5A6LA

High resolution structure of the thermostable glucuronoxylan endo-beta-1, 4-xylanase, ctxyn30a, from clostridium thermocellum with two xylobiose units bound
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
389
structure length
389
Chain Sequence
MASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTAVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords CARBOHYDRATE BINDING FAMILY 6
publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 137
structure length 389
sequence length 389
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5a6lA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5a6lA02
1QWNA 4MB5A 4GPNA 2WWCA 1BFNA 1VFMA 1E3XA 3SCWA 3F4VA 5A2AA 1BGAA 4AEFA 1XD1A 5GNZA 2BY1A 4MTVA 2VNCA 3BAXA 2WHKA 4PCTA 4KGJA 3PZVA 4WK9A 1JIBA 4MDOA 4Q22A 1UKTA 5HPOA 1WDPA 1GQIA 1A47A 1T0OA 3W29A 2ZX6A 4KH2A 2DT3A 3CZNA 1ECEA 2F18A 2RGLA 4MPKA 2YL6A 3MU7A 1W9BM 5M03A 1FFRA 3ZQ9A 4HP5A 1FOBA 4HOWA 2WHMA 3GBDA 1KQZA 1B3ZA 2PBOA 2X09A 3I3BA 2CESA 1D3CA 3T0BA 4ZXLA 1J0KA 2XFRA 4XV0A 3I3EA 3LXCA 2OSYA 5CPQA 4GZIA 3MSDA 1R8LA 3CHFA 3GBEA 3GM8A 2YBUA 3M7SA 2Y8KA 1DWJM 1R47A 1US2A 4LGXA 1OB0A 1QI3A 3AIQA 4V27A 2J7HA 2GJPA 1AQMA 4WF7A 4MNMA 4JZ5A 3EDKA 5D9NA 3AMCA 4P8XA 3AI0A 1VAHA 4AY1A 4UQAA 1DTUA 2WC4A 1W2PA 5BXRA 1HP5A 2VJXA 1XGZA 1BQCA 2VO5A 1UR4A 3WEZA 3MUY1 3DC0A 4AZIA 1UH3A 3WDJA 4AIUA 2A3AA 4AC1X 1CLVA 3ZJKA 3VMOA 2ZICA 3VDCA 2JF6A 3AIBA 1WAWA 3ZT6A 1ZL1A 3LRMA 3U7BA 2QPSA 4D6JA 4F9JA 2W61A 1X6LA 3KL3A 4S3KA 1VBRA 1WPCA 3U5UA 4AD4A 3A6OA 1RP8A 3W6MA 1TMQA 3W53A 2VOTA 1GHSA 1W1PA 2F61A 4QCFA 4FMVA 4AZCA 1E6ZA 4CD4A 2EPLX 2WCSA 4CN4A 1UWTA 7A3HA 1CGTA 2CPUA 1BG4A 1DWHM 5JBFA 2VCBA 4UZSA 4GO8A 1TQWA 2CBVA 1JD7A 2J74A 2PWHA 3BGAA 1R46A 1OGGA 1TQVA 4BZYA 1Q6EA 3WH9A 1LG2A 2VZSA 4AW7A 1UR1A 1KXQA 4W85A 1KXTA 2WKLA 1ODZA 2WNWA 1TE1A 5A8MA 2GFTA 2VT0A 1XCXA 5A8PA 2XWDA 4NRRA 1QI5A 4P7QA 4J28A 3PZGA 1HX0A 1OD0A 1GQLA 5IXEA 2EAEA 4PYSA 1BAGA 4NXSA 4JKMA 3GTNA 1EOMA 2PF0A 1S46A 2A3HA 3ZSSA 1C91A 3VPLA 1JI2A 1CGUA 4U3AA 4F8XA 4OOZA 4EK7A 4J3UA 1ISWA 5A1AA 3WDRA 1BYAA 2J7DA 3CHCA 3PHAA 3ZOAA 4JFTA 1JGIA 4FK9A 1B3WA 4C7GA 2Y4SA 1HXJA 1V0KA 1XCWA 2F7PA 1VF8A 4H04A 3KLLA 3LXBA 1QW9A 3EJRA 4TUFA 2EQDA 3GXIA 3AS0A 3UG5A 3T0AA 3QOKA 1QNSA 1G0CA 5FCZA 3CZLA 3I3DA 4GI6A 2XYLA 2WCAA 2G3NA 3G6MA 2CETA 1H49A 1TCMA 4RE2A 1JI1A 1DWGM 3AHTA 1ZBKA 1UD4A 1VEMA 1FHDA 4HMCA 3KZSA 1MVYA 4PTWA 4PRWA 3AS1A 1E6QM 5BCAA 1UD2A 3K1DA 2DT2A 3WD4A 2WMJA 1TA3A 3FW6A 3WKZA 1CXFA 2WXDM 3VM5A 1R87A 1EIBA 3CUIA 4E8CA 3VIIA 2X2JA 3AHXA 1XSJA 3KEHA 3AMDA 2VZTA 1QX1A 3IAQA 4B9YA 1CIUA 4W8BA 2VMFA 3WDQA 2CXGA 3LRKA 1G94A 3DHPA 4QLLA 3EJPA 1XD0A 4D6IA 3AICA 1EQCA 4J3SA 1CGXA 1E71M 1MW3A 4H41A 4CU8A 2FE0A 2XN2A 3S6TA 2D23A 2EACA 2CCRA 3GZAA 4U33A 4TTGA 1HKIA 4P7LA 2JF7A 1V0MA 2J8GA 2ALWA 2AOSA 1OT1A 3ARYA 4DM1A 3F5KA 5IHSA 4X0NA 5A2CA 3NJ3A 4AZ7A 5CGMA 1EO5A 1E5NA 3WQ5A 1GJWA 4NSBA 1NP2A 2XFFA 2V3DA 3SIMA 2G3MA 3WBAA 1NH6A 1QI4A 3GH4A 3ARXA 4M24A 3VSTA 5HBFA 1G9HA 1A3HA 1NWUA 3VILA 1W1VA 1EXPA 2XVGA 3GDBA 1K9DA 3SCRA 1ZBWA 4FNUA 4OBSA 3WDIA 3WBEA 1KFWA 4BQ4A 1HWWA 3TONA 3WEMA 2RGMA 1DWIM 2F7OA 3S5ZA 3UEQA 1CNVA 1D7FA 4WSJA 2JALA 1OT2A 1BTCA 1BHGA 1UOKA 3PBGA 4ZFMA 1ISVA 4Z2LA 2CIPA 1GQKA 2ZXAA 2WBKA 3WF0A 4M82A 3EDDA 3CO4A 4BCEA 1FP8A 3WF1A 4B15A 1C90A 1HF6A 3B8SA 3W82A 2BXZA 2WHJA 3AIUA 2NW0A 4ZENA 1BVNP 3WQ4A 3ZJ8A 1JDDA 3CLWA 5HXMA 1W9UA 3UR8A 3SCVA 3THCA 1J0HA 3LXAA 3ALFA 3BUBA 3BVXA 2EADA 1JYXA 1UA7A 1JNEA 2FYVA 3EJTA 3SCNA 3RO8A 4D6FA 5D9OA 1PIFA 4AZ6A 3OLIA 1J0IA 2YL9A 2JEPA 4IPNB 3UERA 1GHRA 4DWSB 4BQ2A 4FLOA 5DEZA 1EHNA 1EDQA 1HJSA 4MNKA 1XC6A 5E0FA 3VINA 4W7UA 1SYTA 5FKYA 1K9TA 2WVSA 1HIZA 3CMJA 2W63A 3L2LA 3PTKA 4W86A 3L4YA 1O7AA 1GQJA 1FH8A 5I77A 5D8WA 4JAWA 2BVTA 5JBDA 3VIKA 3IANA 4XUYA 4GQRA 1C3FA 4HA4A 5KEZA 2DIJA 1W3HA 4UQDA 1V3IA 1GOKA 1HVXA 2AAAA 2GSJA 1HN1A 4JL2A 3A4WA 1XHGA 3AFBA 5IFPA 3H53A 1E6SM 1MWOA 1UKQA 1LL4A 2ZX9A 2JIEA 3SURA 2V3EA 1WKYA 3VIPA 1BGGA 1G5AA 4NF7A 3VTRA 3LPPA 3OB8A 3BVTA 3H54A 5TD4A 1UD6A 2PI6A 3K4DA 4WIWA 3UETA 2YBTA 4MNJA 3N11A 4NZJA 2G4FA 2J4GA 2DDXA 1Q6DA 3RMEA 4KMQA 4GINA 4HA1A 5D9MA 3M07A 2GJXB 2D20A 2DSWA 4AYSA 1Q6GA 3WF2A 3A4AA 3K46A 2VR5A 1TQSA 3WNOA 2PB1A 2GDUA 4JKLA 4DUWA 2VURA 2WMKA 4JFSA 4MB1A 4AD0A 4GI9A 4U2ZA 1V3JA 3SCSA 1WZMA 3S2CA 1E6XM 2XGBA 1EQPA 3VM7A 2WMFA 3IAPA 4A3YA 1UG6A 1KXHA 1H4PA 1LF1A 3VGHA 4IUGA 1XH0A 4ATWA 2O9RA 3DDGA 3CZEA 3AMGA 3QHMA 5I5RA 3AIEA 4P8WA 5E6YA 1O7DC 3IJ8A 1H1NA 5C71A 5M3WA 3ZJ7A 1US3A 3SUWA 3AS3A 4LPCA 4LYQA 1QI2A 1W9XA 3WH7A 3ZIZA 3W37A 1GPFA 4AIEA 1M01A 4D1IA 1BG9A 1U33A 4UR9A 3OIHA 1PJ9A 2PBGA 4ZE5A 4MADA 5E70A 3BC9A 2OLHA 3AYRA 5I2UA 1PEZA 4GQQA 4W7WA 5E1QA 4HPGA 4L4OA 3SUUA 3K8MA 4M1RA 4TOQA 1H0IA 1JZ5A 3AIVA 1R34A 1SMAA 3LPOA 1HKJA 1PX8A 1EGZA 1FFQA 1LLOA 1HL8A 1U30A 3POCA 2DSUA 1SFSA 1TG7A 1R86A 1J11A 1JFXA 3AMLA 2O9OA 2BHYA 3GYCA 2WW5A 1GNXA 1PX3A 1J0JA 3WQ6A 1NOWA 1UQZA 1UH2A 1JAKA 2WVUA 2QV4A 3WNMA 4ATLA 2DH3A 3KL0A 2YDRA 1WE5A 2VCCA 4WLCA 3WY4A 1C7TA 1V6UA 3M46A 1JZ8A 4KRUA 3NIYA 1KR0A 2O92A 4B9ZA 1Q6CA 4JHOA 3SCQA 3VIOA 4JCLA 2X0YA 3ZMRA 4D71A 2E3ZA 4CCEA 2X05A 3AZSA 1PPIA 3OZOA 3AJ7A 1V6XA 3LX9A 2X8RA 3DX2A 4PSPA 4J3XA 3DECA 1XH1A 1ITXA 1MW2A 5AY7A 3A24A 4QP0A 1F4AA 1DHKA 3CUGA 3OGRA 1B30A 3UG4A 3RM9A 3BSHA 1C8QA 4B3KA 1PBGA 4NZCA 1H5VA 3WMCA 1DEDA 3GXMA 2WLYA 3WFZA 1HXKA 1V3MA 4M56A 3ARTA 3D4ZA 2JEQA 2VC9A 1KB3A 2DT0A 2VZVA 3BXWA 3RCNA 2BS9A 2OW6A 4UCFA 1HP4A 2VX5A 2ZIDA 3BLKA 2ZUMA 3TTQA 1EHAA 1OWQA 2WMGA 2DSZA 2XHYA 3NYDA 2YLLA 3VIHA 3WQ8A 3WUGA 1YQ2A 4FNSA 3AXIA 4KWUA 3VIFA 3OZPA 3OG2A 1UZ4A 2DT1A 3EMQA 3L4VA 2X0HA 3W24A 2GJRA 2WC7A 1BYBA 3VIJA 2D3LA 2YJQA 2WK2A 1UD8A 3WSUA 2ESCA 3FAWA 1HKKA 1PX4A 2VVNA 4H7VA 1JZ6A 3WMSA 4D6DA 2WVVA 5CPSA 5E09A 1UHVA 3K8KA 2BVYA 1UZ1A 2XN0A 4PUEA 5FL0A 1AVAA 2X1IA 4BQ3A 1JD9A 5BXPA 1KBBA 2WVVB 2IXUA 1H0GA 3TTSA 4TX6A 4UFKA 1GOQA 4CUCA 4QLJA 3SCTA 3VOCA 4AZBA 1Z32X 4ACZA 3PZOA 3T08A 4ACYA 5CLTA 1HKMA 2G8ZA 3TTYA 4S3JA 1W9PA 2VRQA 3LPFA 1CECA 4FNTA 1KGWA 4PMZA 3VUPA 4AZCB 1VIWA 4AISA 3W28A 4XX6A 4UFHA 1LWHA 3BLPX 4W88A 1ISZA 1UWRA 1H41A 1V08A 4DM2A 3VD9A 4PMYA 2Y8VA 2Q8XA 1CYGA 1WDSA 2Z1KA 4E2OA 3AXHA 3MUZ1 4CCDA 3CBWA 1WCGA 3JUGA 5FOOA 3DX1A 2UWFA 4D1JA 2VQUA 1I75A 3SCOA 3DX3A 4TVDA 4JL1A 6CGTA 1X6NA 4J3WA 4D6GA 2WVTA 3MUIA 4PMQA 1B3VA 4E8DA 2OYKA 1V0NA 2CITA 4MB3A 4Z2IA 1YHTA 2IGTA 1ZJBA 3VSUA 5A6BD 1UH4A 4CGTA 1QWUA 2Y24A 4FNRA 1OD8A 4AXNA 1JZ3A 3A21A 2UY3A 5BROA 2WAGA 3SUTA 2WBGA 3MI6A 4DO6A 4HZ8A 1V3HA 1VBUA 1UWQA 3AHZA 4FNQA 1WDQA 2J77A 3RDKA 3WUEA 3OBAA 5EBAA 3AS2A 2YL8A 2V5DA 5A8OA 5BWFA 5CSUA 5GPRA 2XWEA 2D22A 4UQEA 1J10A 2QPUA 4TX8A 2WZHA 1KQYA 3PZQA 5BRQA 5EFFA 5A6LA 3HU7A 4CVUA 3G6LA 3BCFA 2BNJA 1R85A 1WZAA 2F7RA 1UR8A 1SZNA 1KXVA 3WY3A 4IISA 5I6SA 4D6EA 1M7XA 4DWSC 3L2MA 3GNOA 3THDA 2G3JA 1ZJAA 4AD2A 4LYPA 1ZS2A 5A8NA 1KR1A 2J47A 2ZUNA 1E40A 1W1TA 5HNNA 4HPHA 1OBAA 5FIPA 3VKKA 4CD8A 1UA3A 2WHLA 3PZ9A 2BY2A 5M5DA 4FLQA 1R7AA 1H09A 1VFFA 2OSWA 1GONA 3GH5A 1CXHA 4LXFA 2YA1A 1V03A 1C92A 1V3KA 2HISA 5I79A 1V6VA 3SEPA 2E9LA 3S5YA 1W2VA 4MB4A 3DHUA 2QF8A 2Y5EA 2O9PA 3WF3A 4ATDA 1ZB5A 1TA3B 3W81A 2XTKA 1QHOA 3BCDA 4PTVA 2XVKA 2QMKA 1TQUA 3QR3A 2VTFA 1IZKA 2D3NA 2GVYA 2ZUSA 1TQTA 4IPLA 3AHYA 2OYMA 2J7EA 1KTCA 2V38A 5ABEA 3W6LA 4FNPA 1HNYA 5A2BA 1E4LA 5A6KA 3AROA 1B1YA 3D50A 4V28A 4MNLA 5CGTA 4EKJA 2YIHA 4P7NA 2XM2A 1PIGA 2VZUA 3WELA 5JUVA 2PWDA 3FNDA 1E4NA 1M53A 5I78A 2TAAA 3VD3A 1JF6A 1NM9A 4H8VA 1LL6A 4EAMA 4X9YA 2FGLA 2DQXA 1V3LA 3VNYA 4PBGA 1JYWA 4WJXA 4H8UA 4JIEA 1E73M 1XRVA 3QOMA 2NSXA 2VL4A 1UKSA 3EDEA 2WCGA 2J7BA 1W3LA 2J25A 2D0GA 1C8YA 1UASA 1E6PA 2DPEA 4QLKA 2C7FA 2EPMX 4UFJA 3VD7A 3RJYA 2D73A 2FHCA 3CZGA 3W27A 4F66A 1TVNA 2EPKX 3EMZA 2VX6A 3WMBA 1E55A 3O6AA 3DYMA 4AIOA 2G3IA 2UY2A 3EYPA 1GOOA 1WB0A 4FLRA 4IM4A 3GXTA 1EO7A 5IFTA 5ABHA 3D4YA 1HJQA 2UY5A 2EEXA 4PEEA 1H3GA 5A94A 4OJYA 4U3CA 1F4HA 1R7OA 2O9TA 1KBKA 2E40A 4Z2GA 3N15A 1B9ZA 3N04A 3BUIA 2W66A 2QMJA 3VMNA 2YLAA 1NARA 1JL8A 1K6AA 4HMDA 1UD5A 3A3HA 1OIFA 3LRLA 3LMYA 3OA5A 3MV11 3N12A 3VMPA 1CLXA 4CKQA 3HN3A 4LQ1A 4URIA 3L4WA 4XB3A 1FH7A 1CENA 3BVUA 5I24A 4P7OA 3BH4A 4GIAA 1JZ7A 1E0VA 3HG5A 1V6WA 3VDAA 2BV9A 1JDCA 3ALGA 2E4TA 3ZT7A 1ISXA 3DX0A 4BF7A 1OINA 2OWXA 4HMEA 2J7FA 2F1AA 1J9YA 1JNDA 4AEEA 1WZLA 2XVPA 3CV5A 2X2IA 2FGZA 1B2YA 4YHEA 1H2JA 3J7HA 5D8ZA 3ECQA 4DO5A 1ODUA 2ZWYA 1MW1A 3RM4A 4B3LA 1GOMA 1VB9A 1VENA 2WC3A 4NRSA 3ARUA 2VR4A 1UYQA 1OSEA 1HVQA 1HJVA 3QHOA 3PZNA 4U2YA 2XPKA 4FF5A 2W92A 4PN2A 2PC8A 2VVSA 3L4XA 4A3HA 2W5FA 1E3ZA 4AZGA 2ZUUA 5CZKA 3ARQA 2ZXBA 3GNPA 1EDTA 1J01A 5JIPA 3AZRA 1ITCA 4AMCA 2OSXA 4AYGA 3AISA 5A6MA 1CWYA 1JG9A 2VCAA 4JFVA 1VJSA 1J18A 4GZEA 4NI3A 2CHNA 3AQUA 5CQ1A 3HJEA 8A3HA 4HOZA 1XYFA 3D3AA 1KCLA 4ZEPA 1W1YA 2Y2WA 3EMCA 3HG3A 3TTOA 4UOJA 4MJ4A 3CZSA 2ZUWA 3TP4A 3GH7A 2BHZA 3A5VA 3HG4A 2YKKA 2E9MA 3ARZA 5DF0A 5E0CA 3EBVA 2WPGA 1XV8A 1E4IA 2XM1A 3UESA 3A23A 4AZ5A 3PTMA 1E43A 1MXDA 5D9PA 1OGBA 5EFDA 3PZTA 1ISYA 2XVNA 3KL5A 5JIWA 2AMGA 2DIEA 2QHAA 3CUFA 3EJQA 1JYNA 4W8LA 1KGUA 3N13A 2ZUVA 2WLZA 2XUCA 4PMDA 1UR0A 4OKDA 5EMYA 1DP0A 1E72M 3CUJA 1TFVA 3SUSA 1KCKA 2UY4A 4TVCA 4PTMA 3WH8A 2X2YA 5BYWA 3VGBA 2ZX8A 1W9VA 1J0YA 4C7FA 3UR7A 3BUDA 4CN1A 5LA2A 4J3VA 3WQVA 1E0XA 4N42A 4KGLA 3WUBA 5AC4A 1J0ZA 2J75A 4HTYA 3ARVA 2GDVA 3MV01 3GXNA 4U5KA 2IXVA 2ZOXA 1OCQA 1QW8A 4F9DA 2YA0A 2YOCA 4CVWA 3L4ZA 1VFUA 2E8YA 3EJUA 2EBNA 4YHGA 5ECUA 5A6BA 3MO4A 4AWEA 3NDZA 1P6WA 1JXJA 4Z2KA 5ABGA 3BAIA 1W3KA 4MAZA 5DMYA 2E8ZA 2DSKA 3M6DA 1UQYA 9CGTA 4ML4A 2D2OA 3VIGA 1XH2A 1U2YA 1W9DM 3NDYA 3MKKA 1MQRA 3PN8A 4PMNA 2EO7A 1BF2A 2V5CA 4GI8A 3CGTA 1CXIA 2VRJA 1B3YA 1L8NA 1HJWA 3BMWA 2J79A 4HU0A 3PZMA 1HJXA 4QFUA 3B9AA 3E1F1 1PZ3A 1NOFA 4DWSD 2WMIA 1X1NA 2WB5A 1IZJA 3CMGA 4BQ5A 1W3JA 1I1WA 4TTUA 5CXPA 3AHVA 2VRKA 8CGTA 3VSVA 1B3XA 3QGVA 4AMWA 1FH9A 1SR0A 2CEQA 2WMIB 3WD0A 1V6YA 2IUZA 4A4AA 4M8UA 1OM0A 2DGAA 4OIFA 4CU6A 4PSRA 2BHUA 1EDGA 3W4RA 2WSKA 3WH5A 2WSPA 2EJ1A 4AZHA 3VU2A 4UQCA 2F2HA 3CIVA 1UWIA 3VGDA 1RP9A 3A4XA 1PZ2A 2WANA 1PAMA 3NSXA 4UFIA 2XSBA 1CXKA 1BYDA 3BAJA 1C93A 3U5YA 1KWKA 3D5HA 3ZR6A 4EANA 3EDJA 1CGVA 3CHDA 3BLBA 1QNPA 1HL9A 5A69A 4PMUA 5IHRA 2JFEX 4PMXA 1FHLA 3WN6A 4JFUA 3VDHA 1HJUA 4WKFA 3AXXA 5AYIA 3WNNA 1HTYA 2VZOA 3QHNA 3KWXA 4N0RA 1BPLB 4UOQA 5LA1A 1CXEA 1L0PA 2D0HA 1GOIA 3ARPA 1MW0A 1RPKA 3BSGA 2ZX5A 2CBJA 4P8VA 1GW1A 3BAWA 4TVUA 4JHZA 1H11A 5I3DA 1TZ7A 3ZT5A 2JIWA 1WZKA 1XSKA 3BAKA 2C8NA 3EJSA 5A6AA 4OOUA 3IJ9A 2BY0A 1EH9A 3SCUA 2CHOA 3AZTA 2HVMA 3T2QA 4HU8A 2V3GA 3WUFA 4ACZB 1W91A 3N17A 1E6RA 5I23A 4UOZA 4DUXA 3B9EA 1XYZA 3WNLA 1ZBCA 3PZIA 4W87A 2D0FA 3RIKA 1QNOA 2YDSA 4XZWA 3LPGA 2EABA 2W4XA 4BA0A 3N9KA 3ZO9A 3K4AA 1QNRA 3NSMA 4ZXOA 4UQBA 1ZBVA 4H8HA 3UCQA 3ZJ6A 3D52A 1K9FA 3SCPA 4AMXA 5EB8A 2BY3A 3F5JA 1E0WA 1DWAM 3NCOA 4W5UA 2DH2A 2Z1SA 5JBEA 3MMDA 4Y7EA 4LYRA 4AD5A 3WFLA 1LQ0A 1V02A 3BVWA 3W25A 1NOUA 2D24A 1Y7VA 3L4UA 2ZWZA 5A95A 3OLDA 3RJXA 2XGIA 4YPJA 2VX7A 3EDFA 1UUQA 1JF5A 1J12A 1CPUA 4OGZA 3MANA 4JFWA 3VX0A 1WNOA 3VGEA 2DEPA 5HPCA 3ARWA 4MJ2A 1JFHA 3B9DA 5D4YA 4AD3A 3MMUA 4K68A 3RPMA 3CZKA 2FH8A 4H2CA 1WDRA 4PCSA 5CG0A 5FL1A 3CC1A 3VNZA 4UTFA 1JXKA 3ZR5A 1BLIA 1K9EA 1JZ4A 1KGXA 4F79A 4UQ9A 4M80A 4LX4A 2A3CA 3VO0A 2J7CA 2QLYA 2PWFA 4PMOA 1TR1A 7CGTA 3OGSA 1G01A 3IGUA 3OGVA 2YL5A 2FHFA 5HOSA 2J62A 1I1XA 4J27A 2PWEA 3L4TA 1QBBA 3MSGA 1E4MM 1IT0A 1QOXA 3WENA 2G41A 4X0VA 3WIJA 3KE0A 1TUXA 1DWFM 3CTTA 3WH6A 2WMHA 3CZ8A 5CPTA 3ARSA 4FLSA 2VX4A 4NX0A 1KTBA 2WZEA 5FD0A 3FY1A 3CH9A 3TV8A 3TA9A 1RH9A 2J7GA 1V02E 4PTXA 2OW7A 5A6JA 3ZSTA 2CBUA 2XJ7A 4J3TA 1MXGA 3WD1A 3F5LA 4P8UA 2BVDA 4JCMA 2NT1A 4RE3A 2W67A 5M17A 1TVPA 3SUVA 1O6IA 2F8QA 1ZU8A 2PWGA 2ZX7A 1D2KA 3VDBA 4AD1A 1AMYA 5AYBA 1QI0A 2F1BA 1BSIA 3WY2A 2MANA 1CBGA 1ESWA 3AMKA 3AIWA 4P7RA 3VD4A 7TAAA 1LL7A 2ZUTA 3OLGA 1CZ1A 4UFMA 3WQWA 4UNIA 5F7UA 1GORA 3MS8A 1E6NA 1CDGA 3WD2A 3VIMA 1CXLA 1RD6A 2GUYA 4DO4A 2FHBA 2E9BA 4GO9A 4CD7A 1R33A 4OZOA 2WYSA 4ZE4A 2YFNA 3AYSA 4CU7A 1JAEA 3ZM8A 5LA0A 3DDFA 3IJ7A 3FXYA 2WKGA 2VUYA 1B0IA 2EPOA 5BXSA 1UWUA 1BYCA 2FDMA 2ZXQA 3MUAA 1UKPA 4CN6A 5BXTA 2W91A 3WDPP 1MQPA 1B31A 3DX4A 1QBAA 1JZ2A 3HG2A 4PMVA 1QNQA 3U57A 4Z2JA 3PZUA 2XN1A 3WEOA 1VFOA 3FHQA 1NWTA 3FHAA 1NP0A 1E1EA 2BXYA 1MYRA 1QVBA 4HA3A 3WL0A 5CLWA 5AC5A 1N82A 5LYRA 4CD5A 4M81A 1UR2A 3MMWA 4WKAA 2X2HA 1C8XA 5C70A 3WDHA 1E70M 3T2PA 2XFYA 2J78A 3N18A 1E1FA 5I0DA 3BMVA 1AQ0A 2YDQA 2ZE0A 2D1ZA 1LJYA 3DYPA 4OUEA 4QAWA 1OGSA 1GOWA 5CSYA 5ABFA 2EPNA 1HT6A 3K8LA 5DT7A 1UD3A 3APGA 3GXDA 2XSAA 1M04A 1Q4NX 4NZFA 2OYLA 4DWSA 5ABFB 5BRPA 3CHEA 4J7RA 5HDRA 1GJUA 4E4PA 2E0PA 2B31A 3A22A 3CUHA 1QHPA 3RM8A 5DFAA 2WWDA 3FN9A 3W0KA 1LG1A 1VEOA 3BVVA 2FH6A 4PMRA 3VVGA 1CTNA 2EXOA 3PTQA 4M29A 4U31A 4GKLA 4WSKA 5GQBA 2J8FA 2DSVA 3IK2A 1CGYA 4BS0A 1B90A 4D6CA 4TXEA 3TOPA 2C0HA 3BUPA 1MFUA 1SMDA 1NWSA 4EE9A 2OWWA 1NWRA 1R75A 1NQ6A 4PUDA 4QDMA 1UWSA 1JDAA 3ARRA 3VGFA 3NSNA 1E5JA 4MDPA 2VI0A 3WNKA 2GK1A 3FAXA 4YN5A 3POHA 4W8AA 3AOFA 2V3FA 5IDIA 3W38A 6A3HA 4U5IA 3W26A 3WL1A 3RILA 3HMCA 1E15A 3T0DA 3T09A 3N1AA 2GK1B 4R27A 2BFGA 1CEOA 4C7DA 4CD6A 1PS3A 2XG9A 2GJXA 3D51A 2CKSA 4MAVA 3CPUA 4GZJA 2XVLA 3VGGA 2CKRA 4Q7NA 3OLEA 5C8BB 3WY1A 4L4PA 4WKHA 1FA2A 1EOKA 1WO2A 4HZ7A 5GNYA 2A3BA 2F7QA 5GNXA 5E6ZA 3UG3A 1JYVA 1QPKA 1GVIA 3DYOA 3GNRA 1C7SA 3GXPA 4V2XA 4RE4A 3WD3A 4D6HA 4R5EA 1Q6FA 1W32A 4W93A 1GZJA 3A47A 4W89A 1EA9C 3II1A 3O9NA 3O2LA 2YFOA 3WNPA 5A8QA 5CJ5A 2VQTA 2NT0A 5E9AA 1AQHA 2WM0A 3NUKA 1BVZA 3KLKA 4OBRA 4XZBA 1GCYA 3VX1A 4JKKA 3BAYA 2CBIA 3AIRA 4HZ6A 4CCCA 2CERA 4D72A 1M03A 1V0LA 4W7VA 1GUVA 4UZUA 1MQQA 2ZXDA 1E56A 1UKOA 1FP9A 4GXPA 2CYGA 3H55A 4W5ZA 3U7VA 3BUQA 1VRXA 4QCEA 1MFVA 2XIBA 1LWJA 3VD5A 4KRTA 1UR9A 2A3EA 5A6SA 1OIMA 2OWCA 1E9LA 2W62A 4RL3A 1GVYA 4DUVA 3HZ3A 1CGWA 1G1YA 4W84A 1QHZA 1KWGA 3CZJA 4NXKA 2XIIA 3GXFA 4HOXA 5KZ6A 1XSIA 3WF4A 2JE8A 4Z2HA 5DO8A 5A3HA 1VJZA 5DT5A 4B16A 2CNCA 2WZIA 1WP6A 4UFLA 1IV8A 2YA2A 3T2OA 6TAAA 1VEPA
chains in the Genus database with same CATH superfamily
1A4MA 2BMBA 3ZMNA 4OCSH 3HMXH 2VNCA 4KDTA 3KZPA 3AB0B 5SWZB 1L5GB 4Q22A 1A47A 1Z0NA 5GS0D 3EG9A 2QYGA 3HEIB 3L95B 4UQ3B 5EWIH 2IH1B 4I89A 3VFPB 3OM3B 3ENLA 2FJHA 4HIBA 1MI5D 4RV8A 3T0BA 3MU3A 1JERA 3W22A 5IHHA 3LXCA 3RVWD 2YXGA 2ZYRA 5K9OB 4GI4A 1NUGA 2QFPA 3ILQD 2JH2A 3BFQG 4N5ED 4QYOB 1L9WA 1FZJA 1YTKA 4Y2DB 3SAZA 3TN3A 1DTUA 4NQXB 5GGRB 4HEPG 2ARJA 1UR4A 5DURD 1TTPA 2C0AA 3ZJKA 4LCUB 5EEZA 3PV7A 5DJDB 4MUPA 1RULH 3ZXWA 3KPSE 4L8SC 4KROD 5LWYH 4NP4H 2Q1EA 3QJUB 3RF9A 4A2SA 1ZJHA 1DBJH 5L9DL 5GVJA 5C0CD 5JXEC 3RWGA 1FIEA 1EP2A 5ANME 2HTMA 4C4BA 1XP3A 3B4NA 5FAAA 1UP0A 1E6ZA 2ENQA 4YCPA 2H8ZA 4LKCA 1A7QL 3HGSA 4QY8A 5JQ6H 2Q86B 5DUJA 2PCFB 1TQVA 4BZYA 4B5SA 3W7DA 2YPKA 2P3ZA 1RAMA 2P7TB 5A8MA 3N9SA 1IBBA 1OE3A 2XWDA 3N1FC 3OODA 4ZQPA 3GLZA 4E0CA 4MDJB 4HJEA 3KYAA 2QSTA 3VKCA 3T6WA 3QV9A 2C3GA 3EKZA 1S46A 4R4NC 1CGSH 3ZRFC 2ZWSA 5SWSA 3BARA 4MNGA 1HQRA 5I1JL 5A1AA 4MSWB 2AMXA 5IBLC 4PCFA 2HLAB 3B3IB 1IEWA 5IM7B 4OLYH 2CA4A 4HC1L 2ITCA 2XLLA 1UUOA 1VF8A 4DZ8A 3LZOA 3GXIA 3F5WB 4A2FA 2EKSB 5G1YA 3QYMA 3JWOL 4FP8L 4WI7A 5T1LD 1EWHA 3OIXA 5BRZA 4X6DF 3HI5L 1OO2A 4JY4A 3KZSA 3N73A 2POTA 1AQDB 3ZDZB 3CXDH 4M62H 2PCPA 1KXQE 2ORBH 4G1MA 4HVBA 3FW6A 1TKWB 1ASQA 2WXDM 3S0CA 4F80A 3SDOA 4PJDA 2D7TL 2E47A 1OE1A 2PTWA 3IARA 1HH6A 1OK8A 3IAQA 1JGDA 5IR1B 3TWCL 2CUMA 3GSNL 4PJIB 3QHZL 2GK0B 4N2OA 5ILTH 1EQCA 1UWEL 5I6NA 2BSEA 2APWA 3U0HA 4BH7B 3I2CL 4D0DA 4AGNA 4GUQA 1OY3B 2J88A 2VIRB 5AAWA 1C5DB 3KAAA 4DM1A 5IHSA 5GZND 3O05A 2N7SA 1DUYB 1MDTA 4WX2A 4MWFB 3WQ5A 3RWDA 4Q9CA 1YG9A 4XWOD 2Z8VC 1GIGH 2WPBA 5D1ZA 2X0WA 2H26A 5EA0L 2PP8A 1RJLB 4GCXA 3WBEA 5HDQH 1AKJA 1IM9D 4GABA 4WGKA 3UBFA 3FT2A 1KBPA 4AX3A 4NM8H 2B9BA 5I2IA 1HWGB 1UB5A 2C1PA 3HM7A 2QDVA 1GZPB 3PJLA 2LLGA 4HCRH 2WXHA 4AMKH 1SEBA 4B15A 2XSXA 3M7OA 4O50A 5HXMA 4IS6A 3HE6C 3SBWA 4B60A 3DUUA 1YTEA 1J0HA 3FO2B 3USBA 4O4YH 4UTAA 4XP9H 3OVGA 5EIIG 4LVGA 4A8IA 4WFFE 3GMPB 4CQ8A 3HMJG 3PQYB 2XUWA 1P4CA 1IKFH 2OQJB 1MCKA 3TR9A 4LC6A 3PAZA 3L2LA 3VQ1C 3A6CH 2XRAL 1QO2A 3U4BL 4R9XA 4TQPA 3H8AA 1HC1A 2LTQC 3P74A 2AAAA 2K8MA 2YB1A 3GDRA 4YSOA 3SURA 1CZ8H 1BFOA 3SDXF 1Z9OA 2RALA 3EAKA 4QAMB 3TH4T 3NVTA 4XMKH 4HA1A 3E9AA 3LTSA 3L5WA 3P4OA 2WZ6A 5DRWA 4AYSA 2L5HA 5JUEL 2PDLA 4C83A 1GA2A 4O1FA 2Z6IA 1CR9L 1T5WB 1CFMA 3WBXA 1WZMA 3S88H 2XGBA 3T4CA 4ZX4A 4IYKA 3KXFA 2EDHA 1LF1A 3M88A 3P3YA 3A6BH 3RU6A 4QSHA 1HEJC 1MFDL 4P8WA 2RACA 5D7JD 5JXED 1JGEA 2ARJQ 1R0MA 5DD1H 2FZ9A 3BE1L 3OMIB 1B3JA 2VDQL 5D32A 1OAUH 4R4FL 4W7WA 1PKQA 1U36A 3NESA 4XMZA 1H0IA 4DAFA 2BODX 4LOVA 1UWGL 2FWLB 3B37A 3DGBA 3QO0A 1XW8A 5EMJA 5DQPA 1JFXA 1ZD6A 1KLZA 4LB4A 1QQDB 3OXRA 3MVTA 3FQTB 2VMDA 4R4ND 4TO8A 5GIRA 1F07A 2HPMA 5B8CA 1JZ8A 2KPNA 3MC5A 5IBLD 1ZCCA 1UM6L 1DZ0A 2CHWA 1NBYA 2YXMA 1MHPH 2DBJA 1Q94A 1TJIH 1ZV2A 3AJ7A 1F8TL 3FUJA 4Q9BA 1V6XA 3DX2A 4H19A 4HCLA 4TL4A 4ROQA 3DECA 1XH1A 2ZZ3A 3CUGA 1IEIA 3ARGA 4PRBA 4HLZG 1AW1A 5BOOA 4ZMLA 4ZNEE 4GH3A 1C8QA 1H5VA 3LGDA 4M6QA 3H9SD 1HU8A 4UTMA 2QL1A 1V3MA 4FEZA 3LN5B 3KYOA 3N85L 3VI3B 3FT0A 2GAZA 1Y65A 4HPJA 5CINL 3SSJA 5C09E 1A3QA 4ZAKC 3TC3A 3F6JA 3PWNB 4Y1AD 2KS0A 2ESCA 3BKYH 5BUGA 1QACA 3MA9H 3TJHC 3UZJA 3I50L 2YEQA 1TWDA 1TJ2A 2BVYA 1UZ1A 1C1EL 4BEIA 4DXXA 3RDTB 3SDAA 3H12A 3PPEA 3TSDA 2XIQA 3GFYA 4K3DL 1LK3L 3LHUA 3KH4A 1XLAA 3G08A 4AZCB 3MRLA 4P2QB 5B1CA 4EPEC 2OMZB 5AALA 1UXWB 1Z9NA 4K7PL 4KIRA 3RL2A 4MMZB 3V5OA 2WQPA 2BVQB 4ACPA 2WVTA 4EOWH 2UUDK 1YHTA 3T1FA 3LDVA 4AXNA 4QTIL 4O10A 3H6AA 4U6HA 4GRWB 1UWXK 1A14H 4I3RL 3L9CA 4H0HB 1QAPA 3QIWA 43C9B 3GHEH 2AL2B 5HGDB 5CKGA 2YL8A 5AHMA 4UUJA 3CWGA 3HE6D 1DN0A 5U7SA 2IQDA 1YJDL 3HBLA 3R2GA 5KVEE 1E9PB 1OZMA 4XP1H 5IMOA 3OAUH 1J9TA 4NB7A 5CEXB 2XQYG 3MA7A 3LS9A 3K1GA 1ZGLB 2QT6A 4F2ME 2FLRT 3F4CA 3PZ9A 4O8RA 3RI5K 4BZ1H 3C2AH 4W9TA 1Q8AA 4V2BA 1V3KA 3V0GA 3U6RB 2HISA 4LF2A 1V6VA 3SEPA 3KLAB 4RAHA 4EN3A 1J7VR 1P5BA 5IMMB 4JRYB 2C9RA 5D93C 3J8F7 3PGCB 1B0GB 4OV6F 1G6RH 4WGWB 3EPMA 4IPLA 1SF5A 1G87A 3ULUF 4QTHA 2INZA 3R06A 2GSIB 1DVFC 4JM4L 2OS7A 4V28A 4K7PX 3B9NA 3H9YA 3PFQA 3P60A 4WCYH 3GSXA 5I78A 3DCPA 1KCUH 2WB7A 5MHSE 4G7FA 1N64L 2JIXD 3IJSB 5DMNA 4ZG1A 2Z8SA 1M65A 1ONXA 5I6XC 1E73M 1I4FB 1PD1A 4AJWA 5ERWB 2DPEA 3DGGB 2DQTH 4XWGH 1YC8A 3QIBC 4MD5A 5F7MC 4F66A 4G6FD 1GW6A 1E55A 3DYMA 4J3OG 1JGVH 1JV2A 4IM4A 5EZPA 4LAZA 3GAYA 5T1JA 1IEQA 1CN4A 1LHZA 4FS0A 4EUPH 4FTVB 4I7ZC 1B9ZA 4JRWA 4LARL 5DMIL 1J1PL 3WQGA 2QVMA 2XX1A 3UZYA 3D07A 2VEGA 4O2FB 3OA5A 3MUJA 4TNVF 5DLMH 3VMPA 3W71A 1CWVA 4IKIA 3GD6A 4ECLA 1KPUA 4URIA 2AXFB 4XB3A 2BJMH 3BVUA 3PNZA 4QCIA 4FALA 1B9BA 1KRCC 1MCEA 4IOFC 1IBZA 3AGWA 1CDHA 4O51A 4RQQA 1EYEA 1TVBB 5HJLA 2MQ3A 3KDNA 2ICSA 1K8DB 5FB8B 1H2JA 3FHEA 3T81A 4B3LA 1GMIA 2ZUYA 1BV8A 3VXTB 4JRFA 2VEFA 1NTDA 5FHBH 3W76A 3BP6B 2XPKA 2TODA 1WBYA 3HI1A 2W5FA 2NSOA 4ZS7L 1W0VA 4O16A 3SIKA 4BIKA 1I9CB 4AMCA 4I6VA 2OSXA 2I5IA 3DFPA 4M5ZH 1V05A 3TZNA 4ZAKD 4EF9A 4FL4B 4PRPE 5DCBA 1NTHA 3U7YH 1QWGA 3H4GA 1XYFA 1KCLA 3FB7A 1OGAB 4PMEA 3FFDB 1PLGL 3D47A 3HR5B 4LF3A 3TTOA 3TQVA 1VLWA 1KC7A 3TJHD 3EBVA 3NCYP 4YR6B 3RFRA 2C79A 4JFHE 1NFDF 3W6YA 4MWAC 2VXQL 4PMDA 3VCNA 2CKNA 3QXAA 1KFKA 4OFQA 4Y4FC 4D0CB 3O81A 1LTDA 4TMCA 3SYOA 2ZC1A 1QNIA 1KCKA 2VC2H 4HF5L 4MHBA 3P3SA 1KEMH 1LO5A 5E99L 4AEOA 4U1NA 2Q09A 3UP8A 1JZFA 1FH5L 4TTDC 4K8RC 4O0QA 1IAOA 2E8YA 2VLRD 5KUKA 4DERA 4TSBH 1IIHA 5JHLL 4AWEA 5IB1B 2OMTB 1JV5B 1P84K 3RGHA 2A6IB 3CVBA 2E8ZA 3F7QA 3TYEA 4GLRH 1C8VA 2FPVA 3HI6H 2QVHA 4F0RA 4IQDA 1XGYH 1ONRA 4JFYB 3FDGA 2NW2A 4P46A 1HCZA 2ZSVB 5CBBA 1O4UA 3WJZA 1U8PA 3NFSL 1HJWA 1BEUA 1A0QL 4KNTA 3QDMB 4X80H 2NDFA 1KBIA 3RMJA 4HSCX 3OWRA 2Q6ZA 5FK9B 4DI9A 1LO4H 3MMEB 1XCTA 2JNZA 2EJ1A 4NO0B 3GHUA 1UWIA 1RP9A 5LBGA 1XIWC 3SE9H 3BTNA 3R79A 3O2DA 4UR8A 3LXUX 1G7MB 2JBMA 3JXAA 2OPCA 3RGBA 1ZSXA 3TEVA 4DIAA 4MYAA 3WN6A 3VDHA 4L4VB 1LP6A 3RWIB 1HTYA 4UM9A 2F7FA 4UOQA 3DV6B 1DVFD 4YSUA 4N2LA 4MCYB 4MBRA 4L9XA 2CBJA 4JHZA 1H11A 4XB8A 5A6AA 3SKMB 7ENLA 4M4RB 1UOVA 4L9LA 2DWXA 1KV3A 3T2QA 3AZTA 2V7HB 2EVHA 3VFVA 1CD1A 5C2UB 2X4NA 3MRFB 1D5BA 2YX0A 1NZRA 4X98A 4N0YH 2DM3A 1G0DA 3P54A 2YDSA 5HYQB 4B5XA 3QIBD 1ZBVA 2W65A 3WOVA 3VUSA 1S8DA 4BSWA 3NPSC 2JGQA 1ED3A 4W5UA 4G6JH 1WWBX 3BUVA 4WGHA 3TAOA 4EI5A 3N41B 1ZGDA 4QHLB 3M1ZA 4XP4H 4KQNA 1IEAB 3E2SA 3FJ4A 4EI0A 4H0GA 3KYKL 2ZCKH 2P4AB 2N3JA 1OCJA 4DTGH 2JKJA 4IOFD 5IV2A 4RXGA 3VFLA 3JS3A 3R19A 4M80A 3HS0B 5FOBA 1U1UA 1HQ4B 3TZVA 4NNPH 3NFUA 3P0YH 1EX0A 1DJXA 4AC2A 5HDWA 3FF7A 3VG0L 1YVLA 2DUAA 3QXBA 5JIKA 1NIAA 3JQOB 1YNLL 3R43A 1WHOA 1P0BA 2O4QA 3KE0A 1ZGLM 3KJ6L 3GRWL 2GYSA 1JGUH 1OL0A 5EO1B 5ID1A 2SODB 3DX5A 2PNDA 25C8H 3RVTC 2XJ7A 2ZOOA 1KRMA 3RKPA 2P24A 2NT1A 4KX9A 4P2RD 4N2FA 3WFDH 2IEPA 1OX4B 1Z3NA 3VRLE 3OVQA 1HUVA 3EFFB 4JMNA 1S6NA 4XH2B 3SGEI 5CEZE 4S10A 1JPFB 4LIQE 2IQAA 4TLTA 1BZ9A 1E6NA 3O41A 2FHBA 4KY1H 4FQXA 4PCNA 5BOPA 4MWAD 2WYSA 4Y4FD 3ZDYF 1EFXD 3RLVA 1OP9A 4A66A 4PHZA 2W07A 4CSSA 2XWJA 3CDZA 2FQIA 1MQKL 2ZXQA 5CZSA 1U91A 3FA4A 1NC4A 4K8RD 4TTDD 4ZFOB 3U57A 2B7PA 2BNRE 3GX9A 1VFOA 4MXWL 4C56B 4OFVA 1E1EA 3O3DB 2VN5A 1DVXA 2IMNA 5HVWA 2VISB 3WCYA 3Q67A 3N18A 1ZK9A 4PRHB 4GBXA 5F7FA 1WEJH 4R3SA 2B4CL 5GGQH 2D2HA 4QAWA 5K39A 1EO8H 1R3JB 4GC4A 1EBPA 3G6JF 4ZR8A 4MJHA 1EAPB 1ZHKA 1LOSA 4QRRA 1QLRB 4WUKL 5JPMC 1LG1A 2WSQA 2OV0A 1GKEA 1OF6A 3WS3A 4M29A 1FTXA 3FSWA 3ABQA 2VXTL 4K5PA 3IK2A 1OWWA 4UTTC 3TOPA 1EHLL 3CH0A 5AOKA 2AXGB 2C0HA 4Z7UA 1LO2L 3N0AA 4Q14A 5AZ0A 1XIWD 4MDPA 5FDWB 4DF1A 4A6YL 1EV2E 4EN2A 4U5IA 2QV2A 3UIYA 3HMCA 4KPHL 2WZ5A 3RR4A 2KC0A 4S3EA 4AHQA 1TJPA 4DP1X 1G4RA 3DXAE 4CMHB 2BVPA 4YE0A 5AN7A 3KBHE 3IF1B 4GNJA 1NAMH 3TXAA 3BN9D 4M6ML 3K6FA 3ETBJ 5LGZA 3DTUB 2Z25A 5E6ZA 4GXFA 3TF4A 3ATZA 4RGOH 3GNRA 4JY6A 4W93A 3UZEA 1Q6QA 5LGKA 4O1DA 1JCMP 1A3LL 1P7BA 3IJHB 2HFGH 3KLKA 3DEQA 1F86A 3O9WA 2IADA 2X53A 4IPPA 2O72A 1KNWA 5D7EA 3VRIB 4K3ZA 1IEXA 3RZCB 3VXOB 4CNPA 3QJHB 1YECL 1BVOA 3EO1A 2PDNA 4GW1A 4JIIX 1M71B 2W62A 1USZA 3MP4A 3FYPA 2XN9B 1MCPL 4XZHA 1YN6A 1SW0A 1IUZA 3TWYA 4Q4IA 4XZIA 4K2UL 5GRVL 3QDJD 2NMSA 4RIRA 2YQGA 3Q6GL 2OJEA 1VJZA 4OCXH 4UFLA 2YA2A 2HKHH 3GRIA 4Z7QB 4C6PA 3A67H 2DKUA 2PFHA 4I8YA 3GTFA 4NY2A 4MKSA 2O56A 4NO5B 1K3ZA 2K78A 3FOMB 2RGLA 5IY5B 1FFPA 1W17A 1W9BM 2VXVH 1NCCH 1GC1H 3HNTL 2FZDA 3G5XB 2ZOTA 1DJIA 2CXKA 3FCSA 3HJ0A 4GXVL 1J0KA 2Q10A 1HSBA 3F7PC 1ZHLA 2XIJA 2E86A 2BC4B 4A04A 1HESA 3ARDD 2NQLA 1DWJM 3RVTD 2JCCB 2CDFA 4FKHA 4JFDD 3VUAA 5D9NA 4YFEA 4IDJH 1XF0A 4DKEL 3VZYA 4HHMA 2GW5A 1WAWA 1OSZB 4P8QA 3E9TA 4UTBH 4RDYA 2MHAA 2W61A 1Q9KB 1SZRA 15C8H 2WQDA 1DJYA 5CP3A 2VLLA 3LEXA 4MQ7B 4QCFA 3STLA 4JPGA 4JX5A 1IC4H 4UV4H 4MRBA 1SN2A 4DP8X 3CD4A 4N25A 1NGXB 3K2MC 1R2RA 4CSTA 3GFZA 3FONB 3EOLA 4PR5B 5GGVH 4AVJA 3PUDA 1M6OB 3LKOA 3MCKA 2MUCA 1NSNL 1BAGA 1KENH 3GMLA 3SGDI 3C6SA 4TUJA 1Q0YL 3O2VH 4XKYA 2GQ3A 3M5VA 4JX0A 1SW3A 1FAIL 3CSYB 4FZ8H 4OZHF 1W1B1 3LV3A 2WZPD 3LNFA 3O45A 2P5WA 1FVDB 1OXYA 3DARA 4PJHB 4X63A 4GG6B 3CZLA 2G3NA 4RE2A 5HJ3A 2EH8L 5ADOL 2Z4GA 1US0A 3TYCA 5C86A 4Q89A 1K8IB 3MRRB 5D5MB 5DEFA 3UPCA 4S1QL 4ZXBC 3BWUC 4KETA 3OJDB 3FT9A 2A3TA 2VMFA 4HIJA 1AJ7H 5ITFB 3V0UA 4GMTH 1FO0A 3RHWK 4IP5A 3B9OA 1S7VA 2V7NB 5ISZB 5F7LB 1P7QA 2BOCA 4P7LA 4R7OA 2O6CA 2GTWA 4E3VA 4E41A 3I75A 4M7LL 4ZMWA 2P46B 4QRUA 4FOMA 5LZLA 4AZ7A 3ZUCA 5LGJB 1MCWM 2OBGA 2FPTA 3ZDZE 1RJQA 4LLYA 2XFFA 3W7CA 4XWUA 2WUCL 1OZQA 4ZB0A 3HZYA 3VH8A 1QBLL 1NH6A 3GH4A 1VSCA 2VDKL 3KS5A 3HZKB 2X30A 4ZSOA 1OM3L 3TCXA 3MLXH 4AOFA 1XZ0B 4Z3GA 1KV7A 4ODTL 1ZBWA 2R29A 4KTGA 3D0CA 4PJIE 4X7TA 2Y2YA 1KCVL 2QJGA 2X6UA 2BK8A 3T6VA 3DZ1A 4Z18A 3QC3A 1YEHH 1D5MA 4YFLF 1LQ2A 3QJQB 3NVDA 1GQKA 3MV9B 1TJ1A 1GKRA 1BIIA 2PUQT 3UGXA 1A5LC 3V55A 4QEGA 1OARH 5EZOL 5FA4A 4LAMA 1T40A 4QEEA 4AJYV 2B16A 3B9KB 1S1RA 3AREC 3QEGL 1KIUB 3QK0A 4X5WB 2XT1B 3H3PL 5HYSB 1HJSA 3UTTB 3S2JA 3VINA 3C6EA 3NJLA 3AWFA 2VFHA 4WUIA 1ZA6B 1UJQA 2V63A 4FO4A 1EDHA 3CMOL 3ONCA 5I5MA 4Q8UA 4L29B 3D2UB 3RPIA 1W2KT 4JZJC 1W3HA 1HS6A 2XGZA 1FKXA 3K74B 3W1MA 4UINL 5IFPA 1J05A 1LL4A 4GY7A 3D3VA 3RUGE 3FN3A 3KPLA 3HKFA 1S5IL 5CIPH 5LKNA 2CAKA 1LJMA 4BSJA 2EC9T 1MFBL 2VH5L 5J11B 2QCMA 3II3A 4KK9C 1O0VA 2PB1A 3BXNA 2WMKA 4MB1A 4GUHA 1EXUA 4HCIA 1H3WM 1E6XM 4GO6B 4XZUA 3UFYA 2A6DB 2X70A 3M7WA 1UMLA 5IVNA 1XH0A 1KFBA 1I0BA 3F3HA 2EDMA 3LLFA 4WFFD 2UZYA 1C5BL 5D1ZI 1ETJA 4HS6B 1QI2A 3WH7A 1DQKA 35C8H 4Z42C 4LSSH 5HYJA 3W75A 4XPHH 4YDKL 3OIHA 1JNJA 3DMMB 4XCFH 1NGYB 2BP0B 4C6QA 1OCZB 4NKDA 3K6NA 2C14A 2KZBA 1TG7A 3M1BA 3UZZA 2FX9H 2CGYA 1FLRH 5LIWX 3A0OA 1SVZA 1TV7A 1E5UI 1E6OL 3MUCA 2PCYA 1WE5A 5HMSA 1NU5A 5HNUA 4ZPVB 2WTRA 1KR0A 1A3ZA 4I9WE 3IMSA 4JDZA 1MF2L 4UTCA 1FN4A 4J3XA 2N7AA 1RD5A 3CSTA 4FI6A 5JW5A 2LR4A 4MJ5B 4XD4A 4P0DA 3MCOA 2CGZA 1DEDA 3E6EA 1OABA 1DYZA 5E03A 2FJHB 2E56A 1CLCA 3RCNA 2XH0A 1WTGT 4ZXBD 1ZCRA 2CLEA 5HATA 5AOZA 3SQBA 5DD3L 1FVEA 2R4SH 3EMQA 4N22A 1UYWL 4PJ9A 1QO3B 3OR7A 4DK5A 2EXSA 4P5UA 2BSSB 4O57A 4GYKA 4LBUA 4A67A 4K71C 2ARJB 2QPXA 4WWID 2Y9RT 5AKQA 1XLHA 1LQAA 3NACH 1J1OH 4F2FA 3KR3H 1TNMA 1NAL1 3FYOA 1ES0B 1F45A 3BDYL 5I8OH 5FUZL 2PDHA 3S4TA 4A2LA 1AC6A 3T08A 3L1FA 3RWGB 3L3OA 4TQEL 1W9PA 4GACA 2VUOA 5AOMA 2ADFH 1HW6A 1X4YA 5K1JA 2XZCH 3GSUA 4TVPL 4M5YL 3FUDA 2EVFA 3NFPB 1EA0A 3Q8FA 3JUGA 5FOOA 2VQUA 1HI6B 1T7XA 1YEYA 4D6GA 1ZLWH 3WIHL 3FU9A 2VD9A 3E8UH 5FOJA 2YPKB 1A6VL 3KTCA 3F83A 3MCNA 5CH9A 1U8KB 2AQPA 2YGNA 4KXBA 5BWFA 3MFFB 2Z35A 3GY1A 5GPRA 4L4LA 2CR0A 3LNMA 4WK4B 3CAFA 5EFFA 2F53A 3HPXA 3W2DH 3WY3A 3ARED 4UF7C 4IMDA 4LUSB 1DSFL 4DZ8B 2LU3A 4AUJA 4FXGC 3CN4A 3WFAA 4DGYL 2BVEA 3QNZA 3MLPA 1MCOL 3N9GH 4RNJA 4H1ZA 1UZDA 2I5GA 2PCPB 3D18A 4FERA 4XVOA 3W81A 1X4XA 2XTKA 1RALA 4LSBA 2O5YL 3WLMA 4D8PA 5BOJA 4XPTL 3AVEA 1HH6B 3K71A 2RFGA 4L9YA 5EN2B 1JGDB 4UMBA 3TVMA 4RZ5A 1MSSA 1ZEAH 3QIUA 3FO1A 4JYDA 2E9GA 3ASNB 4PWKA 4KK9D 1U5JA 4ZTOH 4F91B 5C5YA 1PCWA 3PAOA 2PWDA 2ZA3A 1YO4A 4UT6H 3NCXA 3CFTA 2NNFA 5FX3A 4J23A 1KJ2A 5DVOA 2YPLA 4GW4A 4H88L 3RWDB 3NRFA 1MDAA 4A8LA 1CE1L 4H8UA 4QRPD 5H8UA 2NSXA 2EVJA 1W3LA 2H4EA 3PWUA 4OLZL 2J71A 4AQEB 2WJ7A 2FHCA 4NAMA 5LAPA 1S2CA 1HKVA 3NXFA 2AGJL 3CAWA 1ZP4A 1ZFJA 4EMZA 4X9FA 3NFNB 1A80A 4PEEA 5JHMA 4HKJB 2A1WL 2YHGA 5I2IB 5I5IA 1NEZG 1WT5A 3ROOA 3BGMA 3BZEA 3GMOA 2I7GA 1SEBB 3ATEA 1UZGA 3LS4L 4YHOH 4IS6B 2NUXA 1U8JA 3C60B 3ALGA 3G0SA 1OINA 4PI0A 2OWXA 5MHSD 5SWQA 5EUOF 1B2YA 1B6UA 1K5NA 4JVPA 3HE7A 4HUNB 3N55A 1FKWA 4X60A 4F15C 2GUUA 4GQ9H 5IKCA 4RX4A 5A2KH 1P53A 5F7EH 1PKOA 2QCDA 3ID7A 2VVSA 4CQAA 2R56H 4I13B 2ZXBA 3MRHB 2E7LA 4DZ5A 5EEUA 5EV7A 4M48L 4GZEA 5J8LA 2OZ4H 4KX7A 4PGDB 5F70A 2AZAA 3M1OA 3C8NA 4OZGE 2ZUWA 1TJRA 4C83B 2E9MA 2EUZA 3WIFA 4K3EL 2HG5A 3L08A 3I6EA 3KXFB 3T71A 2AMGA 1NCJA 5GGVY 5I26A 3RAJH 4X5QA 5J12C 5EF1A 2Y88A 1BFSA 4XSLA 3ITLA 4K8RH 4G5DA 5AW3B 1GVQA 2CDGA 2PR4L 1PKQB 3QPXL 1LM1A 1OAYH 3VVWA 3KAOA 2O5XH 4WNJA 4DQOL 3QO0B 1MHHB 2OYPA 1JXJA 3VNDA 1ZPTA 4MAZA 3UFIA 5IW6A 4PRPD 5AVTB 1UQYA 1KY6A 3OXRB 1RV8A 2OTPA 2D2OA 5J3HD 4A2RA 4ANKA 4W4NA 2EO7A 2EDWA 5GIRB 5FO7B 2OO6A 2OEMA 4QUOA 3PZMA 3EO9H 3UTSE 1TTRA 4WU7A 3CT2A 1XX1A 5HNTA 1A4JA 1Q94B 4R33A 1E30A 3VSVA 2BDNH 5C3TA 4R90L 3EUDA 3GKWH 4WVRA 3G1AA 1UTDA 3CDGA 1V8HA 2DB8A 5KSUB 3ARGB 4PRBB 2D7PA 1LBMA 5D9SA 3WTUA 3WD5H 3VGDA 3S1GA 2XSBA 3UJEA 3QRFM 3KYOB 2J4WH 5EU6B 1GC1C 4QRTA 3TJEH 4J5NA 4UTUA 2R2HB 3S34H 1UUNA 1XLFA 4JJOA 4HA0A 2UV3A 1IGMH 2X9XA 4TSAL 5FYKL 3TYGL 5DJ0B 3GC2A 1XYCA 3OO2A 3D0VB 3XIMA 3P93A 5I16A 3CAVA 2NQ9A 3QDME 4X7SH 2D0HA 3BSMA 1MW0A 3KVQA 2X1UA 4WDWA 4DAGH 3EO0A 2R94A 5IJKC 5SX5H 4H20H 4XBSA 1MEWA 5ICXA 5JQ9A 3SDAB 5KJ7E 5D2LF 3BP4A 2V3GA 1YPFA 3E6HB 4MSSA 2IPTL 3L9YA 3AWEA 3Q1SH 1BZOA 3OGOE 2CZFA 1TZ8A 3G08B 3B0VC 2OK0H 3MRLB 4JDEA 3QDHA 4TMBA 3IGLA 4K3JL 1FCGA 3ZFHA 4UQBA 3KDPB 4O0KA 3D52A 4LSQL 3RL2B 3SCPA 4L4VE 1QFPA 1E4XH 2E7HA 3ULUL 5AWNH 4X6CE 2ZTBA 1T20A 2HX8A 1R5IA 3T1FB 3RO6A 3ZIYA 3NA8A 3IDNA 4U6HB 4GS7C 4QI3A 1Q45A 3OPSA 1TQCB 3PAYA 5GGRY 3NZ1A 2YW3A 2EYTB 3KJ4C 3QIWB 5EEYA 3GDCA 4L3ED 4MJ2A 2GT9A 3QEQA 3AQDA 1QRNE 1Q85A 3RWFA 1M6UA 3ZL2A 2YCEA 3LQZA 5DD5L 1MREL 2VC5A 1G01A 2W94A 1FZKA 3TO2A 2FHFA 2JB6A 1LT7A 1KW1A 1E4MM 4FQCL 4HUXB 4KJQC 3CZ8A 1AMKA 5C2GA 1RI8A 4OCYH 3CH9A 4EN3B 5A6JA 3ZSTA 1FHGA 2XKSA 1MI3A 2CHXA 3P11L 4P8UA 1JVKA 2AQOA 2Y6ZA 3HIZA 2QUTA 2F8QA 3S47A 3U1PA 4BQ9A 1K8ZA 2DQWA 3MJ8A 3GUFA 1FNFA 2Q9OA 4GY4A 1UPMB 1ESWA 5CBEB 4PJXF 1CZ1A 4F93B 3TIEA 1U1JA 3QWNA 3RIAF 1L3NA 5J9PB 2M26A 3EOTL 5LNDA 4M03A 4HKXA 4OGXL 1F3XA 4BEQA 2WKGA 2QGCA 5FHAL 4HWBL 1AO7E 2BXVA 3MUAA 3UC0H 1MQPA 1B31A 3BE7A 1JZ2A 4DQAA 3VI4A 3TH2T 3UEZA 3U9UB 4LDEB 3S0PA 5KVGL 2J9YA 3WIAA 1MYRA 4ALAL 5G4NA 1Z66A 1UM4L 4LS2A 3HCVA 4I1RA 3IJLA 3QUMH 1JWUA 4L8BB 5ABZA 1GVFA 1AQ0A 3H2CA 1QLEL 1BD2E 1WA2X 1D5IL 1OGPA 4WEBL 1KPUB 1RK7A 1FZMA 4QCIB 3OKEA 1V55B 2Y70A 4NO3A 3CH8A 1H7RA 3A22A 4JFFE 4Q32A 1SJMA 4X4XA 4UWMA 2D03L 1FWDC 1FXQA 3NL3A 4ZUTB 3ZTNL 3VXRE 5KETA 4BS0A 4TXEA 5BS0D 3R10A 4UNVA 4LLUA 3ARRA 1E5JA 3G1VA 2KPWA 3LIZA 5IJBC 2N01B 1OD7A 3FAXA 1F2JA 2DOCA 3ZE1E 1SO5A 3N1AA 3M17B 2IPWA 2DBLH 2C9UA 2CMRL 5HGBA 2CKSA 1MCFA 4NYUA 4MMXC 4XNUL 4YHNA 4BWLA 2B81A 1T1XA 3CQHA 3TN0C 5DC0A 1ICTA 4NT0A 5TE4H 2YPVH 3S1WA 2DWYA 3QCVL 1RAKA 2WP3T 2NLYA 4V2XA 4D6HA 1G1CA 3T6ZA 5D37A 4PJBE 5EEWA 4R7JA 2GB2A 4PWIA 2BIQA 2IKIA 1KGJA 1NMBH 2R1MA 1P0EA 3TX4A 2P44B 5I82A 2JB5L 4R26L 1GYNA 1XRTA 3G3MA 1MELA 5BV7L 5JW4N 4U1NB 1NDYA 1MQQA 3U7WL 3DOSB 1E56A 1GPOL 1SYSB 2VO8A 4OAWA 1TR7A 1N8WA 3RWHB 2FB2A 4K39A 1W8OA 2VXUL 4ANUA 4LCWD 2VDPB 1CT8B 2OJZH 5I17A 4ZT1A 2WP3O 3MLWL 4MVAA 2A3EA 3LKPB 1S2UA 5KOMC 3O8XB 1NF7A 1CDUA 3BPWA 3UR5A 5C3IA 2LHAA 3DXAD 3HNVH 4W6XB 1TCDA 3URNA 1QWNA 4OVUA 3CYJA 4P46B 1DVZA 2IBGA 1TZ9A 5GNZA 1PVNA 3UXFA 2GHWB 3BAXA 3OC5A 1IGSA 1AGEB 4M7JH 3C2OA 4LJ3A 1MCLA 3NRPA 2D69A 2HJLA 3ZLFA 4NRXA 1RA0A 2NX9A 4XC3H 5M03A 3WSQL 3WQOA 5HVGB 5FKAA 2WHMA 3PGFL 1NUFA 2R6OA 2ED7A 3SDDC 2K6YA 4DJFA 5IOBA 2E7CA 3GKFA 4DFHA 1LRNA 4KJQD 2V4LA 2C3HA 4J3OF 3GM8A 1UZ6F 1MCCA 3M7SA 3NZHL 1HOEA 1N55A 3GNML 1MWAB 1IFGA 5CEYB 4WF7A 2CM6A 4YDJA 3UGEA 2W1NA 2X1WL 5CJBA 5FI8A 3VFUB 3UXKA 1VACA 5DJCA 1XGZA 3WEZA 3FFCD 4HGWA 4X4ME 3HAEG 2EF9A 3OX8B 4NYLB 2AJUL 2NY3C 1Q2SA 3L7FB 5EGRA 1LEGA 4NKOA 3U5UA 4ZQCA 1D6EB 2ZF9A 3OKKB 4QXGL 2ZXWB 4JS7A 2Z2UA 4HHWA 1BVLA 1OCOB 4OD2A 3PGDB 1CD1B 1BG4A 2DZBA 1SQ7A 3RR1A 2X4NB 1D5BB 2ZC8A 2JCCE 3HGRA 1EC7A 1ONEA 3WTWA 3EB3A 4H9TA 3BGAA 4Q6XA 1OK4A 1UGKA 1Q9LA 1AR2A 3WKPA 4LLMA 1LG2A 3ASOB 5DJ6A 2WUBH 3ISIX 2H1LM 1P4BL 2E77A 3UAEA 1TE1A 4QNWA 1S8DB 4EXQA 5IG7B 1KXTB 3LDBC 1GCFA 3SDCA 1NIBA 4OV5A 2BS8A 4U3AA 2UWEF 3Q45A 4P23A 1BYAA 4GUCA 1DJHA 4X4ZA 2NQ5A 1JGIA 4LAUA 1T41A 5DT1L 3QQWA 2LOEA 2L4OA 4LB8A 5AVSB 5JPNA 2BG5A 3C5ZC 1Y6NR 1DIKA 3U2SA 1VFSA 5FOBB 2IH3B 1O5KA 3FFSA 3B2MA 3RPKA 1T83C 4NQEA 3GBNL 2YBGA 5BW7A 4EPDC 3EWDA 4S1FA 1A7RL 5LSMA 2TYSA 2CLHA 3KWWA 2PP1A 3WD4A 2B39A 3FQ1A 1BXUA 1EBGA 4PJCA 4P5RA 1I9IH 4OTXL 1X5FA 3O6FC 3V95A 4JEGB 3OJGA 1XGRA 2P24B 5IQNA 1OTSC 3EJPA 2GJ6A 3NCWA 2LAGB 1CGXA 3HC4L 1AZCA 1W16A 2FE0A 1FCQA 2EACA 3TN0D 1WISA 1F5ZA 4Y9OA 4U33A 1MSPA 4FA8A 3AITA 4TULH 4X0NA 1OW0A 1UG9A 3B8IA 5DWPA 3DHJA 2LLNA 2NY5C 5CGMA 2FEJA 1OVDA 3F7KA 3SIMA 4R84A 4BWTA 4FQXB 4PGEB 4B53A 5F7AA 3T78A 4LCCB 4KY2A 4ZSTA 2ZUXA 1WSST 4Q9QL 1ILUA 3CYVA 2W07B 2ZKMX 4PGBA 2XWJB 1NICA 1ZSDA 2HT2C 2EEBA 5C0AE 1N19A 1TPUA 1U91B 4JPVH 2H32H 2F7OA 1X1OA 4TX9A 3LHPH 1NC4B 3VXSB 3CUZA 4R6UA 4BQ8A 3P9LB 2RDTA 4EDWL 3NL5A 1HF6A 2ZQ0A 4KQ3L 2NW0A 2ZAGA 5F3HA 2HFEA 4OH2A 1W9UA 3DG7A 1HHJA 4R3SB 4WW2F 1C9DA 4GIYA 1E5YA 4M93B 3CPLA 3VACA 2HV5A 4OGYH 4I9AA 4FE9A 4AUYA 2BX7A 4CKVX 2Y07H 2FJGB 1ZHKB 4MMWA 1K9TA 1YZZA 4QRRB 4KFNA 1XBZA 1GQJA 4FABH 5FJOA 1VYRA 4G11A 2GBTA 3SDDD 5I73C 3IANA 2DQUH 3L5XL 4XAZA 4GQRA 4D0BA 5ICZA 4TRPL 1SO4A 4Z7UB 2GSJA 2DTML 3AFBA 3DGDA 4RSYA 4C59B 4JHBA 2VC6A 3L5LA 2HFTA 2DJMA 3H54A 1E4KA 3D5OF 5F0PB 3C0QA 3SE8L 2YBTA 3NIDB 4TYUA 1A2YA 4KMQA 4YDLC 3M07A 1Q6GA 1OSYA 5KVEH 2BVPB 3FB5B 1ORQA 3VM7A 2YGPA 4MAYA 2NUPA 2NY3D 3FT3B 1E5AA 4ATWA 1UW9A 5C71A 3WQCA 2W88A 3IGAA 5I0WA 4NRZA 4HJFA 3AY4C 4BD4A 3F64A 2H1PH 3N40P 3IGXA 4ZE5A 3O9WB 1BVNT 1BP3B 4DVRL 1S2TA 43CAA 3MRMB 1QYGL 4AXKA 1SMAA 3LPOA 4HT1L 1TPEA 3NEVA 3H42L 4GW5A 1N3NA 4KCTA 3CQKA 3EO1B 1GAFH 1P4IL 4GW1B 4TR9A 1XR9A 4ZFFA 3T0EB 5HA7A 2WQRA 2GQAA 3KP0A 1QSZA 3FZUC 5E4IA 2GUOA 2WVUA 4RIRB 2VCCA 1N8IA 3USZA 4R5TA 2OJEB 3M46A 3PV6B 1F3DH 2Y5JA 1FBIH 4JHOA 2Y22A 4QX4A 3ZMRA 3WJMB 4F0LA 5DHVA 2A7PA 3R0DA 1A21A 5M7QA 3UTOA 3EKLA 3IVSA 4NWTH 5DQJA 3QEHA 1M1BA 2EVIA 1TE6A 3WMCA 3MI3A 3MNWB 5ID0A 2R0LL 2VSDA 4N2NA 1HSBB 3BXWA 1S7TA 1FNEA 3O6FD 1HH9A 4FNSA 2QCEA 4DW2L 1G9MH 4Q8PA 3TLLA 4UTWA 3VIJA 1OTSD 4Y19A 4FYRA 4AG4H 1IFRA 2ODIA 5F3BB 1II4E 4LV9A 1JZ6A 3MV8E 4JTIA 2WN3A 4UT7L 4PUEA 1BFVL 4I5BA 4A2EA 2X1IA 2MHAB 1BM3L 1BQLH 1HAUA 3C9NA 2OI9C 3MNVA 1YQVL 4AC4A 4V1DB 4HH8A 1BMWA 3TTYA 3KHOA 5A16B 2VLLB 3LEXB 3L1EA 2AERT 4AITA 4N8CH 4XTRC 4JLRA 2HQAA 2Q8XA 1S3RA 2UZXB 2Z1KA 2WBXA 3CBWA 3RNDA 2HT2D 3AW5A 4D1JA 3RLHA 1T96A 4WV1A 2G5RA 3ES6B 1ZJBA 5B3NA 3H85A 5T3XL 2WBGA 2XCMC 3N2TA 1MCQA 3ULSA 3MCKB 3W1RA 3Q6FA 3WLJA 4Z8FH 3GMLB 1WFUA 3DJ9A 5CC7A 2V5DA 3QUYC 1FI8C 4TUJB 2QPUA 4XKYB 1HKLL 1ASOA 1XF5A 4YHZL 3BCFA 3NAAL 3COTA 1RZ7L 2Y8UA 4KFOA 4AD2A 1ETB1 4I9TA 4UT9A 1QMUA 4LEOA 1MUCA 1XJBA 1AHWC 3F65A 1F90L 2WAHA 1IB5A 1XAKA 4CBZA 2CU9A 3LD8B 2IBZY 5HJ3B 2E5EA 3VRJB 1AD0B 5D6DC 3RITA 2Z2BA 1W2VA 1ZTXL 3DHUA 2EIEA 2A7NA 3LU2A 1KRAC 4LLWB 3CH1A 3LMZA 5T5FL 5DEFB 1NGWA 2O5ZH 3LSOA 5HYFA 1E2WA 1TQUA 2CJSA 3S3SA 1IZKA 2QCNA 2PTUA 1V5JA 2Q02A 5E8DL 2DZUA 1S2VA 5H2BB 3KPRB 1WKDA 2QQLL 1DXEA 1S7VB 2ISDA 2XM2A 4WI9A 3WELA 3LZPA 5F1KC 1P7QB 2BOCB 1QASA 2R2CA 3BQUB 2GTWB 3I75B 3MROB 1AXIB 3O6ML 3W23A 5I00A 1C9SA 1KLGA 4LLYB 1A8JH 3QV8A 3VNYA 3UY8A 3HZYB 1LLAA 4ODXA 3ATDA 2AJYL 3LCHA 1YYML 2IXQA 3EDEA 2JI1A 1W5NA 4NUQA 4RMBA 4ONOA 4F0HA 2CJTA 4XMLH 4F33B 3UZ5A 5AAMC 4AIOA 2UY2A 2YUWA 3GYRA 1TQJA 3T77B 5BMFH 2EXWC 5AVYB 5FAJA 2E40A 4M1BA 3S6DA 3MOAL 3R0NA 4HMDA 3FZUD 2GBAA 5ETUB 3ZJAA 1FGNL 5FA4B 5C6PB 4WJ5A 3DFQA 1F4XL 2V37A 3V6ZA 2FMOA 5CUSH 1MJ7L 3IFLH 1Q72L 3BT2H 3MPGA 4J12A 3G7TA 4FXTA 2WAQA 3ECQA 3TTEA 2B77A 1MVFA 4AC7C 2F7IA 2WYIA 5AW0B 2XH7A 3VD0A 6FABL 1E3ZA 2ZUUA 1FWHC 2X38A 3BP7B 1XIHA 4ICMA 6TIMA 1ITCA 1L9RA 4U1IA 3WNJA 3D3VB 3NCYS 2N7BA 3OAZH 5D72L 4QF1B 3X17A 3F4NA 5JO5B 5LNWA 1CTOA 1ZK5A 4IG2B 1N2RB 2Y7GA 2P80A 1SBSH 3JYBA 4QRFA 3QH3A 5FF4A 4BGDA 5ECVA 3BXNB 4XZUB 5KVFL 3T4AC 3FF8A 2D3JA 5A6TC 2QHAA 3CUFA 1XMEB 2EILB 2CPCA 1OCNA 2PDWA 2DZVA 3PPGA 2L8AA 1IT7A 1JPST 1QMLA 2ICWA 1GGUA 3GWJA 4P5TC 1VIZA 4PTMA 4M6NL 3APMA 5HYJB 4GUFA 3P2VA 3V10A 2J75A 4P05A 4HTYA 2X6MA 1ZP3A 4RFOL 1F3EA 4D9RE 4ELMB 1W6TA 1I8UA 1IIGA 3R1GH 4DP6X 2WQXA 1J2BA 1RUSA 5B22A 1W72L 2VEMA 4XAKE 2YAEA 1KF9B 5CEZH 3AQXA 3I85A 4LIQH 4BK8A 5I18L 3NDYA 3QUYD 3CGTA 1QD0A 4TIMA 5ACZA 4O5LL 2ZUQC 3HNSH 2WTRB 3VK5A 3RZWA 2QHRH 4GT0A 4IJ3B 1W3JA 1CVRA 1FN4B 1AXTH 4Q8VA 4R7WA 3OEXA 4DHGA 2IOMA 5JW5B 3W4RA 4U0RB 5E8EA 4MQXC 2EUVA 4Y2WA 1QR7A 4KQ4H 3WQFA 1R6VA 1S7RB 3R0MA 2WANA 3IIXA 4MGXA 1I85C 3ECVA 3HFMH 1THAA 3SSGA 1X7IA 4KX8A 3BPNC 1J2WA 3W7EA 5JR1H 3L5HA 3TA6A 3SQBB 4A22A 4JPKL 4GGHA 3WNNA 3OR7B 3UO1L 2EG7A 1POKA 2X4PB 5SWZE 5LCVL 3BYYA 4FG4A 1BXBA 3HUJA 2OM5A 5AVVB 1R3YA 2PDFA 2V5JA 4H5SA 3UTSD 1O12A 5GISL 5F1VA 3BMXA 3L3OB 5K9KA 3DN5A 2JMRA 4Y4HA 9XIAA 3GSUB 3LPGA 3QY6A 5TDPA 4BA0A 2VZ1A 4IOSA 4WGVB 3L0NA 4GSUA 1N8FA 5DBUA 4LL9A 2FAUA 1MRFL 3FT4A 1FVPA 1OIOA 2EXWD 4FB7A 3MJ9H 3IACA 3D8MA 3QULB 3NG3A 4DPPA 1A6PA 1MIEH 2IV8A 2XGIA 4ENZA 4KBPA 2I14A 1KCRH 1YE6A 3AG3B 3EIFA 1NVMA 3MMUA 3PIQA 2YSSA 3FMGH 5FL1A 5JXAH 5DMLA 1RZ8A 3KPSD 3LHYA 4LZKA 1S9VA 2AZUA 2PWFA 5D33A 4I0PC 3WFEL 2AI0L 5E2UH 3WK1A 3MYPA 3QNZB 4QXIA 4X0VA 3DUGA 3E0LA 3I9AA 4KTDH 2H3BA 1L6FA 1S5VA 1OGTA 3D18B 4PGCA 3S6OA 4XMTA 3F4WA 4EPBC 3BH8A 4HU4A 2MFNA 2NLIA 3K2UH 3EEGA 1YEIL 4XOCA 4X2RA 3I74A 1AY1L 3H2NA 2WWOA 2HKFH 2OZ8A 5AYBA 1O6VA 4XXCA 1QI0A 3WY2A 3L7RA 1WUNT 2Y1ZA 5PAZA 5CSRA 1IT9H 4F9LC 3V0WL 4N2EA 2Q87A 1QRND 5JHDB 2PEVA 3NJFA 4HEME 3UABA 4JO8A 4XVTL 1QFWH 1FDLH 1U8CA 4GO9A 4R97C 5MEOB 4DI8A 2YPLB 3EHBB 4O2EA 3PDOA 2NZLA 4P5TD 3IJ7A 4N4PA 2EYRB 4HPYH 2VUYA 4N9GA 1OTUC 4WDIA 5CS7A 2YKLH 1KT2A 1EFZA 1UKPA 3SY6A 4Y8EA 1IRAY 4HWEL 2E7DA 3UCCA 1HZYA 1BKSA 1TQXA 3QRGL 7TIMA 5CLWA 4OQVA 2O26U 4F37K 4LFHD 4OD3H 2CKBL 5LXGH 3SBRA 2J78A 1LWIA 3FL7A 4DNHA 3ROOB 1NMCC 2OX5A 3BGMB 3HA0A 2NCEA 3GMOB 3GU1A 1GOWA 1LM8V 1IC0A 1HZHL 2VN4A 3DSNB 3BO9A 4MD4B 1U8JB 4ODHL 1R38A 5BRPA 3CHEA 4K2SA 1F18A 1TZIA 3GVVA 5DFAA 2IFFL 1ZMYA 2B1AL 3AWNA 4Y5YA 5FKPB 4Z7WA 3CK5A 2P26A 1BRLA 1AQKH 2W9DH 4MQXD 5AW1B 3BPLB 5T1KA 1MFUA 5IKCB 4GUPA 1LEIB 1AO7D 1AKPA 2ZG2A 3VGFA 2IDCA 4M19A 2VMJA 4PTDA 2R59A 5KSWA 1AJZA 5C0RL 4FFYA 4PTTA 4MDIA 4ONGL 4LOEA 3AABA 1F0LA 2PLCA 4M3JA 5EO9A 4C7DA 3BX7C 3PG9A 4XMPL 1PE1A 2B0MA 3N5AA 5GGTH 2WGXA 2LLLA 5BU6A 2PXYC 4CDGC 5I6LA 1YPXA 4TQHA 3RTQA 2UY6B 3PQYE 1BD2D 4JKWA 2DDQL 3RFZA 3WIFB 4XC1H 3MC0A 2HG5B 1NC2D 2XIDA 3WD3A 4Q4EA 3NIGB 4X9IA 1WS8A 4JFFD 3TN6A 4OBRA 3P4MB 4IGSA 9RUBA 3VXRD 1SO3A 2LVEA 4NJHA 3SHSA 1UR3M 3GM0A 2E68A 3B6SA 3WLIA 1DR9A 3GFXA 4IJBA 5DLLA 5JW4Q 3FRUB 4GXPA 3QLLA 5DR5L 2OQLA 3BUYA 2ZRWA 5J8OA 4XTDA 3MGAA 4MJ6A 2ICEC 4QRQB 3BWSA 4UIMA 4D9PA 2ZYIA 2LLEA 4KFPA 5LUMA 1GZ1A 3VB9A 2Y1AA 4GP4B 4HOMA 3HQ1A 2EC9U 4NXKA 1PYMA 5IW6B 1YMHA 4DO7A 4MJZA 4BZ2H 5A3HA 3MLZH 3FO0H 2CBQA 3S2MA 3SCWA 5EC2A 2VMEA 3B1TA 2C9XA 1CK0L 3BRDA 5CU5A 4PTUA 5F0LB 3BZDA 2BWDA 2DT3A 4WU7B 2Y06L 3TH3T 5E8NA 4I0PD 1NCDH 1PZBA 2Y7QA 5AYYA 4LOFA 3EG9B 3CDGB 3GBDA 1K02A 3I3BA 3B2VH 5DS1A 2D2JA 5D9SB 4KXZI 4S2SA 4GZIA 4ONHA 1IBDA 4NVTA 4Y5VC 1ONWA 2AKMA 1XG3A 3UBXA 1MIML 3I10A 1UCBH 5DZJA 5DYOA 4V27A 1AQMA 4IIEA 1KV8A 1I6NA 4NZ5A 1VAHA 4HJJH 5KS9F 1DV7A 5K59F 4GVFA 1LDSA 3MJ7A 1FZJB 5C0GA 4XI5C 5I16B 1ZAIA 3RGTA 2A5UA 3VMOA 2ZICA 1ZL1A 1G9MC 4IKLA 3PHQA 1W1IE 3EO0B 1ZNNA 2NX5A 4UZGA 1ME9A 1OX5A 5ICXB 3OQ8A 2VOTA 1QWKA 5HHVL 1H8LA 1X5XA 3BP4B 4S1RL 4NHUA 4E68A 1ZLWK 3VI3E 1A9EA 4EAYA 1OTUD 2FX7L 3O4OB 4UZSA 1JD7A 1GYLA 4HSOA 4LKCB 1RURH 2FKPA 4QY8B 5K4ZA 3H7VA 4XPAH 1LTXA 2XWCA 2VLKA 1T20B 3B03A 4FA6A 5C09D 2NVDA 3IDNB 1DZBA 3BDXA 4PN6A 4OOZA 5HJXA 5L9FA 1LK2A 5EKYA 1H3XA 3AXLA 1UP2A 1XYBA 2VW4A 5SWSB 4QHUA 4MNGB 1HQRB 4BY3A 5CC5A 3QM3A 3APTA 3AZUA 4NJAH 3FUKA 4P2QE 3ITVA 5EPDA 2ITCB 4JHWL 4X22A 2XV3A 3OJ2C 2DWEA 2JQAA 4M7TA 5J1SC 1FZKB 5LQBH 4XVEA 4LEBA 3B5HA 5HQLA 5BRZB 4YK4B 4JY4B 3IEAA 2HVNA 5B1KA 2X2JA 5DFWH 1P5UC 4GRWE 4G1MB 4N20A 1OAKL 1Q65A 1PHQA 4TM9A 2I26N 1ZT1A 4PJDB 4AQLA 3RI5F 4IU3A 2RB8A 4QQ3A 2ZTKA 2FR4A 1DYSA 1MW3A 3QCUL 4CU8A 4JN1L 1EGMA 1EAOA 2PXYD 2NY5H 4PCPA 4Y89A 2RH0A 1AZRA 2X9YA 4F7KA 4KKNA 2E09A 4D0DB 4ZZFA 4FOJA 3TIEB 2H5UA 4LSTH 2V3DA 4GT7A 4XBMA 4LP5A 3CC5A 3TYAA 3PS6A 4LP8A 4HHLA 4A68A 4NGHL 1NWUA 4MKNA 1IGCL 4X8CA 1GKOA 1KDIA 5EYWA 3SCRA 4LRTA 2V33A 2JJWA 4JRYE 5D1ZB 4KKXA 2H26B 3NM1A 2A74A 4MS6A 5IOPA 5L0QC 1LILA 3VI4B 1AKJB 3QS2A 5G5IA 4JQIL 3FT2B 1R30A 1OK6A 4GQPH 2CIPA 2WBKA 2NYZA 2GOKA 1UB5B 2C1PB 3HCVB 2J8HA 4JPWL 2X4QA 5HHOA 2DF3A 3EGDA 1AXSA 2IPFA 2PGRA 3WKNA 2HS6A 2FEEI 2EADA 4TUOA 1X39A 4WSHA 3DUUB 2BM3A 1J0IA 1FZMB 4GD0A 2PDYA 3OKEB 3BI9X 1F4WL 1QNZL 1NCAH 4ETQA 1SBBA 4X4XB 4N0FA 3VXSE 3OWEA 4QTFA 4XTIA 4HWZA 1YEGL 3QARA 3KVPA 4K38A 4B3ZA 2JFCA 1OFDA 1I2OA 2ZRVA 3VJ6A 4FTVE 2IJ0C 1XHGA 4LLUB 5C0AD 5JH1A 1KB5L 2FWSA 1GSMA 5TTRA 5TD4A 4WIWA 3AU0A 4NZJA 4WHTA 5GZOC 1BFOB 5JNYA 4NBYB 3T2NL 4GINA 4KPLA 5HGBB 1XDLA 1MDLA 3ZTDC 4XI5D 1K6QH 1T1XB 3G1DA 4FXJA 4R83A 3L5WB 2FZNA 3P4OB 5DRWB 1EQPA 4L3FA 3BIKA 5GGSA 2QGDA 3HLAA 2OCFD 4WEVX 3WN5C 3LG3A 4JTUA 3AMGA 3WX7A 1GWJA 3PWJA 1OHQA 1US3A 5IBXA 5KBNC 1EXHA 1W9XA 2JTYA 1N9PA 1VH7A 5J13B 5SV3A 3DKHA 1JGEB 1KJ3H 2G5BA 1PJ9A 1GG1A 1V6TA 4PV8A 1HNGA 1F3DJ 1MFEL 5E1QA 2WBJC 3MLTA 4Z1CA 4NCC2 2WO4A 1A5OC 4OAWB 2IMMA 3IUDA 3W1TA 1OGAE 5I17B 3QJZA 5IGXL 2O9OA 2BHYA 3GYCA 4ODWA 1EJVC 5KTEH 2JSFA 1H7NA 4N6RA 1MNUL 1NOWA 2J12B 5C9WA 5HUPA 2A2IA 1EGJL 4APQC 3S42A 5IUCA 3H7LA 5HGGS 3VTAA 1CLOH 2G0LA 2QQNH 2C9QA 2HVOA 1ZVHA 2EDEA 5B8CB 2X05A 1KC5H 3NURA 2QVIA 2R8SL 3GLDA 2QLVB 4GXMA 3LX9A 4AMAA 1P7KA 1NBYB 2ON3A 3HVNA 4JFHD 1F4AA 5HJDA 3GIZH 3UG4A 1XLJA 4L7ZA 4ABVA 4NZCA 1NINA 3D9AL 4LHUD 4YHPA 4BFKA 2MCAA 3R89A 5LBSA 3T0EE 3ZZLA 2DT0A 2B7NA 2ZIDA 3OZ9H 5DMMA 1DBML 1RFDL 3WUWA 3QJVB 5JVLA 3NIFF 1X7TA 1X97A 3THUA 4HUMB 2GAZB 3PBYA 4ICNA 5FGRA 3W84A 1A3RL 5SX5K 1DLFH 3FAWA 5KZCD 3RFAA 1EXBA 5DJCB 3GIVA 3T0VA 1VFTA 1AMXA 1UHVA 1XR8A 1OM9A 2E5CA 2K4WA 2MQ0A 5AB0A 2CUAA 3IU4L 5G5DA 3FTSA 1MCWW 4HG4J 1U3HA 4N28A 1EJUC 1H0GA 4YC2C 3OYXA 1JUEA 3CLEH 3AWGA 4BQBA 4NN7B 2QW5A 5D55A 5DTFA 3LPFA 4YSQA 1DVYA 4HNLA 1RUAH 3SN0A