5A6LA

High resolution structure of the thermostable glucuronoxylan endo-beta-1, 4-xylanase, ctxyn30a, from clostridium thermocellum with two xylobiose units bound
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
389
structure length
389
Chain Sequence
b'MASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTAVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CARBOHYDRATE BINDING FAMILY 6
publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
total genus 137
structure length 389
sequence length 389
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5a6lA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5a6lA02
1OGSA 3VIOA 2FH8A 4AMWA 1JZ8A 1VFOA 3VOCA 2PBGA 2OSWA 4IISA 4ZFMA 3W53A 4HPHA 1CLXA 2E4TA 1E9LA 3A4XA 4XB3A 4GXPA 2ZXDA 4U2YA 1WCGA 4BF7A 4R27A 3EMZA 5E6YA 1ZB5A 2F61A 1OGGA 4D6GA 1I1WA 1H5VA 1HXJA 3B9EA 3SIMA 3F5JA 3TOPA 3VMNA 2E40A 2EPLX 5EFFA 3GZAA 1R34A 1E6QM 1V3HA 4KGJA 3AS3A 3CGTA 4ZE4A 2J7BA 1EGZA 1RP9A 3B9AA 2YL8A 2ESCA 3OGRA 4AEEA 3WF3A 3VTRA 1H4PA 1KB3A 3DYPA 3WF1A 4D6HA 3WDRA 1PS3A 3U7BA 2OYKA 4AD0A 4JKLA 3AMKA 2VI0A 3WMCA 4HZ6A 3VU2A 1XH2A 3BAWA 3LPGA 4DWSA 1C8YA 1ODUA 3HU7A 3LPPA 2WBKA 2XFRA 3N17A 2WVVA 2GK1A 1CXIA 3MMWA 4K68A 1JXKA 1B30A 2WLZA 3VIKA 3GXPA 5A2BA 2QMKA 3GM8A 5BXRA 4QLLA 1QVBA 1V03A 3IJ8A 3ZSSA 2ZUWA 1BGAA 3EJQA 3GXIA 1BG9A 1CEOA 3QHMA 2YA1A 5D9NA 3BUPA 2XWDA 5JUVA 1SR0A 2YDQA 1CXKA 3L4TA 1LL4A 2VT0A 5A6SA 2O9PA 3AIRA 4ATDA 4AZIA 1MW0A 4PEEA 5IXEA 1TR1A 2J8GA 1VFFA 1LWJA 3WEMA 3S5YA 3MUIA 1Z32X 4YHGA 4WK9A 3VIFA 1W3HA 1E6NA 2GDVA 4HA3A 2W67A 3GYCA 1ZBCA 1HNYA 5CSYA 1AQ0A 5A8OA 2DSUA 3NUKA 2WCGA 2XVGA 1XD0A 2ZUVA 9CGTA 1UWSA 2CKSA 3POCA 4BQ3A 4CGTA 3VINA 3O9NA 3EDDA 1GOQA 6A3HA 4GI6A 3IGUA 2X8RA 2BVDA 2XVNA 1J0IA 4PMQA 2YBTA 3PBGA 3OLEA 4M8UA 4P8XA 1CDGA 3MSGA 1HWWA 5A2AA 1GPFA 1B3WA 4RE4A 4Z2KA 4U33A 3L2MA 4XZWA 4ATLA 3W6LA 1WO2A 1UKOA 5A6MA 2EPMX 4RE2A 1C8XA 3VX0A 4W7WA 3RO8A 4URIA 4W84A 5E1QA 5AYBA 4PUDA 5CLWA 1V3JA 1OINA 1UHVA 3DYOA 2D2OA 3HN3A 3VDAA 2J75A 3ARUA 5IFPA 2CEQA 3WBEA 3KLKA 2D23A 1VAHA 1MXDA 1AQMA 4E8DA 1NWTA 3D50A 3AXHA 1XV8A 2D0FA 2OSXA 1NWSA 2GUYA 2FGZA 3VSVA 3U5UA 4E8CA 1JYXA 1KGUA 2EPNA 1KGXA 1PJ9A 5EFDA 2FHBA 1GOIA 4J27A 1V3LA 4L4OA 4JZ5A 5A6LA 5A94A 4JL2A 3WY4A 3A21A 4FNPA 3WF2A 1UWRA 3H55A 3OB8A 4QAWA 3DDGA 2Y4SA 1PZ2A 4U5KA 1NM9A 3EJSA 1MWOA 3KLLA 3OGSA 4MJ4A 2WHLA 7A3HA 4HA1A 1WKYA 1KWKA 1J0JA 2QMJA 3PZIA 2QHAA 1LLOA 4MPKA 3WUBA 2G3MA 3L4UA 1A47A 2VCCA 1DWAM 4W7UA 2V38A 2Z1SA 1QW8A 1H09A 1FP9A 4A3HA 2BXYA 5AYIA 2WMHA 1EDQA 2W61A 3VIJA 2MANA 2YL5A 4OZOA 5C8BB 1R47A 2V3EA 3N11A 1FFRA 1J0ZA 5BXTA 4WSKA 3K4AA 1OCQA 4CU6A 2ZX5A 3UG4A 3FY1A 4GI8A 1TQWA 5LA2A 4NF7A 3DX0A 1SZNA 5E6ZA 2DSZA 3THCA 2HVMA 3SURA 2YJQA 3PZTA 5FD0A 1G5AA 1CLVA 4B9YA 2AOSA 4M80A 5CZKA 2CBIA 1O7DC 3VD3A 1GOKA 4PMRA 4PSRA 3WDHA 1I1XA 3K1DA 3OLGA 3N9KA 1OIMA 1BPLB 2XHYA 4MB5A 5CQ1A 3T09A 1G0CA 2F8QA 1PX4A 5KZ6A 3K8KA 2WVTA 4MB3A 2CYGA 3A47A 2C7FA 4BA0A 2GSJA 2X09A 1FH8A 1DWIM 2CPUA 2VX7A 3FN9A 1RD6A 5JIWA 4PRWA 4DO6A 1BYDA 3QGVA 1H0IA 2QPSA 5CXPA 3RM8A 1TUXA 1B3ZA 2YFOA 1BQCA 3IJ9A 2YDSA 3DC0A 5E70A 2ZXQA 1O7AA 3GXTA 1WDQA 4A3YA 2BVTA 1AQHA 3THDA 2PBOA 5D4YA 3MSDA 1VB9A 4AMCA 4CN4A 2A3BA 3I3DA 3OZPA 4H8VA 3FXYA 5M5DA 3MI6A 5IHSA 1UOKA 4ZEPA 2WMFA 5AC5A 4GQQA 3UR7A 1M03A 2JEPA 3CZEA 1QNRA 3BUIA 1EIBA 1OD8A 4UQCA 3VIMA 1ZS2A 3W81A 1EH9A 1WDSA 2QV4A 4AD3A 3VM5A 1KWGA 4D71A 1B2YA 2VL4A 1B3YA 4M29A 3AHYA 1BF2A 3ZR6A 1T0OA 4UQEA 3KL3A 3BLBA 3ZJ6A 3A5VA 2Y8VA 3VSUA 2FHCA 3TTSA 1UD3A 1DWFM 3A3HA 4E4PA 4D6IA 3F5KA 1MW1A 1W3KA 1UR1A 2J79A 2WNWA 3PTMA 3EJPA 4B9ZA 4QLJA 1EHAA 5BRPA 2E9MA 2E8ZA 4U3AA 1UQYA 5HXMA 2PWGA 1BLIA 1H0GA 1BYBA 1O6IA 3E1F1 4GKLA 8CGTA 3KEHA 1HJWA 5I77A 3BLKA 3O2LA 1W9VA 4PSPA 5ABHA 3SUVA 5I2UA 1X1NA 2HISA 1DWJM 1EHNA 1SYTA 1WPCA 4MTVA 4MDOA 1MQQA 5I5RA 1NOWA 4QCEA 2XWEA 1R33A 5GNYA 2W4XA 3NIYA 1DWHM 3WQVA 5M03A 3QR3A 2VJXA 3BAKA 3D3AA 3LPOA 2VC9A 3CZNA 2WCSA 4OGZA 2XIBA 3HG2A 1CGWA 1UKTA 4W8AA 1WZMA 2WC7A 5E9AA 4FNSA 1MQRA 3L4VA 4WLCA 3EDJA 4HP5A 1UA3A 1B31A 2OW6A 5I3DA 3ZMRA 3TTOA 3ZT6A 1WDPA 3GTNA 3LRLA 4NX0A 1R86A 3BMVA 3LX9A 1NOUA 3AHZA 1XRVA 2G3JA 3VILA 3WIJA 1F4AA 1QNPA 1AVAA 1GW1A 2A3EA 2VTFA 1UKPA 3ALFA 2OYLA 2W66A 1HIZA 1V6VA 1TCMA 3ARQA 5GPRA 4CN6A 3CC1A 3VM7A 1QBAA 5CJ5A 3MMUA 3VDHA 2XM2A 3WFLA 3KE0A 1CXFA 4PMXA 1NP2A 1IZJA 3D51A 4FMVA 3KL5A 3K8MA 3TV8A 3EYPA 5CLTA 4AIEA 3MUAA 3H53A 3ZT7A 2X2IA 1V0LA 5ECUA 3L4XA 5D9PA 3ZJ8A 3SUSA 2EO7A 2JFEX 3SUUA 4UTFA 4AZ6A 2OWXA 1XGZA 3WY2A 3K46A 4F79A 4WKHA 3OZOA 3FW6A 1F4HA 1TFVA 3WBAA 3AOFA 2WWDA 3MMDA 1UWUA 1G9HA 4HOXA 1W9PA 3EDEA 1IV8A 3VGFA 1IZKA 1C93A 1HN1A 1W1YA 2V3GA 1VJSA 1JGIA 5DEZA 5C71A 2VVNA 2DT2A 1V3KA 2EEXA 3OA5A 2O9OA 3ARVA 3WQ4A 5HBFA 4CCDA 1OIFA 5CG0A 1V3MA 1LF1A 1K9EA 1UR9A 5M3WA 3A4WA 5D9OA 5M17A 3RM4A 4HU8A 2GJXB 4MNLA 5EB8A 3A22A 4DO4A 1HX0A 1E71M 1QW9A 3CUGA 4AD5A 1VJZA 2F1BA 3HG3A 3FHQA 4Z2GA 4OBRA 4PMNA 4UQBA 3VDBA 4AZBA 1LL6A 5FL1A 4LYRA 5I24A 3CZKA 3NDYA 3HJEA 3W82A 1PX8A 3GBEA 1V02E 4NZFA 3L4ZA 1VBRA 3BSGA 4D6FA 3D52A 3L4YA 6TAAA 2XUCA 2XVPA 3S2CA 3KZSA 1JZ3A 1E6ZA 1DTUA 4TTUA 4H7VA 4UFMA 5CPQA 1ISXA 2ALWA 1ODZA 4DWSD 3FHAA 2GJPA 1JAEA 3AS0A 1UKSA 3BUDA 1U33A 1OT2A 3WN6A 4P7QA 1J18A 1BHGA 1ECEA 3OIHA 3BVTA 2DSWA 1KFWA 2X0HA 3ZJKA 2E0PA 4R5EA 4TVDA 3BUBA 4PBGA 3VD4A 4KRUA 3PZGA 1KR0A 2VVSA 3WH9A 3CHFA 3N13A 1JF5A 4AD4A 1VFMA 2WPGA 5A8NA 1QWUA 1LL7A 4PMYA 4AYSA 1UR8A 4D6CA 4BS0A 1CNVA 2GFTA 4MAVA 5DT5A 4NRRA 1UWQA 3BAIA 1FHDA 1XH1A 1HF6A 3GH4A 3T2OA 4EE9A 2YBUA 1RP8A 4TUFA 4NXKA 4DWSC 3ZOAA 4TTGA 2XN1A 3CZLA 4CCEA 1M01A 3AFBA 2E9BA 2J7CA 3L4WA 3W26A 2RGLA 1J0YA 2YFNA 3GH5A 3VIIA 1V02A 3ALGA 4CVUA 7TAAA 2VURA 5CSUA 5BWFA 1JDCA 1W1TA 2EPOA 1UH3A 4GZEA 3MV11 5BROA 1L8NA 1TQSA 3WFZA 1Q6GA 1ZBWA 2VZUA 3BLPX 2WMIB 5D9MA 1OSEA 4AMXA 1CECA 5IHRA 4H8UA 2VNCA 1E56A 2J7FA 3CV5A 1VBUA 4M24A 4UFKA 1EO5A 5KEZA 4P7LA 4UCFA 3AYSA 3QOKA 4LXFA 1QHOA 1WE5A 2PB1A 4J3VA 1J01A 2PF0A 2BHYA 4GZJA 4HOWA 1LG1A 2FE0A 2ZXBA 4GIAA 1E0XA 3M07A 3VNYA 2WSPA 4AZ5A 2A3AA 1KTBA 4W93A 5HOSA 2XG9A 1EOKA 3PTKA 4JKKA 4IM4A 3ARZA 1KXHA 1HKIA 1JZ6A 3IJ7A 1M53A 3BH4A 2EQDA 4TVUA 4D72A 1ESWA 2DPEA 1TE1A 3ZT5A 4B3KA 4KH2A 4JFTA 2EADA 4OKDA 3QOMA 3VMOA 1QI2A 4YPJA 1KGWA 4B3LA 3WL0A 2W62A 2VUYA 1BYAA 2UWFA 4W8LA 1FH7A 3BAXA 1CYGA 2YOCA 1KXTA 1H1NA 1TA3B 1EDGA 1WZAA 5ABEA 3W0KA 1VF8A 4FLSA 1CGXA 5JBDA 1LQ0A 2ZX6A 4U31A 1HJUA 3SCNA 2D3NA 3AZRA 4M1RA 1OM0A 1K9TA 1YQ2A 3RJXA 1QHPA 4LGXA 1OB0A 1E3ZA 3DDFA 1HVQA 3CPUA 3ZJ7A 2NSXA 4JHOA 1UD8A 3EJRA 3B9DA 5E0FA 1J10A 3AHXA 3WDPP 1B3VA 1E72M 3AS2A 1UR0A 4HMEA 4PN2A 3W4RA 1JAKA 1E6PA 1CTNA 2DQXA 5I6SA 3AI0A 4OOZA 5A8QA 3AZSA 4HPGA 3ARTA 5A6AA 3PTQA 4MNMA 3SCOA 3EBVA 1JYWA 1EOMA 3SCQA 1MFUA 2CERA 2IUZA 4AZCB 4JHZA 1MW2A 4J3XA 4D1JA 3LXCA 4CD4A 4W85A 4JCLA 1L0PA 1QNSA 4HMDA 2F1AA 1ISZA 4IPLA 4HTYA 4QLKA 4ML4A 5EBAA 3PZQA 2WYSA 4AZ7A 1QOXA 4JIEA 2OSYA 3NDZA 3RCNA 3EDFA 1XCWA 5DFAA 8A3HA 3AQUA 1V6WA 5FOOA 3A6OA 3DX2A 3TP4A 3ZQ9A 4AW7A 2D0GA 4NXSA 3VIHA 1BFNA 4JFWA 3ZM8A 3O6AA 2EBNA 1OGBA 1UD6A 3QHOA 4YN5A 2NT1A 3RDKA 3HG5A 4QFUA 1QI0A 4JKMA 2Y2WA 4Q22A 1BVNP 1HVXA 1OD0A 3WQWA 3WH5A 1GNXA 3UG3A 1Y7VA 3MO4A 3GNRA 4AISA 1MYRA 2FYVA 2WZEA 2XSAA 3N12A 2J25A 4U2ZA 4W89A 2WB5A 3K4DA 3WH6A 2PI6A 2WVSA 2WZHA 3TA9A 1U2YA 2CIPA 4F9JA 4DM2A 2GJXA 4HU0A 4MJ2A 4H04A 3DHPA 1NARA 2VX4A 3LPFA 3VUPA 1CGTA 4DUWA 4ACYA 2WLYA 3PZMA 1GJUA 1E6SM 2PWHA 1N82A 5DT7A 3W38A 1CZ1A 5DO8A 1US2A 3DECA 2IGTA 3KL0A 2Y24A 3EJUA 1E6RA 3T2QA 4DUXA 4BQ5A 4W8BA 1BSIA 1DWGM 4Z2IA 3EDKA 2D22A 4A4AA 1ZBKA 4KMQA 1GUVA 3WNOA 4PMZA 5BXSA 2EAEA 2WHMA 2D3LA 5GQBA 3BCFA 2A3HA 5I79A 2J74A 1QNQA 5ABFB 4ZXOA 2ZUNA 4EK7A 4W7VA 2FH6A 1K9FA 2FGLA 2G8ZA 3ARPA 1JDDA 2CETA 1JG9A 2J7DA 3CZJA 1XH0A 1R85A 1C92A 1XC6A 1W9DM 3VD9A 1ZL1A 3AYRA 4FNUA 1R87A 4PMUA 3NJ3A 4P7OA 3PZUA 1G01A 4J28A 3A24A 4LYQA 4BQ2A 1QI4A 3L2LA 2EACA 1QI3A 3UR8A 5CPSA 3BAYA 2XSBA 1MXGA 3WY3A 4QCFA 5A69A 4JFVA 3VMPA 5LYRA 3M46A 2O92A 2W63A 1E4LA 1K9DA 3AMDA 4C7DA 4UFLA 4N0RA 4PMDA 3AS1A 2VZVA 1HTYA 1V6XA 2WW5A 3UESA 4HA4A 4UNIA 3AMCA 1C7SA 4UOZA 3ARWA 3BVXA 1RH9A 1JI2A 2DT3A 1HP4A 4CD6A 2VOTA 4LX4A 2Q8XA 3VSTA 3I3EA 1CWYA 2CCRA 1B1YA 1GJWA 2BNJA 3OBAA 1EA9C 1GHSA 3GBDA 5D8ZA 1UH2A 4GZIA 4PYSA 1UG6A 1UUQA 5FIPA 2NW0A 4GO9A 1V0MA 2VQUA 1E1FA 5AY7A 1WB0A 1JNDA 2WMIA 4WKFA 2DEPA 1OT1A 1SFSA 3VIGA 4MAZA 2WK2A 1PIGA 3AXXA 3B8SA 3BSHA 3W24A 1JZ7A 1KXQA 1OWQA 3N15A 2WC3A 4W86A 2QLYA 3UETA 1V3IA 3PZNA 2IXUA 2X1IA 2VX6A 1SMDA 2CESA 4M82A 3ECQA 1HKMA 3N1AA 2YKKA 4LYPA 2VX5A 2XIIA 4ZE5A 3W27A 2BY2A 3WF4A 1W2PA 1Q4NX 2X2JA 1XYZA 1NQ6A 1RPKA 1E1EA 1TVNA 2WVUA 1UKQA 3WDJA 4P7RA 3NSMA 4CVWA 3VGEA 3D4YA 1PPIA 2D1ZA 2PWDA 4MB4A 3MV01 1YHTA 2BY3A 2XN2A 4PTWA 1I75A 3SCWA 1TVPA 1UYQA 5FCZA 3WD2A 3MUY1 2VO5A 3ARXA 1QX1A 2F7OA 4WF7A 3W37A 3WEZA 1WP6A 4NSBA 2WWCA 1E73M 2DIJA 3CUJA 2WHJA 1GCYA 2BHUA 2O9TA 1H3GA 4UQ9A 1WAWA 4W5UA 2ZUSA 4FLQA 1JD7A 3EMCA 4D6EA 1H41A 4JFSA 3VGDA 1Q6CA 4MNKA 2VZOA 1TA3A 1KBBA 3FAXA 3CHDA 1J12A 5GNXA 5F7UA 1FA2A 4D1IA 2JEQA 2X2HA 1TZ7A 3VNZA 2J4GA 1UD2A 4AD1A 1PBGA 3CLWA 2WM0A 4OIFA 2F2HA 4CD8A 1HL9A 3VD5A 1R7AA 2G4FA 3LXBA 2ZIDA 4XX6A 3WH7A 4W87A 2XVLA 2E9LA 2DSKA 2XGIA 3AICA 4CKQA 2XM1A 3N18A 5A8MA 3OG2A 4C7GA 3T0BA 3WD4A 2XFFA 1VRXA 1XSIA 4FK9A 1D7FA 3GXMA 2CBVA 4U5IA 2ZICA 4ZXLA 3AXIA 1R7OA 5BYWA 1WZLA 2DIEA 1E5NA 4OOUA 3AIEA 4DO5A 2WBGA 1GQKA 1QPKA 1E70M 1W1VA 4LQ1A 3CUHA 1CBGA 3SUWA 2YLAA 1EQPA 4MB1A 1HL8A 4AZCA 4X9YA 4P8WA 3GXFA 5A6KA 1JFXA 5A2CA 1FOBA 4GINA 4BCEA 1X6LA 1E4MM 1QBBA 1HJXA 2J8FA 4FLOA 2CITA 1GQLA 3CZ8A 4TXEA 4CD5A 3UEQA 4AIOA 1UWIA 1NWUA 1VEPA 1J0KA 3TTYA 3II1A 4BZYA 1W9BM 2BXZA 2CXGA 2DH3A 4GPNA 2ZXAA 1JF6A 1V0KA 2GJRA 1JNEA 3CH9A 1UA7A 2ZX8A 1B3XA 2GDUA 4X0NA 4JFUA 2J77A 3AIWA 4P8UA 2TAAA 2J47A 2WMJA 1E43A 2YDRA 3CUFA 4Z2JA 2Z1KA 4ZENA 2YA0A 4OJYA 2ZWYA 2WKLA 1GORA 1LJYA 3MANA 2IXVA 2CNCA 2YL6A 1V6YA 2E8YA 1FHLA 1UQZA 3W6MA 2G3IA 4DM1A 3JUGA 4AXNA 4XZBA 2VZSA 3VD7A 3WNNA 1R8LA 2B31A 1CGUA 3ARSA 1EXPA 4AWEA 2XTKA 4N42A 4CU7A 5HPCA 4HZ7A 1UASA 4KWUA 5BRQA 3RMEA 1ZBVA 3K8LA 3SCRA 4IPNB 3F4VA 1E0WA 4AEFA 3BMWA 4L4PA 4PMOA 1P6WA 1E4NA 3WEOA 3HZ3A 1PZ3A 5A6BD 2YIHA 2D24A 3GXNA 4CD7A 4V28A 3BVWA 1PX3A 4J3TA 1BTCA 3AISA 1KBKA 2CKRA 3VGGA 1QWNA 4HZ8A 3AMLA 4UOJA 3G6MA 5HNNA 2WAGA 2EXOA 3MU7A 3WD0A 1GOWA 1TG7A 1W9UA 2G3NA 1R46A 1W1PA 1M04A 5ABFA 3WKZA 3PZVA 1EO7A 5CPTA 4AYGA 3AIUA 4ACZB 3CBWA 2C8NA 2V3DA 2QF8A 3W25A 4RL3A 1Q6FA 1HT6A 1E0VA 2WANA 2E3ZA 1E5JA 2WCAA 3U57A 4WKAA 2VR4A 3WY1A 3ZO9A 5A6BA 3BAJA 5CGTA 1CXHA 3SCPA 1MFVA 2X0YA 1E55A 2GVYA 1W32A 7CGTA 1ZJAA 4PTVA 4CCCA 3W28A 4TOQA 2PWFA 3GDBA 1VFUA 3N04A 4F9DA 5LA0A 1PEZA 1KCLA 3IAQA 3CTTA 3GNPA 2AAAA 1XCXA 3WH8A 3WL1A 4JCMA 3AMGA 1JI1A 1TQUA 4S3JA 1EQCA 1ZU8A 2V5DA 3WDIA 4MNJA 3AIBA 1ZJBA 3GH7A 4XUYA 2OWWA 1KR1A 2ZUMA 1BG4A 5JIPA 4CU8A 1GVYA 4S3KA 2ZOXA 4F8XA 2F18A 2OW7A 3WUGA 1Q6DA 2UY3A 3MUZ1 4PCSA 4M81A 1B0IA 1H11A 1U30A 4P8VA 1VENA 1JYNA 1WZKA 1J9YA 4AZHA 3T08A 5ABGA 5A1AA 1KTCA 1VEOA 3BGAA 2VRQA 1MQPA 1JZ5A 1WNOA 1KXVA 1TQVA 1Q6EA 2CBUA 3D4ZA 1UZ4A 1GQJA 1UD4A 2G41A 3EMQA 2NT0A 4W88A 1BGGA 1FH9A 3AHTA 3T0DA 3VO0A 5IDIA 2ZX9A 5AC4A 3LMYA 4KGLA 2V5CA 4FNRA 1UWTA 1CXLA 4V27A 4V2XA 1TQTA 4CUCA 1HXKA 4UQAA 2DGAA 5E0CA 3VVGA 4FF5A 2BV9A 1US3A 5HPOA 3F5LA 3WSUA 1ISYA 4J3WA 4PMVA 1GHRA 3WELA 2Y8KA 4J3UA 3CZSA 3PN8A 1W3JA 2ZWZA 1QNOA 3BUQA 1GVIA 1QI5A 1NOFA 1TMQA 3PHAA 3WUFA 1UD5A 3S6TA 5JBFA 1JIBA 1BAGA 4HOZA 4AIUA 1UZ1A 2DSVA 3DHUA 3NSXA 1MW3A 3NYDA 1PIFA 1C91A 5IFTA 3FAWA 2W91A 1W2VA 4F66A 2OYMA 4YHEA 2D73A 1OBAA 1A3HA 3CHCA 4NZJA 1K6AA 3RIKA 4E2OA 3AIVA 3TONA 6CGTA 5E09A 3WF0A 5HDRA 4UR9A 2XFYA 5FKYA 3POHA 2JIWA 3VPLA 4NI3A 4PTMA 3NCOA 1NP0A 1HKKA 3A23A 1UR2A 2CHOA 3SEPA 3WQ5A 3CIVA 2RGMA 1XSKA 3ARYA 4H41A 4UFJA 3VDCA 3LRMA 4DWSB 4CN1A 2XYLA 2F7PA 3BXWA 1V0NA 2EABA 1B90A 3IANA 1BYCA 1FFQA 2AMGA 3S5ZA 2WVVB 2XGBA 2GK1B 2WXDM 1LWHA 3UCQA 5TD4A 2JE8A 1E4IA 1E6XM 1NWRA 2UY4A 1XSJA 1DHKA 2OWCA 3WENA 2X05A 2WSKA 3W29A 1D3CA 3RM9A 3PZOA 4M56A 3DYMA 2PC8A 3U7VA 3CZGA 3ZR5A 1KQYA 3T0AA 4PUEA 2ZE0A 2FHFA 1ITXA 3VIPA 2DT0A 1HP5A 2BY0A 3OGVA 3BVVA 1LG2A 1E15A 1DP0A 3WD1A 1G94A 1C7TA 1J0HA 2PWEA 2J7GA 2XN0A 3TTQA 1JXJA 1CGVA 5JBEA 4HMCA 5DMYA 3DX1A 1HJQA 3WUEA 4DUVA 1HJSA 2C0HA 4MADA 4P7NA 3M7SA 5A8PA 1W9XA 2X2YA 2A3CA 3I3BA 3M6DA 4U3CA 2WHKA 2W92A 1PAMA 4EAMA 4FNTA 1GOMA 1H49A 2O9RA 4TX6A 3SUTA 4Q7NA 1XHGA 3IK2A 1CXEA 4UZSA 3MKKA 2VRKA 4J3SA 1HJVA 1B9ZA 2WZIA 3QHNA 3AJ7A 4D6DA 1JFHA 3VGBA 1W3LA 1SMAA 2F7QA 3SCVA 2XVKA 2VCAA 5FL0A 3PZ9A 3CMGA 4H8HA 4KRTA 3LRKA 4OUEA 2VMFA 4AZGA 1XD1A 4BQ4A 4JAWA 3VKKA 1C90A 4TVCA 2JF7A 2ZX7A 4GI9A 3AHVA 3WQ8A 1QHZA 1DEDA 4MDPA 1V08A 3ZSTA 4GQRA 1UR4A 4WJXA 2YL9A 4Y7EA 3HMCA 1E3XA 2Y5EA 3WNKA 1CPUA 1CENA 4PTXA 1M7XA 1C8QA 3SCUA 1J11A 1EDTA 3AROA 2VZTA 4UOQA 4JL1A 3DX4A 3RILA 1CGYA 3BC9A 3D5HA 3GNOA 3WDQA 4NZCA 1GQIA 2J7EA 1H2JA 1R75A 2UY5A 5I23A 2J7HA 2WC4A 4NRSA 4Z2LA 5A95A 1JZ4A 2ZUUA 2BHZA 3APGA 3G6LA 4ACZA 3BCDA 1VEMA 5LA1A 2BVYA 2CHNA 3WMBA 2EPKX 1VIWA 2J62A 5GNZA 4FNQA 1JYVA 1GONA 3WD3A 4B15A 5I78A 4AC1X 2JIEA 4TX8A 5CGMA 4GO8A 1NH6A 2YLLA 5D8WA 3UG5A 3AZTA 5I0DA 3CUIA 2VCBA 4UQDA 1MVYA 2ZUTA 4UFHA 1KQZA 3BVUA 1IT0A 2VRJA 5A6JA 3HG4A 1E40A 2YA2A 3LXAA 4QDMA 3MS8A 1XYFA 4J7RA 3WQ6A 1G1YA 4OBSA 3SCSA 5DF0A 2DDXA 3WNLA 2V3FA 4H2CA 4XV0A 3J7HA 2XJ7A 3SCTA 2OLHA 4W5ZA 3ARRA 4UZUA 2J78A 2UY2A 3NSNA 4ATWA 3KWXA 5EMYA 1C3FA 2D0HA 2DT1A 1W91A 4IUGA 3AIQA 4QP0A 1GZJA 3RJYA 4PCTA 4EKJA 2BY1A 2W5FA 2VR5A 2WKGA 3CO4A 2VQTA 1AMYA 2F7RA 5BCAA 1GOOA 1S46A 2EJ1A 4Z2HA 4AY1A 2D20A 4X0VA 2BFGA 4RE3A 5A3HA 3VGHA 1ITCA 1UH4A 4WSJA 2JALA 2FDMA 2WMKA 3VX1A 4UFIA 3DX3A 5C70A 4AD2A 3EJTA 4WIWA 3OLDA 3CMJA 3GXDA 3U5YA 1BVZA 2BS9A 2JF6A 3RPMA 4EANA 1FP8A 4C7FA 3WNMA 1ISVA 3IAPA 4B16A 1D2KA 3WNPA 3FNDA 3A4AA 3T2PA 2QPUA 3WMSA 3UERA 3CHEA 2WMGA 1X6NA 2CBJA 1V6UA 1JL8A 4D6JA 2DH2A 1JDAA 1ISWA 1JZ2A 1KCKA 4LPCA 1HKJA 1WDRA 1JD9A 1CIUA 3H54A 2XPKA 4FLRA 3OLIA 5BXPA 3ZIZA
chains in the Genus database with same CATH superfamily
2PDQA 4AMWA 4QMEA 4INFA 4HSCX 1I8MB 1TKWB 4HPHA 2RJMA 5JW5B 1MJ8H 3MROB 4D8ZA 2R94A 3UYOD 1WCGA 1ZB5A 4D6GA 1BDYA 1DIDA 3TJ4A 3SIMA 4FNLH 4KFNA 4XP6L 2EPLX 1QPXA 2X42A 3TEWA 4LUTA 1EGZA 3NOYA 1PU0A 5KSAC 4F3FB 3S36X 4XMKH 3LKRB 3WDRA 3AU2A 3NRFA 2AXGB 2BASA 5H8UA 2VDNL 4HK0B 1D9KC 2AEIT 3BAWA 1KTNA 5SWSE 5AALA 3N1FC 4TVPE 4KI1A 2JJWA 3VXRD 3EYQD 1ZANH 2CLRA 1CXIA 3A3XA 4FIRA 4KV5E 3GM8A 3QPKA 1V03A 2YCLB 3IJ8A 3MLXH 2HRWA 3ZSSA 1QFWM 3WTYA 3RX7A 4JJ5B 3QHMA 1C9WA 5C2GA 4AOFA 2YDQA 4NUGH 4QITA 1IFGA 3ARDB 3GGWA 2MCPL 3RVXD 3CTLA 2JXMB 2GFBB 2IPTL 2X4OB 3OJDB 5D7LA 1CI1A 4QXVA 4HJ0C 4YHGA 3HA0A 4GW1A 4MMZA 3ISYA 2OCCB 2EVIA 1YCSA 1ZBCA 5D7JD 1HNYA 1L7IH 2WKOF 4X2PA 1ONQA 9CGTA 3SAZA 3RY6A 1JVOA 1ZHBA 2VC2L 1MCNA 5D72L 3EOTL 2NX5D 3UAJD 3HEIB 2NX3A 4AQ8A 3P3YA 1KM4A 1KB5H 1HWWA 5A2AA 2V5BA 1JNNH 2B77A 2GABA 3L2MA 4O10A 2X6UA 4B4FA 4Y5XB 4HVXA 3ZKXB 3N1QC 4UMGA 2J8OA 3RO8A 3RWFA 1BXVA 2LLEA 1YBQB 5H8MA 5HHQA 3M17A 2H9GB 2J75A 4QG8A 2BOEX 5DEFA 1VAHA 2CSPA 4L4TE 1IIGA 3V2AR 4LEXH 3V5CA 1XLLA 1F1DA 3DHJA 4RXFA 1EC7A 3U5UA 4ZSUA 2Z31B 1E5ZA 3V1HA 2IAMC 2OZNA 4LEOB 2DMGA 1A02N 1VH7A 3QNYB 5A6LA 5A94A 4R7NA 4Y16D 3W0WE 3GHSA 1Q2RA 4GG9A 1KM2A 4KWWA 4XAGA 5CHNB 3A4EA 5FM5O 2SODB 4PJ6A 5E9DE 1A5NC 1MFBH 4MPKA 4P9HL 3EB4A 2BOBB 5AG9A 2IH8A 3L4UA 3N4EA 3D7PA 3EB3A 5DJ0A 2PPAA 3HFTA 4OCRL 4OZOA 3N50A 4YHPA 2E1WA 4OFYA 1OFPA 1OQOA 2WZ5A 3C6SB 4GI8A 4R33A 3UVIA 1ACYL 2BOGX 5ICYB 3WLMA 1FZOB 4O4WA 3FGCB 3UZQA 1K3UA 4B9YA 3Q8AA 4GAFB 4GQZA 3DMMB 3RG1C 2EXYC 3HS0B 3SO5A 1BPLB 3SJVB 1V4YA 3F62A 2C7FA 3U4EA 2HS8A 4KIRA 1DWIM 2J55A 5IBUB 5JIWA 4LAZA 2C3VA 2C3GA 1RPUA 3Q43A 3WE1A 2L7UA 1ICQA 2PLTA 2YEQA 3GSRB 2OX5B 5HHOA 3H7UA 4AMCA 2CDGB 4BJHA 3MI6A 4JG0H 1TITA 1S8DA 3NJIA 3S3DB 5GS2D 4NKOB 3MA9H 4O1BA 3WHE0 3GSOA 3PFQA 3G08A 5DHEA 2ATPA 2G60L 4N6EA 5F1OB 3T4AB 1RV8A 3ZQXA 3OKOB 1UQYA 1XICA 4QRNA 8FABA 2AV7A 1YEFL 2YD0A 3BD4A 3MWAA 4NO5B 3MRLA 4HNTA 1W8NA 1LQAA 3RGVB 2Y88A 1F86A 1E4KA 3UJIH 2EDQA 2VJXA 4PWIA 4A22A 3SO3C 1DQUA 2HX8A 3KM1A 4TIMA 4DJFA 5EMUA 3IXTB 1TCRA 2DWXA 1B31A 1N0XH 3MREA 1P7KB 3LRLA 3QDGA 1T7VA 3RNKB 3UTSD 3BZJA 4NSKA 1G6RH 4PRID 1QNPA 1GA2A 3F7QA 2VTFA 5FJUA 4ZQNA 5IHHA 1TEGA 4PBXA 2ZXCA 1N2RA 4FYQA 2BMKA 3Q7JA 4TS6A 4JO4L 6XIAA 1J9QA 1EEQA 5TGBA 3K8MA 1YE4A 3H53A 5ECUA 3QQ9C 3BFWA 4XH2A 2V9QA 4UTFA 3KCLA 3DO4A 1FIEA 3OZOA 1FFPA 3OJVC 1CLOH 4NP4L 9XIMA 5GJSL 3NIGE 3PNWA 5K9XA 1EX0A 4D9QD 3VGFA 1IZKA 5DUPH 3NNTA 4PGDB 1IAOB 1QK0A 4YBQD 2DRUA 3SB0A 2JCWA 4P3WA 1NCAH 1AO7E 3VK5A 2C6QA 1HHJB 3LM3A 4M3JA 3PRZA 1RAMA 3A4WA 2VFGA 2ZZ1A 2V5TA 4X7CC 3U4KA 2FR4A 2WNXA 2EIJB 5J6HB 4ZNEA 2P76A 2Y6ZA 3QCVH 3QDJE 1TDQA 3KJ4C 3UIYA 1BQRA 1KPUA 1V02E 5M2FX 2P49B 4WJKB 3UACA 3TAOA 5FA3B 2EDEA 4NG3A 3S96A 1EXHA 3ZKMC 1IGTA 4H7VA 4KEZA 3QXAB 4TMBA 1DE4B 3RFAA 1A4KB 1OT2A 5JDJA 4L8DA 5FECB 4KXBA 4ZZ9A 4B9CA 1PNCA 4KRUA 3S9YA 3N34A 1VP5A 4I2XB 4JGUA 5D6CB 2GFTA 4GEJA 5CZJA 3QQNA 5GVJA 3VXPB 3QO1A 5F7EL 3D33A 1M4KA 3MCG1 4I1RA 4GSXA 5HY9B 1TPH1 2HMID 1R3TA 3BGJA 5FJOA 2FEEI 5I15L 2DY3A 1Z6JT 3MVTA 1OTSC 5GZND 1VFLA 1ZAGA 3NQEA 1G4RA 3VW3L 3BFOA 4BGLA 2AJUL 3H24A 1L8NA 1I3VA 5F7MC 5C9JB 3HLKA 3TZVD 1CECA 5DDHB 2XX1A 1GVEA 2A3TA 3SGGA 2INZA 4P2QB 4C6IA 5E8DH 3SY0B 2EDNA 5BOFA 2EDYA 5FUCE 1BYNA 5IFHL 2R24A 3N42F 3QOKA 2ARWA 3FRUB 1DCEA 4QRAA 4JO1L 4GZJA 1X9UA 3QZPA 4RMRA 1E0XA 5LZLA 5CJQH 2HJKA 1VPYA 2DZBA 2WXOA 3W2NA 1DQQA 3KGTA 3PHOA 4B5WA 1FDLH 4MX7A 3BVJA 2P3YA 4BEUA 2YBRA 4JFTA 3QGAC 1SJVA 3O8XA 4BH7A 3HHSA 1NIDA 4ODSL 4YPJA 4X6CB 4Z1DA 1J1PH 1WIOA 2DVTA 4AL8L 3H2CA 3OKMB 4XP1L 4N6QA 3GVRA 1X38A 3W7IA 2D3NA 3P0VH 4X7TB 5C2XA 2ZKHL 3DETD 3I75A 3ZE0B 3CXDL 3DVIA 3E5PA 1FGNL 3TEYA 3CPUA 4GLRI 1T7YA 3HB3C 5GISL 2UXVA 5DS8B 3K13A 2ZPKH 2B15A 2PDMA 1M56B 3QT2A 2OR9L 4DKFL 3N1GC 4JXCA 1E6PA 2HLEB 4IM8A 5A7BA 4WU5B 2AEPL 1KNOB 4KVCL 4WJ5A 3FF7A 3QAQA 1JZIA 4JHZA 4NT6A 2CRIA 3G5VA 4PCPA 3FT4B 3ZX1A 4HMDA 3LKNB 4LMQE 4GG6F 4N2CA 5DUJA 5G55A 1SO4A 3DVNA 2ZWLT 3OG6B 5FUOH 3W57A 5C0BD 1UD6A 5F7YC 1R2TA 2CWRA 3RDKA 1A4BA 4GUQA 5EU4B 4K94C 4FXGC 1G6RA 2C9QA 1Y7VA 2DW7A 1T0NB 4XCFL 2WNZA 4I9AA 3FC8A 5IBTH 2WZHA 2FB4L 1KJVB 4LNYA 1WKFA 5I1DB 1F4YH 3WKML 2FUQA 1ZT7B 4K8RC 4PR5B 4GYJA 1US2A 3OG4B 3SYQA 4NHUB 5FCSH 1NAKH 4DH2A 3MRFB 3CQFA 1I9JH 2OCFD 5GQBA 4G7EB 3VD1A 2MNWA 3V6BR 1G6VK 5DI8A 4PW3A 4M4RB 4ZXOA 4JQXC 3SQOL 3P69A 1EEZB 2Q86A 4FKEA 2CETA 4OLEA 5ALBH 1KXQE 1ZL1A 3KXFB 3ZDXB 1BYPA 1UXLA 3FUDA 3SDXF 3FF8A 3QB7C 3C12A 1T2QH 2R1PA 3TWCH 3GJFB 3KMDA 1FRGH 3BP7B 4C7DA 4U4BA 4PJ9C 2XA3A 2PMZA 1AQ8A 1PMYA 3IE4A 1C7SA 1XLCA 3N4AA 4NS0A 1GHFH 1P7TA 3I3EA 2TMDA 1LBMA 3SQSA 1XIHA 1EA9C 3QH3B 4ZFOL 3W9EB 3C2FA 3QPXL 4GO9A 3A67L 4WKFA 5JU6A 5HGBA 2C4XA 4FQLH 3TT1L 3C2EA 5AVNA 4DKTA 2UVFA 3ZRCC 3WLPA 3Q2CA 3U7YH 3FB7B 1EJTC 3UETA 3E2VA 2CIKB 4MA7H 4JRYB 2VX6A 4LL1A 5E6ID 3RWDA 4M82A 2DKMA 3RP1A 2X2JA 2DQFB 4G1EB 5M7QA 1ZA6A 2FD6L 5KJ4A 1UKQA 4JFEA 2NSQA 3F12A 3CFUA 1FCCA 5DO2C 1G7QB 1HH6A 3L67A 4QT5B 3CUXA 1RI8A 5IEHA 4TO8A 4L0YA 2WHJA 1GCYA 4P2RA 2PO6B 1S9VB 3IACA 4L9XA 1S5TA 5F7UA 4D1IA 3SZ8A 1EWEA 3VNZA 1YG9A 1RK7A 5MHBA 1SOXA 1OALA 1YTEA 4NFDA 4IK6A 4ZA0A 4C6CA 2CHDA 1VRXA 4X9HA 4RX0A 4JX6A 1RV6X 2Z26A 1D6VL 5G5DB 1W1VA 3HURA 4FQHA 3UZEA 3A13A 4WY0B 3AREB 1FNGB 2DEYX 2GY7B 1M2OA 2EIDA 3W75A 1F2XK 3D2UA 3B0YA 2P80D 1KRCC 4CQBA 3GU9A 3MA7B 2WNGA 2ZXAA 4K5LA 2FYYB 3NIFE 1B3XA 4A04A 2YO3A 3SFWA 1IXOA 2BCKB 2LR4A 5A2LH 2KPWA 4Q4PA 4OF7A 5PAZA 4Y4FB 3MANA 1U6AH 4KKAC 2ZDRA 4KEMA 2KT6A 1UQZA 3V5HA 2F2KA 2PGFA 1KLYA 4N42A 2PR4H 1P5UA 2Y72A 3EKGA 1GKRA 5F0JB 1MVFA 4ZXBB 1L9MA 5IVOA 3WLOA 4XVTL 3F03K 5HJ3A 4QG9A 5F0LB 1XLFA 1H15B 1XGTB 4F9LA 3L3KB 1YEEL 1UC4A 1NUFA 4P9ML 5IHZA 2DM7A 3MU7A 5AVZB 5LGJB 1O9ZA 5KMYA 4D8OA 2A3LA 4YDMA 3E12A 4KRPB 5I5MA 5IQ7H 3MP5A 2HN7B 2QF8A 5I30L 1MUJB 5JXEC 5JORB 3WY1A 3IKKA 4BFBD 5A6BA 5CGTA 1P0BA 2GVYA 2B0MA 4GBXC 2PYED 1JGDA 2H3DA 4JPGA 3FYIB 2B5IB 1ITUA 3RDJA 3GNPA 5INCB 5BU9A 4JQVA 4JCMA 2BIHA 1ZENA 4IG2A 4X5LA 3GHBL 3NXFA 4TL4A 3L7EA 1MCRA 4Q6IB 4WRHA 4CU8A 5AFDA 3EYFB 4LJ3A 4DBUA 1R5YA 3BG9A 3S6DA 3KWWA 4C56B 1THFD 3WN5B 5I75B 1UPPA 4PG2C 5CFHA 1QLRB 1R5IB 4G9FA 4NQXA 3ZVIA 1IGFL 1KELL 2JKTM 4JB9L 4F8PA 2D4FA 1UZ4A 3V0AC 1TNNA 6PAZA 4K36A 1FH9A 2LVCA 3RWGA 4KGLA 2QQKL 3L8QA 2VN6A 5H37G 4LVBA 2O5ZL 5I1KH 3VFOB 5E4AA 4ZJ9A 3QUML 4P5KA 4MLIA 1XYAA 3HC3L 2RACA 3GR8A 1GVIA 3P77A 3KOFA 4N2LA 1J1XH 5LNDA 3EOYG 3CU2A 4HOZA 3I85A 1Q7ZA 3MNVB 4JFZH 3IV3A 3MGOA 4OFVA 2GBTA 1YE6A 3OB0H 2W0LA 3EOLA 4WDWA 5I6OA 1A1OA 2IWEA 3MBXH 4AT6A 2XPYA 3APDA 2WIMA 3LKQA 2VLRB 2HUEA 1D8CA 3E3QC 2XFYA 4LOUC 5HYJB 1GH7A 2UVEA 1UA6L 4MQXD 1NP0A 2EYSB 2XWBA 1AQDA 2HFGL 5IF0B 4KI5E 3ULVH 1P1VA 2FZ8A 5FEBA 1B90A 1TJRA 2GKIA 4IKNA 1BYCA 4Z18A 5E1IA 2XGBA 1DVFA 4UTMA 3UCQA 4E42A 4PJHA 4OIIL 4RQQB 1E6XM 4J4PA 2NYZA 2QSCL 1TJIH 1U2CA 3E2HB 1L9NA 3T77B 5I28A 4ZW8A 2H8PB 3VXRB 3ZLFA 3EFOB 3TTQA 1SGJA 5IBLC 3VH8B 3SDYL 3SDDD 3I3BA 4LKCB 3EA1A 4N5UA 2DWSA 4UIKH 2O9RA 1G9NC 4XCNB 4NP7A 1W0VB 4UZSA 5E5UB 1XGQB 3STEA 3DO7B 4C90A 3BJ91 1O0VA 4Y2WA 2E09A 2VDPH 4OD2B 4GOSA 2QJHA 3P11H 3TCLB 1XIGA 1INEL 1PZAA 2HSIA 4BQ4A 5D7JB 4I4WB 1JPIA 4XHJC 2EYTB 3I6RA 2OLDA 4N90E 3VVWA 2JKSA 4B60A 4LRSA 2FQIA 1SY6L 3FDGA 4N9DA 3FU7B 4KQ4H 3WMPA 2NX5B 4BSWA 5CWSA 5TE6H 1VFAA 2UY5A 2WAHA 2BHZA 1I1CA 3APGA 3G6LA 2Y7QB 4AM0Q 5LA1A 3NCBB 2OP4H 4YDLB 3L0KA 2ON3A 1QA9A 5CBIA 1KJ2L 1AL8A 3LRSB 2QCCA 5REQB 1XBXA 1UVQA 5CBEB 1ETJA 2W3ZA 3N9GH 4GSQA 1AR2A 1OX6A 3LXAA 3TU6A 1G1YA 3W2KA 2PTDA 4XXCA 5AB3A 3OYXA 3D85A 2P42B 4F15B 4WHCA 2B7PA 1E9QA 3DI1A 1MH5B 4L5FH 4QDGA 5DK3A 3M4HA 4HGXA 1MUMA 2AK1H 1EZSA 2WB7A 2ZP0T 4FADA 3C60C 3ECVA 3B0UX 4UOW1 3CSFA 3LXUX 1JPGB 2ERJB 4GVHA 3VGHA 1BZ9B 1PFCA 1OFDA 4AQEB 3QI9B 2BS9A 4XBKA 4IRJC 1PSKL 4IJBA 2C1GA 1DVXA 2P8LB 1EGJL 4HKXB 5H94B 1V6UA 1CE6A 4BFIB 5JZ7C 3WBDA 2P5WA 4FLRA 1OG0A 1GTFA 2FH8A 5E9DB 2OSWA 4PJXF 1NCTA 4KHTH 3BPNB 4E9WA 5D5MA 5DK2B 3V79C 4AJVA 3G0UA 2X4PB 5HDQH 4WR3A 3GI8H 4XBPB 2B8OT 2VD8A 4JG1H 5D30A 4RISL 5KG9B 1HGWA 3TGXA 3PAYA 3OGRA 1HE8A 3OSKA 5D2NB 1E4XL 2MNJB 2ZG2A 2IALA 2PCPA 3LPGA 3G1HA 4XE0A 1IIKA 3R7QA 2ISDA 3WIFA 4JDTL 5F3HB 5L2JB 2XYCA 1PKYA 4K23L 2ISSA 25C8H 4PEKA 4HJJL 4XP4L 3UIZA 1JRCA 3PY9A 3RE0A 2UXTA 5C55A 4I9WD 1MW0A 3LZNA 4F33A 3PS7A 2XY1A 3ABXA 3ILEA 4WK9A 4XXWA 4P2VA 1NBCA 4Y88A 1JZEA 3R12A 3EJZD 3NUKA 4GMSH 3AZUA 1XLGA 4IGSA 4U6VL 1RD5A 3JV6A 4NQQA 3I6KB 4OB5L 1KC5H 1HUVA 4BFOA 4OCSH 3JZEA 2QVHA 1XGUB 4PMQA 4XN2A 1T83A 4Z2KA 4PRIB 1T66C 4U1SA 4M5ZH 3NH7L 2UZXB 1T5WB 1UT2A 5H8DA 4IQEA 3D46A 4UB9A 5C09A 2I25N 4WHYH 1TYRA 4Y4HB 3O6MH 4JN2A 5BO1L 2NV9A 4FXKB 5GZOC 3AXHA 1F18A 4ERAA 1Q0YL 3CBJB 3UJJL 2WZAA 4E8CA 1OGTA 3US1A 4O28A 1KGUA 5LUMA 3C5ZA 2AQSA 2VQ1A 4HNCA 1DLHB 4JM2D 1URLA 3RCYA 5E00B 3U8GA 4QAWA 2GQ9A 1QNZL 4W9HC 5CFAA 4LLWB 5BOJA 4IMGA 3OR7B 2NV1A 3NJMA 3MFGB 1L6FA 5TQLA 3FTWA 2E5CA 4I1PA 2YSTA 2F9BT 1ZE3H 1OAYL 3ME0B 2RD0A 3TC7A 4R4FL 4J12A 2VDML 1QFEA 5CM1A 4KC3B 3P74A 3N41B 3RX4A 2GOUA 2Z6FA 4N24A 5FM5M 3MV7A 5D03A 3TJHD 3GFXA 4UDUA 3CVBA 5CP3H 4DN4L 3NURA 3UBXG 3QDJB 4YX2L 4ZMTA 3GU2A 1MJJA 3CVCA 2YDSA 3VGAB 3G1DA 2P8MB 3U4FA 2BC4B 5DTFB 2ZWSA 2AXHA 5F6IB 3M1BA 3OZPA 5M5DA 3TJPA 3A9IA 2WMFA 5AVTB 5DJZB 1AACA 4P2QE 3S1UA 4Y9AA 5DC9B 3CBKB 4WW2B 3ZL2A 3LN4A 3FN3A 3MUGB 3ROLB 4JNZA 3G5EA 4WWKC 3CFKA 3S2LA 5AYYA 4EPBC 3TZVB 4PRHD 1U92A 5CP7A 4ORGB 1VHNA 5FO9B 4WGVB 2IPKA 4MBOA 1EYWA 1KIUB 1UCWA 4U4IA 5DRWA 4EI5A 3SDAC 4PJDF 1I8IA 4FG2A 4IJCA 3W2DL 1TU2B 1IVTA 3SUVA 2EZ0D 2VJ8A 2RH9A 3B7YA 4BCZA 2NZ9D 3OIXA 4R5XA 3O2DL 4AVIA 4OCWH 4HYWA 4X5WA 3ARGB 3QR3A 3A6BL 3VKBA 4GFTB 1KBWA 3URNA 1X98A 4RGMB 3FJ4A 5FF4A 4HUWB 5E9AA 5E99H 2N4IA 4Q4QA 4HUUA 4WK0B 1Y65A 1QASA 1KBGH 3ZE0E 2G3JA 3VILA 1GW1A 2YXVA 3HPJA 1TTAA 4AYEC 3FUEA 1HINL 1CXFA 3KPRD 3L3DB 4JDVA 3VXOA 1EJOH 3KGSA 4XCCL 3ZT7A 2X2IA 2A1WL 3DVGB 3UD6A 1F56A 5K1NA 3ZHKA 4XWOC 5FFGA 4XPHL 5EORH 3AOFA 5F96L 2E5DA 3KNBB 4PGZA 3MMDA 4WO4A 1K6QL 2UWEB 2OL3H 4HH8A 5LO7A 2BSTA 4KNSA 1V3KA 3PAOA 5KYYB 3XISA 2NY6B 1RVGA 4A7TA 4LLUA 3WQCA 4QRTB 3SW6A 3A22A 1HX0A 3VWKA 2VDLH 1TO5A 4Q8QA 1VPOH 4E5TA 3VJ6A 4KCUA 4JZNB 2OZTA 3RZWA 1PVNA 4PMNA 3H2AA 3KTSA 1S7VA 1U3ZA 2BVPB 3IF1B 3P54A 4R0LC 4AIBA 3KZSA 2QV5A 1AMXA 1F4XL 5T1LD 5ID1B 1BFOB 4NNYB 1IQDB 4XBEL 1F2QA 1XR8A 5CSZB 1BHGA 1O7VA 3MAWA 2ISFA 4Y2NA 1VFHA 2E0PA 4WI2A 2WYIA 4R5EA 3VXSD 8XIMA 4TVDA 1PWLA 4L37A 2Z65C 1VD6A 1S1RA 2FNWA 4FFVD 3ZDXE 4MIMA 4D9RE 5EUKA 4N0FA 3GC3A 1THAA 4L9LB 4LSSH 4TLUA 2QCDB 2ACUA 4ZTEA 3L4WA 3V5DA 1UZGA 1R3HA 4IKKA 2EPOA 4ZW3A 1J8VA 1ADQL 3LZ3A 2A9ML 1JK8A 4HIEB 1AD0B 3QFJD 4PFHA 3TVAA 2E25A 3HBLA 4R2GD 3A4FA 1QTWA 3IJLA 2AI0H 2GZXA 1RZIA 3CUPA 2XG4A 2F8XC 3GEWB 5F21B 1WGVA 4AM0B 3EX4A 1A3WA 1H3XA 4N2BA 2V0TA 3FCTB 3SE8H 5CP3A 4JRYE 3BG3A 4FOMA 1U8MA 2VN7A 4EF9A 3IGFA 2AVFA 4A2GA 4TSAL 1K3IA 1ESWA 1RPQA 5B1AB 5F1IB 1G1CA 1S9YA 1NFIA 2ZG1A 4UTTA 1XYMA 4IJ3B 4NQ1A 3GMLA 2Y70A 1KGWA 3TLLA 2VUYA 2G3ZA 4RZCB 3KHJA 1CYGA 3BPOB 4EZJA 2IXQA 3W74A 3H23A 4BBWA 3BJLA 1KLUB 4M1RA 1BEUA 2CLOA 3GMRA 2DPKA 5FWQA 3L13A 5FYKH 2X1PA 1JDEA 1MF2L 2QVTA 3B9DA 3BLEA 5EU3A 1Q6QA 3PABB 1NKOA 2N7BA 1XL6A 3UP6A 3T6ZA 1VGAA 2ZUQC 4I48B 1DDHA 4J3XA 5KSVB 1QLFB 4YL4A 2HJLB 1FL6B 2JMRA 1UM5H 3GB7B 3QUYD 4K7PX 4WGHA 1A1MA 4CJ0A 4LCUA 5F9AC 3TYUA 1RCQA 3ZR4A 3D87B 4AW7A 4LCCB 5B1CA 3QS3A 1QRNA 2NY4D 4JTTA 3LQGA 1BVNP 1G4MA 2K7PA 1RFDL 1MEWA 2FYVA 4X4XA 3P0XA 3W3BA 5MI0B 3CQKA 5IW6B 4GUPA 3IJDA 4R9OA 3PWGA 1LDPH 4YFDB 4IIFA 4M6PA 4NKQB 1GJUA 4G8GE 5KVEE 3AWEA 2DW5A 3EJYD 3FPXA 5L8JB 1WA2X 3CHQA 4HXAH 5HDLA 1DWGM 2LV4A 2ZSWA 5BXSA 1CGSL 4OGQC 1QLEH 3TIEA 2OM5A 4FALA 3D69A 3QVAA 3TM6A 1YPIA 5I1HL 2OL3A 4U1KA 1A5OC 4X7SL 1JG9A 3O63A 3SKJH 4QRRE 1RZ7H 3CZJA 1YNTF 1F6PA 5F6HJ 3LRGA 1W9DM 2HBXA 3NIDF 2VXVL 4AF0B 4NJ9L 4XIAA 3UXLA 2V9RA 3WUZA 1F6YA 5I3FA 4WFFD 1IKNC 2WOQA 1LYXA 1IC5L 4MD5B 3CZFA 1L9TA 3ETTA 3AMDA 4UFLA 5JA9A 1HTYA 2HFEA 3SRFA 5MEQA 3VNKA 3H8AA 3BVXA 4H20H 4OV9A 5F4WA 3WLWD 4OLZH 1NIBA 1XC4A 3QZEA 3CNKA 1IAIL 5FGSA 4J2MA 4WENB 1G7IA 4C56E 1L3WA 1JRHL 2O5XH 2QPFA 4M4PA 3TVMA 2GITA 4E5XG 4G8FB 3AXXA 3PWPD 2FEJA 5HPMA 4DQWA 3O2WH 5EN2A 3MXWL 3R06A 4RXGA 1T3FB 2CBOA 4AVNA 1SMDA 1DN0A 5J7CC 1I8AA 1SXNA 3DPDA 2XIIA 4ZE5A 2BY2A 2D7MA 1FP5A 4N1EA 4YHML 4WDTA 4POCA 1WEJH 1O7SA 4MZ8A 3AWGA 4Y4KD 4OV5A 3CUZA 2O6EA 2EG6A 2XN2A 4BI7A 3ZHNA 3N6HA 2CGRL 3GSQA 3ARXA 1AFSA 1E9YB 2ZBTA 4FLQA 3R8BB 4JQIH 4ZB0A 1HDMA 1F3WA 3E9UA 5GS0L 5GNXA 1SN5A 4D8AA 1FWBC 1RK0B 5ISZA 2IBGA 2V6HA 4OIFA 2HP4A 2YMXL 4KX8A 2VLRE 3GR7A 3TYEA 4AV0A 5L7XL 1EZUA 1W5PA 2YJLA 4AVHA 1NGPL 1VR6A 2VZ3A 1BBDL 4XOBA 3CU1A 4MXWH 1M7JA 1GGYA 2CBVA 4C4BA 5DEGA 1X8FA 2A21A 2ZZ6A 1F45A 1RZJH 4ETYA 4LQ1A 2W27A 1AG6A 4Y9EA 3BK0A 2C19A 4V1YA 3IETB 3TN0D 1EMTL 3LN5B 5CZXC 4EN3B 1WBHA 3V0VB 1WT5C 1YECH 4IDLA 1DL7H 4PWKA 1UA7A 5HMFA 2AJ3B 3RU8L 2GDUA 4X0NA 3UYPB 3HB9A 2GI0A 2LQRA 4XPTL 1E43A 3WXVH 3VXRE 1RPXA 4B9KC 1TZGL 2M26A 4JNMA 4M1GL 3QIBA 2VLLB 3V0HA 1Q3NA 2KAUC 1U8PA 1HILA 4KDWA 5HUPA 5AB9A 4L1SA 3SY5A 3MCLL 3SDDB 3OR6B 1TQBC 2PAJA 3L5MA 4EOWH 3APTA 5BV7H 6PTDA 3WIHH 2ZG3A 2Z0BA 4ZSTA 2Q10A 3VI3E 3BVWA 3PPFA 5DVOA 2NVDA 3SRDA 3JZUA 3ILPA 5IM51 3PG9A 1QRKA 1EA0A 1JK9A 3QEZA 3E0FA 1NFAA 3IGSA 5AHMA 5DS1A 4HPYL 1E8WA 4AYGA 2NX5E 1AODA 3K81A 2WANA 4L3AA 2QELA 2B4CH 3UJ2A 3FFOA 3VD0A 3FONA 4HWNA 3M0VA 5EOQL 5K3VA 1MCOH 1NPNA 2X53A 2XPGA 4P5SA 4MFEA 4MY1A 1XCXA 2VFHA 2X70A 4XNMB 5T1DH 1E90A 1EQCA 1ZU8A 3IDNA 4MNJA 1IGML 1KR1A 3FUNA 1BG4A 1ZIBA 4BH8A 2UY3A 2X4RA 5F8RC 3QN3A 2HRPL 1WH0A 5A1AA 1BOYA 4EKXA 3UWUA 3KH3A 1KNWA 1TZ8A 1UXSA 1GQJA 4UDTB 5FYLD 4S1QL 2XKNA 3T0DA 4R34A 1QK2A 3DNKA 4LF3B 3FO1A 4K2UL 4PJCA 1O5KA 5I1GL 1RUKL 3MRKB 1V79A 3ZYZA 5HPOA 3F5LA 1HYRC 1NGQH 2CZFA 4L6OA 5K1VA 4IOSA 4UZGA 2G5UA 1W3JA 1DVZA 4XOAA 5I5JA 4PY8I 4JTQA 1QI5A 1JGUL 3L5JA 1HK6A 1WA3A 4G43A 2QJJA 1ZS8B 3DHUA 2ZNXA 1WOAA 2ZA1A 3NYDA 2HZGA 2TSAA 5I1CL 2GGEA 4YHEA 5E0QA 5JNYA 3EGDA 1OBAA 1TTUA 1V7NH 1WBXB 4IIZA 2J8UB 1E4HA 6CGTA 4E3TA 4Z0SA 4M61A 4WK4B 5HMSA 2QPEB 5A5WA 3JS3A 2JIWA 1LD9B 1TPXC 2R2HB 5HGDB 1F3XA 4W9EC 1UR2A 3WLBA 4UFJA 3SCMA 3HE7D 2JB5H 2XWTB 5D2NE 2J66A 2WVVB 2GK1B 1JPTL 1JVLA 1OE3A 2R91A 2JE8A 4EUPB 2VJ0A 2J5WA 1SF3A 2J43A 5LKYA 2AL1A 3UVAA 5JR1H 3QCUH 4HS8H 1HP5A 1XUUA 4PGEA 3BVVA 1LG2A 4XSMA 2IFFL 4NPYB 3IDMB 3I02B 2BSLA 2FQEA 1VESA 4HMCA 3G8RA 4N1HB 1RU9L 1ZVHA 3NQCA 4M62L 2CO6B 2W07A 2J1YA 4MCZB 4OF0A 2NW3A 1UIPA 4KFPA 3WFHA 3GS0A 3FB6A 1NAMH 3VB9A 2F7IA 5LCVA 3SGDI 1MZRA 1UOVA 3B04A 3PZ9A 2IQTA 4H8HA 4OZIA 3HC0A 3QWRD 3N0PB 1EAPB 2FWOA 2E7FA 3UTSE 1V08A 3IGAB 5I6KA 4PRIE 3ZXWA 3HMCA 1X3DA 3VACA 4AW4A 1OCWH 3AB0B 4X4MA 5C0CD 4XPGH 4LLVB 4AGMA 5CJBA 1BXBA 2NYYD 3S9ZA 1WX0A 4QRUA 4FJ6A 4MNHA 1YMMD 4G6AD 3H2NA 1PE1A 4FG4A 5ETUB 4GWEA 3SGZA 5GJTH 1N64H 4JX5A 1CWVA 1ZLSH 3WO4B 2ZUTA 4D0CB 3C0QA 2EVGA 4ALAC 5C8JA 3WIHA 3WQ6A 4W9GC 3BW9A 4UTUA 4D9QE 5GSRB 1UC6A 3UX9B 4YXLH 5KVDE 5T5FH 5JOFB 4U1NA 4N2YA 2I7SA 2N7SA 1KPVB 1NBYA 4LCYB 4ICMA 2EJ1A 4P49A 3B8IA 2CUIA 5C0AD 2RB8A 4EPDC 5DVPA 3PGFH 2QSQA 3T0EC 5CILL 2UY7B 3SN4A 2EDJA 1KCUL 4E9VA 1I85A 2CM6A 2LGNA 3CFCL 2HSAA 4WAFA 4FX8A 5KSBF 2XXGA 1FWXA 2NXZC 1I9IH 4L18A 3MTWA 3I9IA 4K2SA 3TFXA 3KRZA 4TQPA 1E4WL 4HHPA 1CBVL 5J11B 3NZHL 1D3GA 1KB5A 2VGBA 5J1SC 4YO0A 2PBGA 1YDPB 2PDHA 1DEEA 4G5ZL 1KFEA 5GRUH 5E93A 2C16A 4Y5YC 1H63A 2FLRT 1T20B 1C5BH 4L8CA 4I7UA 5IESH 3TOPA 5D71L 1ORSA 5FUZH 4ZE4A 1TWZA 2EKGA 3PJXA 4M7LT 4QQUA 2GC7C 4WKZB 5H4ZA 3F2CA 4N6FA 4A8NA 3M47A 2XTLA 3C8HA 4ZNCD 3PP3K 1ZMYA 2Y63A 4JTRA 3B4YA 3CXOA 4K68A 1U1JA 3MJ8A 5BXRA 1FN4B 4C8XA 1ZA3B 5H4YA 2X1XR 2BZNA 3QG6A 3OTRA 3EYOB 3WKQA 3HQ1A 4D3CL 5DC0A 2KC0A 5T8GA 3Q44A 4IRSA 2VM8A 3L4TA 4LPYA 3VOJA 3ASNB 4DJDD 4O2CB 5D8JL 4AZIA 5KWYC 4HZAA 4NO2A 2CNYA 3T4YB 1QFUL 1N10A 4I18C 2A6DA 1PDZA 4JR9L 3IN2A 3HNSH 5AZEH 1WDAA 5CSYA 2BIPA 2WCGA 2Z1WA 4JZOB 3EWWA 3JV4B 3GSVB 3U9UB 2XX0A 3PNZA 3CHVA 2ZVRA 1KOAA 4H9XA 3G6JF 1PLBA 1PTAA 4L05A 3MZGB 3DDMA 3RB5A 2VCOA 4DJEC 4M5PA 3GJEA 4MMXC 1UKOA 3O45B 4FQXA 2HTMA 1HOCB 1C8XA 3BD3A 3UDWA 3QQ3A 4R7LA 4PUDA 2UY6B 3CK0L 5FUCC 1V3JA 5LNGA 3TO4D 1UHVA 4ZZKA 4O17A 5HNUA 3ARUA 3MXVL 5T3ZL 5GS1B 4EVNB 2UWEE 1IE7C 5G4WA 1NAMA 3N1MC 3KXQA 3TU9A 3L1FA 4YS4A 3BDYH 1A21A 3ATBA 3FS9A 3ZTEA 2AQ3A 4LSTL 3CFEA 4POZC 5KSWA 3UJSA 4LIQH 5I0ZA 5FLVA 4YR6B 1QO3B 2WMPB 1NM9A 1GGTA 5C0BE 3DCPA 3XINA 3L2IA 1FQ0A 5DJ6B 1XXXA 2AKRB 3UPMA 1H09A 1X9LA 2J88H 4WNSA 3S35L 3F8UB 3LOTA 3EHBC 3HR5A 4IOFC 1FNSL 4Z7IA 1IO4C 4HJIA 2NZIA 3EW3B 4MLSA 4YJZL 3FY1A 1H7RA 1GVOA 4MA1B 3ZIMA 1PZ5A 3JTSB 5AZ2L 2H26B 2ICWA 3GDLA 2YQ2A 4YDIL 4KTEL 4V2BA 4NN5B 3PWVB 3P60A 5F2GA 2GSJA 4H7CA 2NUYA 2PRLA 4K9EL 3VXSB 2A9CA 4JY5H 4PS8A 1GMIA 3OU8A 2CLMA 1U8NB 4KKZA 1HZHH 3FFDB 1LILA 1O7AA 4LHUD 5T5FA 1DIEA 3HZVA 4MKVA 1V8EA 1AFVH 4OH2A 3ESVF 4YSTA 4MXVF 4Y8FA 3QUKB 3QV9A 3PAUA 1OD8A 3FB8A 4DEFA 1RJZB 2ZRWA 4C60A 2HRHA 4FMKA 2D7TH 1T0OA 3MA8A 3QFJB 2B0SL 2AABH 4Z7WA 3WS6C 4AGOA 1DORA 4E4PA 3WLIA 1UR1A 4QLJA 4ZUWB 5HWNA 4ZUSB 2PXYB 4YSUA 4P46B 1LP9B 4X9BA 8CGTA 3KEHA 4G6JL 5FA4A 1ICTA 2JKLA 2DZEA 1EC9A 4Z6AT 1SYTA 3C08H 1S38A 3PL6A 1R33A 5DHYB 4NVTA 3QUZD 3WQVA 1CD1A 3V18A 3GHRA 3CZNA 4OGZA 3C8KA 3HG2A 5TDPA 4US6A 4MD4B 1CGWA 5E2TH 1HQRA 3TBSB 5C54A 4EZMA 3S37H 3RA7H 4ABQA 4FNSA 5EC2B 1OAXH 4Q2ZB 4WSHA 4LPXA 4P2OD 1A7NL 5D1ZD 1AG1O 5I26A 4ISVB 3C4UA 1F42A 4IPPA 1F9CA 3ROOB 3DV4B 3UCRA 3AHZA 3ZHLA 4NKDB 4GRWF 4H4NA 3DG7A 2Y3AA 1MIMH 1SDYA 2NY5H 5EDXA 4EI0A 4U6XB 1LRTA 2DTML 5DUML 3A5FA 2P5PA 3VM7A 5TPWH 3S3BB 3VDHA 5G4EA 4PMXA 1JOIA 1NGZA 4M6QA 3SDCC 4NZTH 2W0FA 5CLTA 3DX6A 1HCVA 5C6MA 5AVHA 4C6FA 5E1HB 1CDHA 1XL4A 2ROYA 2UV8G 3VXTB 3MB9A 1HKVA 3VA6A 2OWXA 4APQA 3K46A 3HFYA 1WAUA 1YY9C 2QADB 2XRAH 2WWDA 1P7QD 5DQ9A 2AXFB 4RPQA 1JGLL 2G75B 3FX4A 1JGIA 5DEZA 2VVNA 5DANA 4O4VA 3TFCA 3WQ4A 2CLZA 3QUYB 1IUZA 1H5BC 1OP9A 3HC4L 5M3WA 1FNEA 4MNLA 1QBLL 4Y8EA 1VJZA 5I3GA 4P23A 4O16A 4LYRA 5D32A 3W82A 4JPWH 1TTJA 4OKVB 4HISA 3AAMA 1PG7W 3C5SA 4JMNA 2YHGA 3H9SD 2EIZA 5DSCB 4IU3A 2ACRA 3FQUB 4ANWA 4OI8A 2NUTA 3GRIA 4X83A 1KIRB 3P0YL 3TZNA 5CGYD 3F7VA 5J5DA 1X5MA 4JFHD 2BX5A 1A6UL 3CDZB 5DUBB 3L5LA 3FQWA 2WPGA 4H9ZA 3U0TA 4D6CA 1J6OA 5DT5A 5F4XA 4Y0GA 4DW2L 4X4KA 4LLYB 2WXGA 1FHDA 4X9GA 3EO0A 1FGVL 1LMKA 1RP8A 3IFNL 2C18A 5GGTL 4G8GB 4NRYA 4CNOA 3SGEH 1Q9KB 4B96A 2JJSA 4G7YL 5B3NA 2CRZA 3HGSA 1V05A 2J88A 2AKMA 1M05A 2X6MA 3ARFD 5EZLB 2OQJB 1PG7L 3WAJA 5AUMA 2EF9A 1B5TA 1QWGA 3O2VL 5J3HD 1J96A 5KZDA 4QRRB 4GKNA 1J01A 4LBSA 4OLYH 2CJUH 3FSZA 5HI3D 5BW6A 3TJEH 2XG9A 2OX4A 3IJ7A 4XOEA 2FEEL 5D6DC 3HPAA 3GIQA 2DPEA 1OVZA 3D0AA 3QEUA 4NHCL 4YHZH 3U25A 4OFDA 2KUTA 4IQJA 3K1KC 1R9ZA 3HN8A 3QARA 3ECWA 3ME3A 4FFWD 4JPSA 3KR3L 2WSDA 1P5VB 3RFZA 1A22B 4A39A 1OY3B 3WYZA 3SZKC 4WTZG 4FZ8L 1Q7MA 1HCZA 4ODTH 4LGSB 1EDGA 5D7IE 3ATAA 4X4YB 4Q8OA 4Y4KB 4P4KA 3HLAA 1HJUA 4OFCA 3TSBA 4YE0A 1N0LB 2EEBA 1QR1A 5SX5K 1IC1A 2QDEA 3BZDA 3EWDA 2IC2A 3NPVA 1UD8A 3H2PA 2Y7GA 4B5VA 5E6UB 3BKJL 1VCFA 4JVPA 1NU5A 3AZSA 3BGMB 5I1LB 2DJMA 4DP0X 1JYWA 2CERA 4Y5VA 3IU4H 2X41A 5C0ND 4N0YL 5TQ0L 2OI9C 4FL4C 3L9EA 4CD4A 2KZBA 4C59B 3GX9A 2EO1A 4I0PC 4YWGL 2F74A 4YH6A 2ADFH 1QNVA 1RJYA 1RL1A 2XV6B 3QBTB 4Z7NF 3DX2A 4I1NB 2ADGA 4RW5A 1H3PH 1L4IA 3J07A 3GO2A 2QT3A 3TN0B 3KPMB 3MJ9H 1ZSXA 1OD0A 2PFHA 4HZ1A 1MN4A 5I2IB 3IDXL 4A3QA 3K4DA 3NGBB 4YGVB 3V5KB 1QVOA 1DQDL 3DHPA 5F44A 2HK0A 2Y6SC 1FE8H 3MFFA 4NM4L 2MSPA 4NKIL 3G0XA 1A9BB 1GTNA 6TIMA 3AAZA 1JBJA 5LGKA 4H5SA 2UZYA 2D22A 1HJBC 3C2RA 2VR7A 1UM6L 1Z7AA 1JHKH 4XX1G 4XP9H 3UZXA 4W6WB 5HULA 3H1ZA 4N02A 1B9KA 4W4OC 2AZAA 3KHOA 4FF9A 3MV8D 4M7LH 3CCHA 2XZ9A 2Y89A 3LZLA 3V5FA 1XH0A 1FDJA 1MFCL 1DUYB 3QEQD 5LG1A 5FF6A 3OKYA 3A24A 5SWQA 5DFVD 2GGHA 1K02A 3ZZLA 3DXIA 4PGCA 4J5NA 4AE0A 5I66A 4C1NA 3VCLA 3H2QA 1FH5H 1GWJA 4HA4A 2WAQA 4R90H 3AMCA 4F2MB 2J1ZA 1A53A 4LCWD 1RY0A 3KPQA 1I1AA 3VI3B 1GSKA 4NC2B 4DLMA 4DGUA 4ODXA 2XI9A 4Z7UA 3V8CA 1KLFB 1H7WA 3CVHB 4S3DA 4DF2A 1UM4L 4RWHA 3P30H 3EWUA 4FP1A 3ARDC 2ZP9A 2W9LA 3DOSA 5MEOB 4YMPA 2AV1B 4KCVA 3RUGA 3JWNC 3B43A 3ECQA 2ZQ0A 3N1AA 1AY1L 5LHDA 1EX5A 3K5RA 2PWDA 1KIPB 3SE9H 3DFPA 2BY3A 5D4QA 4KJPC 3LKPB 3WD2A 3PPGA 3D34A 3EAUA 2W9EH 2YGNA 3EXTA 5DJDB 4OCMC 3O0RH 1TCDA 1ZEAL 4Y5XC 3ZKXC 2W0KA 2BJML 1T1ZA 3LS4L 1AP2B 4Y16B 3OJGA 1T03L 1NDGB 2J8UE 2EDHA 2WM0A 4JEGB 2K4WA 3HHMA 3HAEH 4F2TA 2OZ3A 1GXEA 1OJXA 1JHLL 2DV0A 1Z3GL 1U8LB 3E80A 5DYFA 2H6PB 1AKPA 4ZUVA 3OG2A 2DJUA 1Q9OA 1A64A 4EACA 1EZWA 4NB7A 3N29A 4DN3H 4YK4B 4ZXLA 2Z31C 1I8JA 5LDSA 1HYSC 4YHLH 5HR6A 2W60B 1KULA 2OZ8A 1HCYA 5LBSL 3MO1B 5E8NA 5EF2A 1TVHA 5IVXF 1YSOA 2X30A 7ENLA 3GK8L 3DX7B 4MMYB 1K77A 1T7ZA 2H32H 1G7PA 3DUHA 1UOLA 4PS4L 5JTWA 2TAAA 3W7GA 5DD1L 3EO9L 3B3DA 1A7OH 3B2UD 4LASH 4GHRA 4X6DF 2Z91B 5E08H 3KLHC 1KENL 1DJHA 2HT3D 1J4EA 2E75C 1MFDH 1YEWA 4H8WL 1H51A 1Q6OA 2GJLA 5E7FA 5FO8B 3VB8A 1IYXA 2PN5A 2WJ7A 2IANA 3DMMC 1BVNT 2XTKA 3HS0C 1JNHA 4ZMNA 5HVWA 3UAAA 4I9WE 3FEQA 3SCRA 3T4CA 2O4EA 3BMWA 2EUZA 3VOHA 2HT4D 3B9OA 5HI5D 2LAGB 4M1DL 5CZVH 3D3VD 2YIHA 3GXNA 5BS0D 1VCGA 3WJMA 3UXFA 1N2VA 2OPJA 5L0QB 2QNEA 1A4MA 4G1KA 4WI5A 3U9PH 5ABFA 3MYZA 3MJ9A 4QHKI 1L9SA 3PVFA 1YEIL 1E5JA 3FT2A 4H6RA 4XT1C 1FG2A 2HLFD 3QFEA 3OA3A 5DJXB 1N70A 1E55A 4IHOA 2X0YA 4QE5A 2I5YL 7CGTA 1ZJAA 1B4JH 2O61B 2MTPA 4O8RA 4F9DA 2Z35A 3IAQA 1JJKA 4PJAA 3T4AC 3WH8A 1J1OL 3AMGA 1YMMB 3TPKA 3A4DA 4S3KA 4QTFA 1O5RA 4KUZH 3UTSB 4O2EB 4JIQA 2E28A 4S0TD 2VEKA 3RGVC 2ODIA 1OZUA 1XZ0B 4WK2B 5JHBA 2VW6A 4AZHA 1HFUA 2DQHH 1FWCC 3BP5A 4QGYA 1NBVL 4NL1A 1ZHKB 1QAWA 3U36A 1UWGH 1DJSA 4KRMB 2Z1XA 2DEWX 3GUWA 3GMOA 1DJQA 2UYLB 1F8TL 3PBYA 3AHTA 1MAMH 2ZX9A 1P2CA 3NZRA 1R4XA 4IMCA 2XYBA 3KUMA 2NY2D 5MEPB 3S1VA 1HXKA 1GYLA 1Z89A 5IR1A 1ISYA 4J3WA 2PGEA 4R4ND 2OK0L 3CZSA 4YEEA 3QR1A 4N85A 4P04A 1UZ1A 4AENA 2RJHA 3BQUD 4C65A 3OBKA 1N8IA 1QABA 3BUYB 4EZKA 2ZYSA 5IB3A 4QEEA 5IKCB 1N6UA 1K6AA 3GO1L 1HKLH 4PRDB 3TONA 2YR3A 3TBWB 4J3OF 1Q0XH 3BZEA 5HDRA 5FKYA 3IS4A 4L80A 4O5LH 4J8RB 3VPLA 4BI6A 5JLZA 5F7DB 2RGMA 4NQTA 3ARYA 4HS6A 3BEWA 4QJ3B 2XYLA 3O06A 1WHOA 4B4HA 5GGVY 2XWZA 1GZQA 3L16A 1LWHA 1LO2L 4DZ8A 3W7MA 1X5YA 1JWMB 4R7DB 5IFAH 1CN4A 2EYRB 3W29A 4MMWA 1SUHA 3NFSH 1OSYA 3OZLA 3D4GA 3RZCA 3T0AA 2FL5B 3L5XH 2BY0A 3WD1A 1FWGC 4PRHE 1J0HA 3G1RA 3HAEA 2IQAA 3CQJA 2H90A 4MADA 3UPBA 2NWRA 3FCSB 3SPVB 3AXLA 1F73A 1EZLA 4GJ1A 4HWBL 5F71A 4FEIA 4OGAD 3KEDA 3SUTA 3AY4C 3H42L 3MRMB 2C9PA 1XHGA 2G4JA 1UWEL 5HHVH 4W68A 4DT2A 3WFBL 4GJTB 1K8DA 3DX8A 4KERA 4XI5C 3CFDA 2DM2A 3RY4A 4ZX5A 3SBRA 4KRTA 1OEPA 4TVCA 2H32A 2A74B 3EUUA 3WQOA 3X2QB 5DD6B 1OXYA 1EJSC 1M7XA 3K6IA 4D9PA 4YE4L 4DQAA 4F9PA 1AHWB 3BOLA 2BSEA 3RLHA 3C5JA 4FTVA 5TQ2H 1WOBA 1GG1A 5L2KA 2PUQT 2JTDA 4R7VA 2HJFA 3ZTNH 2IKGA 4JG9A 4ZFQA 3QQ4B 4L2YA 1YJDC 4QRSB 4M6OL 1L9PA 4MQ7A 1WG3A 1GONA 3S1GA 4OUUA 4XNAA 4A2SA 5IROD 1IIIA 3EG9B 3PG8A 3BHBA 4OLUH 5K39B 2YLLA 3OM3B 4E8GA 4WWID 2EDFA 3QZWB 2CLHA 2L7EA 3TO4B 3LOWA 3QIUA 1BVKB 1Z8AA 2NY3D 3OW1A 2F53A 5LBVA 3JWOH 3MNWA 4WDIA 4FB7A 4H2CA 4XV0A 1KZYA 2XJ7A 4HPOL 3ITVA 1P4IL 5IT2H 3KWXA 2H2SD 2HKFL 3ZHDA 1R2RA 1AZCA 2VXQH 4I90A 1UENA 1U91A 4HH9A 1MY5A 4WSJA 1WCBA 4IWWA 4JHVA 1NFDB 2WXQA 4E0RB 3VKAA 3WL9A 4RMSA 4Y1TA 1ED3A 2JJVA 5I5IA 4M19A 1M1XA 3IMRA 2BZCA 1CCWB 4Q6YA 4H0LC 2J1XA 4ONGL 2JKWA 1NCUA 1A7RH 2DD8H 3ANUA 5C0BB 4ZMYA 1UP2A 3VXSE 1HKJA 3B34A 2NNCA 1BIIA 3ZIZA 3VIOA 3L3IA 1IKFH 2L3BA 4E9QA 4PJ7A 5IJBC 3RNQA 2PETA 3EYSH 2ATSA 3IDJA 3LNDA 1PKQA 1XIIA 3FKUS 3ZLHA 2QIWA 5GSVB 4BDVB 5ALCL 3FTZA 4TOYH 3IPFA 3VTRA 3RVWD 4MY9A 2VSKB 3JRKA 1T5XA 3DYPA 1DFBH 4M1CD 4FEZA 2NZLA 2HPOA 3RDTA 4F7MA 2QCHA 1TVBA 4HZ6A 5EUOA 4DWSA 3QFJE 4KMTH 2C14A 4TXVB 3GVGA 5SV3A 3AQYA 1TENA 2WLZA 3OZKA 4MZ1A 2PP8A 4JRLA 1LP9E 1BXUA 3UP1A 3S36H 5D9NA 2XWDA 4XO3A 4Z7OB 1L6WA 3L6FA 3TFBA 1R9XA 4ZQPA 2A4EA 1CFMA 3K4WA 5F8QC 3MRBA 2Z34A 2WBJA 5DZVA 3O1NA 3UBPC 1DQJB 1M2VA 3CDGB 3M88A 1DUZB 3UXAA 2B2XL 2NQDA 4GQ9L 3FU0A 1K5NA 4BQ3A 4AV5A 2R8SH 4DI9A 3Q9PA 1ORQA 2X8RA 1IC4H 4ODUA 3TBVB 1MFAH 4P2OB 3ZKNC 1OAZH 1MIEL 1OCBA 1MFEH 2F15A 4K3GA 2VXSL 4PGLA 4KUCF 5E6IB 4FQ1L 3NAAH 1PJWA 3VWJD 5LGYA 4G42B 3QEHB 5GRZA 4H2HA 2P5ED 4YZFF 4ZQKB 1KTRL 4TM9A 2UBPC 3NN8A 1R3JA 3VDAA 2XV3A 3BZ5A 2CEQA 3KLKA 1T8XA 2RCSL 1AQMA 2E47A 4E8DA 4F92B 4MJMA 2IAMA 4WHDA 2WOBA 3K2KA 3WE6A 1DBBH 4AEHH 3DI3B 2FAUA 5C6TL 1T7LA 4N8VA 3DV6B 4XVJH 4MUPA 1OP5K 1OCRB 3QZ6A 2HVOA 2BVWA 4LLDB 3AT0A 4XPAH 1F90L 2Y7NA 3OGSA 4Z77A 3UTQB 4GW4A 2OELA 4KNTA 1IKOP 4FLHA 5GIRB 3GZOA 3B9VA 1BQHG 3QZMA 2Z1SA 5CAKA 3L17A 5CS7A 3HCVB 5D1XA 2PO6C 4CKVX 2PCYA 4CNPA 1AKJD 3GD6A 3PS6A 2XFWA 1KIQA 4FOKA 5AQ0A 3H9SB 3NZ8B 2WXNA 1VPQA 1CLVA 2O93L 3TYCA 2HKHH 3WQGA 4LKXB 1OPGL 4FJYA 3WDHA 1KN2L 4P4RA 4MB5A 3VTTA 1IHIA 4LB4A 5HNTA 1IAKB 3V4PB 2PZ0A 1EEYB 4DO6A 2CWNA 2VE6B 3ULUC 3AREC 1XAKA 2FBRA 3N3TA 4RIRA 1AZUA 1VZIA 2Q02A 1RLDA 4DGVH 1XS2A 3MSDA 1OANA 2Y7MA 4WFFE 1S7QB 3F5WA 1B4RA 1S9WB 1GGBL 2VXQA 1A3RH 5IHSA 2UX6A 2XZ7A 3IUIA 2XWJB 4ZAKA 5D7SL 3UR7A 4PJ5D 4WV1B 1QNRA 3KWVA 2QTVA 1W1B1 4D71A 5LBGA 2ONEA 4ANUA 3TYBA 3NQFA 4Y4FC 3VSUA 3ARFB 3OQEA 4HKBB 1QTSA 1I7ZB 3F64A 3GJFK 4R96A 3LH2L 5IW1A 5FYJU 3KVJA 4HX1A 2J6XA 1REIA 3NT0A 2WHVA 1NL0L 4JY6B 2A7RA 2ADAA 3PWPE 1YXDA 5EMLA 4EE2A 4ZXBC 1WPCA 1KM3A 3V7AG 1A7BA 5GNYA 2Y0FA 4DI8A 1UXWB 4XZUB 3IPBA 2PYEB 1JE6A 5K4ZA 2XIBA 3JWDL 4LVOB 4Y1SA 4KRPC 1A4CA 3KPOB 4UB0H 1XWYA 2FEDD 3BEVA 2ODOA 1WTGT 4Q6KA 1C5DA 2INEA 2Z00A 4ZR8A 1YDVA 1V6VA 1EXGA 1XTLA 3RY5A 1F3EA 3U2JA 3O11A 1XISA 3TS8A 2B5IC 3MMUA 4JG5A 3D4CA 3BGGA 4XP5L 4Q6IC 5D7IB 4Y1AD 3NESA 3KLDA 4FGMA 4KVNL 4HOXA 5DR5H 1W0WA 4BZ1H 3S9IA 5HBFA 4LW7A 1JPKA 4XD6A 4XRCA 1RIHL 5HHPA 4Y19A 4HU8A 2ED8A 2OFJA 1TJPA 4DQOL 2J4WL 2GI7A 3KBPA 1QW9A 2H1LM 4AD5A 4GO6B 3HW7A 3W5MA 4UQBA 3BPCB 4MSSA 3TX4A 4BK8A 3VI4B 5BQ7B 1T4KB 4OZGA 1Y18B 4QHMA 1E6ZA 2X9YA 2YD5A 1RUPL 4MDJB 3FTUA 4S1FA 3BO8A 4PJFB 2R51A 3AG1B 1OCZB 3TO2B 3DHDA 1XLBA 2VC2B 3N9RA 1GAFH 3WOVA 3FQNA 1ERNA 2LLNA 1QXLA 2IG2L 4XZHA 2FX8L 3IS0X 1MG3C 2PODA 4HN4A 5KBDA 1S3RA 3RIAF 3T2OA 2GTWB 5AYZA 4NXKA 3PG2A 4TTGA 1M01A 3NP3A 5D04C 4LOVA 3TXZA 5C0FA 3W23A 1R9YA 1J79A 1KV3A 3FRPG 5CCKH 4X5PA 4US5D 5I19H 3QEQB 4G2DA 1N6VA 3IJHA 3IRDA 3R1GL 5BWFA 1KCBA 4WI3A 2X7LB 4F2ME 1WYJA 2Z8SA 1X5AA 3E2HC 4A1RA 2B20A 2VZUA 4HPJA 5BZAA 3VFWA 3CV5A 4GFSA 1UZDA 3HE6A 1NC2D 1I2OA 1QSFA 4UCFA 3BICA 1BFVL 3TN5A 2DQJH 5FACA 1MCFA 2ZJSL 1LG1A 4U1MB 3EGSB 5B8CB 5HOSA 3MKCA 1KXHA 1JGEB 1BZOA 2ZCZA 3TYFB 3VG0L 3PM6A 5AYUH 3PF2A 1TE1A 4R26H 1BEYH 4B3KA 1CLKA 4KH2A 3R18A 3VNDA 5IHLB 3ITXA 4HZLA 1MDAA 5KSUB 1NBQA 3U82B 4RAVB 5FYLE 4UNLA 2I26N 4NWUL 5D7JC 1I3GH 1KXTA 1KTKE 2X87A 3PSWA 3DFYA 1I1RA 3SCNA 4KJWD 1MCIA 5AD0A