A;  5F07 A;  1TKD B;  3F4S A;  4X1U A;  2HSN B;  1TI1 A;  1QGV A;  1JZO A;  1USB A;  3LSZ A;  3EU3 A;  5IO2 A;  5ECS A;  4P3Y B;  1EP7 A;  1K0D A;  3TUE A;  6GSS A;  4RUV A;  2QSI A;  2OAC A;  2H73 A;  1SK2 A;  5HR1 A;  2X99 A;  2XHF A;  3ZYW A;  1SL1 B;  3GHA A;  19GS A;  4FYU A;  3C1S A;  3CRU A;  3F3Q A;  1TK5 B;  2YNX A;  3IR4 A;  1GLP A;  4NMU A;  4KGI A;  4K1F A;  2QC7 A;  2H0I A;  1PL1 A;  3KP9 A;  1WRY A;  3ZLP A;  3IK7 A;  4MPG A;  3UIW A;  2HRN A;  1XWA A;  1PA3 A;  2IFQ A;  4CHS A;  3VWV A;  3TKP A;  3HKR A;  5IO0 A;  2YWI A;  1V58 A;  4LLR A;  2PVO C;  2FA8 A;  4V1A p;  2HYX A;  1KBN A;  5HR2 A;  3GN3 A;  1U3I A;  1YF1 A;  1YJ6 A;  1BX9 A;  5INY A;  4TVE A;  4V2L A;  3TJF A;  2C3Q A;  2J23 A;  1K0C A;  3DRN A;  3L4N A;  3GRX A;  1SYX A;  1HNB A;  1X5E A;  1PX6 A;  5CRG A;  1A0R P;  3KH9 A;  1TRU A;  1M99 A;  2FWH A;  4F0C A;  2REM A;  1GSY A;  2L59 A;  1TU7 A;  1ILO A;  2CZ3 A;  1G7O A;  1J9B A;  1OE8 A;  4Q5F A;  1SD9 A;  3RPN A;  4L5O A;  1FB0 A;  2L6D A;  1JLV A;  1BYE A;  3TJG A;  1TJD A;  1X9M B;  1XFL A;  3P8W A;  1M2A A;  4MF6 A;  4ECB A;  3FY7 A;  3IA1 A;  2FNO A;  2HI7 A;  2HRF A;  2MMN A;  2O7K A;  4MH3 A;  2B5Y A;  6GSV A;  1ON4 A;  4BL7 B;  3FZA A;  1HQO A;  3AY8 A;  2FWG A;  2GZP A;  4G0I A;  1Z3E A;  3UEM A;  2MYG A;  1UN2 A;  2CX3 A;  5IMD A;  5EVO A;  4IHU A;  1V98 A;  4J57 E;  1JLW A;  2N5B A;  4EE0 A;  2V32 A;  5HFI A;  3TDG A;  2X8C A;  3DXB A;  1ERW A;  4K8M A;  3WYW A;  2VCW A;  3DIE A;  2XBQ A;  1N2A A;  4F0B A;  4PQI A;  1T4Y A;  4HUA A;  3DVW A;  1M2D A;  1XZO A;  5IOW A;  3W8S A;  2CQ9 A;  3L9U A;  1EGO A;  2PMT A;  3F8U A;  2TRC P;  5CP1 A;  4JR4 A;  5ECH B;  1TRV A;  2DJ0 A;  1KNG A;  4O92 A;  3HCZ A;  3QFB C;  4N0Z A;  4G0K A;  3S9F A;  2KP1 A;  2B7K A;  3IAM 2;  1YEP A;  4JU5 A;  1AAZ A;  3LOR A;  5B6N A;  1J0F A;  5DBQ A;  4F03 A;  2C4J A;  4D73 A;  1EEM A;  3G7Y A;  3KCM A;  1OKT A;  3QAW A;  2KHP A;  3EC3 A;  1QFN A;  3QAG A;  1XWB A;  3TKS E;  2HSM B;  2CT6 A;  2YWN A;  4JZQ A;  1UC7 A;  3GKK A;  1OKD A;  2PWJ A;  5DAL A;  2FHE A;  4N30 A;  4XS6 A;  1AXD A;  1EV4 A;  5DAK A; 
#chains in the Genus database with same CATH topology
 1W4V A;  3LYP A;  1SJZ A;  3M8N A;  3Q19 A;  4KND A;  1LBK A;  1HD2 A;  1SVO A;  3EWL A;  2I1U A;  2B7J A;  4O32 A;  5A1N A;  3Q18 A;  2KP2 A;  2YJH A;  4JR6 A;  1T4Z A;  1E2Y A;  4CDO A;  3D22 A;  3ZVJ D;  4NAX A;  2JAD A;  1H75 A;  2JU5 A;  1O73 A;  4I8B A;  1LJR A;  2C0E A;  2RUE A;  5G5F A;  4YQV A;  1GSU A;  3H4K A;  3HVX A;  4PX1 A;  4Q5Q A;  3R3E A;  5H5R A;  3TOU A;  2HE3 A;  1XW6 A;  5F8B A;  2V6O A;  2YOI A;  3F0I A;  4AF2 A;  1F6M C;  4N11 A;  5GST A;  2IMF A;  1DE1 A;  5AIX A;  4ZL9 A;  1EGR A;  1OYJ A;  5IMA A;  3TKQ A;  4GSS A;  1TK8 B;  4IP6 A;  3QMX A;  2M46 A;  4TR1 A;  4KH7 A;  4TN8 A;  3D5J A;  2CZ2 A;  4GST A;  4MMM A;  1GUK A;  1GSE A;  2R6K A;  3F4R A;  4IS0 A;  4HU7 A;  4J2F A;  5BMU A;  2BJX A;  5C00 A;  4HZ2 A;  2KLX A;  3ZL5 A;  2VD0 A;  2UZ8 A;  4BIK A;  3SWL A;  1VRS D;  2VL2 C;  2R3X A;  3UMA A;  2RUF A;  3HD5 A;  4HEA 2;  3UOM A;  2WUL A;  3H79 A;  2O85 A;  5IIZ A;  1YF0 A;  3P2A A;  3I9V 2;  3RHB A;  2EIQ A;  4KAE A;  1BQ7 A;  2L4C A;  2VOC A;  3L0H A;  1B48 A;  1GH2 A;  2H30 A;  1M9B A;  4OCF A;  3G7J A;  3MDK A;  5H5Q A;  3D4M A;  2PPT A;  4JED A;  1IYH A;  1R5P A;  5CO3 A;  2HLS A;  2A2R A;  4OMV A;  1DBY A;  1U88 A;  1TRW A;  4NV2 A;  2I3Y A;  2LST A;  2H75 A;  1Z6N A;  5EL8 A;  1TOF A;  4XRD A;  1T1V A;  3ME8 A;  1A8L A;  2O8V B;  3KGK A;  3UJ1 A;  4MF5 A;  5G30 A;  3LW9 A;  4ZL7 A;  2VL3 A;  5ECK B;  2GSQ A;  3I6A A;  3TOT A;  1OC8 A;  2H70 A;  2FWF A;  4EF0 A;  3G9B A;  2A4V A;  2JL4 A;  2K6V A;  5L71 A;  3IC8 A;  2I4A A;  2IME A;  2H71 A;  1XG8 A;  3GSS A;  3O3T A;  1FVK A;  1FVJ A;  2HZE B;  4QQ7 A;  3BD2 A;  1ABA A;  3HJM A;  4HQZ A;  4ZIJ A;  1SYR A;  3QR6 A;  3CHX C;  4QL9 A;  1AW9 A;  1MDK A;  4MLY A;  5IMF A;  1ZGN A;  3HJO A;  3LXZ A;  3I43 A;  4Z2R A;  4USS A;  3KH7 A;  2H6X A;  3VLN A;  1V57 A;  1HYU A;  4POM A;  3QDN A;  2L6C A;  4K7O A;  3FYG A;  4POK A;  4ZB6 A;  2VM1 A;  3KM6 A;  5HR0 A;  2E2M A;  4IQA A;  4KCE A;  5H5S A;  1GNW A;  5CRD A;  3FR3 A;  1F2E A;  3QFA C;  1OC3 A;  4O7H A;  4HU9 A;  2H74 A;  5KEJ A;  2MMZ A;  2OA7 A;  4MK3 A;  2DBC A;  4K5S A;  4FH8 A;  5ID2 B;  1EWX A;  1JZR A;  10GS A;  1B8X A;  2DKI A;  2H76 A;  1S3C A;  1Z9H A;  3VK9 A;  4ZL8 A;  4MJA A;  4G9H A;  3N5O A;  3TRX A;  3HVN A;  5ID2 A;  3KJY A;  4PI2 C;  2KOK A;  1OC9 A;  2ON5 A;  2P0G A;  2WS2 A;  3US3 A;  2OE3 A;  1I1I P;  2K9F A;  4AKI A;  2M80 A;  3GST A;  2YZU A;  4HDE A;  1THO A;  2WB9 A;  5JWQ B;  2EFE A;  1O7U A;  2H72 A;  3KXO A;  5DQS A;  3BBY A;  1ERU A;  2GLR A;  1K0B A;  3A2V A;  3L9S A;  2HRK A;  2O36 A;  3TKS C;  4BWS A;  1GUH A;  3K8N A;  1WE0 A;  18GS A;  1U3A A;  3IPZ A;  4IW9 A;  1XPV A;  4LL1 B;  4G01 A;  1TU8 A;  5IOX A;  5J47 A;  1W89 A;  4ZB8 A;  1G6Y A;  2V1M A;  1GP1 A;  1GWC A;  4HZ4 A;  5IQY A;  1K0O A;  4OO5 A;  1XW9 A;  4IKH A;  5J4Y A;  1AIU A;  1THX A;  3M0F A;  1QUW A;  2O87 A;  5A5H A;  4ECI A;  2C3T A;  2OT3 A;  17GS A;  4O5Q A;  2C3N A;  4X4J A;  3EYT A;  3LG6 A;  4AKG A;  4JRR A;  1K3Y A;  4E8E A;  1JFU A;  4WBR D;  1NHO A;  2WW2 A;  4LMV A;  4HQS A;  2LQO A;  1UVZ A;  3IHQ A;  4I6X A;  4XTS A;  5HFG A;  3VUR A;  3P7X A;  2PN8 A;  2B5E A;  3EMP A;  4XRA A;  4ICY A;  5ECI B;  3GUS A;  2LEG A;  3ZML A;  4YH2 A;  4V1A g;  1DE2 A;  4PQH A;  2DJJ A;  4MP4 A;  1X5C A;  4PUF C;  2GSS A;  2DLX A;  2GSR A;  1SU9 A;  2F9S A;  2IFQ B;  2H1D A;  1MTC A;  8GSS A;  3A5W A;  3VI5 A;  3LJR A;  4XS4 A;  4WEY A;  1FW1 A;  2R0C A;  2LUS A;  4IP1 A;  3UVH A;  4K0G A;  1FB6 A;  1ZMA A;  2P5Q A;  5F0G A;  4K2D A;  4MH2 A;  4L5L A;  4OO4 A;  1SVM A;  1ST9 A;  3ZFL A;  3FR9 A;  4KX4 A;  4K9Z A;  1ZZY A;  2DJK A;  2WW3 A;  3P90 A;  3HA9 A;  3MWH A;  2WVX A;  2H1A A;  3U5R E;  3ZRE A;  2VCV A;  3TJK A;  3HMJ G;  3PR8 A;  3C7M A;  1SK1 A;  3O76 A;  4EC0 A;  5D9V A;  3MAK A;  1XBS A;  3EIN A;  1RW1 A;  4N3Z A;  1K0A A;  1VF1 A;  3HYP A;  2LTK A;  4MZW A;  4PGT A;  2GZY A;  3APO A;  3RAZ A;  4ISD A;  2LNT A;  5J4U A;  4TKY A;  3VFI A;  2HXK A;  1PGT A;  5AIV A;  1ERV A;  3TKR A;  4BWQ A;  1GTU A;  2RM5 A;  2FY6 A;  2DSA A;  1B9X C;  5KN2 A;  1G6W A;  2DKH A;  4IN0 A;  2ZUP A;  5G1L A;  3GH6 A;  3GKM A;  3CWG A;  3E9J B;  5IMV A;  3KP8 A;  4PHZ C;  4DSS B;  1T3B A;  3ZMK A;  1WMJ A;  2H1L A;  4LMW A;  4KDX A;  4AI6 A;  5KN3 A;  3TB2 A;  4FO5 A;  4F2I A;  2CAI A;  4DSS A;  4W66 A;  4JBB A;  2LRN A;  4ECC A;  3IXR A;  1AQW A;  1GTA A;  3GL3 A;  2JZS A;  4GSN A;  3R2Q A;  3WT1 A;  1K0N A;  1SL2 B;  2GT5 A;  5EPF A;  2DC5 A;  5J5N A;  4L0U A;  2GGT A;  1K3L A;  2IN3 A;  4O5R A;  2CX4 A;  4EL1 A;  2OAD A;  1NSW A;  3PPU A;  4YQM A;  4WXT A;  1YY7 A;  5ELA A;  2WW0 A;  5A4W A;  5CAX A;  3TJJ A;  4D73 B;  4BVX A;  3UL3 A;  2YAN A;  1O81 A;  2P31 A;  1WIK A;  3DEX A;  5B7C A;  3NZN A;  4POL A;  5DAL B;  5DAK B;  3CSJ A;  2IPA A;  4ZBB A;  1GSF A;  3D0Z A;  1ZOF A;  3SBC A;  4BA7 A;  2I81 A;  5AGY A;  4Z7X A;  2VM2 A;  1T8E B;  1TXX A;  5E4W A;  5A1N B;  7GSS A;  1XW5 A;  1M7T A;  3ED3 A;  1R26 A;  1MEK A;  4HJM A;  1KTE A;  1N25 A;  2MZC A;  1QXH A;  4GRF A;  2JSY A;  1URM A;  3ZFB A;  2V6K A;  2B5X A;  5ECQ B;  3EU4 A;  3GH9 A;  2WW1 A;  4YKG A;  2LNS A;  5G5E A;  2BTO T;  3O6T A;  2LV3 A;  2QGV A;  3TRP A;  22GS A;  4GLT A;  5EY6 A;  3HDC A;  3V1W A;  1IYI A;  1ERT A;  4KDY A;  2OBI A;  1X0R A;  3F9U A;  3WGD A;  2FUG 2;  4GCI A;  1V40 A;  3M9K A;  2HRA A;  1WP0 A;  3RDW A;  3W6G A;  5D8I A;  2VAF A;  1O8W A;  4TR1 B;  2F8F A;  4PQ1 A;  1A23 A;  2WJU A;  4TXO A;  5F05 A;  1HNA A;  5BMU B;  5COH A;  1MD4 A;  3HZ8 A;  3ISO A;  4A5P A;  2AJQ B;  4ZXG A;  3FHK A;  3Q6O A;  1PN9 A;  5A34 A;  2XPD A;  6GSY A;  4QMK A;  2HZF A;  2GVP A;  2JAC A;  3KD0 A;  4ML1 A;  2HFD A;  2PUK C;  2QA2 A;  1XOB A;  3PIN A;  5J9B A;  1RQM A;  3DVX A;  2QA1 A;  1XIY A;  3F63 A;  5FHI A;  3C71 A;  1XWK A;  3OR5 A;  2GDR A;  3IBH A;  4MAB A;  1X9W B;  4MCU A;  14GS A;  3GKX A;  5IM9 A;  4K7N A;  2XBI A;  1Z7P A;  5HFK A;  1J08 A;  1XVW A;  4ULX A;  3RFR C;  4V2N A;  4ZB9 A;  3MSZ A;  4IGJ A;  2L4Q A;  1SJI A;  1SEN A;  3VWU A;  3LWA A;  1F37 A;  4X43 A;  1FO5 A;  2JSZ A;  1ACV A;  1FG4 A;  4CW9 A;  4KSM A;  1GUM A;  4O5U A;  2ALB A;  3VI7 A;  2DIY A;  4MJB A;  4RI7 A;  1ZYE A;  1XWC A;  4MA9 A;  3FMW A;  3KTL A;  4WF4 A;  2N5F A;  4AKH A;  1JZW A;  4WKW A;  1NHY A;  3J7Y b;  5CRE A;  2K8V A;  3ME7 A;  2NDO A;  2YPM A;  4RI6 A;  4OCE A;  1XCC A;  2H1B A;  4EIP A;  3MYD A;  4PNF A;  4K7I A;  5D96 A;  3D4T A;  3DYR A;  3GNJ A;  1K3O A;  1BG5 A;  2JZR A;  5DDL A;  4GWR A;  2GS3 A;  2FA4 A;  1F3B A;  2H6Y A;  5D9T A;  2LRT A;  2IMD A;  2L57 A;  4WET A;  4PI0 C;  5HQP A;  5CRW A;  2CVD A;  3FKF A;  5JCU A;  3MNG A;  4YAP A;  1ZCP A;  2YV9 A;  1M2B A;  2DJ2 A;  4DEJ A;  3RBT A;  3NIV A;  4POB A;  5IPH A;  1X5D A;  4H86 A;  1AUC A;  3QD9 A;  3LFL A;  1AQV A;  2VUP A;  4OFN A;  1GNE A;  3A3T A;  4KCA A;  5AN1 A;  1PD2 1;  4MNN A;  2R37 A;  3F3R A;  2L5L A;  3APS A;  1WWJ A;  2DIZ A;  4KF9 A;  4Q5R A;  5GSS A;  2A2S A;  4N0V A;  4ILF A;  1Z6M A;  4MZB A;  3QPM A;  5C04 A;  1PL2 A;  2IJY A;  3GX8 A;  3PH9 A;  4GQC A;  5ECP B;  1OC9 B;  2E7P A;  3TGZ A;  4GQF A;  1R5A A;  2O5V A;  2K18 A;  3GUR A;  2IMK A;  1M3J A;  2GT6 A;  3FZ4 A;  1ZYN A;  4ZBA A;  3LGC A;  2LJK A;  4IVF A;  2YWO A;  3KZQ A;  3C8E A;  2H66 A;  1U87 A;  1FOV A;  4E68 A;  1YEX A;  3WGX A;  5KN1 A;  4TOP A;  2HRK B;  1U6T A;  3GMF A;  2YWM A;  1G0T A;  3QAV A;  3GA4 A;  2VIM A;  2EFC A;  3L9V A;  1E6B A;  3ZIV A;  2OE1 A;  3UBL A;  1N8J A;  4MJC A;  12GS A;  2MBS A;  3Q74 A;  4HOJ A;  3EMX A;  3DML A;  1AC1 A;  4BVY B;  1QK8 A;  1R4W A;  4NXI A;  5A4V A;  1X9S B;  5A5H B;  4HJ2 A;  2C0F A;  3D6I A;  2DJ1 A;  3GTU A;  1PRX A;  2IMI A;  4RQX A;  3VWW A;  1TXU A;  1SD8 A;  5E59 A;  4EVM A;  4BVY A;  4PUA A;  4ZBD A;  1VF3 A;  2WDU A;  2WFC A;  1EOG A;  2GQK A;  2VCZ A;  2O89 A;  2OJL A;  2FWE A;  4WR4 A;  2HSH A;  4NV5 A;  1LU4 A;  2AYT A;  3F6F A;  5ECR B;  4ZB7 A;  1O85 A;  2LKU A;  9GSS A;  1A2J A;  5IMC A;  2EFD A;  2D2Z A;  2R4V A;  1OVN A;  2MMO A;  5GAN D;  1A2L A;  5IPG A;  1YKC A;  3A2W A;  1GSQ A;  4XCS A;  1OAZ A;  4QL7 A;  1S4B P;  4HS1 A;  3ERF A;  2EIR A;  3U6V A;  4XS4 B;  4OWY A;  2GTU A;  4NHZ A;  1A2M A;  3F4T A;  1GL8 A;  3GX0 A;  2HSY A;  3JCM L;  4BPY A;  5F06 A;  2DML A;  2HSN A;  4EUY A;  1F3A A;  4G2E A;  1TW9 A;  1GSS A;  3M9J A;  1M9A A;  1I9D A;  1TP9 A;  3RPP A;  3QOU A;  3CYN A;  4AJ7 A;  2JZT A;  1TI3 A;  4Z2T A;  4I97 A;  5G31 A;  3LYK A;  3ZIT A;  3A2X A;  3IHG A;  3IDV A;  2H19 A;  4TR4 A;  1YEW C;  2E2G A;  2HNL A;  2WVX B;  1XWG A;  3IC4 A;  2J9H A;  4AJ8 A;  3FK8 A;  1ML6 A;  4IBP A;  2XPE A;  1TK0 B;  3ERW A;  13GS A;  4JE1 A;  4FQU A;  16GS A;  4HI7 A;  1GRX A;  3FR6 A;  3G7I A;  1SJ6 A;  4ECJ A;  4PXO A;  2C80 A;  1EP8 A;  3TKS A;  1JHB A;  3D21 A;  5J41 A;  5B6M A;  1BG1 A;  2C1Y A;  1SK0 A;  1Z7R A;  3DKS A;  3W8J A;  3TRQ A;  1KEB A;  4IJ3 A;  2OE0 A;  5G2Z A;  1S3R A;  1Z5Y E;  2IWT A;  1S3D A;  2R5G A;  2NPB A;  2H01 A;  2O3E A;  1S3A A;  1QQ2 A;  1Q4J A;  1VF2 A;  2CVB A;  4CY6 A;  2H6Z A;  3H93 A;  1VGL A;  2NVL A;  1PQN A;  2RLI A;  3M1G A;  5A5K A;  1K0M A;  1XXU A;  5KOW A;  3DD3 A;  2ZCT A;  3GKN A;  1I5G A;  2GZZ A;  4LA1 A;  2H0G A;  1XVQ A;  2X64 A;  3APQ A;  1CQG A;  4GTU A;  4TR0 A;  1T00 A;  1GLQ A;  5CRH A;  4KB3 A;  5D9X A;  2FCH A;  5DCH A;  4AKX B;  2UV8 G;  3M3M A;  1EZK A;  3DGQ A;  2CV4 A;  3UBK A;  2ZNM A;  4F82 A;  5LNK e;  1PX7 A;  5D73 A;  2M72 A;  2G2Q A;  1GTI A;  4GF0 A;  1EEJ A;  2X49 A;  3HXS A;  4KA0 A;  2F3M A;  5J9C A;  4DVC A;  4ID0 A;  1YZX A;  2GQL A;  5ECM B;  3UAP A;  3WT2 A;  2L5O A;  3C73 A;  1MDJ A;  2R2J A;  2HT9 A;  2B1K A;  2F51 A;  4BL7 A;  4BVX B;  1A0F A;  4PNG A;  2K8S A;  2IIY A;  2VLU A;  6GSU A;  2NBS A;  3BOA A;  5DJM A;  2CVK A;  2LRC A;  3CSH A;  2VO4 A;  2FD3 A;  4IQ1 A;  4AJ6 A;  4L8E A;  3VPT A;  4GXZ A;  2WVZ A;  1SL0 B;  4XS1 A;  4XIH A;  3BJ5 A;  3ZRD A;  3NOF A;  4KSO A;  1BED A;  1Y6E A;  1PKZ A;  4YAV A;  4EKZ A;  4L0W A;  1WOU A;  2RII A;  1GUL A;  2YP6 A;  1TRS A;  4TRX A;  3ZZX A;  4TW5 A;  3EVI A;  4WF5 A;  3EUR A;  1Y1U A;  3MIX A;  5D9W A;  2CAQ A;  2OKA A;  5AIS A;  3BCK A;  4FYB A;  3DWV A;  1WJK A;  3FZ9 A;  5J3R A;  3HVV A;  3HY2 A;  2EC4 A;  3ZTL A;  1A24 A;  4K0N A;  1DSB A;  2VL9 A;  4HSC X;  4X0X A;  3H8Q A;  3UVT A;  5JWO B;  5ELG A;  20GS A;  2YJ7 A;  1MD3 A;  2KUC A;  2B1L A;  2HSM A;  2R0G A;  4LL4 B;  1DUG A;  1RK4 A;  1ZYP A;  2A2P A;  4TXV A;  3LXT A;  3H1N A;  3HVS A;  3QCP A;  2YZH A;  3E0U A;  1XOA A;  1C72 A;  1V9W A;  4TXO B;  1EOH A;  2V41 A;  3BCI A;  1H4O A;  1M0U A;  3IAS 2;  2OBK A;  2C0G A;  1YVL A;  2YN1 A;  1SVL A;  3IK9 A;  5JCG A;  1PMT A;  3KMO A;  4OFM A;  1Y25 A;  2VCX A;  5A34 B;  4EDZ A;  4IEL A;  4YQU A;  2C8U A;  2MBT A;  2Z9S A;  4EDY A;  4MZC A;  1G7E A;  4PTS A;  4MPF A;  2X8H A;  1CQH A;  4OD7 A;  1O6J A;  3F6D A;  1F9M A;  2C0D A;  3TCO A;  5LD0 A;  2F8A A;  2AAW A;  5KOX A;  2PVQ A;  3CXG A;  5A4U A;  2CA8 A;  4PUR A;  5J40 A;  1UA5 A;  2WCI A;  4K2X A;  5LCZ A;  1O8X A;  4TR3 A;  2VLT A;  3IE3 A;  4G19 A;  4RQR A;  2FLS A;  2TIR A;  4F9Z A;  2YV7 A;  1YKA A;  4E8H A;  5HR3 A;  1OE7 A;  3CQF A;  5ENU A;  2EIO A;  3ZVJ A;  2AUV A;  1JZD A;  2V2G A;  1SKS B;  1B4P A;  3CTG A;  2VCQ A;  1ZYQ B;  2AHE A;  3C1R A;  3KMN A;  3KTB A;  3EE2 A;  1BAY A;  2VCT A;  4ACS A;  2PBJ A;  2RM6 A;  1NM3 A;  5DVB A;  1B9Y C;  3IOS A;  3FZ5 A;  1PKW A;  2GQM A;  3IRA A;  5J4V A;  2YCD A;  4IJI A;  2PGT A;  2R0P A;  4WBJ A;  2IL3 A;  2P5R A;  2WZS A;  3FW2 A;  3VWX A;  3CSI A;  5IMZ A;  5JCW A;  3FRC A;  5DQY A;  3N9J A;  3GV1 A;  6GST A;  3WGE A;  5GAP D;  5ABR A;  4G10 A;  4K6X A;  5B8A A;  1FHE A;  3VPQ A;  4ZIL A;  2WRT A;  1VF4 A;  1Q98 A;  4YKF A;  3CBU A;  3LQ7 A;  1NW2 A;  1YQ1 A;  1FAA A;  3TJB A;  3I69 A;  1B4Q A;  5CNW A;  4MF7 A;  2AV4 A;  3HHV A;  2PER A;  3UAR A;  3CMI A;  2B6M A;  2B3S A;  2AB6 A;  4Q5N A;  4AGS A;  2G0F A;  1PSQ A;  2QKE A;  3L78 A;  4I2U A;  11GS A;  5FWG A;  4OFT A;  2TRX A;  4EIQ A;  1WPI A;  2HZE A;  3IV4 A;  4XHM A;  5FT3 A;  2VLV A;  1TDI A;  3CRT A;  1GSD A;  4KW6 A;  3J7Y k;  2EFH A;  2DJ3 A;  3FEU A;  1TTZ A;  3ERG A;  3RHC A;  5KN0 A;  3GFK A;  2VL2 A;  3A5I A;  4WR5 A;  2X8G A;  2PU9 C;  1MDI A;  4I5Q A;  4KUN A;  2H1G A;  3HJP A;  5B8B A;  2VKZ G;  4G0L A;  5D93 A;  3PGT A;  4ML6 A;  2I9H A;  2BMX A;  1BF5 A;  6GSW A;  5GZZ B;  4CY8 A;  2H8L A;  4DSR A;  4MDC A;  4I2T A;  2GST A;  2FGX A;  3HZ4 A;  1EV9 A;  2ES7 A;  5ECO B;  5BRT A;  5CYY A;  5ECL B;  1FOH A;  2LS5 A;  4EO3 A;  3GIX A;  5DJL A;  3KEB A;  1BJX A;  2LJR A;  4NPB A;  2H0H A;  2WZ9 A;  2E0Q A;  3E3E A;  2A4H A;  1V2A A;  3KIJ A;  3GTU B;  2MMA A;  4EXJ A;  5DCG A;  2WGR A;  1YDK A;  2VD1 A;  1T7P B;  4FIW A;  5ECN B;  3ZIJ A;  4N10 A;  1SKR B;  4FYC A;  4NWY A;  4V2M A;  2N5A A;  1GTB A;  3GYK A;  4DSQ A;  1QMV A;  5JWR B;  2XC2 A;  2HQT A;  4MJE A;  1SKW B;  5G1K A;  3LEF A;  3GL5 A;  4J56 E;  6GSX A;  1ZL9 A;  4KDU A;  2ON7 A;  1HNC A;  4KE3 A;  1A8Y A;  2LJA A;  2LQQ A;  3CTF A;  2NTO A;  2DMM A;  1R7H A;  1AQX A;  3WD6 A;  4NHW A;  5F07 A;  1TKD B;  3F4S A;  4X1U A;  2HSN B;  1TI1 A;  1QGV A;  1JZO A;  1USB A;  3LSZ A;  3EU3 A;  5IO2 A;  5ECS A;  4P3Y B;  1EP7 A;  1K0D A;  3TUE A;  6GSS A;  4RUV A;  2QSI A;  2OAC A;  2H73 A;  1SK2 A;  5HR1 A;  2X99 A;  2XHF A;  3ZYW A;  1SL1 B;  3GHA A;  19GS A;  4FYU A;  3C1S A;  3CRU A;  3F3Q A;  1TK5 B;  2YNX A;  3IR4 A;  1GLP A;  4NMU A;  4KGI A;  4K1F A;  2QC7 A;  2H0I A;  1PL1 A;  3KP9 A;  1WRY A;  4FXY P;  3ZLP A;  3IK7 A;  4MPG A;  3UIW A;  2HRN A;  1XWA A;  1PA3 A;  2IFQ A;  4CHS A;  3VWV A;  3TKP A;  3HKR A;  5IO0 A;  2YWI A;  1V58 A;  4LLR A;  2PVO C;  2FA8 A;  4V1A p;  2HYX A;  1KBN A;  5HR2 A;  3GN3 A;  1U3I A;  1YF1 A;  1YJ6 A;  1BX9 A;  5INY A;  2X4A A;  4TVE A;  4V2L A;  3TJF A;  2C3Q A;  2J23 A;  1K0C A;  3EPT A;  3DRN A;  3L4N A;  3GRX A;  1SYX A;  1HNB A;  4GDF A;  1X5E A;  1PX6 A;  5CRG A;  1A0R P;  3KH9 A;  1TRU A;  1M99 A;  2FWH A;  4F0C A;  2REM A;  1GSY A;  2L59 A;  1TU7 A;  1ILO A;  2CZ3 A;  1G7O A;  1J9B A;  1OE8 A;  4Q5F A;  1PN0 A;  1SD9 A;  3RPN A;  4L5O A;  1FB0 A;  2L6D A;  1JLV A;  1BYE A;  3TJG A;  1TJD A;  1X9M B;  1XFL A;  3P8W A;  1M2A A;  4MF6 A;  4ECB A;  3FY7 A;  3IA1 A;  2FNO A;  2HI7 A;  2HRF A;  2MMN A;  2O7K A;  4MH3 A;  2B5Y A;  6GSV A;  1ON4 A;  4BL7 B;  3FZA A;  4Z2U A;  1HQO A;  3AY8 A;  2FWG A;  2GZP A;  4G0I A;  3TU3 B;  1Z3E A;  3UEM A;  2MYG A;  1UN2 A;  2CX3 A;  5IMD A;  5EVO A;  1PFO A;  4IHU A;  1V98 A;  4J57 E;  1JLW A;  2N5B A;  4K5R A;  3RGB C;  4EE0 A;  1M3I A;  2V32 A;  5HFI A;  3TDG A;  2X8C A;  3DXB A;  1ERW A;  4K8M A;  3WYW A;  2VCW A;  3DIE A;  2XBQ A;  1N2A A;  4F0B A;  4PQI A;  2WVY A;  1T4Y A;  4HUA A;  3DVW A;  1M2D A;  1XZO A;  5IOW A;  3W8S A;  2CQ9 A;  3L9U A;  1EGO A;  2PMT A;  3F8U A;  2TRC P;  5CP1 A;  4JR4 A;  5ECH B;  1TRV A;  2DJ0 A;  1KNG A;  4O92 A;  3HCZ A;  3QFB C;  4N0Z A;  4G0K A;  3S9F A;  2KP1 A;  2B7K A;  3IAM 2;  1YEP A;  4JU5 A;  1AAZ A;  3LOR A;  5B6N A;  1J0F A;  5DBQ A;  4F03 A;  2C4J A;  4D73 A;  1EEM A;  3G7Y A;  3KCM A;  1OKT A;  3QAW A;  2KHP A;  3EC3 A;  1QFN A;  3QAG A;  1XWB A;  3TKS E;  2HSM B;  2CT6 A;  2YWN A;  4JZQ A;  1UC7 A;  3GKK A;  1OKD A;  2PWJ A;  5DAL A;  2FHE A;  4N30 A;  4XS6 A;  1AXD A;  1EV4 A;  5DAK A; 
#chains in the Genus database with same CATH homology
 1W4V A;  3LYP A;  1SJZ A;  3M8N A;  3Q19 A;  4KND A;  1LBK A;  1HD2 A;  1SVO A;  3EWL A;  2I1U A;  2B7J A;  4O32 A;  5A1N A;  3Q18 A;  2KP2 A;  2YJH A;  4JR6 A;  1T4Z A;  1E2Y A;  4CDO A;  3D22 A;  3ZVJ D;  4NAX A;  2JAD A;  1H75 A;  2JU5 A;  1O73 A;  4I8B A;  1LJR A;  2C0E A;  2RUE A;  5G5F A;  4YQV A;  1GSU A;  3H4K A;  3HVX A;  4PX1 A;  4Q5Q A;  3R3E A;  5H5R A;  3TOU A;  2HE3 A;  1XW6 A;  5F8B A;  2V6O A;  2YOI A;  3F0I A;  4AF2 A;  1F6M C;  4N11 A;  5GST A;  2IMF A;  1DE1 A;  5AIX A;  4ZL9 A;  1EGR A;  1OYJ A;  5IMA A;  3TKQ A;  4GSS A;  1TK8 B;  4IP6 A;  3QMX A;  2M46 A;  4TR1 A;  4KH7 A;  4TN8 A;  3D5J A;  2CZ2 A;  4GST A;  4MMM A;  1GUK A;  1GSE A;  2R6K A;  3F4R A;  4IS0 A;  4HU7 A;  4J2F A;  5BMU A;  2BJX A;  5C00 A;  4HZ2 A;  2KLX A;  3ZL5 A;  2VD0 A;  2UZ8 A;  3SWL A;  1VRS D;  2VL2 C;  2R3X A;  3UMA A;  2RUF A;  3HD5 A;  4HEA 2;  3UOM A;  2WUL A;  3H79 A;  2O85 A;  5IIZ A;  1YF0 A;  3P2A A;  3I9V 2;  3RHB A;  2EIQ A;  4KAE A;  1BQ7 A;  2L4C A;  2VOC A;  3L0H A;  1B48 A;  1GH2 A;  2H30 A;  1M9B A;  4OCF A;  3G7J A;  3MDK A;  5H5Q A;  3D4M A;  2PPT A;  4JED A;  1IYH A;  1R5P A;  5CO3 A;  2HLS A;  2A2R A;  4OMV A;  1DBY A;  1U88 A;  1TRW A;  4NV2 A;  2I3Y A;  2LST A;  2H75 A;  1Z6N A;  5EL8 A;  1TOF A;  4XRD A;  1T1V A;  3ME8 A;  1A8L A;  2O8V B;  3KGK A;  3UJ1 A;  4MF5 A;  5G30 A;  3LW9 A;  4ZL7 A;  2VL3 A;  5ECK B;  2GSQ A;  3I6A A;  3TOT A;  1OC8 A;  2H70 A;  2FWF A;  4EF0 A;  3G9B A;  2A4V A;  2JL4 A;  2K6V A;  5L71 A;  3IC8 A;  2I4A A;  2IME A;  2H71 A;  3GSS A;  3O3T A;  1FVK A;  1FVJ A;  2HZE B;  4QQ7 A;  3BD2 A;  1ABA A;  3HJM A;  4HQZ A;  4ZIJ A;  1SYR A;  3QR6 A;  4QL9 A;  1AW9 A;  1MDK A;  4MLY A;  5IMF A;  1ZGN A;  3HJO A;  3LXZ A;  3I43 A;  4Z2R A;  4USS A;  3KH7 A;  2H6X A;  3VLN A;  1V57 A;  1HYU A;  4POM A;  3QDN A;  2L6C A;  4K7O A;  3FYG A;  4POK A;  4ZB6 A;  2VM1 A;  3KM6 A;  5HR0 A;  2E2M A;  4IQA A;  4KCE A;  5H5S A;  1GNW A;  5CRD A;  3FR3 A;  1F2E A;  3QFA C;  1OC3 A;  4O7H A;  4HU9 A;  2H74 A;  5KEJ A;  2MMZ A;  2OA7 A;  4MK3 A;  2DBC A;  4K5S A;  4FH8 A;  5ID2 B;  1EWX A;  1JZR A;  10GS A;  1B8X A;  2DKI A;  2H76 A;  1S3C A;  1Z9H A;  3VK9 A;  4ZL8 A;  4MJA A;  4G9H A;  3N5O A;  3TRX A;  5ID2 A;  3KJY A;  2KOK A;  1OC9 A;  2ON5 A;  2P0G A;  2WS2 A;  3US3 A;  2OE3 A;  2K9F A;  4AKI A;  2M80 A;  3GST A;  2YZU A;  4HDE A;  1THO A;  2WB9 A;  5JWQ B;  2EFE A;  1O7U A;  2H72 A;  3KXO A;  5DQS A;  3BBY A;  1ERU A;  2GLR A;  1K0B A;  3A2V A;  3L9S A;  2HRK A;  3TKS C;  4BWS A;  1GUH A;  3K8N A;  1WE0 A;  18GS A;  1U3A A;  3IPZ A;  4IW9 A;  1XPV A;  4LL1 B;  4G01 A;  1TU8 A;  5IOX A;  5J47 A;  1W89 A;  4ZB8 A;  1G6Y A;  2V1M A;  1GP1 A;  1GWC A;  4HZ4 A;  5IQY A;  1K0O A;  4OO5 A;  1XW9 A;  4IKH A;  5J4Y A;  1AIU A;  1THX A;  3M0F A;  1QUW A;  2O87 A;  5A5H A;  4ECI A;  2C3T A;  2OT3 A;  17GS A;  4O5Q A;  2C3N A;  4X4J A;  3EYT A;  3LG6 A;  4AKG A;  4JRR A;  1K3Y A;  4E8E A;  1JFU A;  4WBR D;  1NHO A;  4LMV A;  4HQS A;  2LQO A;  1UVZ A;  3IHQ A;  4I6X A;  4XTS A;  5HFG A;  3VUR A;  3P7X A;  2PN8 A;  2B5E A;  3EMP A;  4XRA A;  4ICY A;  5ECI B;  3GUS A;  2LEG A;  3ZML A;  4YH2 A;  4V1A g;  1DE2 A;  4PQH A;  2DJJ A;  4MP4 A;  1X5C A;  4PUF C;  2GSS A;  2DLX A;  2GSR A;  1SU9 A;  2F9S A;  2IFQ B;  2H1D A;  1MTC A;  8GSS A;  3A5W A;  3VI5 A;  3LJR A;  4XS4 A;  4WEY A;  1FW1 A;  2R0C A;  2LUS A;  4IP1 A;  3UVH A;  4K0G A;  1FB6 A;  1ZMA A;  2P5Q A;  5F0G A;  4K2D A;  4MH2 A;  4L5L A;  4OO4 A;  1SVM A;  1ST9 A;  3ZFL A;  3FR9 A;  4KX4 A;  4K9Z A;  1ZZY A;  2DJK A;  3P90 A;  3HA9 A;  3MWH A;  2H1A A;  3U5R E;  3ZRE A;  2VCV A;  3TJK A;  3HMJ G;  3PR8 A;  3C7M A;  1SK1 A;  3O76 A;  4EC0 A;  5D9V A;  3MAK A;  1XBS A;  3EIN A;  1RW1 A;  4N3Z A;  1K0A A;  1VF1 A;  3HYP A;  2LTK A;  4MZW A;  4PGT A;  2GZY A;  3APO A;  3RAZ A;  4ISD A;  2LNT A;  5J4U A;  4TKY A;  3VFI A;  2HXK A;  1PGT A;  5AIV A;  1ERV A;  3TKR A;  4BWQ A;  1GTU A;  2RM5 A;  2FY6 A;  2DSA A;  1B9X C;  5KN2 A;  1G6W A;  2DKH A;  4IN0 A;  2ZUP A;  5G1L A;  3GH6 A;  3GKM A;  3CWG A;  3E9J B;  5IMV A;  3KP8 A;  4DSS B;  1T3B A;  3ZMK A;  1WMJ A;  2H1L A;  4LMW A;  4KDX A;  4AI6 A;  5KN3 A;  3TB2 A;  4FO5 A;  4F2I A;  2CAI A;  4DSS A;  4W66 A;  4JBB A;  2LRN A;  4ECC A;  3IXR A;  1AQW A;  1GTA A;  3GL3 A;  2JZS A;  4GSN A;  3R2Q A;  3WT1 A;  1K0N A;  1SL2 B;  2GT5 A;  5EPF A;  2DC5 A;  5J5N A;  4L0U A;  2GGT A;  1K3L A;  2IN3 A;  4O5R A;  2CX4 A;  4EL1 A;  2OAD A;  1NSW A;  3PPU A;  4YQM A;  4WXT A;  1YY7 A;  5ELA A;  5A4W A;  5CAX A;  3TJJ A;  4D73 B;  4BVX A;  3UL3 A;  2YAN A;  1O81 A;  2P31 A;  1WIK A;  3DEX A;  5B7C A;  3NZN A;  4POL A;  5DAL B;  5DAK B;  3CSJ A;  2IPA A;  4ZBB A;  1GSF A;  3D0Z A;  1ZOF A;  3SBC A;  4BA7 A;  2I81 A;  5AGY A;  4Z7X A;  2VM2 A;  1T8E B;  1TXX A;  5E4W A;  5A1N B;  7GSS A;  1XW5 A;  1M7T A;  3ED3 A;  1R26 A;  1MEK A;  4HJM A;  1KTE A;  1N25 A;  2MZC A;  1QXH A;  4GRF A;  2JSY A;  1URM A;  3ZFB A;  2V6K A;  2B5X A;  5ECQ B;  3EU4 A;  3GH9 A;  4YKG A;  2LNS A;  5G5E A;  2BTO T;  3O6T A;  2LV3 A;  2QGV A;  3TRP A;  22GS A;  4GLT A;  5EY6 A;  3HDC A;  3V1W A;  1IYI A;  1ERT A;  4KDY A;  2OBI A;  1X0R A;  3F9U A;  3WGD A;  2FUG 2;  4GCI A;  1V40 A;  3M9K A;  2HRA A;  1WP0 A;  3RDW A;  3W6G A;  5D8I A;  2VAF A;  1O8W A;  4TR1 B;  2F8F A;  4PQ1 A;  1A23 A;  2WJU A;  4TXO A;  5F05 A;  1HNA A;  5BMU B;  5COH A;  1MD4 A;  3HZ8 A;  3ISO A;  4A5P A;  2AJQ B;  4ZXG A;  3FHK A;  3Q6O A;  1PN9 A;  5A34 A;  2XPD A;  6GSY A;  4QMK A;  2HZF A;  2GVP A;  2JAC A;  3KD0 A;  4ML1 A;  2HFD A;  2PUK C;  2QA2 A;  1XOB A;  3PIN A;  5J9B A;  1RQM A;  3DVX A;  2QA1 A;  1XIY A;  3F63 A;  5FHI A;  3C71 A;  1XWK A;  3OR5 A;  2GDR A;  3IBH A;  4MAB A;  1X9W B;  4MCU A;  14GS A;  3GKX A;  5IM9 A;  4K7N A;  2XBI A;  1Z7P A;  5HFK A;  1J08 A;  1XVW A;  4ULX A;  4V2N A;  4ZB9 A;  3MSZ A;  4IGJ A;  2L4Q A;  1SJI A;  1SEN A;  3VWU A;  3LWA A;  1F37 A;  4X43 A;  1FO5 A;  2JSZ A;  1ACV A;  1FG4 A;  4CW9 A;  4KSM A;  1GUM A;  4O5U A;  2ALB A;  3VI7 A;  2DIY A;  4MJB A;  4RI7 A;  1ZYE A;  1XWC A;  4MA9 A;  3FMW A;  3KTL A;  4WF4 A;  2N5F A;  4AKH A;  1JZW A;  4WKW A;  1NHY A;  3J7Y b;  5CRE A;  2K8V A;  3ME7 A;  2NDO A;  2YPM A;  4RI6 A;  4OCE A;  1XCC A;  2H1B A;  4EIP A;  3MYD A;  4PNF A;  4K7I A;  5D96 A;  3D4T A;  3DYR A;  3GNJ A;  1K3O A;  1BG5 A;  2JZR A;  5DDL A;  4GWR A;  2GS3 A;  2FA4 A;  1F3B A;  2H6Y A;  5D9T A;  2LRT A;  2IMD A;  2L57 A;  4WET A;  5HQP A;  5CRW A;  2CVD A;  3FKF A;  5JCU A;  3MNG A;  4YAP A;  1ZCP A;  2YV9 A;  1M2B A;  2DJ2 A;  4DEJ A;  3RBT A;  3NIV A;  4POB A;  5IPH A;  1X5D A;  4H86 A;  1AUC A;  3QD9 A;  3LFL A;  1AQV A;  2VUP A;  4OFN A;  1GNE A;  3A3T A;  4KCA A;  5AN1 A;  1PD2 1;  4MNN A;  2R37 A;  3F3R A;  2L5L A;  3APS A;  1WWJ A;  2DIZ A;  4KF9 A;  4Q5R A;  5GSS A;  2A2S A;  4N0V A;  4ILF A;  1Z6M A;  4MZB A;  3QPM A;  5C04 A;  1PL2 A;  2IJY A;  3GX8 A;  3PH9 A;  4GQC A;  5ECP B;  1OC9 B;  2E7P A;  3TGZ A;  4GQF A;  1R5A A;  2O5V A;  2K18 A;  3GUR A;  2IMK A;  2GT6 A;  3FZ4 A;  1ZYN A;  4ZBA A;  3LGC A;  2LJK A;  4IVF A;  2YWO A;  3KZQ A;  3C8E A;  2H66 A;  1U87 A;  1FOV A;  4E68 A;  1YEX A;  3WGX A;  5KN1 A;  4TOP A;  2HRK B;  1U6T A;  3GMF A;  2YWM A;  1G0T A;  3QAV A;  3GA4 A;  2VIM A;  2EFC A;  3L9V A;  1E6B A;  3ZIV A;  2OE1 A;  3UBL A;  1N8J A;  4MJC A;  12GS A;  2MBS A;  3Q74 A;  4HOJ A;  3EMX A;  3DML A;  1AC1 A;  4BVY B;  1QK8 A;  1R4W A;  4NXI A;  5A4V A;  1X9S B;  5A5H B;  4HJ2 A;  2C0F A;  3D6I A;  2DJ1 A;  3GTU A;  1PRX A;  2IMI A;  4RQX A;  3VWW A;  1TXU A;  1SD8 A;  5E59 A;  4EVM A;  4BVY A;  4PUA A;  4ZBD A;  1VF3 A;  2WDU A;  2WFC A;  1EOG A;  2GQK A;  2VCZ A;  2O89 A;  2OJL A;  2FWE A;  4WR4 A;  2HSH A;  4NV5 A;  1LU4 A;  2AYT A;  3F6F A;  5ECR B;  4ZB7 A;  1O85 A;  2LKU A;  9GSS A;  1A2J A;  5IMC A;  2EFD A;  2D2Z A;  2R4V A;  1OVN A;  2MMO A;  5GAN D;  1A2L A;  5IPG A;  1YKC A;  3A2W A;  1GSQ A;  4XCS A;  1OAZ A;  4QL7 A;  4HS1 A;  3ERF A;  2EIR A;  3U6V A;  4XS4 B;  4OWY A;  2GTU A;  4NHZ A;  1A2M A;  3F4T A;  1GL8 A;  3GX0 A;  2HSY A;  3JCM L;  4BPY A;  5F06 A;  2DML A;  2HSN A;  4EUY A;  1F3A A;  4G2E A;  1TW9 A;  1GSS A;  3M9J A;  1M9A A;  1I9D A;  1TP9 A;  3RPP A;  3QOU A;  3CYN A;  4AJ7 A;  2JZT A;  1TI3 A;  4Z2T A;  4I97 A;  5G31 A;  3LYK A;  3ZIT A;  3A2X A;  3IHG A;  3IDV A;  2H19 A;  4TR4 A;  2E2G A;  2HNL A;  1XWG A;  3IC4 A;  2J9H A;  4AJ8 A;  3FK8 A;  1ML6 A;  4IBP A;  2XPE A;  1TK0 B;  3ERW A;  13GS A;  4JE1 A;  4FQU A;  16GS A;  4HI7 A;  1GRX A;  3FR6 A;  3G7I A;  1SJ6 A;  4ECJ A;  4PXO A;  2C80 A;  1EP8 A;  3TKS A;  1JHB A;  3D21 A;  5J41 A;  5B6M A;  1BG1 A;  2C1Y A;  1SK0 A;  1Z7R A;  3DKS A;  3W8J A;  3TRQ A;  1KEB A;  4IJ3 A;  2OE0 A;  5G2Z A;  1Z5Y E;  2IWT A;  1S3D A;  2R5G A;  2NPB A;  2H01 A;  1S3A A;  1QQ2 A;  1Q4J A;  1VF2 A;  2CVB A;  4CY6 A;  2H6Z A;  3H93 A;  1VGL A;  2NVL A;  1PQN A;  2RLI A;  3M1G A;  5A5K A;  1K0M A;  1XXU A;  5KOW A;  3DD3 A;  2ZCT A;  3GKN A;  1I5G A;  2GZZ A;  4LA1 A;  2H0G A;  1XVQ A;  2X64 A;  3APQ A;  1CQG A;  4GTU A;  4TR0 A;  1T00 A;  1GLQ A;  5CRH A;  4KB3 A;  5D9X A;  2FCH A;  5DCH A;  4AKX B;  2UV8 G;  3M3M A;  1EZK A;  3DGQ A;  2CV4 A;  3UBK A;  2ZNM A;  4F82 A;  5LNK e;  1PX7 A;  5D73 A;  2M72 A;  2G2Q A;  1GTI A;  4GF0 A;  1EEJ A;  2X49 A;  3HXS A;  4KA0 A;  2F3M A;  5J9C A;  4DVC A;  4ID0 A;  1YZX A;  2GQL A;  5ECM B;  3UAP A;  3WT2 A;  2L5O A;  3C73 A;  1MDJ A;  2R2J A;  2HT9 A;  2B1K A;  2F51 A;  4BL7 A;  4BVX B;  1A0F A;  4PNG A;  2K8S A;  2IIY A;  2VLU A;  6GSU A;  2NBS A;  3BOA A;  5DJM A;  2CVK A;  2LRC A;  3CSH A;  2VO4 A;  2FD3 A;  4IQ1 A;  4AJ6 A;  4L8E A;  3VPT A;  4GXZ A;  1SL0 B;  4XS1 A;  4XIH A;  3BJ5 A;  3ZRD A;  3NOF A;  4KSO A;  1BED A;  1Y6E A;  1PKZ A;  4YAV A;  4EKZ A;  4L0W A;  1WOU A;  2RII A;  1GUL A;  2YP6 A;  1TRS A;  4TRX A;  3ZZX A;  4TW5 A;  3EVI A;  4WF5 A;  3EUR A;  1Y1U A;  3MIX A;  5D9W A;  2CAQ A;  2OKA A;  5AIS A;  3BCK A;  4FYB A;  3DWV A;  1WJK A;  3FZ9 A;  5J3R A;  3HVV A;  3HY2 A;  2EC4 A;  3ZTL A;  1A24 A;  4K0N A;  1DSB A;  2VL9 A;  4X0X A;  3H8Q A;  3UVT A;  5JWO B;  5ELG A;  20GS A;  2YJ7 A;  1MD3 A;  2KUC A;  2B1L A;  2HSM A;  2R0G A;  4LL4 B;  1DUG A;  1RK4 A;  1ZYP A;  2A2P A;  4TXV A;  3LXT A;  3H1N A;  3HVS A;  3QCP A;  2YZH A;  3E0U A;  1XOA A;  1C72 A;  1V9W A;  4TXO B;  1EOH A;  2V41 A;  3BCI A;  1H4O A;  1M0U A;  3IAS 2;  2OBK A;  2C0G A;  1YVL A;  2YN1 A;  1SVL A;  3IK9 A;  5JCG A;  1PMT A;  3KMO A;  4OFM A;  1Y25 A;  2VCX A;  5A34 B;  4EDZ A;  4IEL A;  4YQU A;  2C8U A;  2MBT A;  2Z9S A;  4EDY A;  4MZC A;  1G7E A;  4PTS A;  4MPF A;  2X8H A;  1CQH A;  4OD7 A;  1O6J A;  3F6D A;  1F9M A;  2C0D A;  3TCO A;  5LD0 A;  2F8A A;  2AAW A;  5KOX A;  2PVQ A;  3CXG A;  5A4U A;  2CA8 A;  4PUR A;  5J40 A;  1UA5 A;  2WCI A;  4K2X A;  5LCZ A;  1O8X A;  4TR3 A;  2VLT A;  3IE3 A;  4G19 A;  4RQR A;  2FLS A;  2TIR A;  4F9Z A;  2YV7 A;  1YKA A;  4E8H A;  5HR3 A;  1OE7 A;  5ENU A;  2EIO A;  3ZVJ A;  2AUV A;  1JZD A;  2V2G A;  1SKS B;  1B4P A;  3CTG A;  2VCQ A;  1ZYQ B;  2AHE A;  3C1R A;  3KMN A;  3KTB A;  3EE2 A;  1BAY A;  2VCT A;  4ACS A;  2PBJ A;  2RM6 A;  1NM3 A;  5DVB A;  1B9Y C;  3IOS A;  3FZ5 A;  1PKW A;  2GQM A;  3IRA A;  5J4V A;  2YCD A;  4IJI A;  2PGT A;  2R0P A;  4WBJ A;  2IL3 A;  2P5R A;  3FW2 A;  3VWX A;  3CSI A;  5IMZ A;  5JCW A;  3FRC A;  5DQY A;  3N9J A;  3GV1 A;  6GST A;  3WGE A;  5GAP D;  5ABR A;  4G10 A;  4K6X A;  5B8A A;  1FHE A;  3VPQ A;  4ZIL A;  2WRT A;  1VF4 A;  1Q98 A;  4YKF A;  3CBU A;  3LQ7 A;  1NW2 A;  1YQ1 A;  1FAA A;  3TJB A;  3I69 A;  1B4Q A;  5CNW A;  4MF7 A;  2AV4 A;  3HHV A;  2PER A;  3UAR A;  3CMI A;  2B6M A;  2B3S A;  2AB6 A;  4Q5N A;  4AGS A;  2G0F A;  1PSQ A;  2QKE A;  3L78 A;  4I2U A;  11GS A;  5FWG A;  4OFT A;  2TRX A;  4EIQ A;  1WPI A;  2HZE A;  3IV4 A;  4XHM A;  5FT3 A;  2VLV A;  1TDI A;  3CRT A;  1GSD A;  4KW6 A;  3J7Y k;  2EFH A;  2DJ3 A;  3FEU A;  1TTZ A;  3ERG A;  3RHC A;  5KN0 A;  3GFK A;  2VL2 A;  3A5I A;  4WR5 A;  2X8G A;  2PU9 C;  1MDI A;  4I5Q A;  4KUN A;  2H1G A;  3HJP A;  5B8B A;  2VKZ G;  4G0L A;  5D93 A;  3PGT A;  4ML6 A;  2I9H A;  2BMX A;  1BF5 A;  6GSW A;  5GZZ B;  4CY8 A;  2H8L A;  4DSR A;  4MDC A;  4I2T A;  2GST A;  2FGX A;  3HZ4 A;  1EV9 A;  2ES7 A;  5ECO B;  5BRT A;  5CYY A;  5ECL B;  1FOH A;  2LS5 A;  4EO3 A;  3GIX A;  5DJL A;  3KEB A;  1BJX A;  2LJR A;  4NPB A;  2H0H A;  2WZ9 A;  2E0Q A;  3E3E A;  2A4H A;  1V2A A;  3KIJ A;  3GTU B;  2MMA A;  4EXJ A;  5DCG A;  2WGR A;  1YDK A;  2VD1 A;  1T7P B;  4FIW A;  5ECN B;  3ZIJ A;  4N10 A;  1SKR B;  4FYC A;  4NWY A;  4V2M A;  2N5A A;  1GTB A;  3GYK A;  4DSQ A;  1QMV A;  5JWR B;  2XC2 A;  2HQT A;  4MJE A;  1SKW B;  5G1K A;  3LEF A;  3GL5 A;  4J56 E;  6GSX A;  1ZL9 A;  4KDU A;  2ON7 A;  1HNC A;  4KE3 A;  1A8Y A;  2LJA A;  2LQQ A;  3CTF A;  2NTO A;  2DMM A;  1R7H A;  1AQX A;  3WD6 A;  4NHW A;  5F07 A;  1TKD B;  3F4S A;  4X1U A;  2HSN B;  1TI1 A;  1QGV A;  1JZO A;  1USB A;  3LSZ A;  3EU3 A;  5IO2 A;  5ECS A;  4P3Y B;  1EP7 A;  1K0D A;  3TUE A;  6GSS A;  4RUV A;  2QSI A;  2OAC A;  2H73 A;  1SK2 A;  5HR1 A;  2X99 A;  2XHF A;  3ZYW A;  1SL1 B;  3GHA A;  19GS A;  4FYU A;  3C1S A;  3CRU A;  3F3Q A;  1TK5 B;  2YNX A;  3IR4 A;  1GLP A;  4NMU A;  4KGI A;  4K1F A;  2QC7 A;  2H0I A;  1PL1 A;  3KP9 A;  1WRY A;  3ZLP A;  3IK7 A;  4MPG A;  3UIW A;  2HRN A;  1XWA A;  1PA3 A;  2IFQ A;  4CHS A;  3VWV A;  3TKP A;  3HKR A;  5IO0 A;  2YWI A;  1V58 A;  4LLR A;  2PVO C;  2FA8 A;  4V1A p;  2HYX A;  1KBN A;  5HR2 A;  3GN3 A;  1U3I A;  1YF1 A;  1YJ6 A;  1BX9 A;  5INY A;  2X4A A;  4TVE A;  4V2L A;  3TJF A;  2C3Q A;  2J23 A;  1K0C A;  3EPT A;  3DRN A;  3L4N A;  3GRX A;  1SYX A;  1HNB A;  4GDF A;  1X5E A;  1PX6 A;  5CRG A;  1A0R P;  3KH9 A;  1TRU A;  1M99 A;  2FWH A;  4F0C A;  2REM A;  1GSY A;  2L59 A;  1TU7 A;  1ILO A;  2CZ3 A;  1G7O A;  1J9B A;  1OE8 A;  4Q5F A;  1PN0 A;  1SD9 A;  3RPN A;  4L5O A;  1FB0 A;  2L6D A;  1JLV A;  1BYE A;  3TJG A;  1TJD A;  1X9M B;  1XFL A;  3P8W A;  1M2A A;  4MF6 A;  4ECB A;  3FY7 A;  3IA1 A;  2FNO A;  2HI7 A;  2HRF A;  2MMN A;  2O7K A;  4MH3 A;  2B5Y A;  6GSV A;  1ON4 A;  4BL7 B;  3FZA A;  4Z2U A;  1HQO A;  3AY8 A;  2FWG A;  2GZP A;  4G0I A;  3TU3 B;  1Z3E A;  3UEM A;  2MYG A;  1UN2 A;  2CX3 A;  5IMD A;  5EVO A;  4IHU A;  1V98 A;  4J57 E;  1JLW A;  2N5B A;  4K5R A;  4EE0 A;  2V32 A;  5HFI A;  3TDG A;  2X8C A;  3DXB A;  1ERW A;  4K8M A;  3WYW A;  2VCW A;  3DIE A;  2XBQ A;  1N2A A;  4F0B A;  4PQI A;  1T4Y A;  4HUA A;  3DVW A;  1M2D A;  1XZO A;  5IOW A;  3W8S A;  2CQ9 A;  3L9U A;  1EGO A;  2PMT A;  3F8U A;  2TRC P;  5CP1 A;  4JR4 A;  5ECH B;  1TRV A;  2DJ0 A;  1KNG A;  4O92 A;  3HCZ A;  3QFB C;  4N0Z A;  4G0K A;  3S9F A;  2KP1 A;  2B7K A;  3IAM 2;  1YEP A;  4JU5 A;  1AAZ A;  3LOR A;  5B6N A;  1J0F A;  5DBQ A;  4F03 A;  2C4J A;  4D73 A;  1EEM A;  3G7Y A;  3KCM A;  1OKT A;  3QAW A;  2KHP A;  3EC3 A;  1QFN A;  3QAG A;  1XWB A;  3TKS E;  2HSM B;  2CT6 A;  2YWN A;  4JZQ A;  1UC7 A;  3GKK A;  1OKD A;  2PWJ A;  5DAL A;  2FHE A;  4N30 A;  4XS6 A;  1AXD A;  1EV4 A;  5DAK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...