5A5NA

Crystal structure of human atad2 bromodomain in complex with (2s)-2,6- diacetamido-n-methylhexanamide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATPASE FAMILY AAA DOMAIN-CONTAINING PROTEIN 2
publication title Fragment-Based Discovery of Low-Micromolar Atad2 Bromodomain Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 55
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2015-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5a5nA00
5AD2A 5D3SA 5F61A 1X0JA 4QC3A 3SVHA 5HCLA 5IGKA 5FG4A 1JSPB 4LZ2A 5L97A 2D9EA 3O34A 4IR3A 4PTBA 2YQDA 4XUBA 4YATA 5ENGA 5I1QA 5EM3A 3UVYA 4IOOA 4HXRA 4ALGA 5FE1A 3DWYA 5BT5A 3G0JA 4QSUA 5E3DA 4QSWA 5HLSA 3ONIA 5CQTA 4Q0OA 4CL9A 5LKXA 3LQJA 3MB4A 4QEUA 4HXMA 4WIVA 5F1LA 4NYVA 3MQMA 5FBXA 5HRXA 5HQ6A 5DFBA 5L8TA 3NXBA 2I7KA 5E9LA 5DW2A 5ETBA 3JVKA 5IGNA 5LVRA 3UV4A 5F5ZA 1F68A 5E9MA 5FG5A 4Z1SA 5I86A 4YYGA 5KO4A 4F3IA 4A9LA 4LZSA 4QR3A 3HMEA 3D7CA 5EPBA 4O76A 5DLZA 5J0DA 4TT4A 4XY9A 3P1FA 4BW4A 4PKLA 3MB3A 2MJVB 4PS5A 5LUUA 5HENA 5ENBA 2R0SA 4A9OA 4NUEA 5CUAA 4IORA 5ENJA 5F60A 4O71A 2R0YA 4KV1A 5FE2A 5HFQA 3S91A 2YDWA 5C85A 3IU6A 2LSPB 5D3TA 4A9HA 4NQMA 5FE8A 4O7CA 5E0RA 5E73A 4XUAA 4YBMA 4MEQA 3AQAA 4IR4A 2YYNA 2G4AA 4YYKA 5ETDA 4TZ2A 2RNWA 4ZQLA 4HXKA 3QZSA 2L85A 4O72A 5EWVA 5LKUA 3LQHA 3U5LA 4HXPA 4QEWA 4BJXA 5FB1A 5CQ5A 5G4RA 4NR9A 4LC2A 5HRWA 3QZTA 5L8UA 4FLPA 3O36A 3LXJA 4PCEA 5CRZA 5I29A 5C7NA 4ALHA 3P5OA 2GRCA 2E7NA 2RO1A 5G4SA 4YABA 4N4HA 3U5JA 3GG3A 4UIYA 5CY9A 4UYHA 5CQ7A 4UYFA 5FE3A 4HBWA 5A5NA 2RNXA 4KV4A 4UYGA 5EQ1A 4YYJA 4HXOA 3QZVA 5FH6A 4CUPA 5I83A 4A9JA 5CFWA 5HFRA 4NQNA 5EPRA 3MUKA 4ZW1A 4AKNA 4YYMA 2RNYA 4QUUA 4WHUA 4O7BA 1E6IA 3HMHA 5A5QA 5EWCA 5FFYA 4QSPA 4LDFA 5EISA 5CRMA 3UVDA 5CUCA 5AMFA 5CUGA 5D7XA 5EVAA 2OO1A 4LYWA 2RFJA 5D3PA 5E7DA 4ZC9A 4YYDA 3AADA 4MR5A 4CUQA 4UIUA 5DFDA 3G0LA 4KCXA 4HXSA 4TU4A 5H1TA 1WUMA 5HELA 4TT2A 4TYLA 4LYIA 2YEKA 5EGUA 2DVSA 4NXJA 4A9KA 2D82A 5DKDA 5CZGA 4MEPA 4Z93A 5ENEA 5FE4A 4N3WA 4NRCA 5CQAA 2DWWA 4C67A 2OSSA 3ZYUA 5FB0A 4O75A 2N9GA 3LJWA 4NR7A 3UVWA 4BHWA 4NR4A 5A5PA 4YYNA 2RI7A 5EWDA 5ACYA 5F2PA 4YY4A 5DW1A 5CUDA 5AMEA 3UW9A 5CQ4A 3U5MA 4CUTA 4CUUA 5D3JA 5AD3A 2RS9B 5DYAA 2DKWA 3IU5A 2OUOA 4Z1QA 5A7CA 5C8GA 5CUBA 5FFWA 5EU1A 4O7AA 5I7XA 2E7OA 4YH4A 4YYHA 5ENCA 3P1DA 4UIZA 5D3HA 3SVGA 5EPSA 4YAXA 2DVRA 4HBXA 5F3AA 4Z6HA 5EP7A 4N4FA 4YY6A 5KTXA 4QSXA 5A83A 4TT6A 5IBNA 5CGPA 2F6NA 4HBYA 4J0SA 5LKTA 5F63A 2F6JA 4QB3A 4NS5A 4Q0NA 2I8NA 2H60A 5JWMA 4OGIA 4X2IA 4XYAA 5A5SA 5FG6A 5HM0A 4N4IA 4HXLA 3O37A 3P1EA 3Q2FA 4NUCA 4UIVA 5TB6A 5ENHA 4O7FA 5IGMA 5DY7A 5E9IA 4OUFA 1JM4B 2YEMA 4QUTA 3TLPA 5A82A 4NRAA 5CPEA 3JVMA 5FH7A 3HMFA 4CFLA 4MR4A 5DLXA 5EI4A 5CS8A 4CFKA 2WP2A 4LYSA 4QSTA 4Z6IA 5FE7A 5FE5A 4WHWA 2R0VA 4E96A 2KTBB 5L99A 4IR6A 4IR5A 4QR4A 4YBSA 5F25A 2WP1A 5I88A 5EWHA 5A81A 5DX4A 5EWWA 4C66A 5A5OA 5D25A 5D0CA 2NXBA 1N72A 5BT4A 4A9FA 4BW2A 4Y03A 5ENIA 4GPJA 4MEOA 5H1UA 5F62A 4NR8A 3UVXA 5DYXA 4QZSA 5E74A 5TCMA 4TU6A 5CP5A 5FFVA 4NYWA 5H1VA 4NR6A 5FE6A 3U5KA 4XY8A 4CURA 4UIWA 5FH8A 4TQNA 5L98A 4QYDA 5ENFA 3Q2EA 4NRBA 5DKHA 4LR6A 4MR6A 5HQ7A 5JI8A 5CQ3A 3P1CA 3LQIA 4IOQA 3JVJA 5E9KA 5DKCA 4HXNA 5CQ6A 5L96A 3UV5A 5DYUA 4UIXA 4UYEA 5C4QA 2FSAA 5F1HA 5I40A 4O77A 4O74A 4A9MA 4QSRA 2DVQA 4NUDA 5IG6A 2E3KA 4QSQA 4A9NA 5A5RA 5FDZA 5COIA 4QSSA 5DFCA 4TS8A 5IGLA 5LJ2A 5C89A 4BW1A 3SVFA 5EICA 4UITA 5A85A 4UYDA 5HEMA 4CLBA 3FKMX 5CQ8A 4O78A 4O7EA 4YYIA 1ZS5A 4N4GA 5DYCA 4PY6A 4QY4A 5II1A 5EK9A 5CUEA 5D26A 4MENA 5FE0A 4QBMA 5HRVA 4MR3A 5DBMA 5KTUA 4OGJA 5IIDA 4UYFB 3MULA 4QYLA 5KU3A 5BT3A 5CTLA 3O35A 5LVQA 5C87A 5KTWA 5II2A 5D3LA 4A9EA 1WUGA 2L84A 5D3RA 5FE9A 5K29A 5HJCA 4O70A 5I7YA 2R10A 4BW3A 4YK0A 5F36A 4HBVA 4YH3A 3U5NA 4QR5A 4A9IA 5E3GA 3JVLA 5I80A 3I3JA 4J3IA 5E9YA 4PCIA 5CU8A 3U5PA 4NR5A 4NYXA 4QC1A 4DONA 2YELA 4J0RA 4J1PA 5LKZA 5KHMA 5E9VA 3O33A 4QNSA 5EA1A 4QEVA 4TTEA 3S92A 4YBTA 2L5EA 4QSVA 5D3NA 5D24A 5HQ5A 4YADA 4RVRA 5LJ0A 3DAIA 3U5OA 3UV2A 2DVVA 5H85A 1EQFA 4TZ8A 3MXFA 4LZRA 5I89A 5LJ1A 3RCWA 4YC9A 2YW5A 4LRGA 5EV9A 4CUSA 3K2JA 2DATA
chains in the Genus database with same CATH superfamily
5AD2A 5D3SA 5F61A 1X0JA 4AKHA 4QC3A 3SVHA 5HCLA 5IGKA 5FG4A 1JSPB 4LZ2A 5L97A 2D9EA 3O34A 4IR3A 4PTBA 2YQDA 4XUBA 4YATA 5ENGA 5I1QA 5EM3A 3UVYA 4IOOA 4HXRA 4ALGA 5FE1A 3DWYA 5BT5A 3G0JA 4QSUA 5E3DA 4QSWA 5HLSA 3ONIA 5CQTA 4Q0OA 4CL9A 5LKXA 3LQJA 3MB4A 4QEUA 4HXMA 4WIVA 5F1LA 4NYVA 3MQMA 5FBXA 5HRXA 5HQ6A 5DFBA 5L8TA 3NXBA 2I7KA 5E9LA 5DW2A 5ETBA 3JVKA 5IGNA 5LVRA 3UV4A 5F5ZA 1F68A 5E9MA 5FG5A 4Z1SA 5I86A 2EJNA 4YYGA 5KO4A 4F3IA 4A9LA 4LZSA 4QR3A 3HMEA 3D7CA 5EPBA 4O76A 5DLZA 5J0DA 4TT4A 4XY9A 3P1FA 4BW4A 4PKLA 3MB3A 2MJVB 4PS5A 5LUUA 5HENA 5ENBA 2R0SA 4A9OA 4NUEA 5CUAA 4IORA 5ENJA 5F60A 4O71A 2R0YA 4KV1A 5FE2A 5HFQA 3S91A 2YDWA 5C85A 3IU6A 2LSPB 5D3TA 4A9HA 4NQMA 5FE8A 4O7CA 5E0RA 5E73A 4XUAA 4YBMA 4MEQA 3AQAA 4IR4A 2YYNA 2G4AA 4YYKA 5ETDA 4TZ2A 2RNWA 4ZQLA 4HXKA 3QZSA 2L85A 4O72A 5EWVA 5LKUA 3LQHA 3U5LA 4HXPA 4QEWA 4BJXA 5FB1A 5CQ5A 5G4RA 4NR9A 4LC2A 5HRWA 3QZTA 5L8UA 4FLPA 3O36A 3LXJA 4PCEA 5CRZA 5I29A 5C7NA 4ALHA 3P5OA 2GRCA 2E7NA 2RO1A 5G4SA 4YABA 4N4HA 3U5JA 3GG3A 4UIYA 5CY9A 4UYHA 5CQ7A 4UYFA 5FE3A 4HBWA 5A5NA 2RNXA 4KV4A 4UYGA 5EQ1A 4YYJA 4HXOA 3QZVA 5FH6A 4CUPA 5I83A 4A9JA 5CFWA 5HFRA 4NQNA 5EPRA 3MUKA 4ZW1A 4AKNA 4YYMA 2RNYA 4QUUA 4WHUA 4O7BA 1E6IA 3HMHA 5A5QA 5EWCA 5FFYA 4QSPA 4LDFA 5EISA 5CRMA 3UVDA 5CUCA 5AMFA 5CUGA 5D7XA 5EVAA 2OO1A 4LYWA 2RFJA 5D3PA 5E7DA 4ZC9A 4YYDA 3AADA 4MR5A 4CUQA 4UIUA 5DFDA 3G0LA 4KCXA 4HXSA 4TU4A 5H1TA 1WUMA 5HELA 4TT2A 4TYLA 4LYIA 2YEKA 5EGUA 2DVSA 4NXJA 4A9KA 2D82A 5DKDA 5CZGA 4MEPA 4Z93A 5ENEA 5FE4A 4N3WA 4NRCA 5CQAA 2DWWA 4C67A 2OSSA 3ZYUA 5FB0A 4O75A 2N9GA 3LJWA 4NR7A 3UVWA 4BHWA 4NR4A 5A5PA 4YYNA 2RI7A 5EWDA 5ACYA 5F2PA 4YY4A 3VKHA 5DW1A 5CUDA 5AMEA 3UW9A 5CQ4A 3U5MA 4CUTA 4CUUA 1ZKRA 5D3JA 5AD3A 2RS9B 5DYAA 2DKWA 3IU5A 2OUOA 4Z1QA 5A7CA 5C8GA 5CUBA 5FFWA 5EU1A 4O7AA 5I7XA 2E7OA 4YH4A 4YYHA 5ENCA 3P1DA 4UIZA 5D3HA 3SVGA 5EPSA 4YAXA 2DVRA 4HBXA 5F3AA 4Z6HA 5EP7A 4N4FA 4YY6A 5KTXA 4QSXA 5A83A 4TT6A 5IBNA 5CGPA 2F6NA 4HBYA 4J0SA 5LKTA 3ERRA 5F63A 2F6JA 4QB3A 4NS5A 4Q0NA 2I8NA 2H60A 5JWMA 4OGIA 4X2IA 4XYAA 5A5SA 5FG6A 5HM0A 4N4IA 4AKGA 4HXLA 3O37A 3P1EA 3Q2FA 4NUCA 4UIVA 5TB6A 5ENHA 4O7FA 5IGMA 5DY7A 5E9IA 4OUFA 1JM4B 2YEMA 4QUTA 3TLPA 3D1DA 5A82A 4NRAA 5CPEA 3JVMA 5FH7A 3HMFA 4CFLA 4MR4A 3VKGA 5DLXA 5EI4A 5CS8A 4CFKA 2WP2A 4LYSA 4QSTA 4Z6IA 5FE7A 5FE5A 4WHWA 2R0VA 4E96A 2KTBB 5L99A 4IR6A 4IR5A 4QR4A 4YBSA 5F25A 2WP1A 5I88A 5EWHA 5A81A 5DX4A 5EWWA 4C66A 5A5OA 5D25A 5D0CA 2NXBA 1N72A 5BT4A 4A9FA 4BW2A 4Y03A 5ENIA 4GPJA 4MEOA 5H1UA 5F62A 4NR8A 3UVXA 5DYXA 4QZSA 5E74A 5TCMA 4TU6A 5CP5A 5FFVA 4NYWA 5H1VA 4NR6A 5FE6A 3U5KA 4XY8A 4CURA 4UIWA 5FH8A 4TQNA 5L98A 4QYDA 5ENFA 3Q2EA 4NRBA 5DKHA 4LR6A 4MR6A 5HQ7A 5JI8A 5CQ3A 3P1CA 3LQIA 4IOQA 3JVJA 5E9KA 5DKCA 4HXNA 5CQ6A 5L96A 3UV5A 5DYUA 4UIXA 4UYEA 5C4QA 1PUOA 2FSAA 5F1HA 5I40A 4O77A 4O74A 4A9MA 4QSRA 2DVQA 4NUDA 5IG6A 2E3KA 4QSQA 4A9NA 5A5RA 5FDZA 5COIA 4QSSA 5DFCA 4TS8A 5IGLA 5LJ2A 5C89A 4BW1A 3SVFA 5EICA 4UITA 5A85A 4UYDA 5HEMA 3D1BA 4CLBA 3FKMX 5CQ8A 4O78A 4O7EA 4YYIA 1ZS5A 4N4GA 5DYCA 4PY6A 4QY4A 5II1A 5EK9A 5CUEA 5D26A 4MENA 5FE0A 4QBMA 5HRVA 4MR3A 5DBMA 5KTUA 4OGJA 5IIDA 4UYFB 3MULA 4QYLA 5KU3A 5BT3A 5CTLA 3O35A 5LVQA 5C87A 5KTWA 5II2A 5D3LA 4A9EA 1WUGA 2L84A 5D3RA 5FE9A 5K29A 5HJCA 4O70A 5I7YA 2R10A 4BW3A 4YK0A 5F36A 4HBVA 4YH3A 3U5NA 4QR5A 4A9IA 5E3GA 3JVLA 5I80A 3I3JA 4J3IA 5E9YA 4PCIA 5CU8A 3U5PA 4NR5A 4NYXA 4QC1A 4DONA 2YELA 4J0RA 4J1PA 5LKZA 5KHMA 5E9VA 3O33A 4QNSA 5EA1A 4QEVA 4TTEA 3S92A 4YBTA 2L5EA 4QSVA 5D3NA 5D24A 5HQ5A 4YADA 4RVRA 5LJ0A 3DAIA 3U5OA 3UV2A 2DVVA 5H85A 1EQFA 4AI6A 4TZ8A 3MXFA 4LZRA 5I89A 5LJ1A 3RCWA 4YC9A 2YW5A 4LRGA 5EV9A 4AKIA 4CUSA 3K2JA 2DATA
chains in the Genus database with same CATH topology
5AD2A 5D3SA 5F61A 1X0JA 4QC3A 3SVHA 5HCLA 5IGKA 5FG4A 1JSPB 4LZ2A 5L97A 2D9EA 3O34A 4IR3A 4PTBA 2YQDA 4XUBA 4YATA 5ENGA 5I1QA 5EM3A 3UVYA 4IOOA 4HXRA 4ALGA 5FE1A 3DWYA 5BT5A 3G0JA 4QSUA 5E3DA 4QSWA 5HLSA 3ONIA 5CQTA 4Q0OA 4CL9A 5LKXA 3LQJA 3MB4A 4QEUA 4HXMA 4WIVA 5F1LA 4NYVA 3MQMA 5FBXA 5HRXA 5HQ6A 5DFBA 5L8TA 3NXBA 2I7KA 5E9LA 5DW2A 5ETBA 3JVKA 5IGNA 5LVRA 3UV4A 5F5ZA 1F68A 5E9MA 5FG5A 4Z1SA 5I86A 4YYGA 5KO4A 4F3IA 4A9LA 4LZSA 4QR3A 3HMEA 3D7CA 5EPBA 4O76A 5DLZA 5J0DA 4TT4A 4XY9A 3P1FA 4BW4A 4PKLA 3MB3A 2MJVB 4PS5A 5LUUA 5HENA 5ENBA 2R0SA 4A9OA 4NUEA 5CUAA 4IORA 5ENJA 5F60A 4O71A 2R0YA 4KV1A 5FE2A 5HFQA 3S91A 2YDWA 5C85A 3IU6A 2LSPB 5D3TA 4A9HA 4NQMA 5FE8A 4O7CA 5E0RA 5E73A 4XUAA 4YBMA 4MEQA 3AQAA 4IR4A 2YYNA 2G4AA 4YYKA 5ETDA 4TZ2A 2RNWA 4ZQLA 4HXKA 3QZSA 2L85A 4O72A 5EWVA 5LKUA 3LQHA 3U5LA 4HXPA 4QEWA 4BJXA 5FB1A 5CQ5A 5G4RA 4NR9A 4LC2A 5HRWA 3QZTA 5L8UA 4FLPA 3O36A 3LXJA 4PCEA 5CRZA 5I29A 5C7NA 4ALHA 3P5OA 2GRCA 2E7NA 2RO1A 5G4SA 4YABA 4N4HA 3U5JA 3GG3A 4UIYA 5CY9A 4UYHA 5CQ7A 4UYFA 5FE3A 4HBWA 5A5NA 2RNXA 4KV4A 4UYGA 5EQ1A 4YYJA 4HXOA 3QZVA 5FH6A 4CUPA 5I83A 4A9JA 5CFWA 5HFRA 4NQNA 5EPRA 3MUKA 4ZW1A 4AKNA 4YYMA 2RNYA 4QUUA 4WHUA 4O7BA 1E6IA 3HMHA 5A5QA 5EWCA 5FFYA 4QSPA 4LDFA 5EISA 5CRMA 3UVDA 5CUCA 5AMFA 5CUGA 5D7XA 5EVAA 2OO1A 4LYWA 2RFJA 5D3PA 5E7DA 4ZC9A 4YYDA 3AADA 4MR5A 4CUQA 4UIUA 5DFDA 3G0LA 4KCXA 4HXSA 4TU4A 5H1TA 1WUMA 5HELA 4TT2A 4TYLA 4LYIA 2YEKA 5EGUA 2DVSA 4NXJA 4A9KA 2D82A 5DKDA 5CZGA 4MEPA 4Z93A 5ENEA 5FE4A 4N3WA 4NRCA 5CQAA 2DWWA 4C67A 2OSSA 3ZYUA 5FB0A 4O75A 2N9GA 3LJWA 4NR7A 3UVWA 4BHWA 4NR4A 5A5PA 4YYNA 2RI7A 5EWDA 5ACYA 5F2PA 4YY4A 5DW1A 5CUDA 5AMEA 3UW9A 5CQ4A 3U5MA 4CUTA 4CUUA 5D3JA 5AD3A 2RS9B 5DYAA 2DKWA 3IU5A 2OUOA 4Z1QA 5A7CA 5C8GA 5CUBA 5FFWA 5EU1A 4O7AA 5I7XA 2E7OA 4YH4A 4YYHA 5ENCA 3P1DA 4UIZA 5D3HA 3SVGA 5EPSA 4YAXA 2DVRA 4HBXA 5F3AA 4Z6HA 5EP7A 4N4FA 4YY6A 5KTXA 4QSXA 5A83A 4TT6A 5IBNA 5CGPA 2F6NA 4HBYA 4J0SA 5LKTA 5F63A 2F6JA 4QB3A 4NS5A 4Q0NA 2I8NA 2H60A 5JWMA 4OGIA 4X2IA 4XYAA 5A5SA 5FG6A 5HM0A 4N4IA 4HXLA 3O37A 3P1EA 3Q2FA 4NUCA 4UIVA 5TB6A 5ENHA 4O7FA 5IGMA 5DY7A 5E9IA 4OUFA 1JM4B 2YEMA 4QUTA 3TLPA 5A82A 4NRAA 5CPEA 3JVMA 5FH7A 3HMFA 4CFLA 4MR4A 5DLXA 5EI4A 5CS8A 4CFKA 2WP2A 4LYSA 4QSTA 4Z6IA 5FE7A 5FE5A 4WHWA 2R0VA 4E96A 2KTBB 5L99A 4IR6A 4IR5A 4QR4A 4YBSA 5F25A 2WP1A 5I88A 5EWHA 5A81A 5DX4A 5EWWA 4C66A 5A5OA 5D25A 5D0CA 2NXBA 1N72A 5BT4A 4A9FA 4BW2A 4Y03A 5ENIA 4GPJA 4MEOA 5H1UA 5F62A 4NR8A 3UVXA 5DYXA 4QZSA 5E74A 5TCMA 4TU6A 5CP5A 5FFVA 4NYWA 5H1VA 4NR6A 5FE6A 3U5KA 4XY8A 4CURA 4UIWA 5FH8A 4TQNA 5L98A 4QYDA 5ENFA 3Q2EA 4NRBA 5DKHA 4LR6A 4MR6A 5HQ7A 5JI8A 5CQ3A 3P1CA 3LQIA 4IOQA 3JVJA 5E9KA 5DKCA 4HXNA 5CQ6A 5L96A 3UV5A 5DYUA 4UIXA 4UYEA 5C4QA 2FSAA 5F1HA 5I40A 4O77A 4O74A 4A9MA 4QSRA 2DVQA 4NUDA 5IG6A 2E3KA 4QSQA 4A9NA 5A5RA 5FDZA 5COIA 4QSSA 5DFCA 4TS8A 5IGLA 5LJ2A 5C89A 4BW1A 3SVFA 5EICA 4UITA 5A85A 4UYDA 5HEMA 4CLBA 3FKMX 5CQ8A 4O78A 4O7EA 4YYIA 1ZS5A 4N4GA 5DYCA 4PY6A 4QY4A 5II1A 5EK9A 5CUEA 5D26A 4MENA 5FE0A 4QBMA 5HRVA 4MR3A 5DBMA 5KTUA 4OGJA 5IIDA 4UYFB 3MULA 4QYLA 5KU3A 5BT3A 5CTLA 3O35A 5LVQA 5C87A 5KTWA 5II2A 5D3LA 4A9EA 1WUGA 2L84A 5D3RA 5FE9A 5K29A 5HJCA 4O70A 5I7YA 2R10A 4BW3A 4YK0A 5F36A 4HBVA 4YH3A 3U5NA 4QR5A 4A9IA 5E3GA 3JVLA 5I80A 3I3JA 4J3IA 5E9YA 4PCIA 5CU8A 3U5PA 4NR5A 4NYXA 4QC1A 4DONA 2YELA 4J0RA 4J1PA 5LKZA 5KHMA 5E9VA 3O33A 4QNSA 5EA1A 4QEVA 4TTEA 3S92A 4YBTA 2L5EA 4QSVA 5D3NA 5D24A 5HQ5A 4YADA 4RVRA 5LJ0A 3DAIA 3U5OA 3UV2A 2DVVA 5H85A 1EQFA 4TZ8A 3MXFA 4LZRA 5I89A 5LJ1A 3RCWA 4YC9A 2YW5A 4LRGA 5EV9A 4CUSA 3K2JA 2DATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AD2 A;  5D3S A;  5F61 A;  1X0J A;  4QC3 A;  3SVH A;  5HCL A;  5IGK A;  5FG4 A;  1JSP B;  4LZ2 A;  5L97 A;  2D9E A;  3O34 A;  4IR3 A;  4PTB A;  2YQD A;  4XUB A;  4YAT A;  5ENG A;  5I1Q A;  5EM3 A;  3UVY A;  4IOO A;  4HXR A;  4ALG A;  5FE1 A;  3DWY A;  5BT5 A;  3G0J A;  4QSU A;  5E3D A;  4QSW A;  5HLS A;  3ONI A;  5CQT A;  4Q0O A;  4CL9 A;  5LKX A;  3LQJ A;  3MB4 A;  4QEU A;  4HXM A;  4WIV A;  5F1L A;  4NYV A;  3MQM A;  5FBX A;  5HRX A;  5HQ6 A;  5DFB A;  5L8T A;  3NXB A;  2I7K A;  5E9L A;  5DW2 A;  5ETB A;  3JVK A;  5IGN A;  5LVR A;  3UV4 A;  5F5Z A;  1F68 A;  5E9M A;  5FG5 A;  4Z1S A;  5I86 A;  4YYG A;  5KO4 A;  4F3I A;  4A9L A;  4LZS A;  4QR3 A;  3HME A;  3D7C A;  5EPB A;  4O76 A;  5DLZ A;  5J0D A;  4TT4 A;  4XY9 A;  3P1F A;  4BW4 A;  4PKL A;  3MB3 A;  2MJV B;  4PS5 A;  5LUU A;  5HEN A;  5ENB A;  2R0S A;  4A9O A;  4NUE A;  5CUA A;  4IOR A;  5ENJ A;  5F60 A;  4O71 A;  2R0Y A;  4KV1 A;  5FE2 A;  5HFQ A;  3S91 A;  2YDW A;  5C85 A;  3IU6 A;  2LSP B;  5D3T A;  4A9H A;  4NQM A;  5FE8 A;  4O7C A;  5E0R A;  5E73 A;  4XUA A;  4YBM A;  4MEQ A;  3AQA A;  4IR4 A;  2YYN A;  2G4A A;  4YYK A;  5ETD A;  4TZ2 A;  2RNW A;  4ZQL A;  4HXK A;  3QZS A;  2L85 A;  4O72 A;  5EWV A;  5LKU A;  3LQH A;  3U5L A;  4HXP A;  4QEW A;  4BJX A;  5FB1 A;  5CQ5 A;  5G4R A;  4NR9 A;  4LC2 A;  5HRW A;  3QZT A;  5L8U A;  4FLP A;  3O36 A;  3LXJ A;  4PCE A;  5CRZ A;  5I29 A;  5C7N A;  4ALH A;  3P5O A;  2GRC A;  2E7N A;  2RO1 A;  5G4S A;  4YAB A;  4N4H A;  3U5J A;  3GG3 A;  4UIY A;  5CY9 A;  4UYH A;  5CQ7 A;  4UYF A;  5FE3 A;  4HBW A;  5A5N A;  2RNX A;  4KV4 A;  4UYG A;  5EQ1 A;  4YYJ A;  4HXO A;  3QZV A;  5FH6 A;  4CUP A;  5I83 A;  4A9J A;  5CFW A;  5HFR A;  4NQN A;  5EPR A;  3MUK A;  4ZW1 A;  4AKN A;  4YYM A;  2RNY A;  4QUU A;  4WHU A;  4O7B A;  1E6I A;  3HMH A;  5A5Q A;  5EWC A;  5FFY A;  4QSP A;  4LDF A;  5EIS A;  5CRM A;  3UVD A;  5CUC A;  5AMF A;  5CUG A;  5D7X A;  5EVA A;  2OO1 A;  4LYW A;  2RFJ A;  5D3P A;  5E7D A;  4ZC9 A;  4YYD A;  3AAD A;  4MR5 A;  4CUQ A;  4UIU A;  5DFD A;  3G0L A;  4KCX A;  4HXS A;  4TU4 A;  5H1T A;  1WUM A;  5HEL A;  4TT2 A;  4TYL A;  4LYI A;  2YEK A;  5EGU A;  2DVS A;  4NXJ A;  4A9K A;  2D82 A;  5DKD A;  5CZG A;  4MEP A;  4Z93 A;  5ENE A;  5FE4 A;  4N3W A;  4NRC A;  5CQA A;  2DWW A;  4C67 A;  2OSS A;  3ZYU A;  5FB0 A;  4O75 A;  2N9G A;  3LJW A;  4NR7 A;  3UVW A;  4BHW A;  4NR4 A;  5A5P A;  4YYN A;  2RI7 A;  5EWD A;  5ACY A;  5F2P A;  4YY4 A;  5DW1 A;  5CUD A;  5AME A;  3UW9 A;  5CQ4 A;  3U5M A;  4CUT A;  4CUU A;  5D3J A;  5AD3 A;  2RS9 B;  5DYA A;  2DKW A;  3IU5 A;  2OUO A;  4Z1Q A;  5A7C A;  5C8G A;  5CUB A;  5FFW A;  5EU1 A;  4O7A A;  5I7X A;  2E7O A;  4YH4 A;  4YYH A;  5ENC A;  3P1D A;  4UIZ A;  5D3H A;  3SVG A;  5EPS A;  4YAX A;  2DVR A;  4HBX A;  5F3A A;  4Z6H A;  5EP7 A;  4N4F A;  4YY6 A;  5KTX A;  4QSX A;  5A83 A;  4TT6 A;  5IBN A;  5CGP A;  2F6N A;  4HBY A;  4J0S A;  5LKT A;  5F63 A;  2F6J A;  4QB3 A;  4NS5 A;  4Q0N A;  2I8N A;  2H60 A;  5JWM A;  4OGI A;  4X2I A;  4XYA A;  5A5S A;  5FG6 A;  5HM0 A;  4N4I A;  4HXL A;  3O37 A;  3P1E A;  3Q2F A;  4NUC A;  4UIV A;  5TB6 A;  5ENH A;  4O7F A;  5IGM A;  5DY7 A;  5E9I A;  4OUF A;  1JM4 B;  2YEM A;  4QUT A;  3TLP A;  5A82 A;  4NRA A;  5CPE A;  3JVM A;  5FH7 A;  3HMF A;  4CFL A;  4MR4 A;  5DLX A;  5EI4 A;  5CS8 A;  4CFK A;  2WP2 A;  4LYS A;  4QST A;  4Z6I A;  5FE7 A;  5FE5 A;  4WHW A;  2R0V A;  4E96 A;  2KTB B;  5L99 A;  4IR6 A;  4IR5 A;  4QR4 A;  4YBS A;  5F25 A;  2WP1 A;  5I88 A;  5EWH A;  5A81 A;  5DX4 A;  5EWW A;  4C66 A;  5A5O A;  5D25 A;  5D0C A;  2NXB A;  1N72 A;  5BT4 A;  4A9F A;  4BW2 A;  4Y03 A;  5ENI A;  4GPJ A;  4MEO A;  5H1U A;  5F62 A;  4NR8 A;  3UVX A;  5DYX A;  4QZS A;  5E74 A;  5TCM A;  4TU6 A;  5CP5 A;  5FFV A;  4NYW A;  5H1V A;  4NR6 A;  5FE6 A;  3U5K A;  4XY8 A;  4CUR A;  4UIW A;  5FH8 A;  4TQN A;  5L98 A;  4QYD A;  5ENF A;  3Q2E A;  4NRB A;  5DKH A;  4LR6 A;  4MR6 A;  5HQ7 A;  5JI8 A;  5CQ3 A;  3P1C A;  3LQI A;  4IOQ A;  3JVJ A;  5E9K A;  5DKC A;  4HXN A;  5CQ6 A;  5L96 A;  3UV5 A;  5DYU A;  4UIX A;  4UYE A;  5C4Q A;  2FSA A;  5F1H A;  5I40 A;  4O77 A;  4O74 A;  4A9M A;  4QSR A;  2DVQ A;  4NUD A;  5IG6 A;  2E3K A;  4QSQ A;  4A9N A;  5A5R A;  5FDZ A;  5COI A;  4QSS A;  5DFC A;  4TS8 A;  5IGL A;  5LJ2 A;  5C89 A;  4BW1 A;  3SVF A;  5EIC A;  4UIT A;  5A85 A;  4UYD A;  5HEM A;  4CLB A;  3FKM X;  5CQ8 A;  4O78 A;  4O7E A;  4YYI A;  1ZS5 A;  4N4G A;  5DYC A;  4PY6 A;  4QY4 A;  5II1 A;  5EK9 A;  5CUE A;  5D26 A;  4MEN A;  5FE0 A;  4QBM A;  5HRV A;  4MR3 A;  5DBM A;  5KTU A;  4OGJ A;  5IID A;  4UYF B;  3MUL A;  4QYL A;  5KU3 A;  5BT3 A;  5CTL A;  3O35 A;  5LVQ A;  5C87 A;  5KTW A;  5II2 A;  5D3L A;  4A9E A;  1WUG A;  2L84 A;  5D3R A;  5FE9 A;  5K29 A;  5HJC A;  4O70 A;  5I7Y A;  2R10 A;  4BW3 A;  4YK0 A;  5F36 A;  4HBV A;  4YH3 A;  3U5N A;  4QR5 A;  4A9I A;  5E3G A;  3JVL A;  5I80 A;  3I3J A;  4J3I A;  5E9Y A;  4PCI A;  5CU8 A;  3U5P A;  4NR5 A;  4NYX A;  4QC1 A;  4DON A;  2YEL A;  4J0R A;  4J1P A;  5LKZ A;  5KHM A;  5E9V A;  3O33 A;  4QNS A;  5EA1 A;  4QEV A;  4TTE A;  3S92 A;  4YBT A;  2L5E A;  4QSV A;  5D3N A;  5D24 A;  5HQ5 A;  4YAD A;  4RVR A;  5LJ0 A;  3DAI A;  3U5O A;  3UV2 A;  2DVV A;  5H85 A;  1EQF A;  4TZ8 A;  3MXF A;  4LZR A;  5I89 A;  5LJ1 A;  3RCW A;  4YC9 A;  2YW5 A;  4LRG A;  5EV9 A;  4CUS A;  3K2J A;  2DAT A; 
#chains in the Genus database with same CATH topology
 5AD2 A;  5D3S A;  5F61 A;  1X0J A;  4AKH A;  4QC3 A;  3SVH A;  5HCL A;  5IGK A;  5FG4 A;  1JSP B;  4LZ2 A;  5L97 A;  2D9E A;  3O34 A;  4IR3 A;  4PTB A;  2YQD A;  4XUB A;  4YAT A;  5ENG A;  5I1Q A;  5EM3 A;  3UVY A;  4IOO A;  4HXR A;  4ALG A;  5FE1 A;  3DWY A;  5BT5 A;  3G0J A;  4QSU A;  5E3D A;  4QSW A;  5HLS A;  3ONI A;  5CQT A;  4Q0O A;  4CL9 A;  5LKX A;  3LQJ A;  3MB4 A;  4QEU A;  4HXM A;  4WIV A;  5F1L A;  4NYV A;  3MQM A;  5FBX A;  5HRX A;  5HQ6 A;  5DFB A;  5L8T A;  3NXB A;  2I7K A;  5E9L A;  5DW2 A;  5ETB A;  3JVK A;  5IGN A;  5LVR A;  3UV4 A;  5F5Z A;  1F68 A;  5E9M A;  5FG5 A;  4Z1S A;  5I86 A;  2EJN A;  4YYG A;  5KO4 A;  4F3I A;  4A9L A;  4LZS A;  4QR3 A;  3HME A;  3D7C A;  5EPB A;  4O76 A;  5DLZ A;  5J0D A;  4TT4 A;  4XY9 A;  3P1F A;  4BW4 A;  4PKL A;  3MB3 A;  2MJV B;  4PS5 A;  5LUU A;  5HEN A;  5ENB A;  2R0S A;  4A9O A;  4NUE A;  5CUA A;  4IOR A;  5ENJ A;  5F60 A;  4O71 A;  2R0Y A;  4KV1 A;  5FE2 A;  5HFQ A;  3S91 A;  2YDW A;  5C85 A;  3IU6 A;  2LSP B;  5D3T A;  4A9H A;  4NQM A;  5FE8 A;  4O7C A;  5E0R A;  5E73 A;  4XUA A;  4YBM A;  4MEQ A;  3AQA A;  4IR4 A;  2YYN A;  2G4A A;  4YYK A;  5ETD A;  4TZ2 A;  2RNW A;  4ZQL A;  4HXK A;  3QZS A;  2L85 A;  4O72 A;  5EWV A;  5LKU A;  3LQH A;  3U5L A;  4HXP A;  4QEW A;  4BJX A;  5FB1 A;  5CQ5 A;  5G4R A;  4NR9 A;  4LC2 A;  5HRW A;  3QZT A;  5L8U A;  4FLP A;  3O36 A;  3LXJ A;  4PCE A;  5CRZ A;  5I29 A;  5C7N A;  4ALH A;  3P5O A;  2GRC A;  2E7N A;  2RO1 A;  5G4S A;  4YAB A;  4N4H A;  3U5J A;  3GG3 A;  4UIY A;  5CY9 A;  4UYH A;  5CQ7 A;  4UYF A;  5FE3 A;  4HBW A;  5A5N A;  2RNX A;  4KV4 A;  4UYG A;  5EQ1 A;  4YYJ A;  4HXO A;  3QZV A;  5FH6 A;  4CUP A;  5I83 A;  4A9J A;  5CFW A;  5HFR A;  4NQN A;  5EPR A;  3MUK A;  4ZW1 A;  4AKN A;  4YYM A;  2RNY A;  4QUU A;  4WHU A;  4O7B A;  1E6I A;  3HMH A;  5A5Q A;  5EWC A;  5FFY A;  4QSP A;  4LDF A;  5EIS A;  5CRM A;  3UVD A;  5CUC A;  5AMF A;  5CUG A;  5D7X A;  5EVA A;  2OO1 A;  4LYW A;  2RFJ A;  5D3P A;  5E7D A;  4ZC9 A;  4YYD A;  3AAD A;  4MR5 A;  4CUQ A;  4UIU A;  5DFD A;  3G0L A;  4KCX A;  4HXS A;  4TU4 A;  5H1T A;  1WUM A;  5HEL A;  4TT2 A;  4TYL A;  4LYI A;  2YEK A;  5EGU A;  2DVS A;  4NXJ A;  4A9K A;  2D82 A;  5DKD A;  5CZG A;  4MEP A;  4Z93 A;  5ENE A;  5FE4 A;  4N3W A;  4NRC A;  5CQA A;  2DWW A;  4C67 A;  2OSS A;  3ZYU A;  5FB0 A;  4O75 A;  2N9G A;  3LJW A;  4NR7 A;  3UVW A;  4BHW A;  4NR4 A;  5A5P A;  4YYN A;  2RI7 A;  5EWD A;  5ACY A;  5F2P A;  4YY4 A;  3VKH A;  5DW1 A;  5CUD A;  5AME A;  3UW9 A;  5CQ4 A;  3U5M A;  4CUT A;  4CUU A;  1ZKR A;  5D3J A;  5AD3 A;  2RS9 B;  5DYA A;  2DKW A;  3IU5 A;  2OUO A;  4Z1Q A;  5A7C A;  5C8G A;  5CUB A;  5FFW A;  5EU1 A;  4O7A A;  5I7X A;  2E7O A;  4YH4 A;  4YYH A;  5ENC A;  3P1D A;  4UIZ A;  5D3H A;  3SVG A;  5EPS A;  4YAX A;  2DVR A;  4HBX A;  5F3A A;  4Z6H A;  5EP7 A;  4N4F A;  4YY6 A;  5KTX A;  4QSX A;  5A83 A;  4TT6 A;  5IBN A;  5CGP A;  2F6N A;  4HBY A;  4J0S A;  5LKT A;  3ERR A;  5F63 A;  2F6J A;  4QB3 A;  4NS5 A;  4Q0N A;  2I8N A;  2H60 A;  5JWM A;  4OGI A;  4X2I A;  4XYA A;  5A5S A;  5FG6 A;  5HM0 A;  4N4I A;  4AKG A;  4HXL A;  3O37 A;  3P1E A;  3Q2F A;  4NUC A;  4UIV A;  5TB6 A;  5ENH A;  4O7F A;  5IGM A;  5DY7 A;  5E9I A;  4OUF A;  1JM4 B;  2YEM A;  4QUT A;  3TLP A;  3D1D A;  5A82 A;  4NRA A;  5CPE A;  3JVM A;  5FH7 A;  3HMF A;  4CFL A;  4MR4 A;  3VKG A;  5DLX A;  5EI4 A;  5CS8 A;  4CFK A;  2WP2 A;  4LYS A;  4QST A;  4Z6I A;  5FE7 A;  5FE5 A;  4WHW A;  2R0V A;  4E96 A;  2KTB B;  5L99 A;  4IR6 A;  4IR5 A;  4QR4 A;  4YBS A;  5F25 A;  2WP1 A;  5I88 A;  5EWH A;  5A81 A;  5DX4 A;  5EWW A;  4C66 A;  5A5O A;  5D25 A;  5D0C A;  2NXB A;  1N72 A;  5BT4 A;  4A9F A;  4BW2 A;  4Y03 A;  5ENI A;  4GPJ A;  4MEO A;  5H1U A;  5F62 A;  4NR8 A;  3UVX A;  5DYX A;  4QZS A;  5E74 A;  5TCM A;  4TU6 A;  5CP5 A;  5FFV A;  4NYW A;  5H1V A;  4NR6 A;  5FE6 A;  3U5K A;  4XY8 A;  4CUR A;  4UIW A;  5FH8 A;  4TQN A;  5L98 A;  4QYD A;  5ENF A;  3Q2E A;  4NRB A;  5DKH A;  4LR6 A;  4MR6 A;  5HQ7 A;  5JI8 A;  5CQ3 A;  3P1C A;  3LQI A;  4IOQ A;  3JVJ A;  5E9K A;  5DKC A;  4HXN A;  5CQ6 A;  5L96 A;  3UV5 A;  5DYU A;  4UIX A;  4UYE A;  5C4Q A;  1PUO A;  2FSA A;  5F1H A;  5I40 A;  4O77 A;  4O74 A;  4A9M A;  4QSR A;  2DVQ A;  4NUD A;  5IG6 A;  2E3K A;  4QSQ A;  4A9N A;  5A5R A;  5FDZ A;  5COI A;  4QSS A;  5DFC A;  4TS8 A;  5IGL A;  5LJ2 A;  5C89 A;  4BW1 A;  3SVF A;  5EIC A;  4UIT A;  5A85 A;  4UYD A;  5HEM A;  3D1B A;  4CLB A;  3FKM X;  5CQ8 A;  4O78 A;  4O7E A;  4YYI A;  1ZS5 A;  4N4G A;  5DYC A;  4PY6 A;  4QY4 A;  5II1 A;  5EK9 A;  5CUE A;  5D26 A;  4MEN A;  5FE0 A;  4QBM A;  5HRV A;  4MR3 A;  5DBM A;  5KTU A;  4OGJ A;  5IID A;  4UYF B;  3MUL A;  4QYL A;  5KU3 A;  5BT3 A;  5CTL A;  3O35 A;  5LVQ A;  5C87 A;  5KTW A;  5II2 A;  5D3L A;  4A9E A;  1WUG A;  2L84 A;  5D3R A;  5FE9 A;  5K29 A;  5HJC A;  4O70 A;  5I7Y A;  2R10 A;  4BW3 A;  4YK0 A;  5F36 A;  4HBV A;  4YH3 A;  3U5N A;  4QR5 A;  4A9I A;  5E3G A;  3JVL A;  5I80 A;  3I3J A;  4J3I A;  5E9Y A;  4PCI A;  5CU8 A;  3U5P A;  4NR5 A;  4NYX A;  4QC1 A;  4DON A;  2YEL A;  4J0R A;  4J1P A;  5LKZ A;  5KHM A;  5E9V A;  3O33 A;  4QNS A;  5EA1 A;  4QEV A;  4TTE A;  3S92 A;  4YBT A;  2L5E A;  4QSV A;  5D3N A;  5D24 A;  5HQ5 A;  4YAD A;  4RVR A;  5LJ0 A;  3DAI A;  3U5O A;  3UV2 A;  2DVV A;  5H85 A;  1EQF A;  4AI6 A;  4TZ8 A;  3MXF A;  4LZR A;  5I89 A;  5LJ1 A;  3RCW A;  4YC9 A;  2YW5 A;  4LRG A;  5EV9 A;  4AKI A;  4CUS A;  3K2J A;  2DAT A; 
#chains in the Genus database with same CATH homology
 5AD2 A;  5D3S A;  5F61 A;  1X0J A;  4QC3 A;  3SVH A;  5HCL A;  5IGK A;  5FG4 A;  1JSP B;  4LZ2 A;  5L97 A;  2D9E A;  3O34 A;  4IR3 A;  4PTB A;  2YQD A;  4XUB A;  4YAT A;  5ENG A;  5I1Q A;  5EM3 A;  3UVY A;  4IOO A;  4HXR A;  4ALG A;  5FE1 A;  3DWY A;  5BT5 A;  3G0J A;  4QSU A;  5E3D A;  4QSW A;  5HLS A;  3ONI A;  5CQT A;  4Q0O A;  4CL9 A;  5LKX A;  3LQJ A;  3MB4 A;  4QEU A;  4HXM A;  4WIV A;  5F1L A;  4NYV A;  3MQM A;  5FBX A;  5HRX A;  5HQ6 A;  5DFB A;  5L8T A;  3NXB A;  2I7K A;  5E9L A;  5DW2 A;  5ETB A;  3JVK A;  5IGN A;  5LVR A;  3UV4 A;  5F5Z A;  1F68 A;  5E9M A;  5FG5 A;  4Z1S A;  5I86 A;  4YYG A;  5KO4 A;  4F3I A;  4A9L A;  4LZS A;  4QR3 A;  3HME A;  3D7C A;  5EPB A;  4O76 A;  5DLZ A;  5J0D A;  4TT4 A;  4XY9 A;  3P1F A;  4BW4 A;  4PKL A;  3MB3 A;  2MJV B;  4PS5 A;  5LUU A;  5HEN A;  5ENB A;  2R0S A;  4A9O A;  4NUE A;  5CUA A;  4IOR A;  5ENJ A;  5F60 A;  4O71 A;  2R0Y A;  4KV1 A;  5FE2 A;  5HFQ A;  3S91 A;  2YDW A;  5C85 A;  3IU6 A;  2LSP B;  5D3T A;  4A9H A;  4NQM A;  5FE8 A;  4O7C A;  5E0R A;  5E73 A;  4XUA A;  4YBM A;  4MEQ A;  3AQA A;  4IR4 A;  2YYN A;  2G4A A;  4YYK A;  5ETD A;  4TZ2 A;  2RNW A;  4ZQL A;  4HXK A;  3QZS A;  2L85 A;  4O72 A;  5EWV A;  5LKU A;  3LQH A;  3U5L A;  4HXP A;  4QEW A;  4BJX A;  5FB1 A;  5CQ5 A;  5G4R A;  4NR9 A;  4LC2 A;  5HRW A;  3QZT A;  5L8U A;  4FLP A;  3O36 A;  3LXJ A;  4PCE A;  5CRZ A;  5I29 A;  5C7N A;  4ALH A;  3P5O A;  2GRC A;  2E7N A;  2RO1 A;  5G4S A;  4YAB A;  4N4H A;  3U5J A;  3GG3 A;  4UIY A;  5CY9 A;  4UYH A;  5CQ7 A;  4UYF A;  5FE3 A;  4HBW A;  5A5N A;  2RNX A;  4KV4 A;  4UYG A;  5EQ1 A;  4YYJ A;  4HXO A;  3QZV A;  5FH6 A;  4CUP A;  5I83 A;  4A9J A;  5CFW A;  5HFR A;  4NQN A;  5EPR A;  3MUK A;  4ZW1 A;  4AKN A;  4YYM A;  2RNY A;  4QUU A;  4WHU A;  4O7B A;  1E6I A;  3HMH A;  5A5Q A;  5EWC A;  5FFY A;  4QSP A;  4LDF A;  5EIS A;  5CRM A;  3UVD A;  5CUC A;  5AMF A;  5CUG A;  5D7X A;  5EVA A;  2OO1 A;  4LYW A;  2RFJ A;  5D3P A;  5E7D A;  4ZC9 A;  4YYD A;  3AAD A;  4MR5 A;  4CUQ A;  4UIU A;  5DFD A;  3G0L A;  4KCX A;  4HXS A;  4TU4 A;  5H1T A;  1WUM A;  5HEL A;  4TT2 A;  4TYL A;  4LYI A;  2YEK A;  5EGU A;  2DVS A;  4NXJ A;  4A9K A;  2D82 A;  5DKD A;  5CZG A;  4MEP A;  4Z93 A;  5ENE A;  5FE4 A;  4N3W A;  4NRC A;  5CQA A;  2DWW A;  4C67 A;  2OSS A;  3ZYU A;  5FB0 A;  4O75 A;  2N9G A;  3LJW A;  4NR7 A;  3UVW A;  4BHW A;  4NR4 A;  5A5P A;  4YYN A;  2RI7 A;  5EWD A;  5ACY A;  5F2P A;  4YY4 A;  5DW1 A;  5CUD A;  5AME A;  3UW9 A;  5CQ4 A;  3U5M A;  4CUT A;  4CUU A;  5D3J A;  5AD3 A;  2RS9 B;  5DYA A;  2DKW A;  3IU5 A;  2OUO A;  4Z1Q A;  5A7C A;  5C8G A;  5CUB A;  5FFW A;  5EU1 A;  4O7A A;  5I7X A;  2E7O A;  4YH4 A;  4YYH A;  5ENC A;  3P1D A;  4UIZ A;  5D3H A;  3SVG A;  5EPS A;  4YAX A;  2DVR A;  4HBX A;  5F3A A;  4Z6H A;  5EP7 A;  4N4F A;  4YY6 A;  5KTX A;  4QSX A;  5A83 A;  4TT6 A;  5IBN A;  5CGP A;  2F6N A;  4HBY A;  4J0S A;  5LKT A;  5F63 A;  2F6J A;  4QB3 A;  4NS5 A;  4Q0N A;  2I8N A;  2H60 A;  5JWM A;  4OGI A;  4X2I A;  4XYA A;  5A5S A;  5FG6 A;  5HM0 A;  4N4I A;  4HXL A;  3O37 A;  3P1E A;  3Q2F A;  4NUC A;  4UIV A;  5TB6 A;  5ENH A;  4O7F A;  5IGM A;  5DY7 A;  5E9I A;  4OUF A;  1JM4 B;  2YEM A;  4QUT A;  3TLP A;  5A82 A;  4NRA A;  5CPE A;  3JVM A;  5FH7 A;  3HMF A;  4CFL A;  4MR4 A;  5DLX A;  5EI4 A;  5CS8 A;  4CFK A;  2WP2 A;  4LYS A;  4QST A;  4Z6I A;  5FE7 A;  5FE5 A;  4WHW A;  2R0V A;  4E96 A;  2KTB B;  5L99 A;  4IR6 A;  4IR5 A;  4QR4 A;  4YBS A;  5F25 A;  2WP1 A;  5I88 A;  5EWH A;  5A81 A;  5DX4 A;  5EWW A;  4C66 A;  5A5O A;  5D25 A;  5D0C A;  2NXB A;  1N72 A;  5BT4 A;  4A9F A;  4BW2 A;  4Y03 A;  5ENI A;  4GPJ A;  4MEO A;  5H1U A;  5F62 A;  4NR8 A;  3UVX A;  5DYX A;  4QZS A;  5E74 A;  5TCM A;  4TU6 A;  5CP5 A;  5FFV A;  4NYW A;  5H1V A;  4NR6 A;  5FE6 A;  3U5K A;  4XY8 A;  4CUR A;  4UIW A;  5FH8 A;  4TQN A;  5L98 A;  4QYD A;  5ENF A;  3Q2E A;  4NRB A;  5DKH A;  4LR6 A;  4MR6 A;  5HQ7 A;  5JI8 A;  5CQ3 A;  3P1C A;  3LQI A;  4IOQ A;  3JVJ A;  5E9K A;  5DKC A;  4HXN A;  5CQ6 A;  5L96 A;  3UV5 A;  5DYU A;  4UIX A;  4UYE A;  5C4Q A;  2FSA A;  5F1H A;  5I40 A;  4O77 A;  4O74 A;  4A9M A;  4QSR A;  2DVQ A;  4NUD A;  5IG6 A;  2E3K A;  4QSQ A;  4A9N A;  5A5R A;  5FDZ A;  5COI A;  4QSS A;  5DFC A;  4TS8 A;  5IGL A;  5LJ2 A;  5C89 A;  4BW1 A;  3SVF A;  5EIC A;  4UIT A;  5A85 A;  4UYD A;  5HEM A;  4CLB A;  3FKM X;  5CQ8 A;  4O78 A;  4O7E A;  4YYI A;  1ZS5 A;  4N4G A;  5DYC A;  4PY6 A;  4QY4 A;  5II1 A;  5EK9 A;  5CUE A;  5D26 A;  4MEN A;  5FE0 A;  4QBM A;  5HRV A;  4MR3 A;  5DBM A;  5KTU A;  4OGJ A;  5IID A;  4UYF B;  3MUL A;  4QYL A;  5KU3 A;  5BT3 A;  5CTL A;  3O35 A;  5LVQ A;  5C87 A;  5KTW A;  5II2 A;  5D3L A;  4A9E A;  1WUG A;  2L84 A;  5D3R A;  5FE9 A;  5K29 A;  5HJC A;  4O70 A;  5I7Y A;  2R10 A;  4BW3 A;  4YK0 A;  5F36 A;  4HBV A;  4YH3 A;  3U5N A;  4QR5 A;  4A9I A;  5E3G A;  3JVL A;  5I80 A;  3I3J A;  4J3I A;  5E9Y A;  4PCI A;  5CU8 A;  3U5P A;  4NR5 A;  4NYX A;  4QC1 A;  4DON A;  2YEL A;  4J0R A;  4J1P A;  5LKZ A;  5KHM A;  5E9V A;  3O33 A;  4QNS A;  5EA1 A;  4QEV A;  4TTE A;  3S92 A;  4YBT A;  2L5E A;  4QSV A;  5D3N A;  5D24 A;  5HQ5 A;  4YAD A;  4RVR A;  5LJ0 A;  3DAI A;  3U5O A;  3UV2 A;  2DVV A;  5H85 A;  1EQF A;  4TZ8 A;  3MXF A;  4LZR A;  5I89 A;  5LJ1 A;  3RCW A;  4YC9 A;  2YW5 A;  4LRG A;  5EV9 A;  4CUS A;  3K2J A;  2DAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...