5A5XB

Crystal structure of se-met mltf from pseudomonas aeruginosa
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
417
structure length
417
Chain Sequence
EGVLRVITRNSPATYFQDRNGETGFEYELAKRFAERLGVELKIETADNLDDLYAQLSREGGPALAAAGLTPGREDDASVRYSHTYLDVTPQIIYRNGQQRPTRPEDLVGKRIMVLKGSSHAEQLAELKKQYPELKYEESDAVEVVDLLRMVDVGDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLAWALPGGDDDSLMNEVNAFLDQAKKEGLLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPRYESHFKQSGKQKDTDWRLLAAIGYQESLWQPGATSKTGVRGLMMLTNRTAQAMGVSNRLDPKQSIQGGSKYFVQIRSELPESIKEPDRSWFALAAYNIGGAHLEDARKMAEKEGLNPNKWLDVKKMLPRLAQKQWYAKTRYGYARGGETVHFVQNVRRYYDILTWVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activation by Allostery in Cell-Wall Remodeling by a Modular Membrane-Bound Lytic Transglycosylase from Pseudomonas aeruginosa.
pubmed doi rcsb
molecule keywords MEMBRANE-BOUND LYTIC MUREIN TRANSGLYCOSYLASE F
molecule tags Hydrolase
total genus 141
structure length 417
sequence length 417
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2015-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
B PF01464 SLT Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5a5xB01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5a5xB02
4GOTA 3JZJA 4F2QA 4N07A 4U1ZA 3K6UA 4WEDA 2XXIA 5CMKA 3U92A 4OQOA 1AH5A 3VXCA 2Q89A 2UYFA 1EU8A 1MDQA 1DSNA 1JETA 4G68A 1MQGA 5EHMA 4KYEA 3OOAA 2M8CA 3HSTA 2XD3A 4DLDA 3SESA 3I5OA 3VXBA 3FZVA 5I59A 2XXRA 3FVOA 2I4CA 3SEYA 4ZEKA 2GH9A 5DVIA 3MZ9A 3MVXA 1ZBMA 2ESNA 4OESA 3U94A 3MUQA 1M5FA 3O6IA 4TOZA 3R7XA 4AB5A 4Z7EA 1B4HA 1US4A 2HZLA 4NF4B 4R9GA 3A09A 4BDOA 1A7LA 1JVYA 4P0GA 2GHBA 3K6XA 4OVJA 2ONKE 5I56A 1MPDA 1B5HA 3K1NA 1DPEA 4FEBA 1FQCA 1MQHA 3FJMA 1LGBC 1B40A 4PE5B 4H8IA 1SBPA 4JWOA 3PPOA 4C1UA 2B3BA 4KCCA 4EXLA 4NF6A 1YAEA 4OETA 1BP5A 3O28A 3KJTA 3O97A 1IXIA 2THIA 1NL5A 3TELA 1N7XA 1TFDA 3TODA 4KHZE 2RINA 1SW5A 3T22A 1NNPA 3SDFA 3KOTA 1Z7ME 3Q27A 1B3EA 3SETA 2DE4A 2A5TB 2QPQA 3EHUA 3VVDA 4R73A 3IB2A 5ICQA 4PP0A 2F7BA 1MY4A 2UVJA 2DWHA 1A40A 3LSFB 3CVGA 4YZZA 1JW1A 4LP2B 1HSEA 4EXKA 3ZKLA 1OVBA 4OENA 1D9YA 3MAMA 2IA4A 5H8SA 3E4RA 3H6TA 3OO8A 3RN8A 4MBPA 3TMGA 2ONSA 4LZ5A 2F36A 4RA1A 1IQ7A 3C32A 2QL3A 2YJPA 1B58A 3TUSA 2UXAA 1USYE 4MLVA 1P1WA 5M2VA 2F35A 4GFRA 3QUJA 2DSFA 3FD3A 4U23A 2XXHA 3AXFA 3W9VA 2ZNTA 1PBQA 1WODA 1B2HA 1Y20A 3HPIA 1DMBA 4PFUA 4FE8A 2X7PA 1D4NA 5DVJA 4EDPA 2VGQA 3RUMA 4NWCA 2XX7A 4X48A 2P2AA 3UN6A 3SEUA 4R6KA 4WXJA 1H76A 4LVQA 3LSLA 3OELA 4RNSA 4DXCA 2V84A 4BDMA 2I58A 2HEUA 4NEDA 5FHNA 3TQWA 3S2VA 1SD3A 4JBZA 1MS7A 2HAVA 3IORA 3OO6A 2NOOA 4GXSB 3IO6A 2F6PA 2DWAA 5TPAB 5FHOA 3G3KA 4YKKA 3TQLA 1EZPA 5B7DA 3IOTA 1S50A 3M8UA 3K1PA 4LATA 2O7UA 1NNKA 3KSJA 3V83A 5AA2A 4YB5A 1LFHA 2OCUA 5CMCA 4DDDA 5KCJB 2QSXA 4F3GA 2RCAA 3C4MA 2ZMBA 4KD5A 1PB7A 3MPLA 5JK4A 4JWYA 3G3IA 4ZEFA 1SW2A 4F31B 3S9EA 1M5CA 3B6TA 3FJGA 1IXCA 1AIVA 3RGYA 1GR2A 2OK2A 3H6WA 3BKIB 4RXLA 3ONMA 4H1XA 2A5SA 4FEDA 1B3GA 4RYAA 4YKJA 3LBSA 1CB6A 1UIUA 3VFJA 3MZBA 3IJOB 4ELOA 4EF1A 4KPTA 3CIJA 3O66A 5DT6A 1FQBA 4X1BA 2QMWA 1ELJA 1SYIA 5HPQA 3E3KA 4LUBA 2X26A 3N6TA 5EYFA 2HCAA 5AA2D 5I84A 4AB6A 1MH4A 4I8CA 3BBRA 5AA4A 4JXIA 4F39A 5JEIA 5DEXB 5F1QA 3MZ1A 3G3GA 4GLIA 2QS1A 4F19A 2PMSA 1JQFA 3K02A 3PUVE 4EUOA 2I3WA 3FXQA 1Y1ZA 5I2KA 2E1SA 1I6BA 4XXUA 4UA8A 4NF5A 3PUYE 3FV1A 1VSOA 1B46A 5I2NA 5IAIA 3VVEA 3IB1A 4OWDA 2Y7WA 2ABHA 3E9XA 2XX9A 2XXXA 1GGGA 1LBCA 3PMXA 5IKBA 3K6WA 3DP6A 3TFLA 3C31A 4I62A 1M5DA 3CG3A 1YCJA 5L9SA 2DVZA 3OO7A 3LR1A 5B70A 2LAOA 2UVHA 4DZ1A 3MJNA 3PUZE 5FTIA 2D21A 2V3QA 1CE2A 1HSJA 3MP8A 4ONYA 2O6AA 5J1DA 3HO7A 4ND9A 1JW4A 4PFWA 1PB9A 2V93A 1OMPA 1D3KA 3PUXE 4H6DA 4HCYA 3HN0A 1Q35A 2KLFA 2DE3A 3VV5A 4DXBA 3SEWA 4IY6A 1Y9UA 1PDAA 1MXWA 3H4ZA 4OEVA 2F5XA 5TU0A 3JYRA 4IO7A 1ZMGA 3N6UA 2QS4A 1XVYA 1URGA 1UTHB 4H5GA 1FTLA 1IXHA 4XKRA 1GV8A 3W15C 1SDXA 3HHFA 2H9BA 4K3FA 4LA9A 1P99A 1LAGE 5HBCA 4C0RA 3OO9A 2H4IA 3CRBA 4N13A 3UP9A 4I1DA 3S4UA 2Z8EA 4F3SA 3ZSFA 3UK4A 5AA1A 1WVJA 4R72A 1PBPA 2RC8A 4HS7A 3PD8A 1FTOA 5CMMA 1TXFA 5BWJA 4P0IA 1R9QA 1IIWA 3RTWB 1S7YA 2QJEA 1H43A 3LUYA 1N76A 4ELPA 4GWOA 3N94A 1Y3NA 2ZNSA 3E13X 1B0LA 3IAZA 1OIBA 2XHDA 4GL0A 4MF3A 1PEBA 1LCTA 1QKBA 2XD2A 2Y7IA 2V25A 3IOVA 3MQ9A 1BIYA 1JW5A 3THIA 3H7MA 5KDTB 1O7TA 3Q26A 3S9MC 2F78A 3QK6A 1QVSA 3OXNA 2PX1A 4G8NA 2W7YA 4EF2A 3DP4A 1YPNA 4JB7A 3R6UA 1URSA 2I0BA 4OHNA 3QSLA 2RKMA 4U22A 3RLFE 3EN3A 1Y4TA 1RYOA 4R2FA 3FGSA 3P7IA 4YMAA 5TP9B 2F34A 1QUKA 2PVUA 4E0WA 2GFEA 2OWTA 1MRPA 1QUJA 3VDFA 4DCYA 4OEUA 3TAJA 1B6HA 4BDQA 4ELRA 4QFOA 4XTCQ 1P1UA 4HW8A 2ZXTA 3VLUA 2NUVA 4NF4A 2HXWA 3B7DA 2GRVA 4ELQA 1NH7A 1SVXB 4GXAA 3MBPA 4I9DA 4XIGQ 3IX1A 2RC7A 2D5WA 2PBWA 4MFIA 2D3IA 3CFZA 2O7IA 5ITOA 3WAEA 1XS5A 3FV2A 3GZGA 2XXVA 3O2AA 3IL1B 1O64A 4PFTA 1P1QA 2F6GA 1FTMA 1MDP1 5H8HB 2R9JA 1P1NA 1A8EA 1RKMA 3GLBA 4G68C 2E0SA 3HCQA 3Q28A 2NWJA 4HCWA 1R6ZA 2UYEA 1SI1A 2A5TA 1QW0A 1FTJA 1AOVA 2Y7RA 4BDNA 4FATA 3LSXA 1J1NA 5H8FB 3V8XB 1N84A 4ESWA 3KEIA 5LOMA 3TCHA 4L17A 4RK2A 2H98A 2RCBA 1O63A 3OEKA 4KYSA 4ZEBA 1Y3PA 1LB8A 3PPQA 1ANFA 3TTLA 1B5JA 4F3BA 4R74A 4U4SA 3CFLA 2Q88A 1MY0A 4R9FA 4QSCA 1N3WA 1US5A 1B51A 3EF7A 4FORA 4OERA 4E0XA 3KOSA 4DCXA 1FQDA 1NH8A 3D4GA 4OFLA 1Y1MA 5I57B 3I6VA 2VHAA 1MPCA 3K00A 2AYSA 5CMBA 3A3CA 5CM6A 3WAFA 2O51A 1MY2A 2XXWA 5KZTA 4Q0CA 2HFBA 4ESXA 2NXOA 4QF9A 2ANJA 1TT1A 1I69A 4F18A 3OSRA 3GBBA 4POWA 5I57A 3RTFB 4NMYA 2ALUA 1PC3A 3IOWA 3MVYA 1POY1 2DYXA 3RPWA 1QKAA 3TDJA 3HV1A 1YTVA 4TLLB 2QS2A 4RPNA 4LQ5A 5TPAA 3MVWA 2F8DA 4JWXA 1QULA 3KBRA 2QMXA 3TEPA 2ZYKA 3W9WA 2VP1A 5JTYB 1HSLA 4U1OA 3RY3A 3VLVA 4PETA 2WKYA 3Q25A 3RT8A 1VFEA 3TPAA 5ICTA 2NVUB 3FXUA 1NNFA 1LCFA 2PT1A 3K01A 2OJTA 1MQIA 5ITPA 5KCJA 1FQEA 3K0VA 1JNFA 1A55A 2OWSA 3TCGA 3MC2A 2UVIA 2RF1A 1OLAA 2B3FA 4IY5A 3SERA 4OTEA 3T9VA 4QHQA 4ZDMA 4NF8B 4G2ZA 4NWDA 3CG1A 4EQ9A 2XXUA 2O1LA 2H99A 3S9NC 3LSWA 3O29A 5H8NB 1VR5A 3S9LC 4Z0IA 1A54A 3QAXA 3CSBA 4YU0A 5I58B 1B7HA 4P11A 1MPBA 3FVNA 1LB9A 1T0KA 4XKQA 2DWIA 2Z8DA 3T9UA 3GBAA 3QXMA 1UIVA 3KZGA 1B9JA 1MXVA 2X7QA 1II5A 4EQ7A 3D4CA 3Q29A 4U4XA 4EQBA 1B5IA 2R71A 1D9VA 3KFMA 1OQGA 1TFAA 3T96B 5DEXA 3EHTA 1B7UA 1QUIA 3PV0E 4ZS9A 3EHSA 2DE2A 3FXRA 3IB0A 4RPOA 3H6UA 1ZTYA 4C1TA 4Q8RA 1XT8A 1MQJA 2G93A 3PPNA 3FUZA 3UGWA 4KI0E 4F1UA 2DWJA 2F7CA 2ZYOA 5A5XB 3RQTA 1JEVA 3C34A 3QUFA 4FIMA 5DTBA 3PU5A 2Z8FA 4IGRA 5K2XA 1TWYA 2O68A 1B52A 2DXYA 1N3XA 2AIXA 1OQHA 2V3TA 4R2BA 3G7WA 4KQPA 2DP8A 1FTKA 4F3PA 1Q1KA 4IO6A 1B7ZA 3TZAA 2I0CA 1L5TA 5L9OA 1B05A 3V5AA 1LAFE 4FJPA 5FTHA 1F9BA 2OLBA 3CSGA 2I48A 4DE8A 4F22A 1Z7NE 3PD9A 3BFTA 4O3AA 2VOZA 2FYIA 3ZS6A 4R75A 2DQVA 4M1VA 3ECRA 4YKIA 3TTKA 4G68B 1JEUA 3FVGA 4GRKA 2V3UA 4F1VA 1UTHA 2RC9A 3OSQA 4RY1A 5I59B 4U2RA 3DELB 3PPRA 3SKPA 3O9PA 4IO3A 1LAXA 3CFXA 4IB2A 3UA8A 1ZLQA 2CZLA 1QJMA 2ZYNA 3VLWA 5ISUA 1H44A 1B32A 3MP1A 1FW0A 5I56B 4F2OA 1EH3A 4G8MA 4MLQA 1SI0A 1IEJA 3G3HA 2YLNA 1EZOA 3U72A 3QYTA 2I4BA 4QFNA 1DPPA 1MM6A 3B6WA 1I6AA 5K2YA 4NF6B 3K6VA 4JSOA 2Y7KA 2P0SA 3N26A 1SQYA 3RT6B 3VE1B 4OFOA 3MPKA 1URDA 3C36A 3MW0A 3T9XB 2Q8JA 5H8QB 4QFLA 5KDTA 5FHMA 4BDLA 1H45A 1LFIA 1FQFA 1JVXA 2H5YA 3KSXA 4YMBA 3ILUB 4N6PA 2HZKA 4TQUQ 4ISUA 1MQDA 1B4ZA 4R6YA 2PYYA 1A99A 3JV9A 5HM4B 3C9HA 3A3UA 5TP9A 1AL3A 1B3LA 4JDFA 2QRYA 3FIRA 4LZ8A 1EZ9A 4G77A 3M3KA 1IZ1A 2Y84A 1ZU0A 2XXPA 3UIFA 1BKAA 4M4GA 5H8QA 3K1MA 2VD2A 3DP8A 1Y4CA 4X9TA 4QSEA 4OZ9A 1NNTA 2O1MA 1I6QA 2I6EA 4KR5A 5DVFA 4Q5TA 3O6GA 4YKPA 2GHAA 1B1HA 2XX8A 3IO4A 1B3HA 2REJA 4PFYA 5ELVA 3H3GA 4QFKA 4TLMB 2DS9A 2FNCA 2ZYMA 3IOUA 4YB6A 4LQ2A 3MWBA 2YPNA 3K2DA 2REGA 2DOJA 4GIZA 1OLCA 2OZZA 4ECFA 4FECA 4IO4A 2I3VA 5H8HA 4YICA 3DM0A 2PT2A 4H5FA 4WEPA 4GF8A 1NKXA 4GVOA 1MXXA 1MXYA 4ZEDA 3HHGA 1MXUA 3G3JA 4ZZEA 1A8FA 4IGTA 3T9HB 5EHSA 5H8FA 4MH5A 3KN3A 5CBRA 4YAHX 1AMFA 4QFPA 4YB7A 3SEXA 2Z22A 2ONRA 3EPEA 1XOCA 1FQAA 1B3FA 4QRZA 1DTZA 2DXRA 5AA2B 5AA3A 2BJJX 1MY3A 3OEMA 1UTBB 1LLSA 3TTMA 2UVGA 2FA7A 3T66A 3OMBA 1LFGA 1B1XA 2R6GE 3ZKKA 1MY1A 2HQ0A 4OMBA 1BTJA 4GL8A 1H3DA 4OYVA 3GXAA 4U21A 1XVXA 3H6VA 5AE4A 3V89B 3O6HA 3U1OA 1XHYA 3KGCA 2F97A 3IR1A 4O3CA 1UTBA 4QSDA 3TYHA 1DTGA 2XXQA 5DYHA 4X1DA 1ZKBA 1ZJLA 4OXVA 4AQ4A 3MP6A 3PPPA 2G29A 2DVCA 4RJZA 3M3FA 3FJ7A 4JSDA 4XKNA 1UQWA 5AA4B 3PGFA 4DXUA 1WDNA 4IO2A 1N7WA 1IUDA 4WKMA 1Y3QA 2H25A 1R9LA 2AL5A 4RK9A 3PUWE 4ZECA 1MXZA 5I2KB 1B0HA 1KWHA 1SYHA 3H06B 4BDRA 5F7VA 3ILTB 1N0TA 3MVZA 5JTYA 1LSTA 4NF5B 1LBBA 4R6HA 5I2NB 3L6HA 3IJXB 3KG2A 4UACA 2I49A 2Z23A 5CBSA 1USYH 2ZNUA 3TTRA 4POXA 3R26A 3EQ1A 4ZE9A 1RYXA 1IITA 4NE4A 3FVKA 4NTLA 2HAUA 3L6GA 2CMOA 3KN7A 4LONB 4PQJA 5CC2A 3TKDA 2AL4A 1MG1A 5L9MA 3QIMA 3B6QA 1S9TA 1VE4A 4NF8A 1IXGA 3UORA 1GTKA 1MH3A 1MM7A 2P1SA 3PMWA 4ZZAA 1DOTA 4OFJA 4LZ7A 5H8NA 1ZIUA 2Y7PA 4G8HA 4BLAA 1M5EA 3M3LA 3DLNA 4F29A 1POTA 3LC8A 2OBGA 5I58A 1LAHE 1ATGA 4GD5A 1BLFA 2O84X 3RNNA 1M5BA 3CI8A 1SW4A 2Q2AA 4Q30B 4DIGA 4ZE8A 3IK6B 4O3BA 2VD3A 1SW1A 5L8DA 2QS3A 3TCFA 1VFDA 3G3FA 4XKPA 4KCDA 3OENA 4G4PA 4ZEIA 5CI5A 4FAJA 3C33A 3VVFA 3K4UA 3ODBA 4THIA 1XC1A 1GVCA 1FCKA 3SEVA 1NFTA 3U8QA 3U93A 1NMUA 4H0WA 3OD7A 2Q2CA 2F7AA 4KFQA 4IO5A 5CRYA 1OVTA 1P1OA 3BFUA 2XXTA 3KJ7A 5A5XA 4KYDA 3TTNA 2XXYA 2O69A 3C35A 2Q9TA 3I3VA 4H67A 1R1NA 3H03A 4F1YA 5BUUA 2B65A 3FASA 3T93B 4HTGA 3KN8A 3USDA 3FATA 4GQOA 4H65A 3CR9A 4H8JA 3F11A 1N04A 1PB8A 3PMVA 2IEEA 3N5LA
chains in the Genus database with same CATH superfamily
4GOTA 3JZJA 4F2QA 4N07A 4U1ZA 4N17A 3K6UA 4GX4A 4WEDA 2MKZA 2XXIA 5CMKA 3A29A 3U92A 4OQOA 1NV7A 1AH5A 3VXCA 2Q89A 2UYFA 1K9ZA 1EU8A 1MDQA 1DSNA 1JETA 4G68A 2PCRA 1MQGA 5EHMA 4KYEA 2R8TA 3OOAA 2M8CA 3HSTA 2XD3A 4JVCA 4DLDA 4PCDA 3SESA 4QXDA 4MEVA 3I5OA 3VXBA 1NV3A 3FZVA 4X04A 5I59A 4NG7A 2XXRA 3FVOA 2I4CA 4PAFA 3SEYA 4ZEKA 2GH9A 5DVIA 3MZ9A 3MVXA 1ZBMA 2ESNA 4OESA 3U94A 3MUQA 1M5FA 4PF8A 3O6IA 4TOZA 3R7XA 4AB5A 4Z7EA 1B4HA 1FBCA 1US4A 2HZLA 4NF4B 1NV0A 1Q9DA 3QMFA 4R9GA 3A09A 4BDOA 3KC0A 1A7LA 1NUYA 1IMBA 1JVYA 4P0GA 2GHBA 3K6XA 4OVJA 2ONKE 1NV5A 5I56A 4OVSA 1MPDA 1B5HA 3K1NA 1DPEA 4FEBA 1FQCA 1MQHA 3FJMA 1LGBC 2VPNA 5ET7A 1B40A 4PE5B 4H8IA 1SBPA 4JWOA 3PPOA 4C1UA 4N6DA 2B3BA 4KCCA 4EXLA 4NF6A 1YAEA 4OETA 1BP5A 3O28A 3KJTA 4OVQA 4GBVA 3O97A 1IXIA 2THIA 1NL5A 3TELA 1N7XA 1TFDA 3TODA 4KHZE 2RINA 1SW5A 4I3YA 3T22A 1NNPA 1LBVA 3SDFA 3KOTA 1Z7ME 3Q27A 1B3EA 3SETA 2DE4A 2A5TB 2QPQA 3EHUA 3VVDA 2OX3A 4PF6A 4R73A 3IB2A 5ICQA 4PP0A 2F7BA 1MY4A 2UVJA 2DWHA 1A40A 3FBPA 3CVGA 3LSFB 4YZZA 1JW1A 4LP2B 4NX1A 1HSEA 4EXKA 3ZKLA 1OVBA 4OENA 1D9YA 3MAMA 4O7IA 2IA4A 5H8SA 3E4RA 3NOHA 3H6TA 3OO8A 3RN8A 2WX9A 4MBPA 3TMGA 4QBAA 1FRPA 2ONSA 4LZ5A 3MYUA 2F36A 4RA1A 1IQ7A 3C32A 2QL3A 2YJPA 4P9KA 1B58A 3TUSA 2UXAA 3T0JA 1USYE 4MLVA 2PFYA 1P1WA 5M2VA 2F35A 2HPGA 4GFRA 3QUJA 2DSFA 3RYDA 3FD3A 4U23A 2XXHA 3AXFA 4KXPA 3W9VA 2ZNTA 1PBQA 1KA1A 1WODA 1B2HA 1Y20A 2P3NA 3B8BA 3HPIA 1DMBA 4PFUA 4FE8A 2X7PA 1D4NA 5DVJA 4MNCA 4EDPA 2VGQA 1FPKA 3RUMA 4NWCA 2XX7A 4X48A 1DBZA 2P2AA 3UN6A 3SEUA 4R6KA 4WXJA 1H76A 4LVQA 3LSLA 4JVIA 3OELA 2FIEA 4RNSA 4DXCA 2V84A 4BDMA 2I58A 2HEUA 4NEDA 5FHNA 3TQWA 3S2VA 1SD3A 5FBPA 4JBZA 1MS7A 2HAVA 3IORA 3OO6A 2NOOA 4GXSB 3IO6A 2F6PA 2DWAA 5TPAB 5FHOA 3G3KA 4GWSA 4YKKA 3TQLA 1EZPA 5B7DA 3IOTA 1FPEA 1S50A 3M8UA 3K1PA 4LATA 5EYHA 2O7UA 4PAIA 1NNKA 3KSJA 2XWOA 3V83A 5AA2A 4YB5A 1LFHA 2OCUA 5CMCA 4DDDA 5KCJB 2QSXA 4F3GA 2RCAA 3C4MA 2ZMBA 4XEQA 4KD5A 4NHBA 1PB7A 3MPLA 5JK4A 1IMEA 4JWYA 3G3IA 4ZEFA 1SW2A 4F31B 3S9EA 1M5CA 1FPGA 3B6TA 3FJGA 1IXCA 1AIVA 4MNIA 3RGYA 1GR2A 2OK2A 3H6WA 3BKIB 4RXLA 3ONMA 4H1XA 2A5SA 4FEDA 5EQ8A 1B3GA 4RYAA 4YKJA 3LBSA 3PTYA 1CB6A 1UIUA 3VFJA 3MZBA 3IJOB 4ELOA 4EF1A 1NV2A 4KPTA 3CIJA 3O66A 5DT6A 1FQBA 4X1BA 2QMWA 1ELJA 1SYIA 5HPQA 3E3KA 4I3EA 4G61A 4LUBA 2X26A 3N6TA 5EYFA 2HCAA 4OA4A 5AA2D 5I84A 1FBHA 4AB6A 1MH4A 4I8CA 5LTCA 3BBRA 5AA4A 4GX6A 4JXIA 4F39A 5JEIA 5DEXB 5F1QA 3MZ1A 3G3GA 4GLIA 2QS1A 3T1BA 4F19A 2PMSA 1JQFA 1NV6A 3K02A 4IR8A 3PUVE 4EUOA 3BIHA 2I3WA 3FXQA 1Y1ZA 5I2KA 2E1SA 1I6BA 3SZPA 4XXUA 4UA8A 4NF5A 3PUYE 3FV1A 1VSOA 1B46A 5I2NA 1DK4A 5IAIA 1EYKA 3VVEA 3IB1A 5IGAA 4OWDA 2Y7WA 2ABHA 4MMPA 3E9XA 2XX9A 2XXXA 4N8GA 1GGGA 1LBCA 3PMXA 5IKBA 3K6WA 3DP6A 3TFLA 3C31A 4I62A 1M5DA 3CG3A 1YCJA 5L9SA 2DVZA 3OO7A 3LR1A 5B70A 2LAOA 2UVHA 4DZ1A 3MJNA 1FJ9A 3PUZE 5FTIA 2D21A 2V3QA 1SPIA 1CE2A 1HSJA 3MP8A 5IZ1A 4ONYA 2O6AA 5J1DA 3RPLB 3HO7A 4ND9A 1JW4A 4PFWA 1FSAA 1PB9A 2V93A 2Q8MA 4PBQA 2B4MA 1OMPA 3BIGA 1D3KA 3PUXE 4H46A 4PDHA 4H6DA 4HCYA 3HN0A 1Q35A 2KLFA 2DE3A 3VV5A 4DXBA 3SEWA 4IY6A 1Y9UA 4MAGA 1PDAA 1MXWA 2QVUA 3H4ZA 4OEVA 2F5XA 5TU0A 3JYRA 4IO7A 1ZMGA 3N6UA 2QS4A 1XVYA 2WBDA 1URGA 1UTHB 2CZIA 2Y5LA 4H5GA 2WBBA 1FTLA 1IXHA 4XKRA 1INPA 1GV8A 3W15C 1SDXA 3HHFA 2H9BA 4K3FA 4LA9A 1P99A 4H45A 1LAGE 2BJIA 2WYPA 5HBCA 4C0RA 3OO9A 2H4IA 3CRBA 4N13A 3UP9A 4I1DA 2F3DA 3S4UA 2Z8EA 4F3SA 3ZSFA 3UK4A 2Q74A 5AA1A 4PFBA 1WVJA 4R72A 1PBPA 2RC8A 4HS7A 3PD8A 1FTOA 5CMMA 1TXFA 5BWJA 4P0IA 1R9QA 1IIWA 3RTWB 1S7YA 2QJEA 1LEVA 1H43A 5EQ7A 3LUYA 1N76A 4ELPA 4GWOA 3N94A 1Y3NA 2ZNSA 4OANA 3E13X 1B0LA 1FJ6A 3IAZA 2FBPA 1IMFA 4HE2A 1OIBA 2XHDA 4GL0A 4MF3A 1PEBA 1LCTA 1QKBA 2XD2A 2Y7IA 4HE0A 2V25A 3IOVA 3MQ9A 1BIYA 1JW5A 3THIA 2FVZA 1FBGA 1IMDA 3H7MA 5KDTB 1O7TA 3Q26A 1NV4A 3S9MC 2F78A 3QK6A 1QVSA 3OXNA 2PX1A 4G8NA 2W7YA 4EF2A 3DP4A 1YPNA 4JB7A 1KA0A 3R6UA 1URSA 2I0BA 4OHNA 3QSLA 1EYIA 2RKMA 4U22A 3RLFE 3EN3A 1Y4TA 1RYOA 4R2FA 3FGSA 3P7IA 4OVPA 4YMAA 5TP9B 2F34A 1QUKA 2PVUA 2CEXA 4E0WA 2GFEA 2OWTA 1MRPA 1QUJA 4OVTA 3VDFA 4DCYA 4OEUA 3TAJA 1B6HA 4BDQA 4ELRA 4QFOA 4XTCQ 1FTAA 1P1UA 4HW8A 2ZXTA 3VLUA 2NUVA 4NF4A 2HXWA 3B7DA 2GRVA 1LBYA 4ELQA 1NH7A 4DI3D 1SVXB 4GXAA 3MBPA 4I9DA 4XIGQ 3IX1A 4P8BA 2RC7A 2D5WA 2PBWA 4MFIA 2D3IA 3CFZA 2HXRA 2O7IA 5ITOA 3WAEA 1XS5A 3FV2A 3GZGA 2XXVA 3O2AA 2QVRA 3IL1B 4PDDA 1O64A 4PFTA 1FBPA 4I40A 5J16A 1P1QA 2F6GA 1FTMA 1MDP1 5H8HB 3E79A 1BK4A 2R9JA 1P1NA 1A8EA 1RKMA 3GLBA 4G68C 1FPIA 2KR0A 2E0SA 3HCQA 3Q28A 2NWJA 4HCWA 4O94A 1R6ZA 2UYEA 1SI1A 2A5TA 1QW0A 1FTJA 1AOVA 2Y7RA 1NUZA 4BDNA 4FATA 3LSXA 1J1NA 5H8FB 4MX6A 3V8XB 4N8YA 1N84A 4ESWA 3KEIA 5LOMA 3TCHA 4L17A 4RK2A 2H98A 2RCBA 1O63A 3OEKA 4KYSA 4ZEBA 1Y3PA 1LB8A 3PPQA 1ANFA 3LUZA 3TTLA 1B5JA 4R74A 4U4SA 4F3BA 3CFLA 2Q88A 1MY0A 4R9FA 4QSCA 1N3WA 4NF0A 2CEYA 1US5A 1B51A 1FPFA 1YZ0A 3EF7A 4FORA 4OERA 4E0XA 3KOSA 4DCXA 1FQDA 2CZHA 1NH8A 3D4GA 4OFLA 4PTKA 1Y1MA 5I57B 3I6VA 2VHAA 1MPCA 3K00A 2AYSA 2WEFA 5CMBA 3A3CA 5CM6A 3WAFA 2O51A 4PGNA 1AWBA 1MY2A 2XXWA 5KZTA 2WYKA 3IFCA 4P1EA 4Q0CA 2HFBA 4ESXA 2NXOA 4QF9A 2ANJA 1TT1A 1FPLA 1I69A 4F18A 4O7MA 3OSRA 3GBBA 1KZ8A 4POWA 4XF5A 5I57A 3RTFB 4NMYA 2ALUA 1PC3A 3IOWA 3MVYA 1POY1 2DYXA 2Y5KA 3RPWA 1QKAA 3TDJA 3HV1A 1YTVA 4TLLB 2QS2A 4RPNA 4LQ5A 4NN3A 4P1LA 2JJKA 4PAKA 5TPAA 2V4CA 3MVWA 2F8DA 4JWXA 1QULA 3KBRA 2QMXA 3TEPA 2ZYKA 3W9WA 2VP1A 5JTYB 1HSLA 1RDZA 4U1OA 3RY3A 3VLVA 4PETA 2WKYA 3Q25A 3RT8A 1VFEA 2FHYA 3TPAA 5ICTA 2NVUB 3FXUA 2ZZXA 2PFZA 1NNFA 1LCFA 4UABA 2PT1A 3K01A 2OJTA 4MNPA 1MQIA 5ITPA 4GX3A 5KCJA 3IFAA 1FQEA 1LBXA 5IZ3B 3K0VA 1JNFA 1A55A 4NAPA 2OWSA 3TCGA 3MC2A 5ESYA 1IMAA 2RF1A 2UVIA 1OLAA 2B3FA 4IY5A 3SERA 1LBWA 4OTEA 4GWXA 3T9VA 4QHQA 4ZDMA 4NF8B 4G2ZA 4NWDA 3CG1A 4EQ9A 2XXUA 2O1LA 4HE1A 2H99A 3LV0A 3LSWA 3O29A 3S9NC 5H8NB 1VR5A 3S9LC 4Z0IA 1A54A 3QAXA 3CSBA 4YU0A 4PFIA 5I58B 1B7HA 4P11A 5I7IA 1MPBA 4N81A 4PC9A 3FVNA 1LB9A 1T0KA 4XKQA 2DWIA 2Z8DA 3T9UA 2XA5A 3GBAA 3QXMA 1UIVA 4NQ8A 3KZGA 1B9JA 1MXVA 4O8MA 2X7QA 1II5A 4EQ7A 4PE3A 5T3JA 3D4CA 3Q29A 4U4XA 4EQBA 1B5IA 2R71A 1D9VA 3KFMA 1OQGA 1TFAA 3T96B 5DEXA 3EHTA 1B7UA 1QUIA 4N6KA 3PV0E 4ZS9A 3EHSA 2DE2A 3FXRA 4PBHA 3IB0A 4RPOA 3H6UA 3KBZA 1ZTYA 4C1TA 4Q8RA 1XT8A 1VDWA 1MQJA 2G93A 3PPNA 3FUZA 3UGWA 4KI0E 4F1UA 2DWJA 2F7CA 2GQ1A 2ZYOA 5A5XB 1FPDA 2XXKA 3RQTA 1JEVA 3C34A 3QUFA 4FIMA 5DTBA 2HHMA 3PU5A 2Z8FA 4IGRA 1RDYA 5K2XA 1TWYA 1FBDA 2O68A 1B52A 2DXYA 1N3XA 2AIXA 5EQAA 1OQHA 2V3TA 4R2BA 3G7WA 4KQPA 2DP8A 4MIJA 1FTKA 4F3PA 1Q1KA 3RPLA 4IO6A 1B7ZA 3TZAA 2I0CA 1L5TA 5L9OA 1B05A 3V5AA 1NUXA 1LAFE 2KQZA 4FJPA 4OVRA 1FPBA 5FTHA 1F9BA 2OLBA 3CSGA 2I48A 4DE8A 1G0IA 4F22A 2FIXA 1Z7NE 2QVVA 3PD9A 3BFTA 4O3AA 2VOZA 2FYIA 3ZS6A 4R75A 2DQVA 4M1VA 3ECRA 4YKIA 3TTKA 4G68B 1JEUA 3FVGA 4GRKA 2V3UA 4F1VA 1UTHA 2RC9A 3OSQA 4RY1A 5I59B 4U2RA 3DELB 4P47A 3PPRA 3SKPA 4GWZA 3O9PA 4IO3A 1LAXA 3CFXA 4IB2A 3UA8A 1FPJA 4MHFA 4XFEA 1ZLQA 2CZLA 1QJMA 2ZYNA 3VLWA 5ISUA 1H44A 5I3SA 1B32A 3MP1A 1FW0A 5I56B 4F2OA 1EH3A 4G8MA 4MLQA 1SI0A 1IEJA 3G3HA 2YLNA 1EZOA 3U72A 3QYTA 2I4BA 4QFNA 1DPPA 1MM6A 3B6WA 4AS5A 1I6AA 1G0HA 5K2YA 4NF6B 3K6VA 4JSOA 2Y7KA 2P0SA 3N26A 1SQYA 3RT6B 3VE1B 4OFOA 4DI4B 4N15A 3MPKA 1URDA 3C36A 2F3BA 3MW0A 3HFUA 1EYJA 3T9XB 3U65A 2Q8JA 5H8QB 4QFLA 5KDTA 5FHMA 4BDLA 1H45A 1LFIA 1FQFA 1JVXA 2H5YA 3KSXA 5DW8A 4P3LA 4YMBA 3ILUB 4N6PA 2HZKA 4TQUQ 1FBFA 4ISUA 5EYGA 1JP4A 1MQDA 1B4ZA 4R6YA 2PYYA 2ZZWA 1A99A 3JV9A 3FXBA 5HM4B 2XWVA 3C9HA 3A3UA 5TP9A 1AL3A 1B3LA 4JDFA 2QRYA 3FIRA 4LZ8A 1IMCA 1EZ9A 2OWZA 3KC1A 4G77A 3M3KA 1IZ1A 2Y84A 1ZU0A 2XXPA 3UIFA 1BKAA 4M4GA 5H8QA 3K1MA 2VD2A 4JVDA 3DP8A 1Y4CA 4X9TA 4QSEA 4OZ9A 1NNTA 2O1MA 1I6QA 2I6EA 4FBPA 4KR5A 5DVFA 4Q5TA 3O6GA 4YKPA 1XI6A 2GHAA 1B1HA 2XX8A 3IO4A 1B3HA 2REJA 2B4LA 5IM2A 4PFYA 5ELVA 3H3GA 4QFKA 2CZKA 4TLMB 3ROJA 2DS9A 2FNCA 2ZYMA 1NUWA 3IOUA 4YB6A 4LQ2A 2XWKA 3MWBA 2YPNA 3K2DA 2REGA 2DOJA 5ET5A 4GIZA 1OLCA 2OZZA 4ECFA 4FECA 4IO4A 2I3VA 4NGUA 5H8HA 5A5LA 4YICA 3DM0A 2PT2A 4H5FA 1CNQA 4WEPA 4GF8A 1NKXA 4GVOA 1MXXA 4MJOA 1MXYA 4ZEDA 3HHGA 4GWWA 1MXUA 3G3JA 4ZZEA 1A8FA 4IGTA 3T9HB 5EHSA 5H8FA 4MH5A 3KN3A 4GWYA 5CBRA 4YAHX 1AMFA 4QFPA 4YB7A 3SEXA 2Z22A 2ONRA 3EPEA 1XOCA 1FQAA 1B3FA 4QRZA 2L5VA 5IZZA 3ISPA 1DTZA 2ZZVA 2DXRA 5AA2B 5AA3A 2BJJX 1MY3A 3OEMA 1UTBB 4MCOA 1LLSA 3TTMA 2UVGA 4N4UA 2FA7A 3T66A 3OMBA 1LFGA 1B1XA 2R6GE 3B50A 3ZKKA 1MY1A 2HQ0A 4OMBA 1BTJA 4GL8A 1H3DA 4OYVA 3GXAA 4U21A 1XVXA 3H6VA 5AE4A 3EKIA 3V89B 3O6HA 3U1OA 1XHYA 5I5PA 3KGCA 4N91A 2F97A 3IR1A 4O3CA 1UTBA 4QSDA 3TYHA 1DTGA 2XXQA 5DYHA 4X1DA 1ZKBA 1ZJLA 4OXVA 4AQ4A 3MP6A 3PPPA 2G29A 2DVCA 4RJZA 3M3FA 3FJ7A 2DDKA 4JSDA 5EQ9A 4XKNA 1UQWA 3E78A 5AA4B 3PGFA 4DXUA 1WDNA 4IO2A 1N7WA 4GWUA 1IUDA 4WKMA 2QFLA 1Y3QA 2H25A 1R9LA 2AL5A 4RK9A 3PUWE 4ZECA 1MXZA 5I2KB 1B0HA 1KWHA 1SYHA 3H06B 4BDRA 5F7VA 3ILTB 1N0TA 3MVZA 5F24A 5JTYA 3GYYA 1LSTA 4NF5B 1LBBA 4R6HA 5I2NB 3L6HA 3IJXB 3KG2A 4UACA 4PGPA 1YYZA 2I49A 2Z23A 5CBSA 1USYH 2ZNUA 2VT5A 3TTRA 4POXA 3R26A 3EQ1A 1LBZA 1RDXA 4ZE9A 1RYXA 5IZ3A 1IITA 4NE4A 3FVKA 4NTLA 2HAUA 3L6GA 2CMOA 3CHGA 3KN7A 4LONB 4PQJA 5CC2A 3TKDA 2AL4A 1MG1A 5L9MA 3QIMA 4LN5A 3B6QA 1S9TA 3MSTA 1VE4A 4NF8A 1IXGA 1GTKA 1MH3A 1MM7A 2P1SA 3PMWA 3UORA 4ZZAA 1DOTA 4OFJA 1K9YA 4LZ7A 5ET6A 1ZIUA 2Y7PA 4G8HA 5H8NA 4BLAA 1M5EA 3M3LA 3DLNA 1YXIA 4F29A 1POTA 3LC8A 2OBGA 5I58A 1LAHE 4HXVA 1ATGA 1DCUA 4GD5A 1BLFA 4PFRA 2O84X 2VPOA 3RNNA 1M5BA 3CI8A 1SW4A 2Q2AA 4Q30B 4DIGA 4ZE8A 4AS4A 3IK6B 4O3BA 2VD3A 1SW1A 5L8DA 1NI9A 2QS3A 3TCFA 1VFDA 3G3FA 4XKPA 4KCDA 3OENA 4G4PA 4ZEIA 5CI5A 4FAJA 1QGXA 3C33A 3VVFA 3K4UA 3ODBA 4THIA 1XC1A 1GVCA 1FCKA 3SEVA 1NFTA 3U8QA 4P56A 4X8RA 3U93A 1NMUA 4H0WA 3OD7A 2Q2CA 2F7AA 4KFQA 4IO5A 5CRYA 1OVTA 1P1OA 3BFUA 3D1RA 5ET8A 2XXTA 2P3VA 3KJ7A 5A5XA 4KYDA 3TTNA 2XXYA 5LDZA 1D9QA 2O69A 1NV1A 2XWIA 3C35A 2Q9TA 3I3VA 4H67A 1R1NA 3H03A 4F1YA 5BUUA 2B65A 3FASA 3T93B 4HTGA 4GBWA 3KN8A 1FBEA 3USDA 3FATA 4GQOA 4H65A 3CR9A 4H8JA 3F11A 1N04A 1PB8A 3PMVA 2IEEA 3N5LA
chains in the Genus database with same CATH topology
4GOTA 3JZJA 4F2QA 4N07A 4U1ZA 3K6UA 4WEDA 2XXIA 5CMKA 3U92A 4OQOA 1AH5A 3VXCA 2Q89A 2UYFA 1EU8A 1MDQA 1DSNA 1JETA 4G68A 1MQGA 5EHMA 4KYEA 3OOAA 2M8CA 3HSTA 2XD3A 4DLDA 3SESA 3I5OA 3VXBA 3FZVA 5I59A 2XXRA 3FVOA 2I4CA 3SEYA 4ZEKA 2GH9A 5DVIA 3MZ9A 3MVXA 1ZBMA 2ESNA 4OESA 3U94A 3MUQA 1M5FA 3O6IA 4TOZA 3R7XA 4AB5A 4Z7EA 1B4HA 1US4A 2HZLA 4NF4B 4R9GA 3A09A 4BDOA 1A7LA 1JVYA 4P0GA 2GHBA 3K6XA 4OVJA 2ONKE 5I56A 1MPDA 1B5HA 3K1NA 1DPEA 4FEBA 1FQCA 1MQHA 3FJMA 1LGBC 1B40A 4PE5B 4H8IA 1SBPA 4JWOA 3PPOA 4C1UA 2B3BA 4KCCA 4EXLA 4NF6A 1YAEA 4OETA 1BP5A 3O28A 3KJTA 3O97A 1IXIA 2THIA 1NL5A 3TELA 1N7XA 1TFDA 3TODA 4KHZE 2RINA 1SW5A 3T22A 1NNPA 3SDFA 3KOTA 1Z7ME 3Q27A 1B3EA 3SETA 2DE4A 2A5TB 2QPQA 3EHUA 3VVDA 4R73A 3IB2A 5ICQA 4PP0A 2F7BA 1MY4A 2UVJA 2DWHA 1A40A 3LSFB 3CVGA 4YZZA 1JW1A 4LP2B 1HSEA 4EXKA 3ZKLA 1OVBA 4OENA 1D9YA 3MAMA 2IA4A 5H8SA 3E4RA 3H6TA 3OO8A 3RN8A 4MBPA 3TMGA 2ONSA 4LZ5A 2F36A 4RA1A 1IQ7A 3C32A 2QL3A 2YJPA 1B58A 3TUSA 2UXAA 1USYE 4MLVA 1P1WA 5M2VA 2F35A 4GFRA 3QUJA 2DSFA 3FD3A 4U23A 2XXHA 3AXFA 3W9VA 2ZNTA 1PBQA 1WODA 1B2HA 1Y20A 3HPIA 1DMBA 4PFUA 4FE8A 2X7PA 1D4NA 5DVJA 4EDPA 2VGQA 3RUMA 4NWCA 2XX7A 4X48A 2P2AA 3UN6A 3SEUA 4R6KA 4WXJA 1H76A 4LVQA 3LSLA 3OELA 4RNSA 4DXCA 2V84A 4BDMA 2I58A 2HEUA 4NEDA 5FHNA 3TQWA 3S2VA 1SD3A 4JBZA 1MS7A 2HAVA 3IORA 3OO6A 2NOOA 4GXSB 3IO6A 2F6PA 2DWAA 5TPAB 5FHOA 3G3KA 4YKKA 3TQLA 1EZPA 5B7DA 3IOTA 1S50A 3M8UA 3K1PA 4LATA 2O7UA 1NNKA 3KSJA 3V83A 5AA2A 4YB5A 1LFHA 2OCUA 5CMCA 4DDDA 5KCJB 2QSXA 4F3GA 2RCAA 3C4MA 2ZMBA 4KD5A 1PB7A 3MPLA 5JK4A 4JWYA 3G3IA 4ZEFA 1SW2A 4F31B 3S9EA 1M5CA 3B6TA 3FJGA 1IXCA 1AIVA 3RGYA 1GR2A 2OK2A 3H6WA 3BKIB 4RXLA 3ONMA 4H1XA 2A5SA 4FEDA 1B3GA 4RYAA 4YKJA 3LBSA 1CB6A 1UIUA 3VFJA 3MZBA 3IJOB 4ELOA 4EF1A 4KPTA 3CIJA 3O66A 5DT6A 1FQBA 4X1BA 2QMWA 1ELJA 1SYIA 5HPQA 3E3KA 4LUBA 2X26A 3N6TA 5EYFA 2HCAA 5AA2D 5I84A 4AB6A 1MH4A 4I8CA 3BBRA 5AA4A 4JXIA 4F39A 5JEIA 5DEXB 5F1QA 3MZ1A 3G3GA 4GLIA 2QS1A 4F19A 2PMSA 1JQFA 3K02A 3PUVE 4EUOA 2I3WA 3FXQA 1Y1ZA 5I2KA 2E1SA 1I6BA 4XXUA 4UA8A 4NF5A 3PUYE 3FV1A 1VSOA 1B46A 5I2NA 5IAIA 3VVEA 3IB1A 4OWDA 2Y7WA 2ABHA 3E9XA 2XX9A 2XXXA 1GGGA 1LBCA 3PMXA 5IKBA 3K6WA 3DP6A 3TFLA 3C31A 4I62A 1M5DA 3CG3A 1YCJA 5L9SA 2DVZA 3OO7A 3LR1A 5B70A 2LAOA 2UVHA 4DZ1A 3MJNA 3PUZE 5FTIA 2D21A 2V3QA 1CE2A 1HSJA 3MP8A 4ONYA 2O6AA 5J1DA 3HO7A 4ND9A 1JW4A 4PFWA 1PB9A 2V93A 1OMPA 1D3KA 3PUXE 4H6DA 4HCYA 3HN0A 1Q35A 2KLFA 2DE3A 3VV5A 4DXBA 3SEWA 4IY6A 1Y9UA 1PDAA 1MXWA 3H4ZA 4OEVA 2F5XA 5TU0A 3JYRA 4IO7A 1ZMGA 3N6UA 2QS4A 1XVYA 1URGA 1UTHB 4H5GA 1FTLA 1IXHA 4XKRA 1GV8A 3W15C 1SDXA 3HHFA 2H9BA 4K3FA 4LA9A 1P99A 1LAGE 5HBCA 4C0RA 3OO9A 2H4IA 3CRBA 4N13A 3UP9A 4I1DA 3S4UA 2Z8EA 4F3SA 3ZSFA 3UK4A 5AA1A 1WVJA 4R72A 1PBPA 2RC8A 4HS7A 3PD8A 1FTOA 5CMMA 1TXFA 5BWJA 4P0IA 1R9QA 1IIWA 3RTWB 1S7YA 2QJEA 1H43A 3LUYA 1N76A 4ELPA 4GWOA 3N94A 1Y3NA 2ZNSA 3E13X 1B0LA 3IAZA 1OIBA 2XHDA 4GL0A 4MF3A 1PEBA 1LCTA 1QKBA 2XD2A 2Y7IA 2V25A 3IOVA 3MQ9A 1BIYA 1JW5A 3THIA 3H7MA 5KDTB 1O7TA 3Q26A 3S9MC 2F78A 3QK6A 1QVSA 3OXNA 2PX1A 4G8NA 2W7YA 4EF2A 3DP4A 1YPNA 4JB7A 3R6UA 1URSA 2I0BA 4OHNA 3QSLA 2RKMA 4U22A 3RLFE 3EN3A 1Y4TA 1RYOA 4R2FA 3FGSA 3P7IA 4YMAA 5TP9B 2F34A 1QUKA 2PVUA 4E0WA 2GFEA 2OWTA 1MRPA 1QUJA 3VDFA 4DCYA 4OEUA 3TAJA 1B6HA 4BDQA 4ELRA 4QFOA 4XTCQ 1P1UA 4HW8A 2ZXTA 3VLUA 2NUVA 4NF4A 2HXWA 3B7DA 2GRVA 4ELQA 1NH7A 1SVXB 4GXAA 3MBPA 4I9DA 4XIGQ 3IX1A 2RC7A 2D5WA 2PBWA 4MFIA 2D3IA 3CFZA 2O7IA 5ITOA 3WAEA 1XS5A 3FV2A 3GZGA 2XXVA 3O2AA 3IL1B 1O64A 4PFTA 1P1QA 2F6GA 1FTMA 1MDP1 5H8HB 2R9JA 1P1NA 1A8EA 1RKMA 3GLBA 4G68C 2E0SA 3HCQA 3Q28A 2NWJA 4HCWA 1R6ZA 2UYEA 1SI1A 2A5TA 1QW0A 1FTJA 1AOVA 2Y7RA 4BDNA 4FATA 3LSXA 1J1NA 5H8FB 3V8XB 1N84A 4ESWA 3KEIA 5LOMA 3TCHA 4L17A 4RK2A 2H98A 2RCBA 1O63A 3OEKA 4KYSA 4ZEBA 1Y3PA 1LB8A 3PPQA 1ANFA 3TTLA 1B5JA 4F3BA 4R74A 4U4SA 3CFLA 2Q88A 1MY0A 4R9FA 4QSCA 1N3WA 1US5A 1B51A 3EF7A 4FORA 4OERA 4E0XA 3KOSA 4DCXA 1FQDA 1NH8A 3D4GA 4OFLA 1Y1MA 5I57B 3I6VA 2VHAA 1MPCA 3K00A 2AYSA 5CMBA 3A3CA 5CM6A 3WAFA 2O51A 1MY2A 2XXWA 5KZTA 4Q0CA 2HFBA 4ESXA 2NXOA 4QF9A 2ANJA 1TT1A 1I69A 4F18A 3OSRA 3GBBA 4POWA 5I57A 3RTFB 4NMYA 2ALUA 1PC3A 3IOWA 3MVYA 1POY1 2DYXA 3RPWA 1QKAA 3TDJA 3HV1A 1YTVA 4TLLB 2QS2A 4RPNA 4LQ5A 5TPAA 3MVWA 2F8DA 4JWXA 1QULA 3KBRA 2QMXA 3TEPA 2ZYKA 3W9WA 2VP1A 5JTYB 1HSLA 4U1OA 3RY3A 3VLVA 4PETA 2WKYA 3Q25A 3RT8A 1VFEA 3TPAA 5ICTA 2NVUB 3FXUA 1NNFA 1LCFA 2PT1A 3K01A 2OJTA 1MQIA 5ITPA 5KCJA 1FQEA 3K0VA 1JNFA 1A55A 2OWSA 3TCGA 3MC2A 2UVIA 2RF1A 1OLAA 2B3FA 4IY5A 3SERA 4OTEA 3T9VA 4QHQA 4ZDMA 4NF8B 4G2ZA 4NWDA 3CG1A 4EQ9A 2XXUA 2O1LA 2H99A 3S9NC 3LSWA 3O29A 5H8NB 1VR5A 3S9LC 4Z0IA 1A54A 3QAXA 3CSBA 4YU0A 5I58B 1B7HA 4P11A 1MPBA 3FVNA 1LB9A 1T0KA 4XKQA 2DWIA 2Z8DA 3T9UA 3GBAA 3QXMA 1UIVA 3KZGA 1B9JA 1MXVA 2X7QA 1II5A 4EQ7A 3D4CA 3Q29A 4U4XA 4EQBA 1B5IA 2R71A 1D9VA 3KFMA 1OQGA 1TFAA 3T96B 5DEXA 3EHTA 1B7UA 1QUIA 3PV0E 4ZS9A 3EHSA 2DE2A 3FXRA 3IB0A 4RPOA 3H6UA 1ZTYA 4C1TA 4Q8RA 1XT8A 1MQJA 2G93A 3PPNA 3FUZA 3UGWA 4KI0E 4F1UA 2DWJA 2F7CA 2ZYOA 5A5XB 3RQTA 1JEVA 3C34A 3QUFA 4FIMA 5DTBA 3PU5A 2Z8FA 4IGRA 5K2XA 1TWYA 2O68A 1B52A 2DXYA 1N3XA 2AIXA 1OQHA 2V3TA 4R2BA 3G7WA 4KQPA 2DP8A 1FTKA 4F3PA 1Q1KA 4IO6A 1B7ZA 3TZAA 2I0CA 1L5TA 5L9OA 1B05A 3V5AA 1LAFE 4FJPA 5FTHA 1F9BA 2OLBA 3CSGA 2I48A 4DE8A 4F22A 1Z7NE 3PD9A 3BFTA 4O3AA 2VOZA 2FYIA 3ZS6A 4R75A 2DQVA 4M1VA 3ECRA 4YKIA 3TTKA 4G68B 1JEUA 3FVGA 4GRKA 2V3UA 4F1VA 1UTHA 2RC9A 3OSQA 4RY1A 5I59B 4U2RA 3DELB 3PPRA 3SKPA 3O9PA 4IO3A 1LAXA 3CFXA 4IB2A 3UA8A 1ZLQA 2CZLA 1QJMA 2ZYNA 3VLWA 5ISUA 1H44A 1B32A 3MP1A 1FW0A 5I56B 4F2OA 1EH3A 4G8MA 4MLQA 1SI0A 1IEJA 3G3HA 2YLNA 1EZOA 3U72A 3QYTA 2I4BA 4QFNA 1DPPA 1MM6A 3B6WA 1I6AA 5K2YA 4NF6B 3K6VA 4JSOA 2Y7KA 2P0SA 3N26A 1SQYA 3RT6B 3VE1B 4OFOA 3MPKA 1URDA 3C36A 3MW0A 3T9XB 2Q8JA 5H8QB 4QFLA 5KDTA 5FHMA 4BDLA 1H45A 1LFIA 1FQFA 1JVXA 2H5YA 3KSXA 4YMBA 3ILUB 4N6PA 2HZKA 4TQUQ 4ISUA 1MQDA 1B4ZA 4R6YA 2PYYA 1A99A 3JV9A 5HM4B 3C9HA 3A3UA 5TP9A 1AL3A 1B3LA 4JDFA 2QRYA 3FIRA 4LZ8A 1EZ9A 4G77A 3M3KA 1IZ1A 2Y84A 1ZU0A 2XXPA 3UIFA 1BKAA 4M4GA 5H8QA 3K1MA 2VD2A 3DP8A 1Y4CA 4X9TA 4QSEA 4OZ9A 1NNTA 2O1MA 1I6QA 2I6EA 4KR5A 5DVFA 4Q5TA 3O6GA 4YKPA 2GHAA 1B1HA 2XX8A 3IO4A 1B3HA 2REJA 4PFYA 5ELVA 3H3GA 4QFKA 4TLMB 2DS9A 2FNCA 2ZYMA 3IOUA 4YB6A 4LQ2A 3MWBA 2YPNA 3K2DA 2REGA 2DOJA 4GIZA 1OLCA 2OZZA 4ECFA 4FECA 4IO4A 2I3VA 5H8HA 4YICA 3DM0A 2PT2A 4H5FA 4WEPA 4GF8A 1NKXA 4GVOA 1MXXA 1MXYA 4ZEDA 3HHGA 1MXUA 3G3JA 4ZZEA 1A8FA 4IGTA 3T9HB 5EHSA 5H8FA 4MH5A 3KN3A 5CBRA 4YAHX 1AMFA 4QFPA 4YB7A 3SEXA 2Z22A 2ONRA 3EPEA 1XOCA 1FQAA 1B3FA 4QRZA 1DTZA 2DXRA 5AA2B 5AA3A 2BJJX 1MY3A 3OEMA 1UTBB 1LLSA 3TTMA 2UVGA 2FA7A 3T66A 3OMBA 1LFGA 1B1XA 2R6GE 3ZKKA 1MY1A 2HQ0A 4OMBA 1BTJA 4GL8A 1H3DA 4OYVA 3GXAA 4U21A 1XVXA 3H6VA 5AE4A 3V89B 3O6HA 3U1OA 1XHYA 3KGCA 2F97A 3IR1A 4O3CA 1UTBA 4QSDA 3TYHA 1DTGA 2XXQA 5DYHA 4X1DA 1ZKBA 1ZJLA 4OXVA 4AQ4A 3MP6A 3PPPA 2G29A 2DVCA 4RJZA 3M3FA 3FJ7A 4JSDA 4XKNA 1UQWA 5AA4B 3PGFA 4DXUA 1WDNA 4IO2A 1N7WA 1IUDA 4WKMA 1Y3QA 2H25A 1R9LA 2AL5A 4RK9A 3PUWE 4ZECA 1MXZA 5I2KB 1B0HA 1KWHA 1SYHA 3H06B 4BDRA 5F7VA 3ILTB 1N0TA 3MVZA 5JTYA 1LSTA 4NF5B 1LBBA 4R6HA 5I2NB 3L6HA 3IJXB 3KG2A 4UACA 2I49A 2Z23A 5CBSA 1USYH 2ZNUA 3TTRA 4POXA 3R26A 3EQ1A 4ZE9A 1RYXA 1IITA 4NE4A 3FVKA 4NTLA 2HAUA 3L6GA 2CMOA 3KN7A 4LONB 4PQJA 5CC2A 3TKDA 2AL4A 1MG1A 5L9MA 3QIMA 3B6QA 1S9TA 1VE4A 4NF8A 1IXGA 3UORA 1GTKA 1MH3A 1MM7A 2P1SA 3PMWA 4ZZAA 1DOTA 4OFJA 4LZ7A 5H8NA 1ZIUA 2Y7PA 4G8HA 4BLAA 1M5EA 3M3LA 3DLNA 4F29A 1POTA 3LC8A 2OBGA 5I58A 1LAHE 1ATGA 4GD5A 1BLFA 2O84X 3RNNA 1M5BA 3CI8A 1SW4A 2Q2AA 4Q30B 4DIGA 4ZE8A 3IK6B 4O3BA 2VD3A 1SW1A 5L8DA 2QS3A 3TCFA 1VFDA 3G3FA 4XKPA 4KCDA 3OENA 4G4PA 4ZEIA 5CI5A 4FAJA 3C33A 3VVFA 3K4UA 3ODBA 4THIA 1XC1A 1GVCA 1FCKA 3SEVA 1NFTA 3U8QA 3U93A 1NMUA 4H0WA 3OD7A 2Q2CA 2F7AA 4KFQA 4IO5A 5CRYA 1OVTA 1P1OA 3BFUA 2XXTA 3KJ7A 5A5XA 4KYDA 3TTNA 2XXYA 2O69A 3C35A 2Q9TA 3I3VA 4H67A 1R1NA 3H03A 4F1YA 5BUUA 2B65A 3FASA 3T93B 4HTGA 3KN8A 3USDA 3FATA 4GQOA 4H65A 3CR9A 4H8JA 3F11A 1N04A 1PB8A 3PMVA 2IEEA 3N5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GOT A;  3JZJ A;  4F2Q A;  4N07 A;  4U1Z A;  3K6U A;  4WED A;  2XXI A;  5CMK A;  3U92 A;  4OQO A;  1AH5 A;  3VXC A;  2Q89 A;  2UYF A;  1EU8 A;  1MDQ A;  1DSN A;  1JET A;  4G68 A;  1MQG A;  5EHM A;  4KYE A;  3OOA A;  2M8C A;  3HST A;  2XD3 A;  4DLD A;  3SES A;  3I5O A;  3VXB A;  3FZV A;  5I59 A;  2XXR A;  3FVO A;  2I4C A;  3SEY A;  4ZEK A;  2GH9 A;  5DVI A;  3MZ9 A;  3MVX A;  1ZBM A;  2ESN A;  4OES A;  3U94 A;  3MUQ A;  1M5F A;  3O6I A;  4TOZ A;  3R7X A;  4AB5 A;  4Z7E A;  1B4H A;  1US4 A;  2HZL A;  4NF4 B;  4R9G A;  3A09 A;  4BDO A;  1A7L A;  1JVY A;  4P0G A;  2GHB A;  3K6X A;  4OVJ A;  2ONK E;  5I56 A;  1MPD A;  1B5H A;  3K1N A;  1DPE A;  4FEB A;  1FQC A;  1MQH A;  3FJM A;  1LGB C;  1B40 A;  4PE5 B;  4H8I A;  1SBP A;  4JWO A;  3PPO A;  4C1U A;  2B3B A;  4KCC A;  4EXL A;  4NF6 A;  1YAE A;  4OET A;  1BP5 A;  3O28 A;  3KJT A;  3O97 A;  1IXI A;  2THI A;  1NL5 A;  3TEL A;  1N7X A;  1TFD A;  3TOD A;  4KHZ E;  2RIN A;  1SW5 A;  3T22 A;  1NNP A;  3SDF A;  3KOT A;  1Z7M E;  3Q27 A;  1B3E A;  3SET A;  2DE4 A;  2A5T B;  2QPQ A;  3EHU A;  3VVD A;  4R73 A;  3IB2 A;  5ICQ A;  4PP0 A;  2F7B A;  1MY4 A;  2UVJ A;  2DWH A;  1A40 A;  3LSF B;  3CVG A;  4YZZ A;  1JW1 A;  4LP2 B;  1HSE A;  4EXK A;  3ZKL A;  1OVB A;  4OEN A;  1D9Y A;  3MAM A;  2IA4 A;  5H8S A;  3E4R A;  3H6T A;  3OO8 A;  3RN8 A;  4MBP A;  3TMG A;  2ONS A;  4LZ5 A;  2F36 A;  4RA1 A;  1IQ7 A;  3C32 A;  2QL3 A;  2YJP A;  1B58 A;  3TUS A;  2UXA A;  1USY E;  4MLV A;  1P1W A;  5M2V A;  2F35 A;  4GFR A;  3QUJ A;  2DSF A;  3FD3 A;  4U23 A;  2XXH A;  3AXF A;  3W9V A;  2ZNT A;  1PBQ A;  1WOD A;  1B2H A;  1Y20 A;  3HPI A;  1DMB A;  4PFU A;  4FE8 A;  2X7P A;  1D4N A;  5DVJ A;  4EDP A;  2VGQ A;  3RUM A;  4NWC A;  2XX7 A;  4X48 A;  2P2A A;  3UN6 A;  3SEU A;  4R6K A;  4WXJ A;  1H76 A;  4LVQ A;  3LSL A;  3OEL A;  4RNS A;  4DXC A;  2V84 A;  4BDM A;  2I58 A;  2HEU A;  4NED A;  5FHN A;  3TQW A;  3S2V A;  1SD3 A;  4JBZ A;  1MS7 A;  2HAV A;  3IOR A;  3OO6 A;  2NOO A;  4GXS B;  3IO6 A;  2F6P A;  2DWA A;  5TPA B;  5FHO A;  3G3K A;  4YKK A;  3TQL A;  1EZP A;  5B7D A;  3IOT A;  1S50 A;  3M8U A;  3K1P A;  4LAT A;  2O7U A;  1NNK A;  3KSJ A;  3V83 A;  5AA2 A;  4YB5 A;  1LFH A;  2OCU A;  5CMC A;  4DDD A;  5KCJ B;  2QSX A;  4F3G A;  2RCA A;  3C4M A;  2ZMB A;  4KD5 A;  1PB7 A;  3MPL A;  5JK4 A;  4JWY A;  3G3I A;  4ZEF A;  1SW2 A;  4F31 B;  3S9E A;  1M5C A;  3B6T A;  3FJG A;  1IXC A;  1AIV A;  3RGY A;  1GR2 A;  2OK2 A;  3H6W A;  3BKI B;  4RXL A;  3ONM A;  4H1X A;  2A5S A;  4FED A;  1B3G A;  4RYA A;  4YKJ A;  3LBS A;  1CB6 A;  1UIU A;  3VFJ A;  3MZB A;  3IJO B;  4ELO A;  4EF1 A;  4KPT A;  3CIJ A;  3O66 A;  5DT6 A;  1FQB A;  4X1B A;  2QMW A;  1ELJ A;  1SYI A;  5HPQ A;  3E3K A;  4LUB A;  2X26 A;  3N6T A;  5EYF A;  2HCA A;  5AA2 D;  5I84 A;  4AB6 A;  1MH4 A;  4I8C A;  3BBR A;  5AA4 A;  4JXI A;  4F39 A;  5JEI A;  5DEX B;  5F1Q A;  3MZ1 A;  3G3G A;  4GLI A;  2QS1 A;  4F19 A;  2PMS A;  1JQF A;  3K02 A;  3PUV E;  4EUO A;  2I3W A;  3FXQ A;  1Y1Z A;  5I2K A;  2E1S A;  1I6B A;  4XXU A;  4UA8 A;  4NF5 A;  3PUY E;  3FV1 A;  1VSO A;  1B46 A;  5I2N A;  5IAI A;  3VVE A;  3IB1 A;  4OWD A;  2Y7W A;  2ABH A;  3E9X A;  2XX9 A;  2XXX A;  1GGG A;  1LBC A;  3PMX A;  5IKB A;  3K6W A;  3DP6 A;  3TFL A;  3C31 A;  4I62 A;  1M5D A;  3CG3 A;  1YCJ A;  5L9S A;  2DVZ A;  3OO7 A;  3LR1 A;  5B70 A;  2LAO A;  2UVH A;  4DZ1 A;  3MJN A;  3PUZ E;  5FTI A;  2D21 A;  2V3Q A;  1CE2 A;  1HSJ A;  3MP8 A;  4ONY A;  2O6A A;  5J1D A;  3HO7 A;  4ND9 A;  1JW4 A;  4PFW A;  1PB9 A;  2V93 A;  1OMP A;  1D3K A;  3PUX E;  4H6D A;  4HCY A;  3HN0 A;  1Q35 A;  2KLF A;  2DE3 A;  3VV5 A;  4DXB A;  3SEW A;  4IY6 A;  1Y9U A;  1PDA A;  1MXW A;  3H4Z A;  4OEV A;  2F5X A;  5TU0 A;  3JYR A;  4IO7 A;  1ZMG A;  3N6U A;  2QS4 A;  1XVY A;  1URG A;  1UTH B;  4H5G A;  1FTL A;  1IXH A;  4XKR A;  1GV8 A;  3W15 C;  1SDX A;  3HHF A;  2H9B A;  4K3F A;  4LA9 A;  1P99 A;  1LAG E;  5HBC A;  4C0R A;  3OO9 A;  2H4I A;  3CRB A;  4N13 A;  3UP9 A;  4I1D A;  3S4U A;  2Z8E A;  4F3S A;  3ZSF A;  3UK4 A;  5AA1 A;  1WVJ A;  4R72 A;  1PBP A;  2RC8 A;  4HS7 A;  3PD8 A;  1FTO A;  5CMM A;  1TXF A;  5BWJ A;  4P0I A;  1R9Q A;  1IIW A;  3RTW B;  1S7Y A;  2QJE A;  1H43 A;  3LUY A;  1N76 A;  4ELP A;  4GWO A;  3N94 A;  1Y3N A;  2ZNS A;  3E13 X;  1B0L A;  3IAZ A;  1OIB A;  2XHD A;  4GL0 A;  4MF3 A;  1PEB A;  1LCT A;  1QKB A;  2XD2 A;  2Y7I A;  2V25 A;  3IOV A;  3MQ9 A;  1BIY A;  1JW5 A;  3THI A;  3H7M A;  5KDT B;  1O7T A;  3Q26 A;  3S9M C;  2F78 A;  3QK6 A;  1QVS A;  3OXN A;  2PX1 A;  4G8N A;  2W7Y A;  4EF2 A;  3DP4 A;  1YPN A;  4JB7 A;  3R6U A;  1URS A;  2I0B A;  4OHN A;  3QSL A;  2RKM A;  4U22 A;  3RLF E;  3EN3 A;  1Y4T A;  1RYO A;  4R2F A;  3FGS A;  3P7I A;  4YMA A;  5TP9 B;  2F34 A;  1QUK A;  2PVU A;  4E0W A;  2GFE A;  2OWT A;  1MRP A;  1QUJ A;  3VDF A;  4DCY A;  4OEU A;  3TAJ A;  1B6H A;  4BDQ A;  4ELR A;  4QFO A;  4XTC Q;  1P1U A;  4HW8 A;  2ZXT A;  3VLU A;  2NUV A;  4NF4 A;  2HXW A;  3B7D A;  2GRV A;  4ELQ A;  1NH7 A;  1SVX B;  4GXA A;  3MBP A;  4I9D A;  4XIG Q;  3IX1 A;  2RC7 A;  2D5W A;  2PBW A;  4MFI A;  2D3I A;  3CFZ A;  2O7I A;  5ITO A;  3WAE A;  1XS5 A;  3FV2 A;  3GZG A;  2XXV A;  3O2A A;  3IL1 B;  1O64 A;  4PFT A;  1P1Q A;  2F6G A;  1FTM A;  1MDP 1;  5H8H B;  2R9J A;  1P1N A;  1A8E A;  1RKM A;  3GLB A;  4G68 C;  2E0S A;  3HCQ A;  3Q28 A;  2NWJ A;  4HCW A;  1R6Z A;  2UYE A;  1SI1 A;  2A5T A;  1QW0 A;  1FTJ A;  1AOV A;  2Y7R A;  4BDN A;  4FAT A;  3LSX A;  1J1N A;  5H8F B;  3V8X B;  1N84 A;  4ESW A;  3KEI A;  5LOM A;  3TCH A;  4L17 A;  4RK2 A;  2H98 A;  2RCB A;  1O63 A;  3OEK A;  4KYS A;  4ZEB A;  1Y3P A;  1LB8 A;  3PPQ A;  1ANF A;  3TTL A;  1B5J A;  4F3B A;  4R74 A;  4U4S A;  3CFL A;  2Q88 A;  1MY0 A;  4R9F A;  4QSC A;  1N3W A;  1US5 A;  1B51 A;  3EF7 A;  4FOR A;  4OER A;  4E0X A;  3KOS A;  4DCX A;  1FQD A;  1NH8 A;  3D4G A;  4OFL A;  1Y1M A;  5I57 B;  3I6V A;  2VHA A;  1MPC A;  3K00 A;  2AYS A;  5CMB A;  3A3C A;  5CM6 A;  3WAF A;  2O51 A;  1MY2 A;  2XXW A;  5KZT A;  4Q0C A;  2HFB A;  4ESX A;  2NXO A;  4QF9 A;  2ANJ A;  1TT1 A;  1I69 A;  4F18 A;  3OSR A;  3GBB A;  4POW A;  5I57 A;  3RTF B;  4NMY A;  2ALU A;  1PC3 A;  3IOW A;  3MVY A;  1POY 1;  2DYX A;  3RPW A;  1QKA A;  3TDJ A;  3HV1 A;  1YTV A;  4TLL B;  2QS2 A;  4RPN A;  4LQ5 A;  5TPA A;  3MVW A;  2F8D A;  4JWX A;  1QUL A;  3KBR A;  2QMX A;  3TEP A;  2ZYK A;  3W9W A;  2VP1 A;  5JTY B;  1HSL A;  4U1O A;  3RY3 A;  3VLV A;  4PET A;  2WKY A;  3Q25 A;  3RT8 A;  1VFE A;  3TPA A;  5ICT A;  2NVU B;  3FXU A;  1NNF A;  1LCF A;  2PT1 A;  3K01 A;  2OJT A;  1MQI A;  5ITP A;  5KCJ A;  1FQE A;  3K0V A;  1JNF A;  1A55 A;  2OWS A;  3TCG A;  3MC2 A;  2UVI A;  2RF1 A;  1OLA A;  2B3F A;  4IY5 A;  3SER A;  4OTE A;  3T9V A;  4QHQ A;  4ZDM A;  4NF8 B;  4G2Z A;  4NWD A;  3CG1 A;  4EQ9 A;  2XXU A;  2O1L A;  2H99 A;  3S9N C;  3LSW A;  3O29 A;  5H8N B;  1VR5 A;  3S9L C;  4Z0I A;  1A54 A;  3QAX A;  3CSB A;  4YU0 A;  5I58 B;  1B7H A;  4P11 A;  1MPB A;  3FVN A;  1LB9 A;  1T0K A;  4XKQ A;  2DWI A;  2Z8D A;  3T9U A;  3GBA A;  3QXM A;  1UIV A;  3KZG A;  1B9J A;  1MXV A;  2X7Q A;  1II5 A;  4EQ7 A;  3D4C A;  3Q29 A;  4U4X A;  4EQB A;  1B5I A;  2R71 A;  1D9V A;  3KFM A;  1OQG A;  1TFA A;  3T96 B;  5DEX A;  3EHT A;  1B7U A;  1QUI A;  3PV0 E;  4ZS9 A;  3EHS A;  2DE2 A;  3FXR A;  3IB0 A;  4RPO A;  3H6U A;  1ZTY A;  4C1T A;  4Q8R A;  1XT8 A;  1MQJ A;  2G93 A;  3PPN A;  3FUZ A;  3UGW A;  4KI0 E;  4F1U A;  2DWJ A;  2F7C A;  2ZYO A;  5A5X B;  3RQT A;  1JEV A;  3C34 A;  3QUF A;  4FIM A;  5DTB A;  3PU5 A;  2Z8F A;  4IGR A;  5K2X A;  1TWY A;  2O68 A;  1B52 A;  2DXY A;  1N3X A;  2AIX A;  1OQH A;  2V3T A;  4R2B A;  3G7W A;  4KQP A;  2DP8 A;  1FTK A;  4F3P A;  1Q1K A;  4IO6 A;  1B7Z A;  3TZA A;  2I0C A;  1L5T A;  5L9O A;  1B05 A;  3V5A A;  1LAF E;  4FJP A;  5FTH A;  1F9B A;  2OLB A;  3CSG A;  2I48 A;  4DE8 A;  4F22 A;  1Z7N E;  3PD9 A;  3BFT A;  4O3A A;  2VOZ A;  2FYI A;  3ZS6 A;  4R75 A;  2DQV A;  4M1V A;  3ECR A;  4YKI A;  3TTK A;  4G68 B;  1JEU A;  3FVG A;  4GRK A;  2V3U A;  4F1V A;  1UTH A;  2RC9 A;  3OSQ A;  4RY1 A;  5I59 B;  4U2R A;  3DEL B;  3PPR A;  3SKP A;  3O9P A;  4IO3 A;  1LAX A;  3CFX A;  4IB2 A;  3UA8 A;  1ZLQ A;  2CZL A;  1QJM A;  2ZYN A;  3VLW A;  5ISU A;  1H44 A;  1B32 A;  3MP1 A;  1FW0 A;  5I56 B;  4F2O A;  1EH3 A;  4G8M A;  4MLQ A;  1SI0 A;  1IEJ A;  3G3H A;  2YLN A;  1EZO A;  3U72 A;  3QYT A;  2I4B A;  4QFN A;  1DPP A;  1MM6 A;  3B6W A;  1I6A A;  5K2Y A;  4NF6 B;  3K6V A;  4JSO A;  2Y7K A;  2P0S A;  3N26 A;  1SQY A;  3RT6 B;  3VE1 B;  4OFO A;  3MPK A;  1URD A;  3C36 A;  3MW0 A;  3T9X B;  2Q8J A;  5H8Q B;  4QFL A;  5KDT A;  5FHM A;  4BDL A;  1H45 A;  1LFI A;  1FQF A;  1JVX A;  2H5Y A;  3KSX A;  4YMB A;  3ILU B;  4N6P A;  2HZK A;  4TQU Q;  4ISU A;  1MQD A;  1B4Z A;  4R6Y A;  2PYY A;  1A99 A;  3JV9 A;  5HM4 B;  3C9H A;  3A3U A;  5TP9 A;  1AL3 A;  1B3L A;  4JDF A;  2QRY A;  3FIR A;  4LZ8 A;  1EZ9 A;  4G77 A;  3M3K A;  1IZ1 A;  2Y84 A;  1ZU0 A;  2XXP A;  3UIF A;  1BKA A;  4M4G A;  5H8Q A;  3K1M A;  2VD2 A;  3DP8 A;  1Y4C A;  4X9T A;  4QSE A;  4OZ9 A;  1NNT A;  2O1M A;  1I6Q A;  2I6E A;  4KR5 A;  5DVF A;  4Q5T A;  3O6G A;  4YKP A;  2GHA A;  1B1H A;  2XX8 A;  3IO4 A;  1B3H A;  2REJ A;  4PFY A;  5ELV A;  3H3G A;  4QFK A;  4TLM B;  2DS9 A;  2FNC A;  2ZYM A;  3IOU A;  4YB6 A;  4LQ2 A;  3MWB A;  2YPN A;  3K2D A;  2REG A;  2DOJ A;  4GIZ A;  1OLC A;  2OZZ A;  4ECF A;  4FEC A;  4IO4 A;  2I3V A;  5H8H A;  4YIC A;  3DM0 A;  2PT2 A;  4H5F A;  4WEP A;  4GF8 A;  1NKX A;  4GVO A;  1MXX A;  1MXY A;  4ZED A;  3HHG A;  1MXU A;  3G3J A;  4ZZE A;  1A8F A;  4IGT A;  3T9H B;  5EHS A;  5H8F A;  4MH5 A;  3KN3 A;  5CBR A;  4YAH X;  1AMF A;  4QFP A;  4YB7 A;  3SEX A;  2Z22 A;  2ONR A;  3EPE A;  1XOC A;  1FQA A;  1B3F A;  4QRZ A;  1DTZ A;  2DXR A;  5AA2 B;  5AA3 A;  2BJJ X;  1MY3 A;  3OEM A;  1UTB B;  1LLS A;  3TTM A;  2UVG A;  2FA7 A;  3T66 A;  3OMB A;  1LFG A;  1B1X A;  2R6G E;  3ZKK A;  1MY1 A;  2HQ0 A;  4OMB A;  1BTJ A;  4GL8 A;  1H3D A;  4OYV A;  3GXA A;  4U21 A;  1XVX A;  3H6V A;  5AE4 A;  3V89 B;  3O6H A;  3U1O A;  1XHY A;  3KGC A;  2F97 A;  3IR1 A;  4O3C A;  1UTB A;  4QSD A;  3TYH A;  1DTG A;  2XXQ A;  5DYH A;  4X1D A;  1ZKB A;  1ZJL A;  4OXV A;  4AQ4 A;  3MP6 A;  3PPP A;  2G29 A;  2DVC A;  4RJZ A;  3M3F A;  3FJ7 A;  4JSD A;  4XKN A;  1UQW A;  5AA4 B;  3PGF A;  4DXU A;  1WDN A;  4IO2 A;  1N7W A;  1IUD A;  4WKM A;  1Y3Q A;  2H25 A;  1R9L A;  2AL5 A;  4RK9 A;  3PUW E;  4ZEC A;  1MXZ A;  5I2K B;  1B0H A;  1KWH A;  1SYH A;  3H06 B;  4BDR A;  5F7V A;  3ILT B;  1N0T A;  3MVZ A;  5JTY A;  1LST A;  4NF5 B;  1LBB A;  4R6H A;  5I2N B;  3L6H A;  3IJX B;  3KG2 A;  4UAC A;  2I49 A;  2Z23 A;  5CBS A;  1USY H;  2ZNU A;  3TTR A;  4POX A;  3R26 A;  3EQ1 A;  4ZE9 A;  1RYX A;  1IIT A;  4NE4 A;  3FVK A;  4NTL A;  2HAU A;  3L6G A;  2CMO A;  3KN7 A;  4LON B;  4PQJ A;  5CC2 A;  3TKD A;  2AL4 A;  1MG1 A;  5L9M A;  3QIM A;  3B6Q A;  1S9T A;  1VE4 A;  4NF8 A;  1IXG A;  3UOR A;  1GTK A;  1MH3 A;  1MM7 A;  2P1S A;  3PMW A;  4ZZA A;  1DOT A;  4OFJ A;  4LZ7 A;  5H8N A;  1ZIU A;  2Y7P A;  4G8H A;  4BLA A;  1M5E A;  3M3L A;  3DLN A;  4F29 A;  1POT A;  3LC8 A;  2OBG A;  5I58 A;  1LAH E;  1ATG A;  4GD5 A;  1BLF A;  2O84 X;  3RNN A;  1M5B A;  3CI8 A;  1SW4 A;  2Q2A A;  4Q30 B;  4DIG A;  4ZE8 A;  3IK6 B;  4O3B A;  2VD3 A;  1SW1 A;  5L8D A;  2QS3 A;  3TCF A;  1VFD A;  3G3F A;  4XKP A;  4KCD A;  3OEN A;  4G4P A;  4ZEI A;  5CI5 A;  4FAJ A;  3C33 A;  3VVF A;  3K4U A;  3ODB A;  4THI A;  1XC1 A;  1GVC A;  1FCK A;  3SEV A;  1NFT A;  3U8Q A;  3U93 A;  1NMU A;  4H0W A;  3OD7 A;  2Q2C A;  2F7A A;  4KFQ A;  4IO5 A;  5CRY A;  1OVT A;  1P1O A;  3BFU A;  2XXT A;  3KJ7 A;  5A5X A;  4KYD A;  3TTN A;  2XXY A;  2O69 A;  3C35 A;  2Q9T A;  3I3V A;  4H67 A;  1R1N A;  3H03 A;  4F1Y A;  5BUU A;  2B65 A;  3FAS A;  3T93 B;  4HTG A;  3KN8 A;  3USD A;  3FAT A;  4GQO A;  4H65 A;  3CR9 A;  4H8J A;  3F11 A;  1N04 A;  1PB8 A;  3PMV A;  2IEE A;  3N5L A; 
#chains in the Genus database with same CATH topology
 4GOT A;  3JZJ A;  4F2Q A;  4N07 A;  4U1Z A;  4N17 A;  3K6U A;  4GX4 A;  4WED A;  2MKZ A;  2XXI A;  5CMK A;  3A29 A;  3U92 A;  4OQO A;  1NV7 A;  1AH5 A;  3VXC A;  2Q89 A;  2UYF A;  1K9Z A;  1EU8 A;  1MDQ A;  1DSN A;  1JET A;  4G68 A;  2PCR A;  1MQG A;  5EHM A;  4KYE A;  2R8T A;  3OOA A;  2M8C A;  3HST A;  2XD3 A;  4JVC A;  4DLD A;  4PCD A;  3SES A;  4QXD A;  4MEV A;  3I5O A;  3VXB A;  1NV3 A;  3FZV A;  4X04 A;  5I59 A;  4NG7 A;  2XXR A;  3FVO A;  2I4C A;  4PAF A;  3SEY A;  4ZEK A;  2GH9 A;  5DVI A;  3MZ9 A;  3MVX A;  1ZBM A;  2ESN A;  4OES A;  3U94 A;  3MUQ A;  1M5F A;  4PF8 A;  3O6I A;  4TOZ A;  3R7X A;  4AB5 A;  4Z7E A;  1B4H A;  1FBC A;  1US4 A;  2HZL A;  4NF4 B;  1NV0 A;  1Q9D A;  3QMF A;  4R9G A;  3A09 A;  4BDO A;  3KC0 A;  1A7L A;  1NUY A;  1IMB A;  1JVY A;  4P0G A;  2GHB A;  3K6X A;  4OVJ A;  2ONK E;  1NV5 A;  5I56 A;  4OVS A;  1MPD A;  1B5H A;  3K1N A;  1DPE A;  4FEB A;  1FQC A;  1MQH A;  3FJM A;  1LGB C;  2VPN A;  5ET7 A;  1B40 A;  4PE5 B;  4H8I A;  1SBP A;  4JWO A;  3PPO A;  4C1U A;  4N6D A;  2B3B A;  4KCC A;  4EXL A;  4NF6 A;  1YAE A;  4OET A;  1BP5 A;  3O28 A;  3KJT A;  4OVQ A;  4GBV A;  3O97 A;  1IXI A;  2THI A;  1NL5 A;  3TEL A;  1N7X A;  1TFD A;  3TOD A;  4KHZ E;  2RIN A;  1SW5 A;  4I3Y A;  3T22 A;  1NNP A;  1LBV A;  3SDF A;  3KOT A;  1Z7M E;  3Q27 A;  1B3E A;  3SET A;  2DE4 A;  2A5T B;  2QPQ A;  3EHU A;  3VVD A;  2OX3 A;  4PF6 A;  4R73 A;  3IB2 A;  5ICQ A;  4PP0 A;  2F7B A;  1MY4 A;  2UVJ A;  2DWH A;  1A40 A;  3FBP A;  3CVG A;  3LSF B;  4YZZ A;  1JW1 A;  4LP2 B;  4NX1 A;  1HSE A;  4EXK A;  3ZKL A;  1OVB A;  4OEN A;  1D9Y A;  3MAM A;  4O7I A;  2IA4 A;  5H8S A;  3E4R A;  3NOH A;  3H6T A;  3OO8 A;  3RN8 A;  2WX9 A;  4MBP A;  3TMG A;  4QBA A;  1FRP A;  2ONS A;  4LZ5 A;  3MYU A;  2F36 A;  4RA1 A;  1IQ7 A;  3C32 A;  2QL3 A;  2YJP A;  4P9K A;  1B58 A;  3TUS A;  2UXA A;  3T0J A;  1USY E;  4MLV A;  2PFY A;  1P1W A;  5M2V A;  2F35 A;  2HPG A;  4GFR A;  3QUJ A;  2DSF A;  3RYD A;  3FD3 A;  4U23 A;  2XXH A;  3AXF A;  4KXP A;  3W9V A;  2ZNT A;  1PBQ A;  1KA1 A;  1WOD A;  1B2H A;  1Y20 A;  2P3N A;  3B8B A;  3HPI A;  1DMB A;  4PFU A;  4FE8 A;  2X7P A;  1D4N A;  5DVJ A;  4MNC A;  4EDP A;  2VGQ A;  1FPK A;  3RUM A;  4NWC A;  2XX7 A;  4X48 A;  1DBZ A;  2P2A A;  3UN6 A;  3SEU A;  4R6K A;  4WXJ A;  1H76 A;  4LVQ A;  3LSL A;  4JVI A;  3OEL A;  2FIE A;  4RNS A;  4DXC A;  2V84 A;  4BDM A;  2I58 A;  2HEU A;  4NED A;  5FHN A;  3TQW A;  3S2V A;  1SD3 A;  5FBP A;  4JBZ A;  1MS7 A;  2HAV A;  3IOR A;  3OO6 A;  2NOO A;  4GXS B;  3IO6 A;  2F6P A;  2DWA A;  5TPA B;  5FHO A;  3G3K A;  4GWS A;  4YKK A;  3TQL A;  1EZP A;  5B7D A;  3IOT A;  1FPE A;  1S50 A;  3M8U A;  3K1P A;  4LAT A;  5EYH A;  2O7U A;  4PAI A;  1NNK A;  3KSJ A;  2XWO A;  3V83 A;  5AA2 A;  4YB5 A;  1LFH A;  2OCU A;  5CMC A;  4DDD A;  5KCJ B;  2QSX A;  4F3G A;  2RCA A;  3C4M A;  2ZMB A;  4XEQ A;  4KD5 A;  4NHB A;  1PB7 A;  3MPL A;  5JK4 A;  1IME A;  4JWY A;  3G3I A;  4ZEF A;  1SW2 A;  4F31 B;  3S9E A;  1M5C A;  1FPG A;  3B6T A;  3FJG A;  1IXC A;  1AIV A;  4MNI A;  3RGY A;  1GR2 A;  2OK2 A;  3H6W A;  3BKI B;  4RXL A;  3ONM A;  4H1X A;  2A5S A;  4FED A;  5EQ8 A;  1B3G A;  4RYA A;  4YKJ A;  3LBS A;  3PTY A;  1CB6 A;  1UIU A;  3VFJ A;  3MZB A;  3IJO B;  4ELO A;  4EF1 A;  1NV2 A;  4KPT A;  3CIJ A;  3O66 A;  5DT6 A;  1FQB A;  4X1B A;  2QMW A;  1ELJ A;  1SYI A;  5HPQ A;  3E3K A;  4I3E A;  4G61 A;  4LUB A;  2X26 A;  3N6T A;  5EYF A;  2HCA A;  4OA4 A;  5AA2 D;  5I84 A;  1FBH A;  4AB6 A;  1MH4 A;  4I8C A;  5LTC A;  3BBR A;  5AA4 A;  4GX6 A;  4JXI A;  4F39 A;  5JEI A;  5DEX B;  5F1Q A;  3MZ1 A;  3G3G A;  4GLI A;  2QS1 A;  3T1B A;  4F19 A;  2PMS A;  1JQF A;  1NV6 A;  3K02 A;  4IR8 A;  3PUV E;  4EUO A;  3BIH A;  2I3W A;  3FXQ A;  1Y1Z A;  5I2K A;  2E1S A;  1I6B A;  3SZP A;  4XXU A;  4UA8 A;  4NF5 A;  3PUY E;  3FV1 A;  1VSO A;  1B46 A;  5I2N A;  1DK4 A;  5IAI A;  1EYK A;  3VVE A;  3IB1 A;  5IGA A;  4OWD A;  2Y7W A;  2ABH A;  4MMP A;  3E9X A;  2XX9 A;  2XXX A;  4N8G A;  1GGG A;  1LBC A;  3PMX A;  5IKB A;  3K6W A;  3DP6 A;  3TFL A;  3C31 A;  4I62 A;  1M5D A;  3CG3 A;  1YCJ A;  5L9S A;  2DVZ A;  3OO7 A;  3LR1 A;  5B70 A;  2LAO A;  2UVH A;  4DZ1 A;  3MJN A;  1FJ9 A;  3PUZ E;  5FTI A;  2D21 A;  2V3Q A;  1SPI A;  1CE2 A;  1HSJ A;  3MP8 A;  5IZ1 A;  4ONY A;  2O6A A;  5J1D A;  3RPL B;  3HO7 A;  4ND9 A;  1JW4 A;  4PFW A;  1FSA A;  1PB9 A;  2V93 A;  2Q8M A;  4PBQ A;  2B4M A;  1OMP A;  3BIG A;  1D3K A;  3PUX E;  4H46 A;  4PDH A;  4H6D A;  4HCY A;  3HN0 A;  1Q35 A;  2KLF A;  2DE3 A;  3VV5 A;  4DXB A;  3SEW A;  4IY6 A;  1Y9U A;  4MAG A;  1PDA A;  1MXW A;  2QVU A;  3H4Z A;  4OEV A;  2F5X A;  5TU0 A;  3JYR A;  4IO7 A;  1ZMG A;  3N6U A;  2QS4 A;  1XVY A;  2WBD A;  1URG A;  1UTH B;  2CZI A;  2Y5L A;  4H5G A;  2WBB A;  1FTL A;  1IXH A;  4XKR A;  1INP A;  1GV8 A;  3W15 C;  1SDX A;  3HHF A;  2H9B A;  4K3F A;  4LA9 A;  1P99 A;  4H45 A;  1LAG E;  2BJI A;  2WYP A;  5HBC A;  4C0R A;  3OO9 A;  2H4I A;  3CRB A;  4N13 A;  3UP9 A;  4I1D A;  2F3D A;  3S4U A;  2Z8E A;  4F3S A;  3ZSF A;  3UK4 A;  2Q74 A;  5AA1 A;  4PFB A;  1WVJ A;  4R72 A;  1PBP A;  2RC8 A;  4HS7 A;  3PD8 A;  1FTO A;  5CMM A;  1TXF A;  5BWJ A;  4P0I A;  1R9Q A;  1IIW A;  3RTW B;  1S7Y A;  2QJE A;  1LEV A;  1H43 A;  5EQ7 A;  3LUY A;  1N76 A;  4ELP A;  4GWO A;  3N94 A;  1Y3N A;  2ZNS A;  4OAN A;  3E13 X;  1B0L A;  1FJ6 A;  3IAZ A;  2FBP A;  1IMF A;  4HE2 A;  1OIB A;  2XHD A;  4GL0 A;  4MF3 A;  1PEB A;  1LCT A;  1QKB A;  2XD2 A;  2Y7I A;  4HE0 A;  2V25 A;  3IOV A;  3MQ9 A;  1BIY A;  1JW5 A;  3THI A;  2FVZ A;  1FBG A;  1IMD A;  3H7M A;  5KDT B;  1O7T A;  3Q26 A;  1NV4 A;  3S9M C;  2F78 A;  3QK6 A;  1QVS A;  3OXN A;  2PX1 A;  4G8N A;  2W7Y A;  4EF2 A;  3DP4 A;  1YPN A;  4JB7 A;  1KA0 A;  3R6U A;  1URS A;  2I0B A;  4OHN A;  3QSL A;  1EYI A;  2RKM A;  4U22 A;  3RLF E;  3EN3 A;  1Y4T A;  1RYO A;  4R2F A;  3FGS A;  3P7I A;  4OVP A;  4YMA A;  5TP9 B;  2F34 A;  1QUK A;  2PVU A;  2CEX A;  4E0W A;  2GFE A;  2OWT A;  1MRP A;  1QUJ A;  4OVT A;  3VDF A;  4DCY A;  4OEU A;  3TAJ A;  1B6H A;  4BDQ A;  4ELR A;  4QFO A;  4XTC Q;  1FTA A;  1P1U A;  4HW8 A;  2ZXT A;  3VLU A;  2NUV A;  4NF4 A;  2HXW A;  3B7D A;  2GRV A;  1LBY A;  4ELQ A;  1NH7 A;  4DI3 D;  1SVX B;  4GXA A;  3MBP A;  4I9D A;  4XIG Q;  3IX1 A;  4P8B A;  2RC7 A;  2D5W A;  2PBW A;  4MFI A;  2D3I A;  3CFZ A;  2HXR A;  2O7I A;  5ITO A;  3WAE A;  1XS5 A;  3FV2 A;  3GZG A;  2XXV A;  3O2A A;  2QVR A;  3IL1 B;  4PDD A;  1O64 A;  4PFT A;  1FBP A;  4I40 A;  5J16 A;  1P1Q A;  2F6G A;  1FTM A;  1MDP 1;  5H8H B;  3E79 A;  1BK4 A;  2R9J A;  1P1N A;  1A8E A;  1RKM A;  3GLB A;  4G68 C;  1FPI A;  2KR0 A;  2E0S A;  3HCQ A;  3Q28 A;  2NWJ A;  4HCW A;  4O94 A;  1R6Z A;  2UYE A;  1SI1 A;  2A5T A;  1QW0 A;  1FTJ A;  1AOV A;  2Y7R A;  1NUZ A;  4BDN A;  4FAT A;  3LSX A;  1J1N A;  5H8F B;  4MX6 A;  3V8X B;  4N8Y A;  1N84 A;  4ESW A;  3KEI A;  5LOM A;  3TCH A;  4L17 A;  4RK2 A;  2H98 A;  2RCB A;  1O63 A;  3OEK A;  4KYS A;  4ZEB A;  1Y3P A;  1LB8 A;  3PPQ A;  1ANF A;  3LUZ A;  3TTL A;  1B5J A;  4R74 A;  4U4S A;  4F3B A;  3CFL A;  2Q88 A;  1MY0 A;  4R9F A;  4QSC A;  1N3W A;  4NF0 A;  2CEY A;  1US5 A;  1B51 A;  1FPF A;  1YZ0 A;  3EF7 A;  4FOR A;  4OER A;  4E0X A;  3KOS A;  4DCX A;  1FQD A;  2CZH A;  1NH8 A;  3D4G A;  4OFL A;  4PTK A;  1Y1M A;  5I57 B;  3I6V A;  2VHA A;  1MPC A;  3K00 A;  2AYS A;  2WEF A;  5CMB A;  3A3C A;  5CM6 A;  3WAF A;  2O51 A;  4PGN A;  1AWB A;  1MY2 A;  2XXW A;  5KZT A;  2WYK A;  3IFC A;  4P1E A;  4Q0C A;  2HFB A;  4ESX A;  2NXO A;  4QF9 A;  2ANJ A;  1TT1 A;  1FPL A;  1I69 A;  4F18 A;  4O7M A;  3OSR A;  3GBB A;  1KZ8 A;  4POW A;  4XF5 A;  5I57 A;  3RTF B;  4NMY A;  2ALU A;  1PC3 A;  3IOW A;  3MVY A;  1POY 1;  2DYX A;  2Y5K A;  3RPW A;  1QKA A;  3TDJ A;  3HV1 A;  1YTV A;  4TLL B;  2QS2 A;  4RPN A;  4LQ5 A;  4NN3 A;  4P1L A;  2JJK A;  4PAK A;  5TPA A;  2V4C A;  3MVW A;  2F8D A;  4JWX A;  1QUL A;  3KBR A;  2QMX A;  3TEP A;  2ZYK A;  3W9W A;  2VP1 A;  5JTY B;  1HSL A;  1RDZ A;  4U1O A;  3RY3 A;  3VLV A;  4PET A;  2WKY A;  3Q25 A;  3RT8 A;  1VFE A;  2FHY A;  3TPA A;  5ICT A;  2NVU B;  3FXU A;  2ZZX A;  2PFZ A;  1NNF A;  1LCF A;  4UAB A;  2PT1 A;  3K01 A;  2OJT A;  4MNP A;  1MQI A;  5ITP A;  4GX3 A;  5KCJ A;  3IFA A;  1FQE A;  1LBX A;  5IZ3 B;  3K0V A;  1JNF A;  1A55 A;  4NAP A;  2OWS A;  3TCG A;  3MC2 A;  5ESY A;  1IMA A;  2RF1 A;  2UVI A;  1OLA A;  2B3F A;  4IY5 A;  3SER A;  1LBW A;  4OTE A;  4GWX A;  3T9V A;  4QHQ A;  4ZDM A;  4NF8 B;  4G2Z A;  4NWD A;  3CG1 A;  4EQ9 A;  2XXU A;  2O1L A;  4HE1 A;  2H99 A;  3LV0 A;  3LSW A;  3O29 A;  3S9N C;  5H8N B;  1VR5 A;  3S9L C;  4Z0I A;  1A54 A;  3QAX A;  3CSB A;  4YU0 A;  4PFI A;  5I58 B;  1B7H A;  4P11 A;  5I7I A;  1MPB A;  4N81 A;  4PC9 A;  3FVN A;  1LB9 A;  1T0K A;  4XKQ A;  2DWI A;  2Z8D A;  3T9U A;  2XA5 A;  3GBA A;  3QXM A;  1UIV A;  4NQ8 A;  3KZG A;  1B9J A;  1MXV A;  4O8M A;  2X7Q A;  1II5 A;  4EQ7 A;  4PE3 A;  5T3J A;  3D4C A;  3Q29 A;  4U4X A;  4EQB A;  1B5I A;  2R71 A;  1D9V A;  3KFM A;  1OQG A;  1TFA A;  3T96 B;  5DEX A;  3EHT A;  1B7U A;  1QUI A;  4N6K A;  3PV0 E;  4ZS9 A;  3EHS A;  2DE2 A;  3FXR A;  4PBH A;  3IB0 A;  4RPO A;  3H6U A;  3KBZ A;  1ZTY A;  4C1T A;  4Q8R A;  1XT8 A;  1VDW A;  1MQJ A;  2G93 A;  3PPN A;  3FUZ A;  3UGW A;  4KI0 E;  4F1U A;  2DWJ A;  2F7C A;  2GQ1 A;  2ZYO A;  5A5X B;  1FPD A;  2XXK A;  3RQT A;  1JEV A;  3C34 A;  3QUF A;  4FIM A;  5DTB A;  2HHM A;  3PU5 A;  2Z8F A;  4IGR A;  1RDY A;  5K2X A;  1TWY A;  1FBD A;  2O68 A;  1B52 A;  2DXY A;  1N3X A;  2AIX A;  5EQA A;  1OQH A;  2V3T A;  4R2B A;  3G7W A;  4KQP A;  2DP8 A;  4MIJ A;  1FTK A;  4F3P A;  1Q1K A;  3RPL A;  4IO6 A;  1B7Z A;  3TZA A;  2I0C A;  1L5T A;  5L9O A;  1B05 A;  3V5A A;  1NUX A;  1LAF E;  2KQZ A;  4FJP A;  4OVR A;  1FPB A;  5FTH A;  1F9B A;  2OLB A;  3CSG A;  2I48 A;  4DE8 A;  1G0I A;  4F22 A;  2FIX A;  1Z7N E;  2QVV A;  3PD9 A;  3BFT A;  4O3A A;  2VOZ A;  2FYI A;  3ZS6 A;  4R75 A;  2DQV A;  4M1V A;  3ECR A;  4YKI A;  3TTK A;  4G68 B;  1JEU A;  3FVG A;  4GRK A;  2V3U A;  4F1V A;  1UTH A;  2RC9 A;  3OSQ A;  4RY1 A;  5I59 B;  4U2R A;  3DEL B;  4P47 A;  3PPR A;  3SKP A;  4GWZ A;  3O9P A;  4IO3 A;  1LAX A;  3CFX A;  4IB2 A;  3UA8 A;  1FPJ A;  4MHF A;  4XFE A;  1ZLQ A;  2CZL A;  1QJM A;  2ZYN A;  3VLW A;  5ISU A;  1H44 A;  5I3S A;  1B32 A;  3MP1 A;  1FW0 A;  5I56 B;  4F2O A;  1EH3 A;  4G8M A;  4MLQ A;  1SI0 A;  1IEJ A;  3G3H A;  2YLN A;  1EZO A;  3U72 A;  3QYT A;  2I4B A;  4QFN A;  1DPP A;  1MM6 A;  3B6W A;  4AS5 A;  1I6A A;  1G0H A;  5K2Y A;  4NF6 B;  3K6V A;  4JSO A;  2Y7K A;  2P0S A;  3N26 A;  1SQY A;  3RT6 B;  3VE1 B;  4OFO A;  4DI4 B;  4N15 A;  3MPK A;  1URD A;  3C36 A;  2F3B A;  3MW0 A;  3HFU A;  1EYJ A;  3T9X B;  3U65 A;  2Q8J A;  5H8Q B;  4QFL A;  5KDT A;  5FHM A;  4BDL A;  1H45 A;  1LFI A;  1FQF A;  1JVX A;  2H5Y A;  3KSX A;  5DW8 A;  4P3L A;  4YMB A;  3ILU B;  4N6P A;  2HZK A;  4TQU Q;  1FBF A;  4ISU A;  5EYG A;  1JP4 A;  1MQD A;  1B4Z A;  4R6Y A;  2PYY A;  2ZZW A;  1A99 A;  3JV9 A;  3FXB A;  5HM4 B;  2XWV A;  3C9H A;  3A3U A;  5TP9 A;  1AL3 A;  1B3L A;  4JDF A;  2QRY A;  3FIR A;  4LZ8 A;  1IMC A;  1EZ9 A;  2OWZ A;  3KC1 A;  4G77 A;  3M3K A;  1IZ1 A;  2Y84 A;  1ZU0 A;  2XXP A;  3UIF A;  1BKA A;  4M4G A;  5H8Q A;  3K1M A;  2VD2 A;  4JVD A;  3DP8 A;  1Y4C A;  4X9T A;  4QSE A;  4OZ9 A;  1NNT A;  2O1M A;  1I6Q A;  2I6E A;  4FBP A;  4KR5 A;  5DVF A;  4Q5T A;  3O6G A;  4YKP A;  1XI6 A;  2GHA A;  1B1H A;  2XX8 A;  3IO4 A;  1B3H A;  2REJ A;  2B4L A;  5IM2 A;  4PFY A;  5ELV A;  3H3G A;  4QFK A;  2CZK A;  4TLM B;  3ROJ A;  2DS9 A;  2FNC A;  2ZYM A;  1NUW A;  3IOU A;  4YB6 A;  4LQ2 A;  2XWK A;  3MWB A;  2YPN A;  3K2D A;  2REG A;  2DOJ A;  5ET5 A;  4GIZ A;  1OLC A;  2OZZ A;  4ECF A;  4FEC A;  4IO4 A;  2I3V A;  4NGU A;  5H8H A;  5A5L A;  4YIC A;  3DM0 A;  2PT2 A;  4H5F A;  1CNQ A;  4WEP A;  4GF8 A;  1NKX A;  4GVO A;  1MXX A;  4MJO A;  1MXY A;  4ZED A;  3HHG A;  4GWW A;  1MXU A;  3G3J A;  4ZZE A;  1A8F A;  4IGT A;  3T9H B;  5EHS A;  5H8F A;  4MH5 A;  3KN3 A;  4GWY A;  5CBR A;  4YAH X;  1AMF A;  4QFP A;  4YB7 A;  3SEX A;  2Z22 A;  2ONR A;  3EPE A;  1XOC A;  1FQA A;  1B3F A;  4QRZ A;  2L5V A;  5IZZ A;  3ISP A;  1DTZ A;  2ZZV A;  2DXR A;  5AA2 B;  5AA3 A;  2BJJ X;  1MY3 A;  3OEM A;  1UTB B;  4MCO A;  1LLS A;  3TTM A;  2UVG A;  4N4U A;  2FA7 A;  3T66 A;  3OMB A;  1LFG A;  1B1X A;  2R6G E;  3B50 A;  3ZKK A;  1MY1 A;  2HQ0 A;  4OMB A;  1BTJ A;  4GL8 A;  1H3D A;  4OYV A;  3GXA A;  4U21 A;  1XVX A;  3H6V A;  5AE4 A;  3EKI A;  3V89 B;  3O6H A;  3U1O A;  1XHY A;  5I5P A;  3KGC A;  4N91 A;  2F97 A;  3IR1 A;  4O3C A;  1UTB A;  4QSD A;  3TYH A;  1DTG A;  2XXQ A;  5DYH A;  4X1D A;  1ZKB A;  1ZJL A;  4OXV A;  4AQ4 A;  3MP6 A;  3PPP A;  2G29 A;  2DVC A;  4RJZ A;  3M3F A;  3FJ7 A;  2DDK A;  4JSD A;  5EQ9 A;  4XKN A;  1UQW A;  3E78 A;  5AA4 B;  3PGF A;  4DXU A;  1WDN A;  4IO2 A;  1N7W A;  4GWU A;  1IUD A;  4WKM A;  2QFL A;  1Y3Q A;  2H25 A;  1R9L A;  2AL5 A;  4RK9 A;  3PUW E;  4ZEC A;  1MXZ A;  5I2K B;  1B0H A;  1KWH A;  1SYH A;  3H06 B;  4BDR A;  5F7V A;  3ILT B;  1N0T A;  3MVZ A;  5F24 A;  5JTY A;  3GYY A;  1LST A;  4NF5 B;  1LBB A;  4R6H A;  5I2N B;  3L6H A;  3IJX B;  3KG2 A;  4UAC A;  4PGP A;  1YYZ A;  2I49 A;  2Z23 A;  5CBS A;  1USY H;  2ZNU A;  2VT5 A;  3TTR A;  4POX A;  3R26 A;  3EQ1 A;  1LBZ A;  1RDX A;  4ZE9 A;  1RYX A;  5IZ3 A;  1IIT A;  4NE4 A;  3FVK A;  4NTL A;  2HAU A;  3L6G A;  2CMO A;  3CHG A;  3KN7 A;  4LON B;  4PQJ A;  5CC2 A;  3TKD A;  2AL4 A;  1MG1 A;  5L9M A;  3QIM A;  4LN5 A;  3B6Q A;  1S9T A;  3MST A;  1VE4 A;  4NF8 A;  1IXG A;  1GTK A;  1MH3 A;  1MM7 A;  2P1S A;  3PMW A;  3UOR A;  4ZZA A;  1DOT A;  4OFJ A;  1K9Y A;  4LZ7 A;  5ET6 A;  1ZIU A;  2Y7P A;  4G8H A;  5H8N A;  4BLA A;  1M5E A;  3M3L A;  3DLN A;  1YXI A;  4F29 A;  1POT A;  3LC8 A;  2OBG A;  5I58 A;  1LAH E;  4HXV A;  1ATG A;  1DCU A;  4GD5 A;  1BLF A;  4PFR A;  2O84 X;  2VPO A;  3RNN A;  1M5B A;  3CI8 A;  1SW4 A;  2Q2A A;  4Q30 B;  4DIG A;  4ZE8 A;  4AS4 A;  3IK6 B;  4O3B A;  2VD3 A;  1SW1 A;  5L8D A;  1NI9 A;  2QS3 A;  3TCF A;  1VFD A;  3G3F A;  4XKP A;  4KCD A;  3OEN A;  4G4P A;  4ZEI A;  5CI5 A;  4FAJ A;  1QGX A;  3C33 A;  3VVF A;  3K4U A;  3ODB A;  4THI A;  1XC1 A;  1GVC A;  1FCK A;  3SEV A;  1NFT A;  3U8Q A;  4P56 A;  4X8R A;  3U93 A;  1NMU A;  4H0W A;  3OD7 A;  2Q2C A;  2F7A A;  4KFQ A;  4IO5 A;  5CRY A;  1OVT A;  1P1O A;  3BFU A;  3D1R A;  5ET8 A;  2XXT A;  2P3V A;  3KJ7 A;  5A5X A;  4KYD A;  3TTN A;  2XXY A;  5LDZ A;  1D9Q A;  2O69 A;  1NV1 A;  2XWI A;  3C35 A;  2Q9T A;  3I3V A;  4H67 A;  1R1N A;  3H03 A;  4F1Y A;  5BUU A;  2B65 A;  3FAS A;  3T93 B;  4HTG A;  4GBW A;  3KN8 A;  1FBE A;  3USD A;  3FAT A;  4GQO A;  4H65 A;  3CR9 A;  4H8J A;  3F11 A;  1N04 A;  1PB8 A;  3PMV A;  2IEE A;  3N5L A; 
#chains in the Genus database with same CATH homology
 4GOT A;  3JZJ A;  4F2Q A;  4N07 A;  4U1Z A;  3K6U A;  4WED A;  2XXI A;  5CMK A;  3U92 A;  4OQO A;  1AH5 A;  3VXC A;  2Q89 A;  2UYF A;  1EU8 A;  1MDQ A;  1DSN A;  1JET A;  4G68 A;  1MQG A;  5EHM A;  4KYE A;  3OOA A;  2M8C A;  3HST A;  2XD3 A;  4DLD A;  3SES A;  3I5O A;  3VXB A;  3FZV A;  5I59 A;  2XXR A;  3FVO A;  2I4C A;  3SEY A;  4ZEK A;  2GH9 A;  5DVI A;  3MZ9 A;  3MVX A;  1ZBM A;  2ESN A;  4OES A;  3U94 A;  3MUQ A;  1M5F A;  3O6I A;  4TOZ A;  3R7X A;  4AB5 A;  4Z7E A;  1B4H A;  1US4 A;  2HZL A;  4NF4 B;  4R9G A;  3A09 A;  4BDO A;  1A7L A;  1JVY A;  4P0G A;  2GHB A;  3K6X A;  4OVJ A;  2ONK E;  5I56 A;  1MPD A;  1B5H A;  3K1N A;  1DPE A;  4FEB A;  1FQC A;  1MQH A;  3FJM A;  1LGB C;  1B40 A;  4PE5 B;  4H8I A;  1SBP A;  4JWO A;  3PPO A;  4C1U A;  2B3B A;  4KCC A;  4EXL A;  4NF6 A;  1YAE A;  4OET A;  1BP5 A;  3O28 A;  3KJT A;  3O97 A;  1IXI A;  2THI A;  1NL5 A;  3TEL A;  1N7X A;  1TFD A;  3TOD A;  4KHZ E;  2RIN A;  1SW5 A;  3T22 A;  1NNP A;  3SDF A;  3KOT A;  1Z7M E;  3Q27 A;  1B3E A;  3SET A;  2DE4 A;  2A5T B;  2QPQ A;  3EHU A;  3VVD A;  4R73 A;  3IB2 A;  5ICQ A;  4PP0 A;  2F7B A;  1MY4 A;  2UVJ A;  2DWH A;  1A40 A;  3LSF B;  3CVG A;  4YZZ A;  1JW1 A;  4LP2 B;  1HSE A;  4EXK A;  3ZKL A;  1OVB A;  4OEN A;  1D9Y A;  3MAM A;  2IA4 A;  5H8S A;  3E4R A;  3H6T A;  3OO8 A;  3RN8 A;  4MBP A;  3TMG A;  2ONS A;  4LZ5 A;  2F36 A;  4RA1 A;  1IQ7 A;  3C32 A;  2QL3 A;  2YJP A;  1B58 A;  3TUS A;  2UXA A;  1USY E;  4MLV A;  1P1W A;  5M2V A;  2F35 A;  4GFR A;  3QUJ A;  2DSF A;  3FD3 A;  4U23 A;  2XXH A;  3AXF A;  3W9V A;  2ZNT A;  1PBQ A;  1WOD A;  1B2H A;  1Y20 A;  3HPI A;  1DMB A;  4PFU A;  4FE8 A;  2X7P A;  1D4N A;  5DVJ A;  4EDP A;  2VGQ A;  3RUM A;  4NWC A;  2XX7 A;  4X48 A;  2P2A A;  3UN6 A;  3SEU A;  4R6K A;  4WXJ A;  1H76 A;  4LVQ A;  3LSL A;  3OEL A;  4RNS A;  4DXC A;  2V84 A;  4BDM A;  2I58 A;  2HEU A;  4NED A;  5FHN A;  3TQW A;  3S2V A;  1SD3 A;  4JBZ A;  1MS7 A;  2HAV A;  3IOR A;  3OO6 A;  2NOO A;  4GXS B;  3IO6 A;  2F6P A;  2DWA A;  5TPA B;  5FHO A;  3G3K A;  4YKK A;  3TQL A;  1EZP A;  5B7D A;  3IOT A;  1S50 A;  3M8U A;  3K1P A;  4LAT A;  2O7U A;  1NNK A;  3KSJ A;  3V83 A;  5AA2 A;  4YB5 A;  1LFH A;  2OCU A;  5CMC A;  4DDD A;  5KCJ B;  2QSX A;  4F3G A;  2RCA A;  3C4M A;  2ZMB A;  4KD5 A;  1PB7 A;  3MPL A;  5JK4 A;  4JWY A;  3G3I A;  4ZEF A;  1SW2 A;  4F31 B;  3S9E A;  1M5C A;  3B6T A;  3FJG A;  1IXC A;  1AIV A;  3RGY A;  1GR2 A;  2OK2 A;  3H6W A;  3BKI B;  4RXL A;  3ONM A;  4H1X A;  2A5S A;  4FED A;  1B3G A;  4RYA A;  4YKJ A;  3LBS A;  1CB6 A;  1UIU A;  3VFJ A;  3MZB A;  3IJO B;  4ELO A;  4EF1 A;  4KPT A;  3CIJ A;  3O66 A;  5DT6 A;  1FQB A;  4X1B A;  2QMW A;  1ELJ A;  1SYI A;  5HPQ A;  3E3K A;  4LUB A;  2X26 A;  3N6T A;  5EYF A;  2HCA A;  5AA2 D;  5I84 A;  4AB6 A;  1MH4 A;  4I8C A;  3BBR A;  5AA4 A;  4JXI A;  4F39 A;  5JEI A;  5DEX B;  5F1Q A;  3MZ1 A;  3G3G A;  4GLI A;  2QS1 A;  4F19 A;  2PMS A;  1JQF A;  3K02 A;  3PUV E;  4EUO A;  2I3W A;  3FXQ A;  1Y1Z A;  5I2K A;  2E1S A;  1I6B A;  4XXU A;  4UA8 A;  4NF5 A;  3PUY E;  3FV1 A;  1VSO A;  1B46 A;  5I2N A;  5IAI A;  3VVE A;  3IB1 A;  4OWD A;  2Y7W A;  2ABH A;  3E9X A;  2XX9 A;  2XXX A;  1GGG A;  1LBC A;  3PMX A;  5IKB A;  3K6W A;  3DP6 A;  3TFL A;  3C31 A;  4I62 A;  1M5D A;  3CG3 A;  1YCJ A;  5L9S A;  2DVZ A;  3OO7 A;  3LR1 A;  5B70 A;  2LAO A;  2UVH A;  4DZ1 A;  3MJN A;  3PUZ E;  5FTI A;  2D21 A;  2V3Q A;  1CE2 A;  1HSJ A;  3MP8 A;  4ONY A;  2O6A A;  5J1D A;  3HO7 A;  4ND9 A;  1JW4 A;  4PFW A;  1PB9 A;  2V93 A;  1OMP A;  1D3K A;  3PUX E;  4H6D A;  4HCY A;  3HN0 A;  1Q35 A;  2KLF A;  2DE3 A;  3VV5 A;  4DXB A;  3SEW A;  4IY6 A;  1Y9U A;  1PDA A;  1MXW A;  3H4Z A;  4OEV A;  2F5X A;  5TU0 A;  3JYR A;  4IO7 A;  1ZMG A;  3N6U A;  2QS4 A;  1XVY A;  1URG A;  1UTH B;  4H5G A;  1FTL A;  1IXH A;  4XKR A;  1GV8 A;  3W15 C;  1SDX A;  3HHF A;  2H9B A;  4K3F A;  4LA9 A;  1P99 A;  1LAG E;  5HBC A;  4C0R A;  3OO9 A;  2H4I A;  3CRB A;  4N13 A;  3UP9 A;  4I1D A;  3S4U A;  2Z8E A;  4F3S A;  3ZSF A;  3UK4 A;  5AA1 A;  1WVJ A;  4R72 A;  1PBP A;  2RC8 A;  4HS7 A;  3PD8 A;  1FTO A;  5CMM A;  1TXF A;  5BWJ A;  4P0I A;  1R9Q A;  1IIW A;  3RTW B;  1S7Y A;  2QJE A;  1H43 A;  3LUY A;  1N76 A;  4ELP A;  4GWO A;  3N94 A;  1Y3N A;  2ZNS A;  3E13 X;  1B0L A;  3IAZ A;  1OIB A;  2XHD A;  4GL0 A;  4MF3 A;  1PEB A;  1LCT A;  1QKB A;  2XD2 A;  2Y7I A;  2V25 A;  3IOV A;  3MQ9 A;  1BIY A;  1JW5 A;  3THI A;  3H7M A;  5KDT B;  1O7T A;  3Q26 A;  3S9M C;  2F78 A;  3QK6 A;  1QVS A;  3OXN A;  2PX1 A;  4G8N A;  2W7Y A;  4EF2 A;  3DP4 A;  1YPN A;  4JB7 A;  3R6U A;  1URS A;  2I0B A;  4OHN A;  3QSL A;  2RKM A;  4U22 A;  3RLF E;  3EN3 A;  1Y4T A;  1RYO A;  4R2F A;  3FGS A;  3P7I A;  4YMA A;  5TP9 B;  2F34 A;  1QUK A;  2PVU A;  4E0W A;  2GFE A;  2OWT A;  1MRP A;  1QUJ A;  3VDF A;  4DCY A;  4OEU A;  3TAJ A;  1B6H A;  4BDQ A;  4ELR A;  4QFO A;  4XTC Q;  1P1U A;  4HW8 A;  2ZXT A;  3VLU A;  2NUV A;  4NF4 A;  2HXW A;  3B7D A;  2GRV A;  4ELQ A;  1NH7 A;  1SVX B;  4GXA A;  3MBP A;  4I9D A;  4XIG Q;  3IX1 A;  2RC7 A;  2D5W A;  2PBW A;  4MFI A;  2D3I A;  3CFZ A;  2O7I A;  5ITO A;  3WAE A;  1XS5 A;  3FV2 A;  3GZG A;  2XXV A;  3O2A A;  3IL1 B;  1O64 A;  4PFT A;  1P1Q A;  2F6G A;  1FTM A;  1MDP 1;  5H8H B;  2R9J A;  1P1N A;  1A8E A;  1RKM A;  3GLB A;  4G68 C;  2E0S A;  3HCQ A;  3Q28 A;  2NWJ A;  4HCW A;  1R6Z A;  2UYE A;  1SI1 A;  2A5T A;  1QW0 A;  1FTJ A;  1AOV A;  2Y7R A;  4BDN A;  4FAT A;  3LSX A;  1J1N A;  5H8F B;  3V8X B;  1N84 A;  4ESW A;  3KEI A;  5LOM A;  3TCH A;  4L17 A;  4RK2 A;  2H98 A;  2RCB A;  1O63 A;  3OEK A;  4KYS A;  4ZEB A;  1Y3P A;  1LB8 A;  3PPQ A;  1ANF A;  3TTL A;  1B5J A;  4F3B A;  4R74 A;  4U4S A;  3CFL A;  2Q88 A;  1MY0 A;  4R9F A;  4QSC A;  1N3W A;  1US5 A;  1B51 A;  3EF7 A;  4FOR A;  4OER A;  4E0X A;  3KOS A;  4DCX A;  1FQD A;  1NH8 A;  3D4G A;  4OFL A;  1Y1M A;  5I57 B;  3I6V A;  2VHA A;  1MPC A;  3K00 A;  2AYS A;  5CMB A;  3A3C A;  5CM6 A;  3WAF A;  2O51 A;  1MY2 A;  2XXW A;  5KZT A;  4Q0C A;  2HFB A;  4ESX A;  2NXO A;  4QF9 A;  2ANJ A;  1TT1 A;  1I69 A;  4F18 A;  3OSR A;  3GBB A;  4POW A;  5I57 A;  3RTF B;  4NMY A;  2ALU A;  1PC3 A;  3IOW A;  3MVY A;  1POY 1;  2DYX A;  3RPW A;  1QKA A;  3TDJ A;  3HV1 A;  1YTV A;  4TLL B;  2QS2 A;  4RPN A;  4LQ5 A;  5TPA A;  3MVW A;  2F8D A;  4JWX A;  1QUL A;  3KBR A;  2QMX A;  3TEP A;  2ZYK A;  3W9W A;  2VP1 A;  5JTY B;  1HSL A;  4U1O A;  3RY3 A;  3VLV A;  4PET A;  2WKY A;  3Q25 A;  3RT8 A;  1VFE A;  3TPA A;  5ICT A;  2NVU B;  3FXU A;  1NNF A;  1LCF A;  2PT1 A;  3K01 A;  2OJT A;  1MQI A;  5ITP A;  5KCJ A;  1FQE A;  3K0V A;  1JNF A;  1A55 A;  2OWS A;  3TCG A;  3MC2 A;  2UVI A;  2RF1 A;  1OLA A;  2B3F A;  4IY5 A;  3SER A;  4OTE A;  3T9V A;  4QHQ A;  4ZDM A;  4NF8 B;  4G2Z A;  4NWD A;  3CG1 A;  4EQ9 A;  2XXU A;  2O1L A;  2H99 A;  3S9N C;  3LSW A;  3O29 A;  5H8N B;  1VR5 A;  3S9L C;  4Z0I A;  1A54 A;  3QAX A;  3CSB A;  4YU0 A;  5I58 B;  1B7H A;  4P11 A;  1MPB A;  3FVN A;  1LB9 A;  1T0K A;  4XKQ A;  2DWI A;  2Z8D A;  3T9U A;  3GBA A;  3QXM A;  1UIV A;  3KZG A;  1B9J A;  1MXV A;  2X7Q A;  1II5 A;  4EQ7 A;  3D4C A;  3Q29 A;  4U4X A;  4EQB A;  1B5I A;  2R71 A;  1D9V A;  3KFM A;  1OQG A;  1TFA A;  3T96 B;  5DEX A;  3EHT A;  1B7U A;  1QUI A;  3PV0 E;  4ZS9 A;  3EHS A;  2DE2 A;  3FXR A;  3IB0 A;  4RPO A;  3H6U A;  1ZTY A;  4C1T A;  4Q8R A;  1XT8 A;  1MQJ A;  2G93 A;  3PPN A;  3FUZ A;  3UGW A;  4KI0 E;  4F1U A;  2DWJ A;  2F7C A;  2ZYO A;  5A5X B;  3RQT A;  1JEV A;  3C34 A;  3QUF A;  4FIM A;  5DTB A;  3PU5 A;  2Z8F A;  4IGR A;  5K2X A;  1TWY A;  2O68 A;  1B52 A;  2DXY A;  1N3X A;  2AIX A;  1OQH A;  2V3T A;  4R2B A;  3G7W A;  4KQP A;  2DP8 A;  1FTK A;  4F3P A;  1Q1K A;  4IO6 A;  1B7Z A;  3TZA A;  2I0C A;  1L5T A;  5L9O A;  1B05 A;  3V5A A;  1LAF E;  4FJP A;  5FTH A;  1F9B A;  2OLB A;  3CSG A;  2I48 A;  4DE8 A;  4F22 A;  1Z7N E;  3PD9 A;  3BFT A;  4O3A A;  2VOZ A;  2FYI A;  3ZS6 A;  4R75 A;  2DQV A;  4M1V A;  3ECR A;  4YKI A;  3TTK A;  4G68 B;  1JEU A;  3FVG A;  4GRK A;  2V3U A;  4F1V A;  1UTH A;  2RC9 A;  3OSQ A;  4RY1 A;  5I59 B;  4U2R A;  3DEL B;  3PPR A;  3SKP A;  3O9P A;  4IO3 A;  1LAX A;  3CFX A;  4IB2 A;  3UA8 A;  1ZLQ A;  2CZL A;  1QJM A;  2ZYN A;  3VLW A;  5ISU A;  1H44 A;  1B32 A;  3MP1 A;  1FW0 A;  5I56 B;  4F2O A;  1EH3 A;  4G8M A;  4MLQ A;  1SI0 A;  1IEJ A;  3G3H A;  2YLN A;  1EZO A;  3U72 A;  3QYT A;  2I4B A;  4QFN A;  1DPP A;  1MM6 A;  3B6W A;  1I6A A;  5K2Y A;  4NF6 B;  3K6V A;  4JSO A;  2Y7K A;  2P0S A;  3N26 A;  1SQY A;  3RT6 B;  3VE1 B;  4OFO A;  3MPK A;  1URD A;  3C36 A;  3MW0 A;  3T9X B;  2Q8J A;  5H8Q B;  4QFL A;  5KDT A;  5FHM A;  4BDL A;  1H45 A;  1LFI A;  1FQF A;  1JVX A;  2H5Y A;  3KSX A;  4YMB A;  3ILU B;  4N6P A;  2HZK A;  4TQU Q;  4ISU A;  1MQD A;  1B4Z A;  4R6Y A;  2PYY A;  1A99 A;  3JV9 A;  5HM4 B;  3C9H A;  3A3U A;  5TP9 A;  1AL3 A;  1B3L A;  4JDF A;  2QRY A;  3FIR A;  4LZ8 A;  1EZ9 A;  4G77 A;  3M3K A;  1IZ1 A;  2Y84 A;  1ZU0 A;  2XXP A;  3UIF A;  1BKA A;  4M4G A;  5H8Q A;  3K1M A;  2VD2 A;  3DP8 A;  1Y4C A;  4X9T A;  4QSE A;  4OZ9 A;  1NNT A;  2O1M A;  1I6Q A;  2I6E A;  4KR5 A;  5DVF A;  4Q5T A;  3O6G A;  4YKP A;  2GHA A;  1B1H A;  2XX8 A;  3IO4 A;  1B3H A;  2REJ A;  4PFY A;  5ELV A;  3H3G A;  4QFK A;  4TLM B;  2DS9 A;  2FNC A;  2ZYM A;  3IOU A;  4YB6 A;  4LQ2 A;  3MWB A;  2YPN A;  3K2D A;  2REG A;  2DOJ A;  4GIZ A;  1OLC A;  2OZZ A;  4ECF A;  4FEC A;  4IO4 A;  2I3V A;  5H8H A;  4YIC A;  3DM0 A;  2PT2 A;  4H5F A;  4WEP A;  4GF8 A;  1NKX A;  4GVO A;  1MXX A;  1MXY A;  4ZED A;  3HHG A;  1MXU A;  3G3J A;  4ZZE A;  1A8F A;  4IGT A;  3T9H B;  5EHS A;  5H8F A;  4MH5 A;  3KN3 A;  5CBR A;  4YAH X;  1AMF A;  4QFP A;  4YB7 A;  3SEX A;  2Z22 A;  2ONR A;  3EPE A;  1XOC A;  1FQA A;  1B3F A;  4QRZ A;  1DTZ A;  2DXR A;  5AA2 B;  5AA3 A;  2BJJ X;  1MY3 A;  3OEM A;  1UTB B;  1LLS A;  3TTM A;  2UVG A;  2FA7 A;  3T66 A;  3OMB A;  1LFG A;  1B1X A;  2R6G E;  3ZKK A;  1MY1 A;  2HQ0 A;  4OMB A;  1BTJ A;  4GL8 A;  1H3D A;  4OYV A;  3GXA A;  4U21 A;  1XVX A;  3H6V A;  5AE4 A;  3V89 B;  3O6H A;  3U1O A;  1XHY A;  3KGC A;  2F97 A;  3IR1 A;  4O3C A;  1UTB A;  4QSD A;  3TYH A;  1DTG A;  2XXQ A;  5DYH A;  4X1D A;  1ZKB A;  1ZJL A;  4OXV A;  4AQ4 A;  3MP6 A;  3PPP A;  2G29 A;  2DVC A;  4RJZ A;  3M3F A;  3FJ7 A;  4JSD A;  4XKN A;  1UQW A;  5AA4 B;  3PGF A;  4DXU A;  1WDN A;  4IO2 A;  1N7W A;  1IUD A;  4WKM A;  1Y3Q A;  2H25 A;  1R9L A;  2AL5 A;  4RK9 A;  3PUW E;  4ZEC A;  1MXZ A;  5I2K B;  1B0H A;  1KWH A;  1SYH A;  3H06 B;  4BDR A;  5F7V A;  3ILT B;  1N0T A;  3MVZ A;  5JTY A;  1LST A;  4NF5 B;  1LBB A;  4R6H A;  5I2N B;  3L6H A;  3IJX B;  3KG2 A;  4UAC A;  2I49 A;  2Z23 A;  5CBS A;  1USY H;  2ZNU A;  3TTR A;  4POX A;  3R26 A;  3EQ1 A;  4ZE9 A;  1RYX A;  1IIT A;  4NE4 A;  3FVK A;  4NTL A;  2HAU A;  3L6G A;  2CMO A;  3KN7 A;  4LON B;  4PQJ A;  5CC2 A;  3TKD A;  2AL4 A;  1MG1 A;  5L9M A;  3QIM A;  3B6Q A;  1S9T A;  1VE4 A;  4NF8 A;  1IXG A;  3UOR A;  1GTK A;  1MH3 A;  1MM7 A;  2P1S A;  3PMW A;  4ZZA A;  1DOT A;  4OFJ A;  4LZ7 A;  5H8N A;  1ZIU A;  2Y7P A;  4G8H A;  4BLA A;  1M5E A;  3M3L A;  3DLN A;  4F29 A;  1POT A;  3LC8 A;  2OBG A;  5I58 A;  1LAH E;  1ATG A;  4GD5 A;  1BLF A;  2O84 X;  3RNN A;  1M5B A;  3CI8 A;  1SW4 A;  2Q2A A;  4Q30 B;  4DIG A;  4ZE8 A;  3IK6 B;  4O3B A;  2VD3 A;  1SW1 A;  5L8D A;  2QS3 A;  3TCF A;  1VFD A;  3G3F A;  4XKP A;  4KCD A;  3OEN A;  4G4P A;  4ZEI A;  5CI5 A;  4FAJ A;  3C33 A;  3VVF A;  3K4U A;  3ODB A;  4THI A;  1XC1 A;  1GVC A;  1FCK A;  3SEV A;  1NFT A;  3U8Q A;  3U93 A;  1NMU A;  4H0W A;  3OD7 A;  2Q2C A;  2F7A A;  4KFQ A;  4IO5 A;  5CRY A;  1OVT A;  1P1O A;  3BFU A;  2XXT A;  3KJ7 A;  5A5X A;  4KYD A;  3TTN A;  2XXY A;  2O69 A;  3C35 A;  2Q9T A;  3I3V A;  4H67 A;  1R1N A;  3H03 A;  4F1Y A;  5BUU A;  2B65 A;  3FAS A;  3T93 B;  4HTG A;  3KN8 A;  3USD A;  3FAT A;  4GQO A;  4H65 A;  3CR9 A;  4H8J A;  3F11 A;  1N04 A;  1PB8 A;  3PMV A;  2IEE A;  3N5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...