5A6LA

High resolution structure of the thermostable glucuronoxylan endo-beta-1, 4-xylanase, ctxyn30a, from clostridium thermocellum with two xylobiose units bound
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
389
structure length
389
Chain Sequence
MASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTAVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CARBOHYDRATE BINDING FAMILY 6
publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
total genus 137
structure length 389
sequence length 389
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5a6lA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5a6lA02
5I24A 4X0NA 1JD9A 3EJPA 2CHOA 2EXOA 2WKLA 3F5LA 3WD4A 3LPOA 3VNZA 4PTWA 3DHUA 5CG0A 2WC7A 4JFSA 4LYRA 5ECUA 5JIPA 1FOBA 3RMEA 4JHZA 5A6KA 3BH4A 2J75A 1UR2A 1DWAM 4JFVA 1CYGA 1KTCA 3WF4A 3WENA 3ZT7A 4V28A 4TOQA 1HKJA 4MPKA 3MMWA 4FNTA 3RM8A 2VRKA 1QOXA 2ZUNA 1EOMA 1BVNP 3A47A 3L2MA 3VIPA 4TTUA 3MKKA 3SCSA 1TR1A 5GNYA 3NCOA 1KGWA 4PYSA 2VX6A 3BUPA 4QCFA 2OWWA 1E0WA 4AY1A 1E72M 2XSBA 2WLZA 4IISA 1CLXA 1OWQA 3HG4A 3SCTA 3EDFA 1MW3A 2O9TA 3RDKA 3WL0A 3L4WA 1I75A 2D20A 5BROA 2JEPA 2XVGA 2VZSA 4AZ5A 2PI6A 1E5NA 2F7RA 4OGZA 5CPQA 4MAZA 1UZ4A 4CD8A 3EJSA 1TQWA 3VSVA 1JD7A 1HL9A 2V5DA 3RO8A 2BVTA 1UR9A 1UD4A 2E8YA 1HJVA 1J0YA 1VBRA 3VDBA 1FP8A 3AZSA 1KXHA 4U33A 2W67A 2D0HA 2A3HA 2PB1A 2W91A 4ZE4A 1AQHA 1KCLA 4Z2GA 5DMYA 3PZTA 3WDIA 4YHEA 4GO9A 2AOSA 3WNLA 1I1XA 2XGBA 5I5RA 4D6JA 1A47A 1KGUA 3W26A 2YOCA 1SR0A 4HZ7A 3LRMA 3AYRA 1GQIA 2F18A 1AVAA 4JCMA 1LF1A 3I3BA 1JXJA 4B9YA 1JNDA 3EDJA 4OOZA 2ZX8A 4PMNA 2ZXAA 2CERA 1DHKA 2V3GA 1K9EA 3GBEA 2EACA 3DHPA 1E43A 2EPNA 1W3HA 2J7FA 1VFFA 1QHOA 1QVBA 3EJRA 1UZ1A 1TUXA 3OBAA 5A8NA 4OZOA 4OOUA 4PCSA 3ARSA 4XUYA 3AIQA 3GXFA 3EMQA 4HPGA 3O2LA 4C7DA 1B31A 1CXEA 1T0OA 3ZSTA 5ABFA 4HA1A 2NSXA 3N15A 4M8UA 3M46A 3W29A 1KCKA 5CGMA 1C7TA 2XFRA 4Z2HA 2VQUA 2EADA 4ZE5A 3BSHA 3PN8A 1QI4A 1WE5A 2ZX7A 2CPUA 4PMQA 3TP4A 1QNQA 2XGIA 2YL8A 1L0PA 4PUEA 2XWEA 3A3HA 1JZ7A 5CXPA 4W7VA 2JIEA 1ITXA 3VM7A 1XSIA 1W1VA 4UFKA 3CHFA 1O6IA 4JKLA 2VQTA 3TV8A 1GJUA 1MVYA 3AISA 1RPKA 4EK7A 4NRRA 1UA7A 1DEDA 4PRWA 2WMIA 4WKHA 4H7VA 3TONA 2E3ZA 3KL3A 1BAGA 1P6WA 4OJYA 2A3CA 4MJ4A 3LPFA 4RE4A 2VZVA 2DSVA 4B16A 1WP6A 1PX4A 5A8MA 3BAXA 3KLKA 2V5CA 2XIBA 4QLKA 3MUIA 2X0YA 4XV0A 1M7XA 1AMYA 4GQQA 4XZWA 4OKDA 4HMCA 5AC5A 5A94A 3WD3A 3W0KA 4J7RA 1V6VA 2VRQA 4WK9A 1NP0A 1VEPA 2D1ZA 3SCRA 2BVDA 4D6EA 4X9YA 4K68A 1V0MA 4U3CA 4CCEA 1BLIA 4D1IA 3N9KA 1E4NA 1PIGA 4DWSA 1KR1A 4W89A 4B9ZA 3BCFA 3BAWA 1BSIA 2GFTA 4P7LA 5D9MA 4LXFA 2NT1A 3FAXA 4CGTA 1CWYA 3WF2A 1XV8A 1UKPA 1UR1A 1H3GA 2ZUMA 4OBRA 2CESA 2F8QA 5BRQA 3W27A 1ZBWA 3WNMA 1UQZA 4P7RA 1MXDA 3ZT6A 5KZ6A 2QLYA 3GM8A 2YBUA 2EABA 1TVNA 2DT3A 2WCGA 4B3KA 1UQYA 2Y24A 3B8SA 3O6AA 2J74A 4GXPA 3PHAA 3WH5A 1ISWA 4UQ9A 1DP0A 3SCOA 2PWFA 1JL8A 3AQUA 3U7BA 3QHMA 3L4YA 5E6YA 1MXGA 3L4UA 4Q22A 1R75A 4FNQA 1H11A 4RL3A 3VILA 1EHAA 4AZBA 3OG2A 2WHKA 1ODUA 3VMPA 4NRSA 3VVGA 1CGTA 1EH9A 3W28A 5A6BA 1W1YA 4Z2LA 3B9EA 2YDRA 3O9NA 1C3FA 1HT6A 2E9BA 1G0CA 1E6PA 2UY4A 2DSWA 3AHTA 4PUDA 4J3XA 1R7OA 2FH6A 3ALGA 1PZ2A 2X8RA 1V3IA 3BUIA 1H1NA 3VO0A 1W3KA 2G8ZA 2VTFA 5A6SA 3AMCA 1HP4A 3UG4A 5LA2A 1CDGA 2DT2A 1BQCA 3CH9A 3VPLA 3W6LA 3CZJA 4UNIA 1V02E 1JI1A 2J7CA 3WDPP 3WELA 1LL7A 3BVUA 1R87A 1FFQA 7A3HA 3UCQA 3VSUA 3A22A 3VDAA 1RP8A 2J25A 4PSPA 4AZCA 4Z2IA 1GW1A 2PBGA 1OB0A 5D8ZA 3T2PA 4W86A 3WBAA 3U7VA 1CXHA 1Q6DA 4CUCA 2WYSA 3KEHA 2WVVB 4E8DA 4UOQA 1KWGA 5GNZA 1HKMA 4GO8A 1V3JA 4ZFMA 3D4ZA 1O7DC 3AXIA 1HIZA 3OLGA 2XFFA 4E8CA 2W66A 4P8XA 1CGXA 2DSUA 2W63A 3DYOA 5CPSA 4JHOA 4W5UA 2Z1SA 1G01A 4DO4A 4H8HA 4MADA 4MJ2A 3F4VA 1BYCA 1ZJAA 4Q7NA 3DX2A 1MFVA 1UG6A 1HKKA 3LX9A 4W5ZA 2GDUA 4NF7A 3WEZA 3D50A 1VRXA 1BHGA 4DUXA 3AYSA 3WY3A 5EB8A 4AD0A 4D71A 1UKTA 1OIFA 2QMKA 1VF8A 4AEFA 1CXLA 2W92A 5BXRA 1TQSA 4MDOA 5FCZA 4UQCA 3PZOA 4H8VA 4KRTA 2W62A 3LXCA 4H8UA 1ZB5A 1LWHA 1W9DM 1KB3A 2J8GA 1OGSA 4H41A 1GOIA 4URIA 2CITA 3NDYA 2EBNA 4BS0A 3WH9A 1B3WA 3KZSA 4LPCA 1JDAA 4ATLA 2UY5A 1E15A 1VFUA 3VINA 1UWQA 3L4TA 2OW6A 1J0JA 4M82A 5E09A 1HJQA 1ZBKA 5KEZA 4HOWA 1XCXA 3BUDA 1E6RA 5A2BA 4BQ5A 4PTMA 1XH1A 1EIBA 1NARA 1RH9A 3LXBA 1WDSA 3NSNA 4H04A 3GZAA 5AC4A 2XN0A 2NW0A 3GH5A 4LGXA 1HL8A 3ARVA 4E4PA 2BV9A 2DQXA 3AIVA 2ZUSA 6CGTA 5EBAA 4MDPA 4X0VA 2G41A 3WQ6A 4PMYA 4YPJA 1V02A 3MSDA 5HPCA 5BXSA 3WY1A 3GH7A 4IPNB 4ZEPA 4QFUA 5ABEA 1E6QM 3WUEA 3WMCA 2V3DA 1NOUA 1NWRA 5E9AA 4LYQA 1DWFM 2D23A 3AHYA 3EDEA 1HX0A 2ZICA 2AMGA 5EMYA 1UWUA 1E55A 3ZR5A 3POHA 5ABGA 1E3XA 2YL5A 3MO4A 5DFAA 2IUZA 4AWEA 1EDTA 1E4LA 2WWDA 1E4IA 2ZX6A 4NSBA 2EPKX 1B9ZA 4GI8A 3F5KA 1J0HA 4M24A 2BXYA 3ZJKA 1D3CA 1K9FA 4AZGA 5IHRA 1XD0A 5CSYA 3IJ7A 3CMGA 3FY1A 3VM5A 2EPOA 4HP5A 5D9OA 3SUVA 4U2YA 1HVXA 3CZEA 1B90A 1G1YA 3ZO9A 1BG9A 2EEXA 4W8LA 2Q8XA 2WW5A 4R5EA 1MYRA 2ZXBA 3WUBA 3G6LA 2XPKA 1C8XA 2QMJA 4CN4A 1E73M 5M5DA 2CBVA 4JFWA 4P7NA 2WMGA 4OBSA 3WQ5A 3QHNA 1JG9A 4GZJA 4UFHA 3BVTA 3L4ZA 1V3HA 1NQ6A 4YHGA 4ATDA 3ZOAA 3BAYA 3FHQA 3BUQA 4XX6A 1QX1A 3T08A 1HJUA 1R33A 1ISXA 1HJXA 1ISYA 4MB1A 4JL2A 1R34A 3A23A 3UETA 4EE9A 1UR4A 3VU2A 1N82A 1JDDA 1V3KA 1ECEA 3TA9A 3AXHA 2DH2A 1KXTA 2BY3A 2DEPA 5C71A 1UD8A 1EA9C 2WMHA 1NOFA 3WH8A 2YA2A 1GOWA 1SYTA 2E9MA 3GH4A 3KL0A 3UEQA 5AYBA 1HTYA 2YIHA 3PZ9A 4PTVA 3APGA 3CZLA 2YKKA 3VUPA 4F9JA 3BAIA 3AROA 4NZFA 4DUWA 3N04A 1WZMA 3VGDA 2WBKA 4KGLA 4UTFA 2BHZA 1JYVA 1CNVA 1OT1A 3N13A 3IJ8A 1ZJBA 3OLEA 4P7QA 3VD3A 4CD4A 1OSEA 3RILA 2WVUA 2G3NA 1TFVA 1I1WA 5BRPA 4F79A 4PTXA 2UWFA 3J7HA 3OGVA 4WSJA 2WVSA 3OZOA 4AIOA 1B1YA 3NIYA 4ACZB 4Y7EA 5E1QA 2OWXA 5JIWA 3L4XA 1HP5A 2D2OA 4JFTA 1W9VA 5BYWA 1GZJA 3WD0A 1KQZA 2GJXA 1RD6A 1E0VA 2WWCA 1BPLB 2DGAA 4JKKA 2YLAA 2OSXA 4XB3A 1CTNA 2WXDM 3AXXA 4NZCA 4UQBA 1PJ9A 3QOKA 2O9RA 3TOPA 2WKGA 3T0DA 1WKYA 1BYAA 4QLLA 5E0CA 3PTMA 3BXWA 4DUVA 3BUBA 3WDQA 4AZ6A 1CENA 1OGBA 2J7GA 1SMAA 4EANA 3HJEA 5BCAA 1XCWA 3VX0A 1B30A 2EPLX 4AD1A 4DWSD 5IFTA 4PMZA 2B31A 1MW2A 1B2YA 2WHJA 1QHPA 4J3VA 2XTKA 1XYZA 5I2UA 3A24A 3ALFA 3RIKA 4C7GA 1NWUA 1VFMA 1PS3A 1XRVA 1W9XA 1JAEA 1K9DA 1SZNA 1R85A 4LX4A 1W91A 2CEQA 1J0IA 3HG5A 4HPHA 4MNMA 2TAAA 2DIJA 5CZKA 4CN6A 1XC6A 2W5FA 2D0GA 5AY7A 3MUAA 3DYPA 2WC3A 2XM2A 1JFHA 2BVYA 1QBAA 4HZ8A 1Q6FA 2ZUWA 3HG3A 2WHLA 4PMVA 3BAKA 3WL1A 5CSUA 2EJ1A 1EQPA 2WPGA 3RJXA 1NWSA 4M1RA 3DECA 1UWRA 1QI2A 1KBKA 2A3BA 4PBGA 2WBGA 3VIKA 5D9PA 3BCDA 1CXIA 1EO7A 3EJUA 4WSKA 2QF8A 4J27A 1EDQA 4W84A 3DX4A 2DPEA 2D3LA 3AICA 3CBWA 3E1F1 3ARQA 1O7AA 1RP9A 2CYGA 4IPLA 3AIWA 3SEPA 5D9NA 5I3DA 4JIEA 5IHSA 3ARZA 5A6BD 2BXZA 2YBTA 5I78A 3AS0A 1VJZA 1V08A 3CZGA 2ZX5A 1HF6A 1J11A 2J7EA 4HOZA 5FIPA 4OIFA 1BYBA 2X2YA 1VB9A 1QNSA 2Z1KA 2DT1A 1E70M 4U5KA 4TVUA 2O9PA 4MNJA 3AIRA 4QLJA 1TQVA 3ZT5A 1C93A 2XM1A 3WEMA 4FF5A 4FLSA 1HXKA 3VTRA 4AYGA 3ARPA 3CMJA 1V03A 3H53A 4U31A 1V0NA 3AMKA 2YLLA 4MB4A 1UWTA 2W61A 2J7BA 3S2CA 2F1AA 4CVWA 3DYMA 4J3UA 3MV01 1KXVA 2OW7A 1QI5A 2WAGA 2ZWZA 4PSRA 1VJSA 2D22A 1G94A 1UWSA 1UR8A 2X2IA 3VD4A 1A3HA 4TXEA 3BVWA 1DWIM 2HISA 1UUQA 3SIMA 4TTGA 2FDMA 5A6MA 2YFNA 3GXDA 2ZUVA 3BVVA 1V0LA 1C90A 5BXTA 2FE0A 4KRUA 4N42A 4FNRA 2GK1A 2WLYA 3ZQ9A 2QHAA 5LA0A 4FNSA 5CLWA 3DDFA 4PMOA 2CBUA 1K6AA 2C8NA 1CGWA 3I3EA 4FLQA 1BGGA 3IAQA 2WK2A 1MQQA 1WZKA 2DIEA 1E6NA 3U5YA 3K46A 4CD6A 3OA5A 2PC8A 4F66A 4AW7A 1GCYA 3GXIA 3QOMA 1UD2A 1B3YA 1ISZA 3SCWA 1GQLA 1JYWA 3BC9A 4L4OA 3WNNA 4NXKA 4HA3A 4A3YA 3W81A 1GNXA 4UCFA 1MFUA 1W1TA 1W9UA 3UG5A 1AQMA 2X1IA 1Y7VA 3VIHA 2OWCA 1E56A 2VX7A 3AMDA 1B3ZA 2WZIA 3N11A 3CLWA 2XFYA 3PZVA 4UFIA 4QAWA 1NOWA 3HMCA 4KWUA 1MQPA 1EGZA 1TVPA 2WC4A 4ACZA 1UH3A 3S5ZA 4AD2A 3WSUA 3UR8A 1LWJA 1EQCA 3BLPX 4C7FA 5JBDA 1H0GA 5A6AA 3MI6A 1W3JA 1OCQA 4HOXA 3MANA 3II1A 2ALWA 3B9DA 2F7OA 1CBGA 4DM2A 3D5HA 1GUVA 2YDSA 1LLOA 1JFXA 3CUJA 2EPMX 5I79A 3EYPA 4M80A 4CD7A 2X09A 3CGTA 5A69A 1WB0A 3ARYA 4HU0A 4FK9A 1HNYA 5AYIA 4AIUA 3WDRA 1R46A 4XZBA 1GHSA 4A4AA 2XIIA 3SURA 2WMFA 3L4VA 2VR5A 4BZYA 1NWTA 4CKQA 3GXTA 4BQ3A 4WJXA 1TA3B 1V6YA 2C0HA 2D24A 1IT0A 2UY3A 2BY2A 5C8BB 5GPRA 3SCPA 1UD6A 3H54A 2GJRA 3K4AA 2ZOXA 2YA1A 1ESWA 5CGTA 4W8AA 2CHNA 2E9LA 3WH6A 4OUEA 3W37A 4E2OA 4D6CA 2XHYA 5HNNA 1TCMA 3WY4A 2Y2WA 5I0DA 1XYFA 4L4PA 1W2PA 3NSMA 2A3AA 6TAAA 3UERA 2CIPA 2WMJA 1FHLA 4JKMA 5CQ1A 1PAMA 3AZRA 2JEQA 3PTKA 4W88A 1E1EA 2WANA 4MNKA 2J78A 1B3VA 2PWDA 4W93A 1B3XA 3CUFA 3W53A 1ISVA 4GIAA 2F61A 1KQYA 3WF1A 5A95A 3K8MA 3ZR6A 1V3LA 2YL6A 3ZJ8A 4W7UA 1D7FA 7TAAA 2WCSA 4MTVA 2E0PA 3GBDA 1GPFA 2ZXDA 4W8BA 1V0KA 2JALA 1GQKA 3KE0A 3A21A 1L8NA 5E0FA 2AAAA 1UH2A 2BY0A 3DDGA 3AHZA 1VEMA 2VL4A 1WCGA 3VIJA 1KGXA 3WKZA 2GUYA 3A5VA 3RCNA 4W7WA 3WEOA 2VZOA 2GVYA 2VX5A 4BF7A 1W9PA 2GJPA 1PIFA 3AS1A 1LL6A 4CU6A 2YFOA 1XD1A 1XSKA 3KL5A 3KWXA 4GINA 5M03A 4NX0A 4J3SA 3A4AA 3BAJA 1DTUA 2VCCA 4KGJA 3K1DA 3CUHA 5ABFB 1F4AA 2UY2A 1DWJM 2X0HA 5LYRA 3M07A 1GHRA 3WN6A 1US2A 2VVNA 4J3WA 3OZPA 4NI3A 3ZM8A 1ODZA 1E3ZA 4HTYA 5JUVA 5A2CA 4AMCA 3NDZA 4HA4A 4WKAA 1LQ0A 5BXPA 3AIUA 4CD5A 2HVMA 2PWGA 5I77A 1UYQA 2WMIB 4UFMA 3BSGA 1HXJA 4DO5A 3U57A 1PBGA 2O92A 5IFPA 2XSAA 3EMCA 4JCLA 4D6HA 2F7QA 4QCEA 3ARUA 3WUGA 3WQVA 5CJ5A 4TX6A 3VOCA 3PTQA 1W9BM 1J9YA 2IGTA 4EAMA 2GDVA 1XGZA 1GORA 2YL9A 3AFBA 3MMUA 1EHNA 4ZENA 5A2AA 2ZIDA 3RM9A 4U2ZA 1C7SA 4JAWA 2E4TA 5DT5A 5GNXA 4H2CA 2DT0A 2OLHA 3TTYA 3VMNA 2VURA 6A3HA 4P7OA 3VGHA 1J18A 3CUGA 4D6IA 5E6ZA 3WMSA 1J01A 1J12A 1ZL1A 1FH9A 4DWSB 3MSGA 2MANA 3ZMRA 1H2JA 3ARTA 3IJ9A 2VR4A 3CTTA 1BFNA 5EFDA 3VKKA 1W2VA 2WMKA 1JAKA 1VAHA 1X1NA 2J7HA 4HMDA 1KBBA 3T2OA 2X2HA 1TZ7A 4AD5A 3AMLA 1UOKA 3T09A 1JZ5A 1WZAA 3LPPA 1WDRA 1JDCA 4AD4A 3BMVA 5M17A 4N0RA 5HDRA 1G5AA 1PZ3A 5CPTA 2CXGA 3FN9A 1E1FA 5DF0A 4J28A 1UD5A 1LL4A 1SFSA 4FNUA 1OM0A 4JFUA 4FLRA 4DWSC 1R86A 3PZNA 1MWOA 3SUSA 4AZHA 4GZIA 5C70A 2Y4SA 2WM0A 1KTBA 1TA3A 3UESA 2WVVA 1NM9A 2PWHA 4YN5A 1VENA 2OYLA 4PN2A 2J7DA 1J0KA 3S5YA 3VD7A 3HZ3A 4Z2KA 3WQWA 3WBEA 4WF7A 5FL1A 3HU7A 3BLKA 3M7SA 3VD5A 3WQ4A 1JXKA 3VX1A 2BNJA 4ATWA 1WAWA 3WUFA 1U30A 2XN2A 3WNOA 3M6DA 4W87A 2E8ZA 5E70A 1JI2A 2VRJA 3K8KA 3WQ8A 1CXKA 4U5IA 1IZJA 1JNEA 1QNPA 1GOOA 1V6XA 1NH6A 1US3A 3AHVA 1AQ0A 4R27A 1YHTA 4NXSA 4UQEA 3ZIZA 3BMWA 3N18A 4FLOA 3SUTA 2BY1A 2J47A 1D2KA 2EAEA 4UZUA 1TQTA 1V6UA 3IGUA 3WY2A 3A4XA 5A3HA 2BHYA 3CZNA 2ZUTA 3FAWA 2CBIA 1TG7A 3UG3A 3QHOA 3GXMA 3W25A 4MAVA 4MB3A 4BCEA 1WDPA 1SMDA 4A3HA 2BHUA 4PMXA 1UASA 2CETA 5M3WA 1R8LA 3VIMA 4P8WA 4P8VA 1JZ2A 3WIJA 2VMFA 4QP0A 1C91A 1OT2A 1PEZA 3DC0A 4J3TA 3RPMA 2WVTA 2WZEA 4NZJA 4UQAA 3SCNA 1EOKA 1GONA 4AZCB 4BQ4A 3VGBA 2WHMA 1UA3A 1JF6A 1E0XA 1TMQA 1Z32X 4B15A 2FHFA 3SUUA 3T0AA 9CGTA 1QNRA 1HJWA 3VIOA 1H0IA 1E5JA 1E4MM 2ESCA 2PBOA 1GOQA 1GVYA 3WF3A 3VGEA 4U3AA 2ZUUA 3GXNA 2JF6A 1XH2A 5GQBA 1W3LA 5DO8A 2RGLA 4PMUA 1IZKA 1H49A 4PCTA 3WD1A 2PF0A 3PZUA 1Q4NX 1DWGM 2OSYA 4V27A 4D1JA 3DX0A 2VZTA 2FGZA 1H5VA 5A6JA 2CCRA 3CHDA 4GZEA 2G3IA 2VCAA 3BLBA 4TVDA 2WNWA 3A4WA 5LA1A 3W82A 3BGAA 2V3EA 4F9DA 1WO2A 1E6ZA 2QPUA 1VBUA 3MUY1 3FNDA 1C8QA 1BVZA 1ZU8A 3WMBA 2CNCA 1J10A 4LYPA 3PZIA 3L2LA 1HVQA 2JF7A 3VNYA 2X05A 3PBGA 1ZBCA 3SCQA 1GOKA 2G3MA 3D52A 1QI0A 3CIVA 2XVKA 5HXMA 2D73A 2BFGA 3W24A 4CU7A 3RM4A 2QPSA 2D3NA 2FH8A 1JF5A 1UD3A 1E40A 3IK2A 4UOJA 3IANA 3RJYA 2XVNA 4ZXLA 1PX3A 2FGLA 4RE2A 3ZJ7A 2WCAA 3WNPA 1PPIA 3MU7A 2DDXA 5IDIA 3N17A 3THCA 3D3AA 8A3HA 2VNCA 1LJYA 4CCCA 1E9LA 2EQDA 3MUZ1 4S3JA 3AHXA 2VZUA 3AIEA 5BWFA 3WFLA 3W4RA 4W85A 3LMYA 4TVCA 1M03A 3DX1A 1H41A 3AOFA 4AD3A 2XVPA 4UFJA 1WDQA 2PWEA 1OD8A 5IXEA 1EO5A 3VGFA 2YDQA 1CXFA 3VDHA 3NYDA 1QW9A 1MW1A 2O9OA 4AZ7A 2VI0A 2Y8KA 4V2XA 1JIBA 1KWKA 1KR0A 2JIWA 5A8PA 4BQ2A 3ZJ6A 4QDMA 1OIMA 3W38A 4IM4A 4AISA 4DM1A 3F5JA 3N1AA 1VFOA 2VT0A 1ZS2A 3EMZA 1Q6EA 5HBFA 4CN1A 1CGYA 1Q6GA 1CGVA 2IXUA 5A1AA 2OSWA 2WZHA 3WDHA 4FMVA 2VO5A 2DH3A 4UOZA 4UQDA 3ARXA 2VCBA 4S3KA 4UR9A 3LPGA 2J79A 2J77A 3GNRA 2VC9A 4FNPA 1W1PA 1JZ8A 2VVSA 5D4YA 4AYSA 1C92A 2J8FA 1JZ3A 1OBAA 4WLCA 1QPKA 1JZ4A 1UKQA 2ZX9A 3ZSSA 3T2QA 2F2HA 4TUFA 1BG4A 2NT0A 3WF0A 4AZIA 4B3LA 3OB8A 2XG9A 1M53A 2FYVA 1JYXA 3D4YA 1V6WA 2VX4A 2YJQA 3WDJA 4AMXA 1QWUA 5HPOA 2XVLA 4D6DA 3OGSA 2QV4A 1UWIA 3OLIA 1BYDA 1M04A 3AS2A 5A6LA 3AIBA 2VJXA 3TTQA 3PZGA 2CBJA 1CECA 3BVXA 1MQRA 1XHGA 2ZXQA 1CIUA 4CU8A 3AJ7A 1FHDA 5CLTA 1E71M 3CC1A 1GVIA 7CGTA 1E6SM 2WSKA 3NJ3A 4KMQA 3QGVA 5HOSA 2WSPA 1HN1A 2JE8A 3VD9A 3POCA 1UHVA 3ECQA 3GNPA 4M81A 2XYLA 3HG2A 1B0IA 5FD0A 4GKLA 3ARRA 2ZWYA 1LG1A 3PZMA 2V38A 1IV8A 1GJWA 3GXPA 1G9HA 1OGGA 4CCDA 1R47A 1E6XM 3CO4A 4M29A 4BA0A 3D51A 1UR0A 3VIIA 4JL1A 3IAPA 1C8YA 1TE1A 4AMWA 3W6MA 3B9AA 3CZSA 4DO6A 1FA2A 1HJSA 4ZXOA 3CUIA 3CZKA 3G6MA 1WNOA 4GI6A 2JFEX 1DWHM 3S6TA 1UKSA 1WZLA 1F4HA 2GJXB 2CKSA 4AEEA 3VMOA 4EKJA 4Z2JA 4IUGA 1VEOA 1X6LA 4D6FA 5DT7A 8CGTA 4P8UA 4LQ1A 3LXAA 1FH7A 3AS3A 3SCUA 3MV11 2F1BA 4GI9A 3JUGA 1X6NA 3FHAA 3KLLA 3TTSA 2ZE0A 5JBFA 2Y5EA 3VDCA 2E40A 5FKYA 2F7PA 1Q6CA 1QWNA 1NP2A 2YA0A 1BGAA 1H4PA 1LG2A 1HWWA 2XWDA 3ARWA 1QBBA 4M56A 3N12A 2G4FA 1FH8A 5ABHA 3EJQA 2D0FA 2IXVA 2X2JA 4PMDA 3GTNA 3OLDA 1QHZA 3THDA 2DSZA 1U2YA 3CHEA 4AC1X 2GSJA 2RGMA 2CKRA 1JGIA 2WB5A 3QR3A 1JYNA 1QW8A 3A6OA 2G3JA 4CVUA 3AI0A 1CLVA 3MMDA 3GNOA 1PX8A 1HKIA 4F8XA 5I6SA 3SUWA 4GPNA 1WPCA 3EDDA 3OIHA 1JZ6A 4HMEA 1EXPA 5DEZA 5I23A 3GYCA 3FXYA 3EJTA 3EBVA 3EDKA 5A8OA 1W32A 5A8QA 3SCVA 1BF2A 1QI3A 5D8WA 1KXQA 3LRLA 1OINA 5TD4A 4MNLA 2FHCA 1GOMA 1OD0A 4TX8A 2J62A 5F7UA 2EO7A 4AIEA 3WNKA 3U5UA 3NSXA 4ACYA 4UFLA 3VIFA 3CZ8A 4HU8A 2FHBA 4D6GA 4AXNA 1UH4A 1GQJA 3CV5A 1ITCA 3VIGA 3K4DA 1EDGA 2J4GA 3DX3A 3AZTA 2XN1A 1CPUA 5FOOA 1TQUA 1CZ1A 1XH0A 3T0BA 3WFZA 3K8LA 3MS8A 3UR7A 4GQRA 1BTCA 2XUCA 1VIWA 1QNOA 3WD2A 4JZ5A 1CEOA 2XJ7A 4RE3A 2VUYA 3CPUA 1FFRA 3HN3A 1CGUA 4D72A 2OYKA 1MW0A 1FP9A 4PMRA 3OGRA 1R7AA 2Y8VA 2C7FA 2OYMA 3TTOA 1S46A 1K9TA 2DSKA 3VSTA 1V3MA 2V3FA 2VOTA 3AMGA 2A3EA 5FL0A 3I3DA 3WH7A 1J0ZA 3LRKA 3PZQA 4WIWA 3VGGA 3NUKA 4WKFA 4UZSA 3FW6A 1U33A 4HZ6A 3H55A 1YQ2A 4PEEA 1ZBVA 5JBEA 1XSJA 2GK1B 1UKOA 3GDBA 1H09A 3CHCA 5EFFA 2BS9A 1M01A 1KFWA 4MB5A 4ML4A 2W4XA 4KH2A
chains in the Genus database with same CATH superfamily
1KEML 3FCBA 4Y9AA 2ZG1A 5ISZE 3IDXH 5ACLA 4KXBA 1XLIA 5IW3A 4PH6A 3S1GA 1HCFX 4Q4EA 5ICXA 3ZFHA 2ZFAA 2BNRD 1E8WA 3QDGD 3S8FB 3W7OA 2WB1A 2XY1A 3WMLA 4OJAA 3VFLA 3OKMB 3C12A 3BDYH 1RJPA 1LOQA 1ZK9A 4AL8H 2WIIB 2V5YA 4URTB 3U4FA 1UM6L 5IM7B 5HVWA 1ILSA 2HKAA 1WCBB 4IEFB 4NN6B 4Z08A 2BVUA 3CFTA 2YZRA 3FFOA 4AUUA 3AWEA 3IFNL 5EEZA 3VDBA 4H6RA 4G1MB 4UT6A 3FCGA 2Y61A 2D0HA 3BESR 2X1WL 3E12A 1L6PA 3T3PF 5DMYA 1M5WA 2MQCA 1FYTB 2AOSA 2CW6A 3N50A 3V9CA 2A9CA 3QUZC 4JR9L 2Y7NA 4G9DB 2J9ZA 3I3BA 4B9YA 1P5VA 1CFBA 5FM4A 4PS8A 1DQQA 1RL1A 4ELKB 4C56A 4IBLT 3LCWA 4MJIA 4FADA 5FYLD 1OX6A 3JVGA 3BP5A 4IP5A 4HGWB 2CCVA 4JM4L 1UZ1A 3N0AA 1A5SA 4GJ1A 1QFWI 2CBOA 2ZJSH 5DJXB 4XUYA 4YX2L 3W11D 1UT2A 5E9DB 3IJIA 1XGPA 1XFBA 3FN0H 5EO9A 3WEBA 2ESVA 1BIIA 4BJHA 4EACA 3E9UA 5F96L 2C71A 4EN2A 1LDCA 2XWEA 3K0YA 3VM7A 3EA2A 3PXLA 2GPZA 3CHFA 4O14A 4ODSH 3QQDB 3OAUH 1ZEAH 2XHNA 3VFWA 3ZE2E 3LB6C 4FQJH 4WKHA 3UNDA 5F7WC 4I8YA 4WJ5A 3BEVB 4MVBC 4MJ4A 3KAAA 4PJXB 4IQEA 3JWDH 4LNYA 4IIHA 2HX7A 5C9WA 4JO2H 2E67A 3WLMA 2TRSA 4LCWA 1OT4A 2NSOA 5EZIH 4IQHA 4U3CA 4XMXA 2XZQL 5KUMA 4DJED 1IGFH 3MBXL 4OZHE 3TO2A 5D32A 4AVKA 1FI8C 1E27A 5JOFB 1CWYA 4AQ1B 3WF2A 1XR8A 3CHOA 4PV8A 2D31A 4P7RA 3SRDA 4RZCA 1QOQA 4QHLA 3CJPA 1EBAA 1Z69A 4EF9A 5HGHB 1JL8A 5F7YC 3I02B 3AQYA 1IEBB 25C8H 4GY4A 2WTPA 3IMVA 3VILA 1EHAA 1CB2A 4U7KA 2IMMA 1IM9D 2OX5A 2H2SC 5FGBA 4A8IA 4BY3A 3CSYB 1JPMA 2X40A 3MZ2A 3HI6L 5F8RC 2VW6A 2WN3A 4R5TA 2P53A 3ALGA 4XCNA 5HHNA 4HD9A 1H6FA 3EA3A 2TSAA 1HP4A 4R96B 2VERA 3VNIA 2JB5H 5EOCL 4EDWL 5KOVC 1DYZA 3VDAA 3PXJA 4ECNA 2XUWA 4DPCX 1OB0A 3G6JE 1WZ1H 4L8SA 1U22A 5I3KA 3MCNA 3KEHA 2IWGA 4UOQA 3NRQA 3ZBMA 2CMRL 2R59A 3S4SG 1O5DT 3O16A 2RIKA 3EO1B 4I18C 4K7PY 4GAJH 3F4VA 3HBGA 2V0AA 3HCVB 3MRRB 4Z7QE 5FHAH 1KM3A 3NEEA 5L4IA 3VWKC 4R8WH 3C0QA 3PWPA 1W9DM 4H41A 4OFCA 5ELIA 3J27A 4G6CA 2ZBTA 4DP1X 2OQJB 4C6PA 4F80A 3FZUD 5IRPA 1ZKAA 2P5EE 4QHUB 4J1UB 4WEMB 3T0ED 1ZBKA 1EIXA 2EYSB 1NICA 3ABXA 1XH1A 5FJRA 2GYSA 3RUGE 3GU2A 3JV6A 5CFAA 3GH5A 4HN8A 2HT2C 1WFTA 3CQ0A 1ZMYA 2DQXA 3CL8A 5JHLH 3II3A 4DYEA 3N2JA 4IJTA 2OV0A 3WQ6A 3QEQE 4UIMB 1UOWA 3GH7A 3TO4A 4QJ5B 3C2SA 4YSDA 4IYKA 1AGBA 1J5OH 5IMOA 4WKZA 4FS0A 4OM0L 3VXMA 4R3SB 5JHDE 2BNRB 2VN3A 1G6RL 3NQVA 2XYBA 3QDGB 5ADPL 2VDOL 1A7BA 4KPHH 3PBMA 4BSWB 2XG4B 3U2SA 4Z5RA 3NIGE 2Y1HA 2ZXBA 4PGLA 1Z1WA 2EVJA 1E73M 3P80A 5PTDA 2QKIC 1UMYA 3R6IA 5EHFA 4JEQA 4HNTA 3PJWA 2AQSA 2IDCA 1PYWB 3GW0A 4ATDA 1VPOL 5K7JA 2GKIA 3QXDB 2GJLA 1ISXA 1HJXA 1OPGH 2W65A 3MAWA 4D0BB 1IE4A 4B4FA 1G7MA 3UYIA 3SJ3A 1KXTA 1H0DB 3FJLA 5EIVA 5AYBA 3ESNA 5E2UL 4JBRA 3VGDA 5EZJB 4X6FB 3ONBA 3F7LA 2CHZA 2GSIB 4FA7B 3DGBA 5GS1B 4K5OA 3D3VE 3WTXA 4UNUA 1NELA 4OUUA 2OBGA 3O8XA 3BDBA 3DMMD 1HKLH 4IPIA 3HN5A 1ZRUA 2N0KA 3AM8C 3T1FB 1BPVA 2PZNA 1S7RB 3E3QC 5H37A 3AU2A 3T6ZA 5DRZA 5KYYB 5T1KD 1E0UA 2NPLX 5IJKC 4G7YH 3VFUA 3MLXH 4MASA 2V2CA 2NZLA 2P52A 3LEVL 5CINH 3JW7A 2VDIA 1TJ1A 5TF1H 4XD6A 3LNFA 2FWOB 2EPLX 2OULB 4PMZA 2BNQA 2GIYA 2IQ9H 2W0FB 4GMSH 3GHUA 1FLRL 1V5XA 1OG0A 3ALFA 4TL5A 2R2EB 4D0CA 4UB0L 2E46A 5CUSH 2K6ZA 1M6UA 3RQ3A 1R85A 4E9TA 1FWCC 1VCAA 4WGXA 4KEVA 5HHOE 1WXZA 4XAZA 3DYPA 4YNGA 4LUSB 2JBMA 2NR6D 3MKVA 1ACYL 3DECA 4NCC2 4G43B 2MH4A 4EVZA 4M7SA 3QULA 2XGZA 4ERAA 3NQKA 5KBLA 5DK0A 4KKBD 2MKWA 4L1WA 1F3WA 1BECA 5EBLA 1KPUB 4IPLA 4IS6A 3VWJC 4H20L 5A6BD 2X42A 3FFCD 4ABWA 4Y4FD 2GJ6D 1UB6A 4PUNA 1J5IA 2FSDA 4KHTH 2ZX5A 1OGAA 3BKCL 3D5OF 2X2YA 1GGCH 1QNSA 3ET9F 5L2KA 4E0RB 4I9WD 4WFGD 1KTRL 4FLSA 2VXTH 2NZ9C 5IK3B 2AEQL 2ZSVA 4XBGA 3B03A 2QHLA 5GGSY 1FCCA 3I85A 1FORL 2FGBA 3B0PA 2WLLB 4Y1AD 1PY9A 5EEVA 4I13B 2VMCA 5MP6L 5IT2H 3HPLA 4O9HL 3VD4A 3W73A 2YUXA 2X6VA 3FKRA 4HIHB 2YAMA 4KEMA 1IM9B 1TV2A 2FE0A 4XO6A 3S34H 5IQ7L 2WBXA 5DELA 1BJ1H 2FNBA 3SGUA 2P4AB 1K6AA 2GPTA 2YQGA 1JRHI 3P9WB 1E6NA 3QIUD 1UCBH 1T7XA 1VBGA 3W39B 1M41A 4UWMA 3HVNA 1HGWA 4CQDA 3QS2A 2ZCHL 3SCMD 3VXOB 3MA9H 4C83A 2PPCA 4HWZA 1LD9B 2IH8A 1MJJA 4DN1A 1E4KC 1NLBH 2EJAA 1G7LA 4WGVB 2R1MA 3IGSA 3TLQA 1FNEA 2WC4A 2FSEB 2DBLH 2NNCA 3FBQA 4RW5A 1WKEA 3IDYC 4KEZA 4NM4L 4YDZA 4UR7A 4ELME 3G1DA 2DQUH 4NKIL 4GNKB 2EPMX 1XTMA 3LKQB 1AZNA 3CGTA 3CX5K 1F3EA 2KT6A 2H9AA 1C9DA 1R2SA 1K72A 5D5MF 3T0EB 2Y1VA 4UB9A 1GZHA 4LSSH 5DJ2B 2UY3A 1KTLB 4XP1L 1A3ZA 1X7FA 3KM2A 1KLUB 5AHEA 4I9AA 1PL9A 4I2XB 3B5HA 1A1NB 5JO5B 4N0FB 4ZMPA 4Q8TA 2A9MH 1OVZA 4ZSUA 2FDBP 3KLAB 4LNRA 2F54D 3V4PB 4KWWA 1J8HE 1I7ZB 2HLFC 4FFZL 4DVRH 5AB2A 1ZA6A 2CO2A 2GFBB 4YU1A 3U1PA 2PWDA 3R8BB 3CUFA 3GR7A 3PHOA 3CHQA 3LIZA 3SQOH 3MNVA 1E5YA 4W1TA 2VFDA 4N5UA 1LT8A 5B39A 1B0GB 2DQGH 4AUJA 5EEXA 3WK0A 4ZMGA 4GFXA 3M0KA 1GQKA 1A53A 4BWLC 1DUYA 2CO6A 3DDGA 4G8EA 1BQHG 1FWJC 4XXCC 3ARDD 4JANA 2QQ6A 3RCNA 3FJTA 1U8PA 4EPDC 2DVXA 3PF2A 5MENE 3ABZA 2WUCL 5F0MB 2AABL 3PNWA 1V7AA 1YY9C 1ZALA 4FFVC 1FWTA 1E4JA 5EOQH 4LS2A 2VDKB 4RSYA 4TVPE 4YWGL 1X38A 1UZ6E 3D06A 4I8DA 1B6UA 4NP4L 3ABLB 1M7DA 4WKAA 3OQEA 2XIMA 2PWGA 3BSZL 1NCAH 4O4YH 2VELA 3GUGA 1TVHA 3DMMB 1EWDA 2H9GA 3UXDA 3WJJA 3DURA 5TTRA 4PJHB 2BP8B 3BAEL 1W9BM 2E6YA 4F15C 2IGTA 5FKAB 3WX7A 5IBTL 3GLAA 3G0XA 4G5ZH 5T1KB 3CDZA 3ZKXC 1AY1H 4ZYKB 4P61A 1OGPA 2O61B 1C7SA 2AF2A 3QNFA 3N6JA 4RDVA 3FMGH 1CD1B 4JNMA 3VGHA 3TH3T 3QY7A 5I0YA 4EI5C 2X9YA 3R1GL 2VEFA 2F8OA 4GUJA 4D8PA 4JFDD 3HV8A 2BSLA 2YC1B 4K8RC 1JZ5A 3OZ9L 1ZTXL 1RCYA 4NWUH 1FWXA 2IBGA 1UJTA 3LSBA 2WXKA 1UURA 3I9AA 4QRTA 5ABAA 4GRWB 2A79A 3WN5C 3ZQXA 2QUNA 1KTBA 1M4KA 3UESA 4O2FB 3G5WA 4L8DB 3PJTA 2FD6H 1BBDL 3C5ZA 4CEXC 1GOOA 3RCYA 2AI0L 3FFCB 1AQ0A 4BKTC 3N43F 2GJ6B 2YX0A 3ZIZA 1JGVH 4QD2E 4X80L 1I8IB 2BY1A 2EAEA 4UR8A 3BWUC 1T0MB 5EA0L 4GSQA 3W25A 1MUCA 1YUHA 4PGCA 5T3XE 2CETA 3F83A 5M3WA 3FT2B 4AT6B 3QDMD 1PZAA 3TJHC 5SWQB 1BQRA 5SWSE 1WS7A 5CD3A 3GMQA 1Z32X 4NN6C 4Y1AB 4W9EC 3K5XA 4XB7A 4HZLA 3ME0B 3IAGC 1XDMA 4Q4SA 1E5JA 1RCXB 4WY0A 4ZTOL 2H3DA 3CMOL 4WTXA 4G59C 4N8UA 2RGLA 2WZ5A 3ZPDA 5TF0A 5DHVH 1H49A 3O3AA 5FEWA 4PRDA 4KMTH 3JU2A 2FGZA 3MOBH 1H5VA 4KWOA 1QTWA 3OHMB 2VWSA 1XIFA 3A4WA 2DEXX 4J4KA 3MRIA 1EJ7L 1IGCH 1DVFA 5TGBA 1T4KA 4ORZC 5EWIL 3WLKX 4YBQC 1QD0A 3QIUB 4RQQB 1WBZB 4TULH 1MEHA 1MCRA 3D52A 3LNEA 5DRXA 5HDQH 5HWJA 5IG7A 3GSOB 4IG2B 3UVIA 1KW1A 1YUKB 4C54A 3SCMB 4UOJA 1PCSA 1N5YH 3ZJ7A 5D30A 1S8DA 2YBVA 4YHPB 1N7MH 3TYGH 2DI9A 1X7TA 2P1FA 2D69A 3WOVA 4W85A 3ZHDA 2H8ZA 1W0VA 4R5VA 5HATA 4KY1H 1WDQA 3V4VH 1T3FA 4GVFA 3ZDXF 1A6WL 2E7BA 4LU5L 3P4LA 1OIMA 4IM4A 3S8GB 1FWEC 1R3KB 4M7TA 4GKZB 3OKKB 5IMKA 5DZVA 3EMZA 3P3RA 1HIML 1Q6EA 5HBFA 3U4BL 3P4OB 5D4HA 2DQIL 3QJXA 3WDHA 1S7QB 3WLJA 1U8NA 2VCBA 4HS6B 3M0YA 4BFGA 3SRHA 2QCGA 4FNPA 3VACA 4BHUI 4C65A 1TYGA 2PR9A 5E99L 4ZBCA 2YSSB 4OFPA 2ADJB 4ZW6A 1SY6A 4AIZA 1CTOA 2J8UF 2F54B 1Y18A 2XVLA 3O6LL 4AQ1C 3M5XA 3W02A 4FOKA 3N1QC 3GR8A 4I4WA 3AIBA 5LXEA 1MQRA 1RFDH 3AJ7A 1E71M 3S97C 1L5GB 2MUCA 1FBIH 3RL1A 4QRRA 2CO7A 3B3IA 4X7CC 3ATYA 1D7CA 3O6FD 3BKYH 4V1DD 4EVNA 1UJ3A 2PUQT 1G7IB 3ARDB 1Q13A 3H56A 1EFXD 3OZMA 2E27H 1TE1A 1VCFA 3UJTL 4P46A 2Y06L 4ZUSB 2H2SD 2ZOKB 1U1JA 4NNPL 1OQXA 2I16A 3L3HB 1CB7B 1HYRC 2HN7A 3VXME 3OKOA 3OW1A 3N1MC 4Z2JA 5I1JL 4WTWA 3EOTH 1UUOA 4P49A 3CVHH 4DJMA 1EC9A 3FHAA 4UUJA 2Y70A 2AK1L 4KFNA 2VXSL 1HWWA 3MJ9L 3FQ2A 1YBQA 5C2XA 1DJXA 3M0IA 1B4RA 4N5EC 4N6RA 3VG0H 5DLML 3MRGB 3FJ4A 4LIQL 3ZHKA 3QIWD 1FBAA 4JTJA 3ZY7A 4GPNA 2WOBA 1TJHH 1LQ2A 3HQNA 3JWOC 3VWKD 5I75B 3MNWA 4DK5A 5A8QA 3W2JA 3NOYA 1F0LA 4LT7A 3QQ4A 4Z7OE 2NLIA 3D18A 4BH7A 4L4VA 2JJWA 4PRBB 3REWA 4LDOB 1HXYB 3G5ZB 1UTDA 4KPLA 3UD6A 4JFDB 2EXTA 1O1ZA 4D6GA 1D5ZA 3VXSA 3UZ5A 3FCSB 3N14A 4GX9A 4XO9A 1IKFH 3ZR4A 1DXEA 2ANUA 3MRFA 4HSHA 5D7HA 5KZEA 3HN3A 4C5ZA 4M8VA 3DH7A 2JIXD 2R0LL 5IVZB 1WWWX 3VSTA 3DFPA 1IC5H 4K9EL 4OZ4B 4WKFA 1VKFA 3R0UA 3RKDD 1UKOA 1YG9A 5LGHH 3GSRA 2TSBA 4MD5B 5EDSA 4GXFA 4P23A 1I0BA 1DUZA 3H7BA 4HXAH 4JZOA 4Q3MA 3P8IA 1O0VA 5JIPA 1IQWL 4HF5L 3QDMB 5A6KA 5EUOA 3V5KA 2XY2A 3IVTA 2DU2A 3WENA 4R33A 2BS71 2R2HA 1OF2A 5I17B 1XFPA 3VNLA 3L2MA 4TTUA 3HUJF 4ZO6A 1XIHA 5IROD 1LM1A 4FO4A 1P84K 2X4OA 3APNA 2V8MA 1QLRB 3QUMA 4AZ8A 2OO6A 4J6RL 2E6DA 4AZ5A 1N12A 4JM2F 2X4SB 1OGAE 4HWUA 1KIPA 1ME8A 1WCQA 3ZDYF 4PJDA 5DVMA 1KB5L 5JPMA 3DETD 4OLEA 1RULL 5K9KA 4XMUA 2A38A 2DZSA 5I76A 5BXFB 2BVQB 2AJSL 4Z2GA 4JY8A 4OIBA 5EU6E 5CC7A 3TS8A 3HI5H 3RWIB 1P2CB 3R06A 1ZHKA 2CKBA 1B4TA 4YCPA 3X1BA 1AYRA 1LF1A 32C2B 4MD4B 1AS6A 4K94C 2CERA 1DHKA 2R4RH 4JQXC 3EH4B 4WDTA 3H4HA 3CQQA 3EJRA 5A8NA 1SNRA 4JRXE 5DMGD 5MEQA 3EMQA 2QHRH 3V36A 2F74B 3URQA 5DQDH 5EA9A 1C5DA 4H4IA 4HA1A 4M8UA 2PW1B 4LUJA 5JXEC 1N55A 1K4DB 2VQUA 2EADA 1JPSL 4QKXB 4ZFOL 2RJMA 4ZUTB 5IHZB 2CPUA 4PUKA 2FEEI 4AK2A 3W70A 4W7VA 3APMA 1BP3B 2IGFH 4OBTA 4D9LL 4ZG1A 3TV8A 1GJUA 2H32B 5L4FA 5AOZA 4GOAA 2LE9A 1RPKA 4QOKE 4B90A 2HE8A 3B43A 4RE4A 4QE4A 1BLNA 4AAJA 3BQ6A 4UM8A 1ZVSA 2EIJB 3R43A 1QUPA 2ZTKA 4DELA 4X5XB 5A94A 1FZKA 4MY1A 3BH8B 4YNYA 1SJDA 2NZ9D 1AUSL 1NF7A 5C8JA 1G5GA 1DE5A 3OJVC 1YYCA 5I1IL 2HRGA 1QCWA 4TSAL 4MWAE 1XB3A 4WZ9A 1DQML 2WSRA 4CGTA 2B0MA 1KF9B 1UR1A 2IKJA 2ZUMA 3GHSA 3O6FB 4U3SB 2YXGA 4V1DB 3MHZA 3MZTA 4KV5E 1EFXB 4US6A 1A4KA 4X63A 4Z7WF 5E51A 2NX1A 2XPYA 1A8JH 3BFQG 3O6AA 3PJXA 3RMJA 2IH9A 4N3TA 4M8RA 3WFHA 3SSZA 3U7BA 2DY3A 1DQXA 4FKHA 1SJBA 3YPIA 3UTPE 5E6YA 2C18A 3QNXB 3FTXA 2VLKE 1GZQB 2GITB 2YQ3A 3FSWA 3HV9A 1MRDL 1SVZA 2VLLB 3L3JA 3D4CA 5BNKA 2VEGA 4LPUA 1BZOA 4N8CL 3QTPA 2HUHA 3BUIA 1ZLWK 3WEAA 3MUUA 4A7GA 3QIWB 2VGGA 2A4AA 4PG2C 2UY6A 4M5YH 3BIKB 4ZMNA 1LL7A 3BVUA 3GE7A 3VSUA 4A2DA 4RWHA 4AZCA 2G75A 3QUXC 5IGXL 3VWKB 3LBOA 3EFDL 1Q6DA 1UB3A 3L5WA 4OZHA 1KWGA 1TX2A 1YSOA 2UXGA 3C08H 1H7XA 3B06A 3QCTL 1E4XH 3LA4A 3I6LD 2OCCB 3QZOA 3ZKND 3EH1A 1MWAA 2AQPA 3QWOB 1G01A 3QM3A 3LEXA 4HKPA 4QXTA 3T0EC 4OECA 2IALB 3NL6A 3UJIH 1OIFA 5BXRA 1CXLA 1VBHA 2FGWH 2PR4H 1U6AH 3WEXA 2R1YB 5E93A 4M02A 5I2IB 2N1TE 3S37X 3KPOB 3VVVA 2WJEA 1DQLH 4OCRH 4LPCA 2FLRT 4XR8C 3NMEA 3VXPB 3LNIA 4X7SL 4WI9A 4ABVA 3V6ZA 2R1NA 2JIXB 3E2RA 4ICXA 2EZ0D 2DICA 3EYVB 4NRZA 3KW8A 1DVTA 1D9KD 1WDWA 3SJNA 2X28A 1H5YA 5EBAA 4MDPA 4LSQH 2P0IA 1ZP3A 4PPTA 2F58H 4PMYA 1N18A 3NPZB 2HPMA 2DWDB 4ZW7A 3G6JA 1ZNNA 2IH3B 4NZUH 2DZVA 3WFDL 4GYJA 3CAVA 1ZTMA 1DQVA 3MRMA 1LM8V 1E50A 1Q94A 3PQYB 2EPKX 5KYXB 1QNVA 3DV4B 5JU6A 5IHRA 4OV5B 4KKAC 1DE6A 2Y36L 5MF5A 2XH4A 2RTTA 4E9YA 2ZWSA 4Q8PA 1I53A 1HTIA 4GAFB 1NEZG 4JYDA 3G6LA 1UR3M 3WIHA 2XPGA 2ED9A 2AEPL 5BO1L 4HH9B 5IHHA 4BJLA 2P5EA 4EP8C 5LNUA 1NDGB 2ZADA 4XX6A 1BAWA 3W5NA 1ISYA 1GY2A 1FJ1A 3VU2A 3MX0B 4OV9A 3RUGA 2JKXA 3VFMB 4OD1L 3KL0A 4PTVA 4AXWB 1WF5A 5BZAA 2XXGA 3OKNB 3WJXA 3QEQA 1MFCH 2JFCA 1WZMA 4N2FA 1SBSH 4HIEA 4NC1E 1IF2A 3NZGA 1CNVA 1OT1A 2ACQA 1HXMA 2G3NA 4EI5D 4J6IA 2O4MA 3B7SA 2FJGB 1ONEA 2RDXA 4F57H 5AVTB 4BCXA 4AIOA 4WEVX 4KFOA 2YMXL 4RSVA 3F7VA 1I4NA 3FO0H 5GGVY 3X14A 2BOLA 3CPLA 1RD6A 3PL6D 4UU9B 2OTPA 4JKKA 2YLAA 2FYYA 1HL4A 1VF5C 3F2DA 4AGOA 2ODIA 3DGGB 5K9QG 4YDJB 4CC4C 3FOMB 3S6DA 2PP8A 1OCWL 3UH8A 2EKGA 1HEJC 4P2VA 4FB7A 1MW2A 1U8CA 5HYFA 1BWVA 1N0XH 3BPWA 2UZPA 3UBGA 1XRVA 2WYHA 4JZNA 3TROA 2AXGB 1E6OL 1ZGLP 1DO5A 1J0IA 4OD2A 4FYSA 1WAAF 4JG1H 5DQ9A 4OQTL 2B4CC 3MUAA 3QFJD 3ULUE 2R56L 3F4NA 5CSUA 5IESL 1IBHA 4WHYG 2Y3NA 3KNBB 1XSOA 4P4KC 2DPEA 3TJHD 3D3VA 1LDSA 2UZYB 5I1AA 3C0JA 1R3QA 3GMLA 1ICTA 5DD3H 4OD3L 1X5IA 1GT8A 2GG1A 4HJ1A 3T4AC 3VGAC 2EIMB 5GSRB 3CWHA 3SE8H 1PG7L 4IFKB 1Y5WA 1J05A 3GSNA 3VFRA 2HVOA 4FF5A 2BSSB 3H53A 4KRZA 4JO8A 2J7BA 5D7LD 4PCKA 3BLFA 2BRQA 4YQXH 4XO8A 4RFEB 7FABL 1CICA 4RCAA 4WEEA 1NCBL 4AKQA 2HISA 3LHUA 4BE5A 2ZUVA 5GGRB 4Q56A 5AYXA 4RDQG 3U1SL 4LB8A 3Q4DA 5L2JB 5HHOA 2PETA 1ML0A 1BX2B 3SCMC 5DRNA 4YIQB 5TPWH 4YK4B 5TK4A 4E5XB 5E5MB 4QRPE 3MT1A 4CD6A 2HLAB 3LQZA 4UTWA 2XQBH 4LCUA 1ZTVA 2EKSB 4O5LH 1GQLA 2Q8BH 5CEXA 3ISRA 3RNQA 1A9BA 3PWLA 3VIHA 3VW3L 2BERA 1IJNA 2B1AH 1A25A 1U8IB 3UZQA 3H7RA 1VFHA 4ADUA 3FO1A 4J8RA 2XFYA 1UOZA 3HE6A 4HLZG 3QDAA 3PWGA 2H8XA 1G9EA 3OAZK 3SDYL 5LGZA 2CCWA 3HF3A 1S9VB 2GWNA 1RIHH 3LNDA 1H0GA 4H9XA 2OKOA 5L0QB 3KS0J 3B9DA 2F7OA 3FOKA 2YDSA 4U6YA 2ZAGA 5DYOB 3CUJA 5DFTA 4LHUG 1MQKH 1GYMA 4MLRA 5CJBA 2PCYA 1H6TA 4Y8AA 4A4AA 1HFBA 2BGQA 2NV1A 4P2RA 1P7TA 1S2TA 2CR3A 4J4PD 2YAEA 2ITDA 2WWNA 1FL5B 2D03L 2GJRA 5K33A 3HS0B 1D9KB 2EVIA 2NUWA 4ZSOE 4WHYH 3HBQA 1R6VA 1AE6L 4L1BA 4MZRA 3VFTA 1IB5A 4TQEL 2M8XA 4MYWB 2DOCA 4DCQB 3FQWA 3CPGA 3CN3A 1SR9A 2D7NA 3HOJA 4ICNA 3C61A 2WANA 3WQDA 3F04A 2R91A 2PF6A 1KDJA 3ARDC 1KQYA 4MD0B 3TF4A 3QZWG 3E2SA 1N67A 1D7FA 4FG4A 3T44A 3D69A 3BJSA 1JGDA 2EUWA 4NP7A 1SLWA 3OVUB 4YYCA 4NIKB 3KE0A 2VDOB 1L8NA 4LAMA 2BRRL 2CC0A 2C3VB 4ELMA 4C6IA 2AGTA 2CHXA 3SKNA 1MHPL 1OQFA 2YLKA 4LNCA 2ZA3A 5K59F 4N5ED 5D09A 3RA7L 3O6KL 5C07D 2E6JA 3CUHA 4TQTA 3FGCB 3UBPC 1HKWA 1J8VA 1ANUA 2NXYD 4XWUA 4H40A 3OKEB 4I3SH 4AC4A 4J3WA 4XBMA 3V0SA 1ZD6A 4NI3A 5C9JA 4GI4A 2AHIA 1CJYA 3UL4A 5C08D 5I75C 4LFYA 4GACA 4MAUH 3AIUA 2WBJA 1J8HA 3QC0A 1E7VA 3V0GA 4ZX6A 3QWQB 5T5FA 3MUJA 3D25B 4PY8J 1K5NA 1MEXH 4HLZH 3F4CA 3CDGB 4I3RL 1K2DB 3PL6B 4NQUA 3S36X 4QBXA 4EAEA 4R0LB 2E4TA 5TQ0H 4P7OA 1J18A 1VC4A 2AZAA 1L9SA 2XJLA 1JCNA 5I8CA 3ARTA 3HGRA 3KBPA 5MENA 1VAHA 1NGWA 4PM1A 5FF6B 3LAFA 3AAZA 2W3ZA 1XIMA 2DYSB 3VTMA 1K8DB 5HDRA 4P3WA 5CMAB 3B97A 2WZAA 3QFJB 3UPCA 5IEHB 2YYUA 1EJTC 1L7IH 4X60A 1G67A 3U1QA 2OYLA 3APDA 3DIVA 1KBGH 5BU9A 3VXRD 3SY6A 2PTTA 4HNNA 3NQGA 1U30A 1CG9B 3M45A 2FJHA 3DX7B 3GJEA 4R27A 4KK9D 1U8JA 4IX0A 4Z7VA 4XBSA 4HKZA 2QCCA 3EWXA 3UTZA 3VFNB 4E8GA 4W9DC 3GFXA 5G5IA 4KQ3H 4UILH 1E3FA 4L1TA 2XXCB 4GH3A 1I9CB 1S3HA 3LI1A 1B0WA 3GS7A 5TDNA 4XX1E 3EWBX 1NAL1 1OP4A 5D7LB 1QSEE 3HC4H 3V0EA 2Q20A 4Q6IC 4HHGA 1E4MM 3DX9B 4G8AC 3EOSA 3H23A 4A66A 1GVYA 4HFWB 1YECH 2H8PB 5DO8A 3R0DA 3MNDA 1XPGA 4PCTA 3WD1A 3PZUA 3UPMA 5GGQH 2MTPA 1DJWA 1WFMA 1YAIA 3CHDA 1WBJA 3TYFB 4U4IA 3F03K 1FCBA 3W82A 4EWJA 1WO2A 1YW1A 2W9EH 1T21A 2AQRA 1VBUA 2FMOA 4BI7A 2DLGA 3PZIA 1X1OA 4E4FA 3L1GA 2VQ1B 3WZ0E 5FO8B 3WIFB 3SQLA 2OI9B 4QY8B 4R85A 1KGCD 1NBQA 4P4RA 1E40A 3IK2A 4DAIA 3P9LA 5A6IA 5JMRA 3V8CA 1RZIA 1PPIA 3BP4A 5JXED 4B9IA 3LXUX 3NQ7A 2OPJA 1S9WB 1WBXB 5ACMA 5C3TA 4IU3B 3SY8A 1QRNA 1TYRA 3AHXA 1RZ8A 1GC1L 4TUOB 3WFLA 2VE6A 3GMOB 5AKSA 3MY9A 3DX1A 2EYRB 1T7LA 3GI9H 5SWSA 3G04A 1UVQB 5LBVA 2QTVA 4LVEA 3VAEA 3W0WE 5IB2B 1UT9A 3M0MA 4NL1A 3LNPA 3KBMA 2IIJA 3MLWL 4IICA 1H15A 4RGNE 2IXUA 2Z0BA 1TZIA 3NSCA 5FAJA 3GLCA 1FIGH 2RALA 1D7DA 3IMSA 4XK2A 1OX5A 1Q1JL 4OFYA 1H5BA 1WEJH 4JX4A 3TBYB 1XUUA 5EU3B 4BIKA 1V8HA 4GAYA 4IIQA 4E3VA 1R0MA 4LC6A 4ZOBA 1CK0L 1IEXA 5C92A 3DOSA 4XCFH 1P7BA 2HKHL 4D94A 3O6FC 4Y5YB 1D7BA 3OQ3B 5I73B 5A6LA 4BI6A 1EANA 3F7PC 3VH8G 1A5BA 3T77A 5I66A 1R17A 1ZV2A 1QT1A 1FHDA 3BW4A 1CGSL 2WSPA 4ZUWA 4GQZA 1DR9A 1XF0A 4MJ6A 3WAJA 4YVXA 2FECI 4X9BA 3T65A 1JXFA 2DD8H 4NRXB 3EX4A 4OLVL 1IV8A 1S7WA 3L5MA 3OMNB 3CO4A 2B2XL 5C9KA 3BUVA 5AKRA 2YR1A 3TMQA 1UKSA 2Z93B 4FXGB 3QI9D 5C07B 1QW7A 1OABA 1A7PL 1X6LA 5FESA 2PKDA 3QIWC 4ZMXA 2NXYB 3MV11 4WW1A 1MREL 2UVFA 3VDCA 4A6YA 3QNZB 3NVDA 4JRFA 3QUXD 5C08B 1GEHA 3F2CA 1FH8A 4PZVA 5L88L 3FRUA 2JNZA 1T22A 2A7RA 2BVWA 1YYLL 3C2VA 1DVZA 4L0PB 1HYSD 1O9VA 1QW8A 3LSOB 3MRQA 1ZCCA 3HJ0A 12E8H 3GSUA 1RK0A 3WXVH 1WPCA 3G5XB 3WUZA 4U05A 4U7SA 2FYMA 3HN8A 5DQJB 5ACZB 4ZMYA 2K8MA 4HKXA 3TXZA 3OIXA 3ZE0B 1XDJA 3DVNB 1FRBA 3MZGB 2J62A 3TA3A 2R0WH 1WXJA 4O15A 4HJIA 1X7QB 4PGEB 4G7FA 4LLDA 2EDRA 2C7UA 5A2KH 3MC5A 5CEWA 3FQUB 3OF6A 2A77L 3WBWA 3BT0A 3FVMA 2XUCA 1VIWA 3RKDC 1LT7A 4DQWA 1YPZF 5CEZD 2DI8A 1UWXK 5LWYH 5ITBH 3AUWB 1OAXH 2Y1AA 4D72A 1FP9A 4JO5A 3GB6A 1J7VR 2ZAHA 3WJLC 1RZ7H 4L56A 3EZ4A 5D8JH 1F6KA 3VXRB 4PJ7F 4G70B 3IRPX 4JDZA 2VOTA 1PEWA 3I3DA 3STCA 5CN3A 3NZPA 4YBHA 4WIWA 2QUUA 4HA0A 3HAEA 3GDBA 1A7RL 3CBJB 3ABGA 5EFFA 3M6YA 2MOQA 4XD4A 4KKAD 1NDWA 3ES8A 2XISA 4XPHH 1Q2RA 4P3DA 2AKRA 1JPHA 5CILH 2REQA 5IROC 2WC7A 2V63A 1TETL 3D30A 2X3AA 1H6EA 4PL1A 3RLVA 3EFOB 4P9HL 4C6OA 4UTLA 1Z9LA 5F4SA 4KRNA 3MKKA 2GVEA 3DETC 1KTDA 1A3LH 5DUML 3GRWL 4ICCX 1KYFA 2QUVA 3CXOA 2ISDA 3IACA 2WQXA 4QMEA 4G9FE 4L4JA 1OM9A 3VNMA 1D2PA 4RMVA 1EEYA 4F8OA 2O5NA 3WK3A 4CD8A 3EUDA 5HJLA 2OOFA 1A5LC 3RO8A 3DERA 3AZSA 3QZEA 1KXHA 4N8VG 3TWBA 3AWGA 5CP7B 4M5SA 2NZ1A 2Z2AA 2WMPA 1AO7D 1T89C 2XGBA 5DMGC 5ID0A 4QRFA 2I56A 1OP5K 2ZPKH 4OCSH 4JCMA 4Z7UE 4PMNA 5HJBA 1INQB 3S1VA 3B9KA 2OMZB 3V0WL 1RSFA 5FJPA 2DDQL 2ZOOA 2I07A 5L9DH 3ARSA 2BGSA 3B7TA 4HGMA 1B31A 4PJAE 1KPRB 1S3RA 4EAYA 4JLRA 1KIQB 4MBRA 4BCYA 5DJ0A 4RDBA 5J89A 2WZ6A 2XFRA 4RESB 1W72H 1QEXA 1BXXA 4JO3H 5GRUH 1MCJA 4OAWB 4Z0XB 4F7CB 1IR2A 4TLKA 3WUWG 1EZVY 3H6AA 1TXKA 4JTEA 1ITXA 5KTEH 2IMRA 1YNTB 4KFPA 5D1QE 4P4KD 2B1HL 1ZE3C 2H1PH 2WMIA 5C0FB 3K6DA 4F33B 5I19L 5LNRA 2G95A 5EU6A 1IGSA 3DUSB 2ZZ6A 5JW5A 4L8BA 3AGVA 5A2LH 2JGQA 3MBDA 4N0CD 4D6EA 4P2RE 1WFOA 2QW5A 2ZOWA 4IHCA 3CUPA 2Q7YA 4KVNH 1F9CA 2GFTA 4YCOA 1E5BA 5I8EA 4JRXA 4NC2B 4QQUA 4XC3H 5ALBH 4JFPB 1J1PL 1K8YA 4K5MA 3W1NA 4ADJA 2Y24A 3B8SA 2V7NA 1R3IH 3QI9B 2FMNA 4YK4C 1FWIC 4EPEC 4QHRA 4Q22A 4NCDA 5AOIA 1HSBB 3OG2A 1FYHB 4QOKA 2Q2LA 1PKQE 3VMPA 1B9KA 3IIVA 4N2BA 3R0NA 4N2KA 2A6IB 4DZBB 3VVGA 4S0TD 1UZDA 1B2WH 3QUXB 4X9SA 4Z2LA 1LO2L 1A65A 4JB9L 2F5AL 1KDIA 3ZKNC 4HBCH 3OMIB 2AL2A 1P4CA 3S5OA 1ZSDB 2X0UA 3BWAB 4K7FB 4RJEA 3D2UD 4OF8A 4OSUL 3WDPP 1R87A 5IBUG 5E94B 4CQ9A 2E3VA 3AT8A 3U2IA 1NMBL 5JIKA 5EUKB 4ZUVB 5L0QC 4S2SB 1E9OB 5KSBE 1BMZA 2H7WA 3D33A 1Q72H 3ID7A 4MWAA 4YR6A 2XFFA 3BKJH 5TDOA 4P8XA 5C09D 1HEZB 4JO4L 2FQEA 3GSVA 6XIAA 2I5YL 1MFVA 3PGFH 1R0AH 2DV6A 3NZHL 3T3MB 3BG9A 3AYSA 1UEMA 4JFED 2QMKA 2EZ0C 3PZOA 4US5D 5EC1A 4EKXA 1OGSA 2J8TA 4X83A 1RUQL 3HS0C 1D9KC 4KXZH 3UO1H 2DYPA 4DH2A 4ZCWA 1VZWA 4IRJD 2VLKA 1E15A 3VKAA 3KPLA 5U7SA 3OSVA 1OFQA 1PB0A 1HJQA 1QDSA 3MLYL 5F7AA 4M00A 4HOWA 1A3RH 1E6RA 3WJZA 3HS8A 5A2BA 1Y1DA 4F0MA 4OJCA 4BF5A 4HKBA 3IDXL 1SXZA 5ESAB 3L3KA 3TT1H 4P5MA 4KI5E 3VUAA 3OJ2C 4U4BA 3LQAH 2O6EA 5J8LA 1E6QM 4RMUA 4ZDHA 3WKYA 4PJEE 4MS6A 5C7VA 2XN9E 5LHDA 4DF0A 4MJJA 5CZRA 5EMYA 3BDYL 3NPVA 4QF1B 5B4MC 1EDTA 3MDWA 1RZJH 4NENB 2WWDA 2ZKXA 4OLYH 3LNGA 5KYNA 3GDLA 2PP1A 1FGNH 3MO1A 5D9OA 2VC5A 4W81A 1GTHA 3B0VC 3RJQB 1PVNA 2VIRB 5E7BA 3MODL 1AOZA 5D03A 5BVPH 3E80A 4Z7VE 3O11B 1ACCA 3EPNA 3FT4A 4DVBA 3IJEB 4UFHA 2YRBA 4YHGA 2X2GA 4I9TA 3KCPB 5DUBA 3IU3A 2X16A 1HJUA 1FIEA 3F58H 1C1EH 5J12C 3AXHA 3TR2A 1KB5B 3UGEA 3IMUA 1AO7B 3H42L 1N8ZB 4UT6H 5FOBB 1RA5A 3F8UB 4IH3A 4ZL1A 1Q9WA 1O4UA 5H8DA 1HHKB 3PL6C 4KGLA 1S5MA 4CMMB 2BS8A 3EPOA 1YC7A 3N13A 4R0LC 1OSEA 1JVLA 2ZJSL 5I3JA 1VFBB 3W22A 1ZUAX 2YCJA 3H85A 4XNMB 2D2OA 3STFA 4J39A 3UY7A 3AXXA 4ODSL 4PY7B 4BFFA 3OAUL 1ZEAL 3TWCH 1BVNT 4FQJL 3PAYA 3VX0A 2F7FA 4F2TA 3SFWA 5IFTA 3BHBB 3C0SA 4S3DA 3JWDL 4M5PA 5JIMA 2PMQA 1NAKH 3NURA 1BQ5A 2CGRH 4ZFOB 5JMOC 1HZLA 4QUOA 1QRNE 4JO2L 4P4KB 5FCUL 3C09C 1FH5L 3T71A 5C2CA 2DTSA 1H7WA 4X7TA 1SZGA 4UTHA 3UEZA 1D5BB 3R79A 5J5RA 5EZIL 4RRPM 2WC3A 1X5KA 3KWWA 1IGFL 1QFWM 3EKLA 3T4AB 3VGAB 3ORJA 5BOPA 4FXFA 5LDUA 2HBVA 5MHBA 2IG2H 3STPA 5J04A 5F9JB 4PBGA 2HJPA 1FL6A 2V9DA 3QLDA 2HFFB 2EKCA 5FDWA 4NQXB 1VJZA 3UJRA 3RWJB 1J11A 2P26A 2PLJA 4WZHA 1BYBA 1WT5C 5FO7A 1E70M 4Y2OA 2ACSA 3UAJA 25C8L 4OZFA 5I6KA 1PBYA 5IMLA 4L80A 1T5WA 3DRQA 4NO3B 3JYCA 4M5TA 1FH2A 1M9WA 5JW4Q 4NQCE 3N44B 1R9YA 2LR4A 1ZHLA 4K4KA 4WVRA 3SIMA 1NANH 4EXBA 1AG0A 4PGDA 2ITFA 1HEHC 4FSAA 3KTCA 4KRUA 2JB5L 4POUB 2OI9C 2E9WA 2HBXA 1ZHAA 5IW1B 3QYMA 2CBUA 4B3ZA 5SV3A 3CVIH 4MUZA 1WZ1L 2A5UA 3GTXA 2IPGA 1KFAH 5C54A 3UZVB 2DIEA 3WMQA 4U7MA 3N1FC 5I1CL 4AW7A 3D2UB 2IQAA 2W0UA 4GAJL 3W81A 2Y23A 3GQFA 1LO5A 2MCAA 4AJVA 3V4UL 1AQMA 4WKXA 1B3ZA 4TSCH 3GGWB 4NNAA 2JGYA 5C09B 4LLYA 1TG8A 2A9BA 2MEJB 3R8HA 4LSRH 4OJEH 1DYSA 3UR8A 5H37G 4JFEB 4J4PC 3E8UH 5DEFA 2FO4A 1JQVA 1G0DA 3MI6A 1TTUA 4IMAA 3H9HB 3BL3A 5EZLA 3LI0A 5LDSA 3I7SA 1S7UA 3EYPA 4OCXH 3W07A 5A2IH 2PUZA 3IDNA 4IRJB 3OTTA 4PUJA 3S5LB 2OMBA 1ONQA 4FK9A 5HGGS 3X3GL 4Q4KA 5JHLL 2VWEC 2OJ1A 2XWZA 5BPPA 4KQNA 4HIQA 3UZJA 4AW4A 1TREA 1MZZA 3WTUA 4Y5YC 2Q5BA 4MNHB 5I73C 1VPYA 4PMJA 3SFKA 5HHMD 3S96A 3AU1B 1SEBA 3CUXA 1YNLH 3DARA 4NQDD 4KRPD 3UVAA 4QRPA 3VRLE 1KTKE 3IYLW 5I0DA 1KC7A 3NSYA 3RWCB 1NUNB 4E9SA 4KPHL 1CTMA 1FHLA 5CQ1A 3AZRA 1SO3A 3I6KA 1YPFA 3MCYA 2F0CA 2BOCA 3LKSB 3KPTA 3SDAC 4PVLA 2IBBA 5B3SB 5LIYX 3C2AH 4Y4KC 1V3LA 2B7PA 4LLWA 3GC4A 2WZPA 5B7ZA 5EU9A 1TJGH 4FXGC 3E6FB 4PRNA 3SN0A 2AAAA 3GTIA 1NTDA 4AENA 3MGOB 2NXYC 4I48B 2R14A 2P3ZA 1BVKB 1IQDA 2GUYA 2VZOA 4RDQF 4HSOA 4ONOA 3T6WA 1HL2A 2B77A 5M03A 4AGPA 2AJXH 2PCXA 2Q09A 1DJYA 4JG5A 2OMXA 4GG9A 5LIUX 1H50A 1WYJA 4H1LB 3BW3A 3ZTJG 1CT8A 2NQCA 1CLKA 4RNFA 3MP5A 1NJ9B 4C4UA 4C6FA 5IB3A 5KANI 4ZSOA 1U3YA 2KAUC 4EXAA 1HKLL 1BF6A 2P24A 4MQ7A 2ENJA 4PLOB 5JYMA 3H2CA 4BUQA 5C0QA 3M0LA 4G7VL 4QO1A 3RO6A 1WIPA 4G7YL 3KPSD 1JHLH 3MLXL 2DM7A 3GHRA 3GWQA 4PW9A 5CINL 5BUPA 3TIEB 3AREA 3MMUA 1PTDA 2IQ9L 4GVIA 1GW0A 5FEZA 2AXFB 4LFHD 4E41D 3BPCA 5E6UB 5CUSL 2VURA 2WTRA 2HWZL 8XIMA 1NCOA 1AODA 5B1JC 2ZZUT 4OT1L 4GY0A 3MTWA 3MUXA 2E47A 1V8EA 2WMKA 1RURH 2X2HA 3EYUL 4UDTA 3FL7A 5C0DB 1W3TA 1WDRA 1K6QL 5JORA 3K4WA 3UJEA 3S88H 4BRJA 3PQYD 5DJ8B 3GS6A 4KK9C 4JFUA 2QDGA 2ZOLA 4DWSC 4IPPA 2PXYA 5FX3A 5DI8B 4N24A 5IV2B 1JWSB 1QFUH 5D2VA 2HJFB 5FYKU 2XZZA 1J6OA 4MMXB 5DD6A 3ILPB 3JZYA 3TN0A 3LMJH 3TN3A 3DX8B 1TTAA 2P8PA 3NPSB 5E70A 1I4FA 4PJ5A 5LKNA 3WQPA 2VXTL 4IOIA 2NY6D 3T8XA 4Q6IB 1I31A 3BMWA 1MLCB 3FB6A 5EPMA 3NNTA 5TDPA 2ARJB 2UXFA 1SHMA 3B5TA 3E0WA 5IT2L 4ZQTA 3WIJA 2PNDA 4BZ1A 3EYFA 1XGUA 3QA3B 2V6AA 1D6EB 2EG6A 5B39G 3EFFA 3Q2LA 4N0YH 3L3GA 4GT0A 3S34L 5F9DC 4XMKH 4YGVA 2CA3A 1MAMH 4MZ3A 2XVBA 3D0CA 1YYMH 5IFJA 2QIIA 3ZTJH 1UCBL 4UINH 2G3IA 4NZ1A 4Z8FL 2VR7A 2OEKA 3DHFA 5K1JA 4JAMB 2B7NA 3MA9L 4MY9A 3OZKA 5D7SH 4Q52A 3W1RA 5M7QA 1GOKA 3IFLH 4N2DA 2ZT9C 4ES8A 3CC5B 1NKOA 4JHBA 3GNMH 3VOHA 43C9A 2B59A 1A2YB 3LLFA 5BQ7A 4GY1A 3UF9A 1O9WA 3DX6A 4WUIA 1TPFA 1HZKA 2DQUL 1NIEA 4W9GC 3WL9A 4HK3J 4UDUA 1EX5A 3H2OA 4OTXL 3MUZ1 5BWFA 1NF0A 1JHTB 3QKEA 1QLFB 2Q87A 1I8KB 1Q6RA 1QSEA 7XIMA 1CCWB 1KLFB 4LSSL 2VFEA 1G9NH 5GIRA 2CLIA 4X6DF 1ZLSH 3X2QB 3ZL1A 3FJ6A 2JB6A 1N0LB 3SD5A 4L6DA 4FG0A 4Q4RA 4BSVB 4QXIA 3DKLA 5HMSA 1EB3A 2PU1A 1Z2KA 4AH2B 2OSWA 1JR1A 1PGRB 1XQLA 2A9ML 2R29H 4QXUH 1OTUC 4OZHF 2VLJA 4LW7A 2AS5M 5HHMB 4DVRL 4NQDB 4KRPB 3Q6FA 3L3OA 3BYTA 1WTLA 1BTMA 1IGYA 2XG9A 4O10A 3IMWA 3SQOL 4LSBA 4UQ2B 3VYPA 3LDBB 2CLEA 4PJBF 2QV4A 4N25A 3FQRA 5JW4N 4K9JA 2DQGL 4YXGA 2BCKA 5HVFB 2Z1XA 2CBJA 5D1ZA 2Z6IA 1FQ0A 1U36A 4PB0H 1HZYA 2EEBA 2VKWA 3M1OA 3V7PA 1UYWH 3QI9C 1H7RA 2MJWA 1R5IB 1G7JA 3LIZH 4G80A 4UIOA 1BREA 3QG7H 5DJYB 5J06A 2I25N 3W0WA 5E8NA 4G1NA 3OXRB 3Q3GA 5EOQL 4INFA 2J1YA 2VM4A 4AMWA 3QAZB 3W6MA 9XIAA 1DQDH 1YRKA 3X11A 4HCHA 5FJIA 5K4XA 4IUGA 1HYSC 3W87A 3RLHA 2GL5A 1XL9A 3LXAA 3OZYA 1U92B 3A67H 1NCAL 4O4YL 2AXJA 2OP4H 3UXFA 3OKYA 1Q6CA 3RFZC 4XOBA 3FUIA 3LHPL 1TJXA 4LV9A 5KJ7E 1FZOA 2Y07L 4Z7QF 1JCMP 4G5ZL 1YAZA 2V69A 4DZ5A 3KPSB 5B38A 1NBVH 5DX7A 5B1BB 4CVUA 4OKVB 5M94B 1KO0A 4O51B 2NSQA 5HTSA 4H7CA 3NCYS 3OIHA 1G7PA 4E41B 2VLRD 4HNUA 2UBPC 4ONFH 2BSRB 3ZDZE 4WJKB 1QBLH 4GSXA 4TX8A 3VJ6B 1RPQA 1AXSB 2J21A 2X7WA 4NWUL 3SE6A 3O8AA 3SN6N 3SDOA 5HDLA 1SW3A 1PNDA 4J9JA 3W71A 4MG4A 4IKIA 1S7XA 4PRHD 1SOQA 4LL4A 1K7EA 2WLHA 1NEPA 3QJQB 4JZ5A 3WQGA 3ZLHA 2FD6L 1EUAA 2RQ8A 1JVKA 2VUYA 2XA8H 5G2IA 1CGUA 4NUPA 1TZHA 1TKWB 1N64H 2FZ3A 4K9EC 1L9OA 3DA0A 1JGVL 3MV8E 4APQD 4DAGH 3FVDA 4XVUC 1ZLUH 1AZRA 5B4MD 4I3GA 2MNRA 3NIGF 4PFHA 4XXWC 4WK0B 2NY6B 4KQ4H 2FTWA 2XICA 5DVKA 2I57A 4FABH 4KAQH 1GZPB 3IDGA 3G7TA 3KYMA 5CG0A 4LYRA 1M7OA 3U2JA 1P4LB 2J75A 4DUOA 2R1WB 1MLBB 1R5VB 4UYQA 3MBWA 3C8NA 1JUBA 2IO5A 1FWSA 3H4FA 3RM8A 4FXKA 4KMTL 3KRUA 1EOMA 4PTDA 3MOBL 2RBLA 4S3AA 1JPKA 3C52A 5DT1H 3U7AA 1ZSXA 4AY1A 1IGCL 3IJ6A 4DGYH 1CLXA 1OWQA 4X22A 1EXUB 3SE4C 1E9PB 3I65A 1M42A 1RZGA 1T2QH 3M16A 1GGUA 1VZIA 2DLFH 2XVGA 4TULL 1HH6A 5DHDA 2X4NB 1LJMA 4A05A 5HDQL 3PUEA 3OQ8A 1UBSA 1JD7A 1EWHA 3OBEA 1C16B 4HJ0D 3TJIA 4JGDA 5FF4A 1FG2A 2IWFA 5TAOA 5HGDB 1MUMA 1XG4A 4YL2A 3ETBJ 4ZE4A 1FE8H 4TNWF 3F1QA 2P8MA 4YHEA 1N7ML 1XLAA 3P3BA 3TYGL 3SIKA 4HETA 3S2AA 3SDXF 1HWHB 1H9DA 1SR0A 5J6GA 4GT7A 1Y5VA 3V4VL 4Z7NB 2GY5A 4OOZA 2ZX8A 1XF3A 3GU9A 4ZA0A 1OZQA 4LCYA 4ERIA 3A13A 5ILTH 1MY7A 1FZMB 1VFFA 3R0MA 3PNZA 4QRNA 2OGJA 4H6EA 3A9BA 3BANA 4L3CB 2G2RA 2OL3H 3QBUA 4E9XA 3PGCA 3O2LA 1WDAA 2ZYIA 5ABFA 1DN0B 2YS4A 3N15A 4TUKH 5CGMA 4DWDA 1BOGB 1A6ZA 1KCUH 1EUUA 3PN8A 3EYSL 1XH3A 4GIEA 1E4WL 4XKYA 3B04A 3QJHA 1R3HB 1W3IA 4G9FA 5F4WA 4Y16D 2Y7SA 4NKOA 3N4AA 3OO2A 3OHIA 4NAFA 1F4WH 4N0CC 2Z1WA 3TA6A 1S2WA 3MRNB 1NEYA 2NY5H 2DSVA 2E7LA 5CSBA 5J6HA 4QRQA 5D7IE 4QT5B 2WXRA 1RFDL 3KZPA 2ZXWB 1T0NA 4GIOA 1SY6H 3P60A 2NXIA 1FBIL 3C86A 2PPFA 1G4TA 1G4RA 3ZVIA 1VEPA 4WQ6A 1QFOA 4Z7UA 3BKYL 1ADSA 2OZ4A 1GKEA 1D5XB 1OK8A 2OX4A 4XMPH 1PIGA 4LF2A 2E27L 2R8SL 3HC0B 4DP8X 3ZE1F 2A6KA 4PJAA 2AQQA 5C7XH 3WBXA 1GVQA 2P5WD 2RHEA 3CVHL 1A5CA 1I85C 5AVSB 4OCYL 1BYOA 1P7QA 4HIIA 4WW2F 2KC0A 5IVXF 1K4CA 1IFRA 4ZFZB 4UNKA 4UQ9A 5MERA 3SCOA 4DOHE 4PL2A 1U8KB 4IBZA 2Q76B 2A9DA 4HHMA 3GI8H 5D1QA 2NQ5A 3DXAE 1HE8A 1GS8A 3LRSB 2BLFA 1Q0EA 4U0RC 1EZLA 2BX5A 1EH9A 3FQTA 3S48A 4F8QA 5CSSA 3STZA 2OMYA 1C3FA 3V9EA 1E90A 4H00A 1E2VA 5DD0H 2FH6A 1TJHL 3LPWA 3VO0A 2G8ZA 2CBMA 4AFYA 3BISA 1SDDB 3TDFA 4QDPA 1JI1A 3A22A 1OAUH 3A9IA 1TEFA 5D8ZA 2O6CA 5IMMB 4HZAA 2VLRB 3B1UA 4E8DA 4ANWA 1KN4H 1F4XH 2X9XA 1BA9A 2WZTA 1DANT 1I1AA 5CPSA 4IRJC 1IKFL 1BYCA 3CK0H 3V2AR 3RVVD 3EX2A 5EB8A 4JO1L 4PRHB 5F9OL 1ACXA 3QHFH 4N1CA 1FFOB 2EVHA 1OCJA 5JH2A 4UZGA 4LL1A 4GG8B 2NQLA 1IC5L 2J72A 5E1GA 1PKQA 3VNDA 3MR9A 1G6RB 4DIXA 1J0JA 4FI4A 5LGHL 4XPFL 1S1PA 4APQB 4ANUA 5I02A 3SDAD 4NQVB 5JUEH 4B2DA 5AC4A 2XZCH 3MRKA 1W17A 4LGXA 2O4QA 3VOIA 1NFAA 4CNIB 2YUWA 4QGYA 4Y4KD 1PKNA 4BI5A 1FCUA 5IJVA 2V7HA 3MLZH 4LASL 4TMBA 3DGRA 4U3XA 2CG9X 5KSBA 1SUXA 2ALDA 3RPIA 1T7ZA 3RXZA 1KIRA 2YL5A 1XX9C 1P5UB 4ZPTB 1YYAA 4GYFA 3VXNA 4JTAA 4X8CA 3RBSA 3N40P 1RU9H 1HVXA 4UQ3B 1B90A 3ZO9A 1BG9A 1UZ6F 3VCNA 4H0GA 4ZOCA 3P4MA 5J12B 4IBTA 4PJ5E 5E8OB 1H7PA 2RCSH 1XCTB 4AC7C 3TBWA 3ABQA 4MLSA 4GUQA 3DBSA 2FJFB 2Z7KA 3QHNA 2WOYA 4IOSD 2GAZB 4JRYE 3LHTA 2CKNA 3QUMH 3BAYA 1UZ8A 2XTJC 3PG8A 2LW3A 4MB1A 1L9NA 1YA5A 4EE9A 2XXFA 4DNMA 1EA9C 2DPKA 3CAQA 2BINA 1WC7A 1JULA 3CZLA 3FF7A 4QR7A 2OTWB 2BIPA 1TPWA 2EEFA 4NZFA 3VFOA 2RDWA 1LWIA 5CEYB 4PJEA 5JQHC 2XN9A 4RAVB 2OQYA 2R0ZL 5I18L 2QHRL 5D72H 5B80A 5DQDL 3L7EA 1GOXA 1CE1L 4ODXA 4HVBA 5GISH 4Q97A 4E38A 2X7LA 4CDHA 3WD0A 5I6PA 5D2WA 3C09B 1CTNA 2IGFL 4UQBA 4ZRGA 5HYQB 3CV1A 2DVTA 1BYAA 2YW4A 3AB0B 4IRSD 1N26A 1QXLA 2FCBA 1XRSA 5IW6B 4DWSD 3DFTA 3IIPA 1KZQA 3TAOA 4WNQA 3PDOA 3AXKA 4Y16B 2WHJA 4FA3A 2G5BA 3Q2NA 1EDHA 4X7EC 2C9AA 3NJLA 3LK6A 4MMXC 1Z44A 5HPMB 4AYID 4YFEA 5E08L 3GHTA 1DDHA 1JPTH 3NPSC 1QTYT 5AY7A 2J24A 5JDJA 2YPLD