5A6LA

High resolution structure of the thermostable glucuronoxylan endo-beta-1, 4-xylanase, ctxyn30a, from clostridium thermocellum with two xylobiose units bound
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
389
structure length
389
Chain Sequence
MASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTAVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
molecule keywords CARBOHYDRATE BINDING FAMILY 6
total genus 137
structure length 389
sequence length 389
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5a6lA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5a6lA02
3GH4A 5FL0A 3CUGA 2FH6A 1Q6DA 3ALFA 2ZUTA 3AIBA 1CTNA 4FK9A 5I24A 5D8ZA 1OD8A 4UCFA 3CH9A 4AD0A 1CENA 2WSKA 3PTMA 2XM2A 1DHKA 1US2A 3WDRA 3UR7A 4DM2A 2J7BA 4AIEA 4S3KA 3SCVA 1JD7A 2VRJA 1C3FA 1HJQA 4GO8A 3WN6A 4CCDA 3VGDA 3VD3A 1V02E 2YFNA 3IJ9A 3VMOA 1WB0A 2VI0A 2WWCA 1GVIA 2NW0A 1PJ9A 1QOXA 3SCOA 1UH4A 3VINA 1YHTA 4AD2A 3VNYA 1G1YA 1U2YA 2YFOA 4JKLA 5IXEA 3UERA 3PZVA 3ZQ9A 4XX6A 3QHNA 1M03A 4IPLA 5HNNA 2VZOA 5C8BB 1J01A 2BXYA 3VILA 1NWUA 5KEZA 3ZM8A 1UG6A 3VX1A 3RO8A 2FE0A 1FH9A 3WUGA 1CGYA 3D50A 3HMCA 4BF7A 5A8NA 5ABHA 2D0HA 3BUDA 2CERA 1E6XM 1I75A 1GNXA 1KQZA 7A3HA 4NZFA 2WMFA 2VNCA 2ZUVA 1W1VA 4W8AA 2WW5A 4UZUA 3PTKA 1QI2A 1V6VA 5D4YA 1XSKA 1O7DC 3G6MA 1E6RA 2G3IA 4WIWA 5E0CA 3VD4A 1JAKA 3THCA 4IM4A 3II1A 5TD4A 2W63A 4AWEA 1WZMA 3U7BA 2BY1A 4CUCA 4V28A 3K46A 3BC9A 5IHRA 1V03A 2XGBA 2X0HA 3ZMRA 1V0NA 1HT6A 1DTUA 3TV8A 4JCMA 1TFVA 4F9DA 3AJ7A 3WDHA 4RE3A 1HWWA 2XSBA 3W6LA 1W2VA 5GNYA 3VM5A 5A6BD 3AHZA 4E4PA 2DSKA 4Z2LA 4PTWA 1TG7A 2O9OA 3W82A 1J0YA 4FNRA 2DGAA 1DP0A 3ARRA 1E56A 1JZ2A 1HL9A 4CN6A 3EJQA 1W1PA 3NSXA 5CXPA 4FLRA 1B3WA 4PYSA 4UFLA 4BZYA 2VOTA 2J7FA 1UWSA 4QCFA 1E6QM 1J12A 3SUUA 1CGXA 4NZJA 1ZJBA 3GXPA 1BG4A 1Y7VA 4DO4A 1ITCA 4PTMA 3VIHA 1UR8A 3BUBA 2ZUMA 3MUY1 2YJQA 1KGWA 1LG1A 4BQ4A 2WNWA 2XJ7A 4PEEA 3EJUA 1CXFA 5CGMA 1QBBA 4P8UA 4TOQA 4J3XA 4F9JA 1PPIA 3AHTA 1OGBA 4KGJA 3FY1A 1CGWA 2J25A 1PIGA 1EOMA 2WLYA 3AMKA 3N11A 5A8PA 1SMAA 3FAWA 3VNZA 4H2CA 4Z2JA 2CXGA 2WWDA 1O6IA 3ARVA 2W4XA 2F61A 1E40A 3BVWA 3BXWA 3SUTA 4MB1A 1CECA 1X1NA 4BQ5A 5HPCA 4JFVA 4AZGA 1PZ3A 2VCBA 2A3EA 2YLAA 2EACA 2JFEX 4UQBA 3AZRA 2EAEA 1E0VA 1NWSA 1ISVA 2EBNA 4X0NA 2W62A 3OGRA 3GH5A 3T0BA 1E15A 1UD6A 3RPMA 4W87A 3BAKA 1TQVA 3W27A 3AISA 4CD4A 3WDJA 3LX9A 3D52A 4J3VA 2E4TA 5C70A 3NSNA 4UFHA 4XB3A 3IANA 1AQMA 4B9YA 2PWFA 3TTYA 1ISYA 3MUZ1 1V6XA 1GJUA 1I1WA 1ZBKA 1CWYA 1W32A 4AYGA 3AROA 3RDKA 1V6WA 1HXJA 3WL0A 4M81A 2PWGA 3VDBA 1OT2A 1W91A 4A4AA 2OWXA 4U3CA 3D3AA 1ODUA 3A24A 5AYBA 2EPNA 2UY2A 2VUYA 5I77A 2XTKA 2FDMA 4LYPA 1JF6A 3WF1A 3SIMA 3L4YA 2DT2A 3TTQA 2ZUSA 4FMVA 1H3GA 2C8NA 1ZBVA 2VX7A 1XSJA 2WPGA 2FGLA 1VEMA 4LGXA 2DQXA 1C8XA 4KRUA 1Q6GA 3D4YA 4WSJA 3BVUA 3HG3A 2WC4A 4P8VA 2ZXAA 2WHKA 1QNRA 3NJ3A 3WQVA 1E4IA 3B9DA 3VD7A 1ISXA 1FFRA 4NI3A 3QOKA 1UR4A 1EH9A 1BVNP 2V5DA 4GXPA 2VVNA 1GW1A 1R7AA 3EMQA 3K8KA 3DHUA 5LYRA 2YDQA 3BAYA 3HZ3A 1UR0A 1JF5A 2EADA 2UY5A 3EJSA 1QI3A 2QF8A 3W29A 2VO5A 1CZ1A 2ZX5A 1JDAA 1E0XA 4P8WA 5I5RA 1WAWA 3A22A 5LA1A 3DX0A 1C7SA 2EEXA 1H11A 2D24A 2DPEA 3CHFA 1V0KA 3SUVA 3D4ZA 3EJRA 1UA3A 5DO8A 5HPOA 3SCWA 1H0GA 1EA9C 1JZ6A 4OGZA 1MFVA 3APGA 1UD4A 1T0OA 1WDRA 4GI6A 3BLBA 3S6TA 1DWFM 2WMIB 4FLQA 2XVLA 4ACZB 3WH7A 2EABA 1C8QA 1EHAA 2XIBA 3WD2A 1CLXA 3ARQA 2WHLA 5FIPA 1UKQA 2ZIDA 1FFQA 5CSYA 1RH9A 4EE9A 1GZJA 1GOQA 5BYWA 4JFSA 2VQUA 4JL2A 4DUWA 1BG9A 3ZT6A 2VCCA 4NF7A 3W4RA 3N12A 3CZSA 3L4VA 4MADA 3N13A 2XWEA 2E8YA 4TXEA 2GDUA 1OIFA 5I23A 4P7QA 3HU7A 1GHRA 3VIMA 3WH6A 5A8MA 2DSZA 3VIOA 2PWEA 1HP5A 4HU0A 4AMWA 3EJPA 5BWFA 4DWSA 2BY0A 1BYCA 3GDBA 1JFXA 1R85A 3WQ8A 2ZUNA 1XH0A 2VVSA 1BVZA 2CITA 4RL3A 3VIIA 3PZOA 3W38A 3ZJ8A 5JBEA 4NXSA 2E8ZA 2FHBA 1L8NA 4JHOA 5BROA 4TX6A 2V5CA 4V2XA 1G0CA 5E09A 2OYKA 2JALA 5BRPA 3MUIA 4P7OA 1BTCA 4FNPA 3AIEA 1V3HA 1LWHA 3AICA 3GNPA 3WMCA 2BFGA 2D3LA 5BCAA 5JBDA 1LL4A 3GXMA 3WFLA 4YHEA 2Z1KA 1UQYA 2E0PA 1KXVA 2CKRA 3D5HA 3ARYA 4Q22A 2PWDA 3VDAA 1GQLA 1TR1A 3CBWA 3T2QA 5GQBA 2YLLA 6TAAA 4AZ5A 1UOKA 3T09A 2GSJA 3FHAA 2X2JA 2BVTA 2WMJA 1FH7A 1G01A 1KTBA 3GNOA 1VEPA 3O9NA 3WF0A 1VJZA 4YPJA 3BCFA 3FNDA 3EBVA 5E9AA 3DX4A 3F4VA 2CBIA 1DWIM 1W1YA 3NYDA 3SURA 1E9LA 2VZSA 3MMWA 4MPKA 1UWRA 4D72A 1A3HA 3CUFA 4NZCA 4B16A 2J74A 1QNQA 1J0HA 2J8GA 1W9UA 4BQ2A 1NH6A 1UKTA 4XZBA 4GI9A 4HA1A 4J3WA 3AIWA 1Z32X 2B31A 4QDMA 3ZJ7A 4MB5A 2C7FA 2XYLA 2V3EA 1E43A 1KWGA 1MW1A 2QV4A 3AS1A 2FH8A 3AS3A 3WH9A 2YA0A 3WY1A 4Z2KA 3VSTA 1M53A 4Q7NA 3KLKA 1X6NA 4ACYA 2VMFA 1SFSA 5LA2A 3L4ZA 4JAWA 1H49A 4J3TA 4GIAA 1LQ0A 1N82A 3L4XA 5E1QA 1JDCA 1H2JA 5FCZA 4CD8A 5I0DA 2NT0A 3A47A 1UWUA 1EXPA 3F5KA 3WQ5A 3OG2A 2CESA 2O9PA 5CG0A 4U2YA 3CMGA 3AIUA 1OINA 2JF6A 2F8QA 5GPRA 1K6AA 1K9TA 3I3EA 4W7WA 4X9YA 1H0IA 3A4WA 3BMWA 3WEZA 4JHZA 1QX1A 1ODZA 2BHUA 2A3CA 4W86A 3BLKA 1ZL1A 4S3JA 3VTRA 4AZ7A 1MQPA 1XC6A 1W9VA 3AMCA 3CZLA 3WD1A 4PUEA 3CPUA 3K8MA 4C7GA 1PX8A 4PMQA 4DO6A 1KXTA 2J7DA 5IFTA 1LWJA 9CGTA 4HMDA 3KL3A 1HVQA 1WCGA 1UKSA 4D71A 4M1RA 4N0RA 1UYQA 2UY3A 1FOBA 3MS8A 2A3HA 4OKDA 4WLCA 2F7OA 2VZUA 3IJ7A 2WANA 3U5UA 1NWTA 4H8UA 1M01A 2WKLA 1J18A 1WDQA 3WEOA 1GOOA 3A5VA 1QPKA 1ESWA 1HJXA 2XHYA 2CCRA 1AQ0A 1KGXA 3M46A 5A2BA 4JKKA 1MW3A 1GQJA 2ZICA 4PCSA 2WZIA 3MO4A 1US3A 4EAMA 4GZEA 3KL0A 1HL8A 3VO0A 3B8SA 4B3LA 1Q6CA 2VCAA 2BNJA 5EB8A 3J7HA 3SCRA 3WBAA 1NARA 3MU7A 2WVTA 4MTVA 4H8VA 4MNLA 1GORA 3M07A 3DC0A 1XH1A 3WDPP 1XCXA 2PBGA 1C90A 3L4WA 2CKSA 3WNPA 3WMSA 5DMYA 2GDVA 2WAGA 3CZ8A 1U30A 1GQKA 4MB3A 3EMCA 3NDZA 4PN2A 2WVUA 3IJ8A 2ZX6A 3A4AA 1VFUA 2V3GA 1HJSA 3VIPA 1L0PA 4PMXA 2E40A 5A3HA 3QHMA 1UA7A 3W53A 5AC5A 3HG2A 3WF2A 4GZIA 1JGIA 1TQUA 4BQ3A 4H7VA 1NP2A 5IHSA 1J0ZA 3UCQA 4AYSA 1NOUA 1JI1A 2WHJA 1D3CA 1VFMA 2XFYA 2PC8A 2E9MA 2W5FA 4CGTA 3DECA 3T2PA 2Y24A 1HP4A 4LQ1A 4ACZA 3BGAA 2VC9A 1KR1A 3WD4A 3WH5A 3WY4A 2WLZA 1W3HA 1XYFA 5EMYA 4MJ2A 4PTXA 1CNVA 3CZNA 1WE5A 4W85A 2J78A 1M04A 5D8WA 3OLGA 2WCSA 2WMIA 3CZJA 1E6NA 3H55A 2J7EA 1PAMA 4J28A 5M03A 3NDYA 3T0DA 1RPKA 3VMNA 5A6AA 1NWRA 2Y2WA 3EDKA 1PEZA 4DUVA 4CCCA 2EPLX 1UH3A 4M8UA 3SCNA 3DX1A 1QHOA 3L4UA 2Y5EA 3SCUA 1KR0A 1R7OA 2YOCA 3UETA 2YIHA 3KZSA 1JIBA 4QP0A 2F7PA 1A47A 1KGUA 4UZSA 1GQIA 1KQYA 2EO7A 2YA1A 1CIUA 1CLVA 3OLDA 1HKJA 2A3AA 5I6SA 4M24A 3TONA 2VR4A 1CXEA 3AIRA 1K9DA 1W9DM 1ZU8A 3TA9A 3S5YA 1R8LA 3OIHA 2G3MA 5HBFA 2X2HA 2O92A 2XM1A 2BXZA 1J10A 1JFHA 1E5NA 3AXXA 3POCA 4AIOA 1U33A 1EO5A 5CJ5A 4P8XA 1IZKA 1EO7A 2W67A 2PI6A 1BAGA 4NSBA 4LYRA 1D2KA 1HJWA 1W3LA 4LX4A 1QVBA 3O2LA 1MFUA 5BXPA 1E6PA 2WYSA 3U57A 2X0YA 2FHCA 3AFBA 1P6WA 1FHDA 3PZTA 4ATLA 2ZX8A 3BUIA 5DT5A 4P7NA 4CCEA 4HA3A 3DX2A 1BHGA 3VIKA 2VQTA 3DYPA 3SCSA 3VIFA 3ZT5A 4CU8A 5BRQA 4ZEPA 3A21A 2E3ZA 3NSMA 1UZ4A 3WFZA 1UHVA 1J0IA 2X09A 3NIYA 4F8XA 4Z2HA 1H41A 2DIEA 2VTFA 3ZO9A 1VBRA 2OYLA 1JZ7A 4WJXA 1CDGA 3MV01 1WO2A 3T0AA 2YL9A 4QFUA 3RMEA 2EPMX 3QHOA 4J7RA 2AMGA 3A6OA 1MW0A 3W37A 4WK9A 3BAJA 4U31A 1B90A 4HU8A 1B3YA 1MQRA 4AXNA 1VENA 1VBUA 2VX6A 3RILA 5A6LA 3CO4A 2VURA 2CYGA 3A4XA 2J79A 3L2MA 4ZFMA 2WVVB 3OZPA 1HVXA 1R47A 4M82A 3AYSA 3KL5A 3EDDA 3GXFA 3SCTA 4MNMA 2ZWYA 4CN4A 3OA5A 1ZS2A 3UESA 1VIWA 4NRRA 5AY7A 2YL5A 3BVXA 4GZJA 5DF0A 5A8OA 3POHA 1MW2A 3BUQA 1J11A 4D1IA 4OBRA 3AI0A 5A95A 2J4GA 2XVGA 3VX0A 1R75A 2J62A 1HKIA 1UR2A 1CEOA 3LMYA 3IK2A 3L4TA 1M7XA 2W66A 4IPNB 4BCEA 3AMDA 4GINA 4UFJA 2ZUUA 1B9ZA 4J3SA 1BYDA 5CGTA 1VFFA 2Z1SA 1R46A 3AMGA 4P7LA 5GNXA 2CPUA 1HJUA 4CVWA 2OLHA 4XUYA 4HPGA 3WENA 3VKKA 3AHVA 1W3JA 2D23A 3B9EA 3AXHA 4ZENA 4UOJA 4BA0A 4LYQA 1CGVA 4HMEA 3KLLA 1WZLA 4PMYA 2PF0A 1UASA 3K1DA 2YDRA 5EFFA 6A3HA 1CXKA 1Q4NX 1GOWA 2XFRA 4P7RA 1C93A 3IAPA 5CQ1A 3PZNA 3PZMA 2FHFA 1W1TA 3DYOA 4V27A 1GOKA 4Z2GA 3UG5A 4FNSA 2E9LA 4DWSD 1B3VA 3CUJA 1OGGA 2DT3A 3TTOA 5ABGA 3VGFA 2J8FA 2X8RA 2C0HA 3WD0A 1AVAA 1MXDA 3U5YA 3GXIA 3DDGA 3W25A 3EDFA 2ZE0A 3VDHA 3BCDA 3BMVA 2ZX9A 4M29A 1SYTA 3ZSTA 1GONA 2BV9A 3MV11 4WF7A 2VRQA 3PHAA 1JYNA 3TP4A 1V3MA 1XCWA 1LF1A 2W61A 3OGVA 4ATWA 1DWHM 1WDPA 5DFAA 1OSEA 2DT1A 4PCTA 2WC3A 4UOZA 1VFOA 1JL8A 1XHGA 3M6DA 4W89A 1BGAA 1JG9A 1V3KA 1MYRA 5A1AA 5CLWA 4AZCA 1QHZA 1BLIA 3S2CA 1ZBWA 4CKQA 5DEZA 4JFTA 1UKPA 3OB8A 5JIPA 3AHXA 3PZUA 3CUIA 3O6AA 5HOSA 3SUSA 5BXTA 4F66A 3ZT7A 2GK1B 3HJEA 1V6UA 2G8ZA 4OUEA 4U33A 1E73M 4D6DA 1MQQA 3AOFA 1KBKA 1MXGA 2WM0A 2IXVA 2XN1A 1W9XA 1OGSA 4URIA 4AMCA 3N17A 4N42A 4DUXA 4NXKA 3W28A 3A23A 2XVNA 3RM9A 4X0VA 1S46A 5BXRA 2CIPA 3G6LA 4DWSC 2GJRA 2WMHA 4OOZA 1VEOA 3FXYA 1SR0A 1TVPA 2PBOA 1PX4A 1OB0A 4JZ5A 3T08A 1OCQA 3UG4A 2PB1A 2Y8KA 3WQ4A 3IGUA 1JAEA 3UEQA 2VZTA 2YL8A 3DYMA 3PBGA 3LXCA 1HX0A 3LPOA 2WZEA 1QWUA 1UWIA 1JNDA 1HKKA 3MSGA 4HA4A 2AAAA 2GJPA 1ZBCA 1E71M 1EHNA 4CD5A 1VJSA 4HP5A 3SCPA 4J3UA 1NP0A 4ATDA 3AZTA 1G94A 3PZIA 2RGLA 1WZKA 4C7DA 2BHYA 3WNKA 2BHZA 4FNQA 4MAVA 1R34A 4TTGA 3HN3A 3LXAA 2OSXA 1E70M 4D6JA 4UQCA 2BY3A 1KWKA 5M3WA 5AC4A 3GBEA 4NX0A 4UQAA 4AIUA 4U2ZA 4UNIA 2XVPA 3WEMA 4W93A 4JKMA 2HVMA 2WHMA 4AEEA 1XYZA 2DH3A 2DSVA 4AC1X 2CHNA 3RCNA 1R86A 1ISWA 4XV0A 3VGEA 4W7UA 5A6SA 2D0GA 4QLKA 3WQWA 1GCYA 2DIJA 4LXFA 1HKMA 5I79A 3VDCA 3WBEA 4AD5A 4B3KA 1B1YA 4E8DA 3W6MA 3LPPA 4PTVA 4QCEA 4GQQA 3IAQA 1C92A 2G3NA 2QPSA 5A2AA 3BH4A 2F18A 2JEQA 4FNTA 1FH8A 3PZ9A 1OT1A 4KMQA 4OJYA 5A8QA 2DSWA 1KCLA 5FOOA 2OSWA 2X05A 2XUCA 1OM0A 1KXHA 1E3XA 1GOIA 2WMKA 3OBAA 3ALGA 1E5JA 3FAXA 1WZAA 3MKKA 4NRSA 3RJXA 3VUPA 5KZ6A 3K4AA 3W81A 4IUGA 3MANA 1XRVA 4HOXA 4PUDA 4ZXOA 1K9FA 4HPHA 2GFTA 3ZR5A 3K8LA 4HZ8A 4QLLA 4Y7EA 2EPOA 4U5IA 2E9BA 2VT0A 8CGTA 1EDQA 2OYMA 2VX4A 2CETA 3RJYA 2YA2A 4AMXA 2G4FA 5I2UA 3AZSA 1CBGA 7CGTA 4U3AA 5HXMA 3BSGA 1HXKA 3AHYA 2WC7A 4W5ZA 5CPSA 1EOKA 3JUGA 1QW8A 4CD6A 2V38A 1IT0A 1HN1A 1OWQA 1FA2A 2XFFA 4H04A 3WNOA 2F1AA 4MB4A 2ZXQA 1BSIA 3LRLA 4TVCA 1H1NA 1BF2A 1CYGA 1B3XA 4HZ6A 1NOFA 3WF4A 1QI4A 1V3JA 2VRKA 4HZ7A 1G9HA 3W26A 3BVTA 3TTSA 3VIJA 1TVNA 3BAWA 3QGVA 3VU2A 4PMUA 2W91A 4HTYA 4MDOA 1KCKA 3I3DA 2OWWA 1W2PA 1V02A 3THDA 2RGMA 1XGZA 3CTTA 1E4NA 5I3DA 1C7TA 2J47A 1FP9A 4GQRA 1E6ZA 4E8CA 4OZOA 1TQTA 2BVDA 2WSPA 4JCLA 1EQCA 4M80A 5JUVA 3LRKA 3ARZA 1RD6A 2CEQA 4IISA 1J0KA 2WCGA 3DHPA 2F2HA 4PSPA 3T2OA 4W8LA 4FNUA 5A6BA 3AMLA 3OZOA 1C8YA 5FL1A 3QOMA 4UQDA 3VGBA 4HMCA 1JDDA 3HG4A 3CV5A 4W7VA 2F1BA 4UFMA 5D9PA 1BQCA 4AZ6A 4OBSA 3ARTA 4D6CA 2F7QA 4TTUA 1V3IA 3H54A 3UR8A 1B31A 3WUEA 2XWDA 2D2OA 4H41A 2GVYA 2DH2A 3GBDA 1ISZA 4D6HA 1JZ8A 5A94A 3VVGA 4CN1A 1PZ2A 3ZR6A 3D51A 3I3BA 2CNCA 4RE2A 1TZ7A 2WXDM 3RIKA 5AYIA 4TVUA 1X6LA 1UR9A 2WVVA 3UG3A 3VM7A 1B3ZA 2FYVA 1UD5A 4GKLA 4F79A 3EYPA 3W24A 3N9KA 1WDSA 1MWOA 1V0MA 3WNNA 2CBVA 3QR3A 6CGTA 1JXKA 4L4PA 3BUPA 1E4MM 3CZKA 1OD0A 1E55A 3MI6A 4PMRA 3PZQA 5E70A 3OLEA 1VF8A 1F4AA 4AD3A 3PZGA 2BY2A 2XN0A 3DX3A 2YKKA 3WIJA 7TAAA 1NM9A 3BAIA 2OW6A 5HDRA 2GK1A 3K4DA 4CU6A 1UH2A 5A6MA 3U7VA 1C91A 1VAHA 5ABFA 1KXQA 3KWXA 3RM4A 3FW6A 2GJXB 2WK2A 4JFUA 5A2CA 2AOSA 2ALWA 3CHCA 1VRXA 4ZE5A 5A69A 3WNLA 4LPCA 2TAAA 2JEPA 1WKYA 3NUKA 4QAWA 4D6IA 5I78A 4AZBA 1H4PA 3TOPA 5A6JA 1FHLA 2ZUWA 1W9BM 4DWSB 4TVDA 3CLWA 4R5EA 1DWJM 1QNOA 4MAZA 4UFIA 2HISA 2VX5A 1E72M 1GVYA 2D1ZA 1PS3A 2CHOA 4A3YA 2UWFA 4ZXLA 1DWGM 4UOQA 3E1F1 1LG2A 4EANA 5FD0A 1BGGA 3VSUA 4RE4A 4FF5A 4W5UA 1GJWA 4WKAA 4WKHA 5M17A 3WH8A 4UQ9A 3VGGA 1OIMA 3EJTA 5ECUA 3RM8A 1UWTA 1V08A 3EMZA 1XD1A 5CZKA 1TA3B 2QHAA 4UFKA 2JIEA 2YBUA 3ZIZA 4UR9A 4AZIA 1JI2A 4MDPA 4C7FA 1XV8A 1JZ5A 2G3JA 2XSAA 1XSIA 3ARWA 2D22A 3WDQA 3ZOAA 5JIWA 3LXBA 2PWHA 2YBTA 3BVVA 1SMDA 1CGUA 3CMJA 4AD4A 3VSVA 2VZVA 3WSUA 1JD9A 4YHGA 5ABFB 1E3ZA 2ZXBA 3EDJA 1E1EA 1JXJA 4PMOA 2EQDA 5E6YA 3BAXA 2Q8XA 3ARSA 4PMVA 3WMBA 1WP6A 1PX3A 1UD3A 2WBGA 5BXSA 3WL1A 1BPLB 1J9YA 2X1IA 1GOMA 1CXHA 3GH7A 4GPNA 2VJXA 1BYBA 1RP8A 3WF3A 4GO9A 3N15A 4AD1A 3AIVA 3GNRA 2OSYA 2V3FA 2DT0A 2YL6A 1WNOA 1EQPA 4PSRA 1ECEA 1QBAA 4EKJA 5C71A 1UZ1A 1KBBA 4XZWA 1YQ2A 4JL1A 2J7GA 1QW9A 1QNPA 3SCQA 1E1FA 2WMGA 4D6FA 3WUFA 3WDIA 5CPQA 5LA0A 2NSXA 1LJYA 2BS9A 4PBGA 1JNEA 4HOZA 4Z2IA 1EIBA 4BS0A 3KE0A 3BLPX 2OW7A 3PN8A 1HIZA 2JE8A 2VR5A 2Y4SA 5JBFA 1UD2A 2XG9A 1JYWA 8A3HA 1W3KA 4TX8A 5E0FA 2MANA 2Y8VA 1PBGA 2G41A 4HOWA 3H53A 1CXIA 2XN2A 5IFPA 1KB3A 3MUAA 4EK7A 1EDGA 4K68A 3AS0A 3BSHA 1AQHA 4JIEA 4AY1A 1CPUA 2J77A 2QMKA 2CBUA 1LLOA 3EDEA 2JIWA 3ZJ6A 2UY4A 4B9ZA 4B15A 3CHDA 2X2YA 4AISA 1JZ4A 2DDXA 1TQWA 5EFDA 5D9MA 2QLYA 2V3DA 4QLJA 3LPFA 1HNYA 1R87A 4KH2A 1V6YA 1LL7A 1CGTA 3DDFA 4TUFA 2WZHA 1E4LA 2D73A 4M56A 3VOCA 1KTCA 1E6SM 1ITXA 4PMNA 2EPKX 3SEPA 2CBJA 3GYCA 3MSDA 3WKZA 1UQZA 2A3BA 1IZJA 4KGLA 3N04A 2XGIA 1R33A 2WB5A 1JZ3A 1KFWA 4CD7A 1WPCA 3GXDA 1TMQA 1UKOA 1XD0A 1Q6FA 1F4HA 5CPTA 1PIFA 2XVKA 1UUQA 3M7SA 4L4OA 4ML4A 3ARXA 3WELA 1TE1A 1SZNA 1B2YA 1NOWA 3OGSA 1UD8A 1QHPA 3GTNA 1GUVA 4W84A 1OBAA 3N1AA 4OOUA 3GXNA 5D9OA 2WCAA 1GHSA 1V0LA 2D3NA 3ECQA 1W9PA 4PMDA 5CSUA 5FKYA 2IGTA 5GNZA 3WD3A 1K9EA 1HF6A 3ZSSA 1GPFA 3CIVA 4WSKA 2IUZA 4GI8A 2DEPA 4MNJA 2ZXDA 5D9NA 1QI5A 4DM1A 3OLIA 4PMZA 1EDTA 3SUWA 3CHEA 1DEDA 1B30A 3VIGA 1EGZA 2QPUA 4AZHA 2EJ1A 3FN9A 3L2LA 4D1JA 1MVYA 5A6KA 1JYVA 3CZEA 2J75A 4PRWA 1TCMA 3HG5A 1FP8A 1DWAM 2ZWZA 3FHQA 3MMUA 2QMJA 3WY2A 1AMYA 2O9RA 2D0FA 3CC1A 1JYXA 2X2IA 4E2OA 1TQSA 1O7AA 2WBKA 3WQ6A 3VPLA 4W88A 5IDIA 3WNMA 2XPKA 3ARPA 3ARUA 3WUBA 4JFWA 2GJXA 4YN5A 3WY3A 1H09A 1G5AA 3MMDA 2EXOA 3VD9A 3GM8A 1UR1A 5EBAA 5E6ZA 1ZB5A 3F5LA 1UWQA 5M5DA 1B0IA 3F5JA 5ABEA 1HTYA 3LPGA 2VL4A 4OIFA 1XH2A 1QNSA 4AZCB 4FLSA 1ZJAA 3KEHA 1BYAA 2F7RA 3AXIA 2J7CA 4CVUA 2JF7A 5CLTA 4UTFA 4ZE4A 3VGHA 1IV8A 4A3HA 1VB9A 1BFNA 1J0JA 3AYRA 4W8BA 4R27A 2GUYA 2W92A 1HJVA 3AS2A 1CXLA 1H5VA 3A3HA 2ZOXA 3NCOA 4FLOA 1LL6A 4AEFA 1TA3A 3AIQA 1E0WA 4MJ4A 1TUXA 2ZX7A 1D7FA 3GXTA 2FGZA 1V3LA 3S5ZA 3PTQA 2J7HA 4KWUA 2O9TA 4AW7A 3CZGA 4DO5A 2D20A 2WVSA 5F7UA 1RP9A 1I1XA 1NQ6A 3CUHA 4CU7A 4UQEA 3VMPA 2ESCA 3CGTA 3AQUA 3N18A 4U5KA 1Q6EA 4WKFA 3W0KA 2YDSA 5DT7A 2OWCA 2NT1A 4MNKA 3GZAA 4J27A 2IXUA 2BVYA 3LRMA 2WKGA 3B9AA 1QI0A 3VD5A 4H8HA 3ZJKA 4D6GA 4KRTA 1QWNA 2DSUA 4D6EA 2XIIA
chains in the Genus database with same CATH superfamily
4U1IA 5AVZB 4FERA 2G5WA 1FFPB 4TQEH 3C60C 2HE8A 2ZAGA 4H7ZA 2VDLH 5FCUL 2ZZ7A 1PYWA 2YAMA 3UC2A 1Q6DA 5IESL 4HHPA 5KOMC 3PL6B 5L2KE 3OAWA 4W4OC 4BHUA 2YCLA 5I24A 5F9OL 1F9CA 1EX0A 1LYXA 5L9FA 3MV8A 1KTKE 1VBGA 4PU2A 4UCFA 2V0AA 1Z0MA 3W83A 2GK0B 2JKIS 1CENA 2NY4C 4PP1D 1ZV5A 1R2SA 1PSKL 3PV7A 1XLDA 3PWIA 2CKBA 4JDEB 4AIEA 2DZAA 2PDCA 4QGTA 3RAJL 1XUZA 5GGQL 1QXLA 1YY9D 4NKIH 3RVVC 1MEXL 3DOHA 1A6WH 3P3YA 4L9LA 4WFGD 1KCUL 1I3VA 4FQLL 2B7QA 4XQ6A 1FLTX 3LTVA 1HJQA 3LN4A 2JIXA 1KEML 2ORBL 3RGVA 3UBXA 5CSGA 2WMPB 3U7AA 3EUUA 1BF8A 4KKQA 1MLCB 3SGDH 4QRSA 4U10A 3ILPB 2YLKA 4KKCD 1BQRA 1V02E 2OKTA 3C08L 2WWCA 1YRRA 4Y9AA 3TH2T 1WBZA 4JZOB 5BRZE 2XKUA 1PJ9A 3Q2WA 4MCYB 4Y4HC 5F0MB 1W3TA 1QOXA 3HG1E 2JKPA 4CNPA 3N42F 4MJHA 3QDMB 3EXRA 1RURL 1RBLA 4PJEF 4YK4B 3MV7E 5I17B 2YO3A 2VEFA 3UPMA 1TPC1 2P5WE 3A0OA 1U1JA 3GDRA 4LVDA 1V77A 3VZXA 1G1YA 3F58L 1NDVA 4ZMVA 2BOCB 4M93C 1KLFA 4XHJD 1D3HA 3MZ2A 4PW3A 1XMWA 3DK0A 3UERA 3ZQ9A 1IVLA 3QHNA 3QK0A 4XX6A 5HULA 3UAFA 1M03A 1T20A 5TGBA 5HNNA 2VZOA 4L4TA 1DLHA 3QWOB 4EDXA 3KOWA 1KM3A 4KKAC 2UXTA 3SE9H 1A5OC 1SW3A 4NKDA 4DN4L 4Q9BA 4PD4K 3ZE0E 3WBXA 4OF0A 3EO9H 3OBEA 5MP6H 1LWIA 3U6XS 3S36X 3KYMA 3LHYA 3MRHA 4PTTA 4U1HB 2O30A 4HCRL 5C0CD 1R3LA 5D6CB 3V5DB 3HAEG 3VX1A 4WU7B 3DROA 1FWEC 1UZDA 1T21A 3KW3A 2FE0A 2NY1D 1FH9A 1G9MC 3ASOB 3EX4A 3R0DA 3WUGA 2E7DA 3KGUA 1CE1L 3DX7B 4JFZL 3GHBH 3ZJAA 4BF7A 5D04C 3LGEA 2P43B 3UZWA 4ZRGA 2H1PL 2CERA 3T4AA 1I75A 5FM5O 1E6XM 2GVEA 1KQZA 4OZFA 1HL4A 2A83A 3TEZA 4YWIA 4AUBA 3BT2L 1QCWA 4IPJA 3OMIB 1SLVA 1YEDA 4MCZB 4I0PB 4B5EA 4DZBB 5KN5B 1SHXA 1NFGA 4NGHL 4XNYL 2HG5A 4AH7A 1W1VA 3LN4B 1SDYA 4W8AA 3QC5X 2WW5A 4TQEL 4X5LA 5C7XH 4M6PA 4HZLB 5F1VA 2HT2C 3ZKNC 2I9TB 1OGTB 5CCJA 1QI2A 2HTKC 1X5MA 4PW4A 4U6HA 5C07A 1XB8A 2VKWA 1TWSA 4P2QB 2E7HA 1ACXA 3FO1B 3HBZA 4OJCA 2G3IA 1WBZB 4KTDL 3VD4A 3G6MA 3I6LD 3NPVA 3NG3A 3EFDH 3WHXA 3TVMA 3O06A 5ESQA 3TN0A 1YXDA 2CUMA 1A2YB 5ADOL 4IM4A 1AE6L 3THCA 1EJFA 1G9MH 5FO8A 4K3DH 3EXTA 2PYEE 4XN7A 3I74A 3QQDA 5TD4A 1GYAA 2Q71A 4JTTA 5H8UA 4AWEA 4B5UA 1NOAA 4HIJB 3G1SA 3PP3H 2CBOA 2HXAA 4CUCA 1M7IB 3K46A 4KCVA 5IHRA 5EFIB 3MLVH 1S7TB 3TT3H 3H8AA 1FL6A 2XHNA 1R6VA 4OUUA 5C0BA 3Q2DA 4MKSA 1HQ4B 1T89C 2OXHB 1V0NA 4MMZA 5I07A 2A6JB 3TV8A 5ETUB 5DY3A 3TYGH 1PO9A 4WHDA 1TFVA 5D55A 5DYOB 1DBJL 1Z9AA 1F18A 4BINA 2R39A 2Y5TB 1C5BH 2D2CC 3MFFA 3MRFA 2Y7OA 4FP1A 4RDWA 3AUOA 3WDHA 3CYVA 3IKCB 1A5FH 2AQNA 2FBRA 3MACL 4TQ8A 4HKZA 1AY1L 4Z7WB 4MWFA 1GSMA 3HZVB 2WQ8A 3QFJD 2V7NA 4PLJC 5DURD 1JNNL 1YNKH 1XR2A 3CBKB 3TA4D 3UPRA 1U0QA 3N1QC 2DSKA 5IBXA 4E4PA 2ZOKB 5IMMB 3D4GA 4JW3A 4JTSA 3UY7A 2GTWB 3BKYH 5DMLA 4MGXA 4NQDA 2O9OA 5SV3A 4DJFD 5GISL 1J0YA 3LN5A 2NCEA 3L3JA 2YXVA 2VE6A 4H26A 1E56A 2N0MA 2D7PA 4LMQE 2P46B 1QFWM 1FL5B 3EJQA 1KIPB 1F76A 3S34L 2OJPA 1OCNA 1TPUA 4S1SH 1F1AA 2ENYA 3MSPA 2N7AA 3QXTA 2HK1A 1GS6X 3WL9A 4XAGA 3QPKA 3HO8A 3N91A 3FO2B 1DFXA 3D48R 4D8PB 4NZJA 4XI5D 1WCQA 2JKNA 4PREA 2B7DT 3CIAA 5DJ8B 2R14A 4OHQA 2ATPB 3GXPA 5D7JD 5EOTB 3U46A 5IQOA 4IUOA 4EAYA 2R2BB 4JYEA 2OI9C 5KSUB 1TPVA 1ITCA 2H1PH 4P5TD 4PTMA 3VIHA 4FYRA 1MUCA 3BUBA 2UY6A 2G97A 3HI1B 4XPFL 2YKLL 3STZA 4HS6B 2JGYA 3GGWA 3IFPB 5DZPA 2IXQB 1YYML 3CFEB 4JK0D 1L0QA 1X5GA 3DX8A 4MXQC 4MPQA 3EJUA 1CXFA 5CGMA 4A35A 1O68A 1PPIA 3MBDA 2QSCH 3AHTA 1UWFA 3FY1A 4GKSA 3PHQB 1JFQH 4HUWA 2J25A 4KDWA 4NWUL 4OH2A 1PIGA 4Q0XH 1MWAA 4Y4FB 5ANMB 1MJUH 1QUNA 2FWOA 1UENA 2WO4A 3KRSA 4LCQA 3ZFHA 1YG9A 1NIAA 5CSZA 5DD3L 4PGDA 4HKZB 3GYRA 2XY1A 3P0XA 1Z6KA 1LDPH 2FEDD 4LSDA 3LIZH 2IBBA 4M5SA 3ARVA 2MCMA 2WWDA 3IFNL 3VACA 1X5AA 4HETA 3SUTA 4C91A 4H1LG 3DVGA 3FTYA 4DK6A 2GOKA 3RPIA 4BQ5A 4LT7A 3MMEA 2Y06H 3RVXD 3WFBH 3TM6A 3DPDA 3IFOA 3V8OA 2VCBA 3W1UA 2EACA 4OM1H 1XLMA 3LTYA 3QIWA 2EO1A 2X6CA 4M8RA 4MNGB 3BE7A 1N6VA 1E65A 4QO1A 4N0UB 3UX9B 1KEGL 2Q1EA 1E50A 2PPDA 3IEAA 2W62A 1AJ2A 5EZIH 2W94A 4G71B 5FJOA 2F15A 4W87A 1GRWA 1WBYA 1TQVA 2BP3A 2G5UA 4AGPA 5IHWA 2VELA 3MLPA 1DR9A 3V4PH 4LAUA 2Q0ZX 5LNDA 3CUPB 2FT6A 4JTHA 1ZLEA 2P47B 4ABVA 4NJGA 2DTML 2MCPH 1P5UB 3E8UL 4XPBL 1GMIA 5E00A 2C0AA 2G60H 3FH8A 3NL6A 3GDLA 4JUTA 2E67A 3NSNA 2RR3A 1TPWA 2ALAA 4NC1E 3IANA 1BD2A 4KZCA 1S2VA 4B5XA 1PD6A 3TTYA 1ISYA 2LV4A 3SGDI 1SW0A 1AD4A 1N12A 3UCRA 1V6XA 1KPVA 1S5TA 3N3EA 2AV7A 5C6TH 1W32A 1ZBKA 1TE6A 1TX2A 4P8WA 3TBWA 3SQBB 2OAAA 3W87A 3QUXB 3MHGA 2PWGA 2YARA 5FECB 3HS0C 1W91A 5DBTA 3NZSA 1MRDH 1IXQA 4U3CA 5IJDC 4YPGB 1OC6A 2Y88A 3PFQA 5F0LB 2EDKA 1ODUA 1E7VA 2VDIA 3B8VA 5C97A 5FI8A 5AYBA 5C0BE 3T2NH 4V33A 2OS7A 2UY2A 3FTVA 2VDOL 4QGYA 5A2JH 2EUWA 3HPJB 1DSYA 3WHE1 4HHHA 1DVQA 4OQTL 3L4YA 1NCOA 4ICCX 3QEQA 4EWJA 3CVIL 3MNZB 1G0XA 1ZBVA 5H1WA 2VW7A 2X4QA 3BKML 1GC1H 1HFBA 3CMFA 5GGSB 5DT1H 2WPBA 1UOVA 2BSCA 2NY5L 3KLAA 3FRUB 1HAUA 5E8OA 5A7BA 3CMOL 2L7JA 3CV2A 1AHWB 3TJ4A 5FS5A 1XSOA 4YWGL 2ZC8A 2QL1A 3UTPD 4QT5A 1AKJB 1X5YA 1EB3A 1MCFA 1K4DA 1MRCH 1KG0B 4Y8DC 1LMIA 3NCXA 3MV7B 5B3SB 3EO1B 2GT9A 4YBLB 1OADA 2A6NA 4YXHH 4AK1A 1YEJL 3OF6D 3E8VA 2LGNA 3I6KA 3O6MH 4B9JA 1E4IA 1O5XA 3N2BA 2XV0A 1IQDA 4A68A 3BDXA 4JJHA 1FFRA 1WKFA 4KMTH 4NI3A 1VLWA 1UZ6F 4LALA 4WI5A 2WZMA 4XMLH 3BPCA 2P76A 2V5DA 1QLEH 2VVNA 4AHPA 4G11A 1Q66A 2OMYB 1FN4B 3EYQC 5A2FA 4OM1L 1M42A 3W9DA 2Y1VA 3L5WB 2ZOTA 5EBGA 3VQMA 3HFYA 4K1GA 4KWWA 1L9NA 3BAYA 4H0HB 1OC7A 3GUGA 4S3AA 2EADA 3QUZA 4XC1H 3EOBA 1AS7A 5ISZD 2E68A 3MCYA 1NEYA 3W29A 3GC2A 2V2XB 3KCPB 1ZLVH 1MY7A 3BP4A 4QYOA 2ZX5A 2Y0FA 3IKKA 2WQXA 2FJKA 4QQUA 4Y9PA 5D03A 1WBHA 1L9OA 3TWCH 4OZFG 5DJ0B 4I6KA 2KQMA 4UT7L 5LA1A 2CD0A 1C7SA 3AUVA 3DX0A 3QVAA 1AO7A 5GRUL 1AR2A 4LLDB 1H11A 1I60A 1C1EH 2D24A 3LCGA 5AENA 1I2OA 4GFSA 3O3DA 1V0KA 3SUVA 5CJXC 3IYLW 3TVAA 4OZFB 4XR8C 3W23A 2QVFB 3G8EA 2OTPA 2HS6A 1UA3A 5DO8A 3THUA 4Q4MA 2X4SB 3NSYA 3C12A 4FL4B 4WV1A 1OAQL 4FS0A 4M3JA 2CLIA 4Y96A 3AY2A 4M6OH 2QEZA 1NCAH 3HVNA 5FYKD 1M6JA 1WDRA 2EKSB 2RTTA 1NCTA 3IU3A 4HIEA 3S6TA 3UZZA 1ETJA 4K9EL 1JGEA 1IEQA 5TJWK 4Y5YC 4TM9A 1HQRB 2P5ED 2RKXA 1S3TC 4IP5A 4BWUA 5E08H 1XI3A 1IARB 4ZXBC 2XVLA 4X6CB 5K69A 3KH3A 3S37H 4UNLA 3RNDA 3WH7A 2EABA 4OZHF 4F91B 5C09B 2XIBA 5DD6B 3WD2A 1LT8A 3O2WL 5IM7B 3OHIA 1AYRA 3ARQA 3P4LA 3PWVA 4ZFOA 4GG6A 2WHLA 1PF3A 2A6IB 1HNFA 3W07A 5L9DH 4O1CA 2I85A 2ZIDA 1Q9LB 3ASNB 2VJ0A 4N2IA 4F7CB 2XIDA 1RH9A 1XYBA 5F2IA 3TJIA 2B0MA 3B6SA 1HI6B 3FCSB 1XIJA 2XFWA 2CHZA 4JFSA 4OLXL 1SEBB 5ACMA 1QZNA 5J89A 4UMCA 5C9XA 6XIAA 4F20A 4Q7DA 1GOGA 5FYKE 1XGEA 3L4VA 2AXFB 2EDBA 3N13A 5HHVH 2W9MA 2A6KA 3LQZB 4X5XB 3RX4A 4P7QA 3KBPA 3MOBL 3S4SB 3MRNB 5GS2H 1GHRA 3T6CA 3HOJA 4IQEA 1A1OA 2EDOA 1XMEB 5A8MA 4PD4J 3LNGA 4OLWL 3OMAB 4PY7A 5TF1H 1F00I 2PYFA 5C08B 4XAZA 2QT3A 5F8QC 3STCA 4JTLA 2P7TB 5I0ZA 4QE5A 4FEIA 4KKAD 1WIUA 1BYCA 3IDJA 4I3RH 1Y6MR 4NZTH 1EXBA 3WIIH 3R0UA 1JFXA 1I3GL 1R85A 4ZMQA 1AW2A 2MQGA 3GTTA 4RRPM 4A7GF 4PRBB 4R0LB 4C60A 1PQZA 2VN5A 1BBJA 1MI5D 5DY2A 3QIBB 3R6IA 3VIIA 1YNTA 4LGPB 4TMBA 4KPHL 5BQ7A 3W38A 4MUZA 4MZ8A 4HV8A 1ZVSB 5CZTA 1L8NA 4TX6A 2OEJA 2PDUA 1EXUB 1U8HA 3S6DA 3OXSA 5JW4Q 4LRNH 2LHAA 2Q8AH 1JWSB 3O2DL 2YXOA 3VFLA 1UM6L 1GMEA 3TWCL 3C8NA 1LWHA 4Y2OB 3AICA 3WMCA 1A64A 2UWEF 3CHVA 1E5AA 3KPPB 1N5YH 1JCJA 4F2EA 5JBDA 3SPVA 1NBZB 1G9NC 1OF2A 1RZIA 3RUGA 3GXMA 5LXGH 2NQLA 3WFLA 1PEWA 5KZMA 3BIKA 5DJYB 3PF3A 1T4WA 1AP2A 1CB7B 2R2EB 1Y1UA 3SYAA 2AKRA 2H3KA 2XA3A 4ZA0A 3W9EA 5H37A 3N06B 1ZANL 2A5HA 4RZCA 1TV3A 3CH0A 3RX2A 3WLOA 4GJIA 4MCNA 2PTZA 3EOAA 2FGWH 1FE8L 1KXVA 2X4UA 4JJ5A 2YPIA 4PGZA 3D5HA 4PODA 1SEQH 2V2DA 4FQXA 1JTOA 4YH6A 1HXYB 1GQLA 4M00A 3HFTA 4LEEA 4BFFA 4RX4D 3MXWH 3ULVF 1JBJA 1YUKB 3GKAA 4ADIA 2NX5E 2GPZA 2P5EE 3O11B 2Y1YA 1F8IA 4AZ5A 3T09A 2GSJA 2X2JA 2XXGA 2J71A 3FQTA 4KRPD 4RZ5A 1CUOA 3AREA 4AGOA 2Q02A 4K8EA 3WF0A 3CIQA 3UTTD 1VJZA 3TYFB 5FACA 4UAHA 1VBJA 5JH2A 1PTZA 2OMAA 3ZDZB 3GQYA 5LGJB 1PB0A 5KBDA 4PRID 4PE8A 3C5SA 4B16A 3IE4A 3H56A 1A53A 4Q8QA 3REQB 4G7QB 5E9AA 3H4XA 1RLWA 3F4VA 1OLLA 3KMDA 4YTQA 1W1YA 1T21B 4UTLA 2AJZB 2F54D 1HHIA 3PGFH 3PXJA 1YIXA 4HKBB 3FO9B 3RNKB 2BH0A 2ZTJA 3B03A 5G4WA 4D72A 1S7SB 4F1SA 2M83A 1U8IA 2R7EB 3FRUA 1AXTH 1RV6X 5E8OB 2FSEB 2Z7UA 1R5WA 4HVBA 1QNQA 1TJRA 1V7AA 2J74A 4JN7A 4BQ2A 1R3KB 2F6AA 1JK8A 2B3IA 4P46C 5EGRA 3TLLA 3VXRE 4R4ND 2XV3A 3P3UA 3RE0A 4ES4A 1R5YA 4J1OA 4X80H 2GUUA 1WC7B 5LKNA 1MNSA 4J3WA 4M5ZL 3AIWA 2B31A 3ZJ7A 1G43A 4MB5A 4U1SB 2C7FA 2Z31B 4QHNB 3APFA 3ML9A 3TW9A 1MJ8L 5D1ZB 1MFBL 2E6FA 3VXSA 2V3EA 1KWGA 1RZJL 1JGUL 4BSWA 1B3OA 1JZIA 1TKWA 4FHBD 5GJSL 3HZVA 3WKQA 2EEFA 3FS9A 3NCYS 5D1ZC 1I9EA 2YA0A 3WH9A 3KXQA 3DJSA 3QHZL 3RDTA 4QRTB 2VERA 3WY1A 3SCMA 5GS0L 1MFCL 1J5TA 4FFWD 3TU6A 3RFZC 1J9CT 5JUEL 4ZJ9A 3VSTA 1BZDA 1M53A 2VFEA 4Q7NA 4G9FA 1LEGA 3LB6C 3MNWA 4DI9A 1V7NH 2NY2B 4ACYA 3I84A 4BUGA 3G04A 1AD9B 2QAPA 3JZEA 1N4XH 2YN3A 5HI3C 3L4ZA 3UF9A 4N9DA 2AC0A 4WSHA 4O5LH 5KS9A 1PWMA 3ESMA 6PCYA 1WUZA 1N82A 3F6JA 2VGBA 2BNRB 2Y6TE 3L4XA 4XMXA 3WLHA 1ZT7B 3MNVB 5LAPA 4GG6F 4XC3L 3VOIA 3ABZA 1BFOB 3FYEB 3PWUA 5I0DA 1H2JA 2X7WA 3EOLA 3SQLA 3ETBJ 4NHCL 5FB8B 5EEWA 1ACYL 4LSBA 2SEBB 2F6UA 4O15A 1Q8MA 3T0EA 2CESA 3OG2A 4KEMA 4NP4L 4U2YA 2X40A 2VWEE 3H3KA 2W38A 3QUYA 4A63A 1VP5A 3STLB 1SNRA 4JMNA 2YCLB 4FD0A 3WIHA 4P5MB 4BFKA 2F8QA 4LUIA 4S1RH 1K7XA 5FYLL 1TZ7A 1RSFA 2OPCA 4MXVE 3PPCA 4IQHA 1T1WB 2W9EH 1H0IA 3A4WA 3THAA 4B5TA 1NBVL 3GJEB 1JUBA 5C0IA 1QX1A 3H9SE 3LKSB 4QRPE 5IW1A 1ODZA 1JPKA 2E47A 3WFHB 2A3CA 3BG3A 4IRSA 3NGFA 1RCOB 1B0RB 3ESNA 4NKOB 2MJWA 2CCLA 4NAMA 3QDHA 4JTRA 4XO8A 5CM1A 2XICA 3KWTA 5FGCB 5E4EB 4LLMA 3TO2B 5DVOA 2PDYA 3A9BA 5KZDA 3P11H 1AZZC 1DEEB 1LM8V 3O6LL 4UQ2A 4ZQOA 4KI1A 4FQ1L 1A6VH 5JOPE 3TXVA 1AXTL 1IGYA 2F2KA 5G1MA 2Q3OA 1Q2SA 4TVSa 2DQJL 4QWWD 3IRPX 4GAJH 4QHKI 4N1HB 2Y7QB 2JF1A 4NC0B 5I06A 2H3BA 5AZ2H 3UMTA 3VRLE 3PABA 4N0RA 4MMYA 5IWLC 4KERA 2C9RA 1A3RL 2X1OA 2UY3A 4IG2A 4PY7B 1Z3GH 4XMTA 1NC2D 1J5OH 4IHCA 4JFXA 4RNIA 2F8XC 3RUGF 4P5TB 1MCJA 4MMWA 4L6HA 4H8WH 2VLJA 1ZT4B 4JDZB 4EDXB 3T1FB 2HX9A 2H1XA 4JLRA 4PLKC 5BVJA 2X7VA 2JCCE 2KBGA 3A67H 3W3BA 2NNCA 4TUOA 4PJ8D 4I6VA 1NAKH 5CH9A 2FKPA 2Z6FA 5FDYA 1A9BB 5D7LB 1NWTA 1M01A 4IIHA 1AAJA 4KROB 5IQ9A 2QCCA 4P59H 3PP4L 4XXDA 3T7VA 4K3JL 1ME8A 2I9UA 1TTRA 4FOUA 4JN2B 1A5BA 4O1BA 3SDXF 3N9GL 4IHOA 5IW6B 3CU2A 4GQ0A 4IGBC 5HHMD 5TGBB 4P61A 1M7OA 3GZQA 4FZEH 1CYWA 4JJOA 2V8MA 5C9WA 2CCRA 2NNAA 5MEPB 1O5PA 1X5HA 2OO0A 3H12A 2VN3A 2Y6SD 2FX7L 3KWVA 2RAGA 1IGML 3M46A 5A2BA 2IMMA 2WQWA 3T40A 3QJHB 1GQJA 1ACYH 3VG9C 1R0AL 4P48A 4JRLA 5AYUL 4IOSA 1L9WA 1PG7W 4GEIA 4KI5D 4PCSA 1SJHA 4XXCA 4I77L 4M0XA 3W7OA 1TSIA 2Z27A 3HW7A 1EAQA 4OKVA 1US3A 4RMQA 4O57A 3ONCA 3FB8A 1DQQA 2VC5A 1PY9A 3E6FA 1EIXA 4ZCWA 5HWNA 3VO0A 3JU2A 1TV7A 4QQ3A 3TURA 1M05A 1NFDE 3OVQA 3PJNA 3TN0B 2MOQA 4N87A 3S2AA 2VCAA 5EB8A 2X4UB 4JJ5B 3UTSB 3W01A 3W74A 2HFFB 1EEZA 4IXXA 4ANKA 5AUMB 1T1ZB 1NARA 2ESVD 3LZFH 1FUNA 2RBLA 5H37H 3V0DA 5INCB 2J4WL 2VEIA 1FWBC 5A2IH 1PDYA 2J88A 4MNLA 1XIWA 2BBFA 4GD0A 3RWJB 5LNVA 1GORA 3NEEA 1G4RA 5TE7L 4PJDA 3IUHA 3I9GH 3M07A 1IC7H 4JGDA 1ZY9A 1MFAL 2P8LA 4PJBB 4IGNA 3MREB 3I6KB 1Q6OA 4YMZA 1PQZB 4XZUA 4LAJH 4M7KL 2PBGA 1C90A 3KWWA 2KLRA 1G7LA 3FB5A 3HN8A 4TNWF 4UNTA 3WNPA 3TF4A 2V5KA 4KFNA 2ZYHA 4PJGB 5DYFA 3CVHH 4IRJD 3NZ8A 1B3JA 2OV0A 2WQVA 1NDWA 3NIGB 3W1RA 2AJSH 4IKKA 1EDHA 2VLRA 1L5GB 1U30A 4I2XB 4B96A 1OWRM 3B04A 1JRBA 1QPPA 3HNTL 2GJ6D 2VR6A 4JPSA 1TVDA 3F4WA 3WJXA 4JQ1A 3ABOA 2NQ9A 3VKDA 2H47C 4GRWB 5GGSA 2W9DH 3IJ8A 1U8MA 1JGDB 4MD0A 2ZX6A 5E5LA 4AJ0A 3QAQA 5EIIA 4Z77B 3EG9B 1ICTA 1KEMH 1HINH 1B4EA 2A6LA 4Z2JA 1JCVA 1EEQA 1KO0A 3E12A 3EYVA 3QC6X 1NEPA 3CFJA 4OJFH 3QXAA 2QVMA 1CURA 3W7GA 5BOFA 1BW8A 3HG2A 4IOIA 1HK6A 1K8IB 4ZTOH 4IHBA 4UQIM 4P49A 4HT3A 1NSNH 5H35B 1JGIA 3DBSA 4MF4A 1JNHA 3FQYA 4R9OA 2HFTA 3V5OA 4BQ3A 2OL3B 3LEVH 3CL6A 3ERXA 4XCCH 2XZZA 1E9ZB 4FX5A 2UZXA 4JQVC 5D7SL 3TBSA 3ZL1A 4HPNA 4AYSA 1S5MA 3NP3A 3MBWA 4NZ8A 4JBSA 1QFWH 1RBOB 4JQVA 4POCA 3T42A 3HI6H 4FZEL 4Z7UE 4CNUA 2NX1A 1OAUH 2PXYD 4W9DC 3U0WL 2Z0IA 4ZX6A 2E9MA 3SJVE 2FUTA 2W5FA 4JFPB 4FHKA 1IC4H 3ZZLA 1LTXA 4HZAA 4ABUA 3DECA 3KJ4C 4JIQA 4A2GA 3PL6C 3JT0A 5ANHA 4DBUA 5JO5A 4JHAL 1NSJA 2VDPB 5AD0A 3MCLH 2J73A 5DMIH 1HP4A 3L5HA 1CDHA 1IEAB 4X6CA 1OEZW 1N5AB 1PLBA 2IEPA 5FLVA 4YSUA 2DV0A 1MAKA 2H3NA 1NJJA 2HUHA 1I8KA 2PDMA 2VRJA 2H32A 3QWQB 5EOCL 5KYYA 3WD4A 3H6OA 1OP5H 3C2SA 2MCAA 5F7FA 1R24A 3WJMB 1OYCA 5MENA 3RR1A 3LQGA 5BOEA 2AQ2A 2CALA 2JJTC 1XYFA 2Y25A 2J12B 4MJ6A 3MXVH 1N8WA 3CAKA 2ONEA 1DVXA 4M3KB 4M1CD 1KIQB 1UBPC 3AAZA 1RIUH 3UJJH 1Q38A 1S5VA 3NFPB 3QQ9C 3MMEB 5DJ2A 4Z78B 5FW6A 3Q8EA 4P0DA 1PMYA 1SSDA 3W1NA 3LD8C 2VC2H 3D0VB 4JPQA 4MQ7A 2AJ3A 4NIYE 4Q4IA 4LANA 1XL9A 1M04A 3WIHH 4LRTA 3WQPA 2WMIA 3H55A 1R3HB 4G80B 1J7VR 4O2CA 5MERB 4NI6A 2Y62A 4X6FB 4A3RA 3XISA 5SX5K 4J28A 3CSYA 4EKXA 2AP2A 3NDYA 2J6EH 4RCXA 4QSHA 2QTEA 4R7XA 4TPRH 5DJCA 3MUHL 3QCTH 4TIMA 4WTZA 1KW1A 5GGRY 5I02A 2ACRA 1G7UA 5B22A 1N2RB 5C0AE 4B3ZA 4FKEA 2ZTBA 1CDUA 1KBWA 3GI9L 1MAML 5E4OA 3UJIL 4E3VA 4JG0H 3IJHA 2ZKMX 3DX1A 3GZPA 1QHOA 1KJMB 1FLRL 2Y5EA 3ARFD 5JW4M 5ILTH 3DFOA 5FJJA 3SCUA 1KR0A 3QI9C 4WSGA 1E27A 3MACH 5GS1B 1SO3A 3F4CA 3URQA 5JW5B 1EHKB 3I65A 3AU0A 4JLRB 4NENB 2PDKA 7ODCA 4OCRL 3HNVH 4I4WB 1DXIA 2PDLA 1A47A 1KGUA 4UZSA 3SGJA 4Z1PA 4ONFL 3GT6A 2IH1B 1U8QB 4JUSA 4LSVH 4TV5A 5K9CA 4YOKA 1CIUA 1YE4A 4P23A 2J1YA 3ARDC 3OLDA 2ATSA 2VDKB 2A3AA 2EDDA 2PDNA 3W11D 5CLXA 5I6SA 3HPSA 1GYCA 4HFWA 5CWSB 3TONA 1GZGA 3C61A 1EHLL 3GHPA 1QU4A 3BO8A 1CXEA 2B81A 4MOZA 3EOSA 2KLSA 1K9DA 3M1ZA 3QGAC 4NM8H 4M19A 3ERPA 3V0TA 3LZRA 5F9OH 4LLVA 2YUVA 3S1UA 1RCYA 4YDJB 3S5YA 4JEJA 4LYKA 3N43F 4XNAA 1WA3A 1D8CA 4GCAA 4O2CB 5MERA 2ODHA 2XM1A 2E6JA 4JRYE 1V6TA 4J23A 5F2LA 3AXXA 2Q6WA 3POCA 4KK6C 1AD0A 3RAJH 3V6ZB 3UTTE 4AIOA 1U33A 2HRPL 3M6YA 4HB7A 2I1OA 4XVOA 2YKLH 4Y1TA 2MPAL 1KCUH 2WQAA 5KTEH 3G24A 1A7NL 4XZHA 1EFXD 3B8WA 3S3SA 2GQ9A 1KC5H 3CN1A 3VVVA 4LCCA 1JHKH 4KY1H 3IMTA 1D2KA 4HK0B 1JF1A 1T03L 4WY7H 3QRHA 3TYCA 4HNOA 1QVBA 3ATAA 2VLME 4R6UA 4XBEL 5ITFB 1MFUA 2DLIA 3ZBMA 2LLNA 4LFHG 3OL2A 2V9DA 1WSST 3RWFA 4PJCA 3CTLA 1U8CB 1PDKA 4FFYL 4JKWA 1SJAA 2GJZB 1E9QB 5IHUH 4GHRA 3G7TA 1MWAB 3QJUB 2J6EL 5L7XL 2ZX8A 1F58H 2AJYL 2J55A 4CGUB 1VADB 4NUJA 1ES0A 4TUKL 2R29A 1CD0A 3RJQB 2ADYA 4P7NA 4YL9A 1GPOH 3MRBA 2APFA 5DRZA 3SDDB 3MBED 5IOKA 1T8QA 2R9RA 3T3PF 4B9IA 1A5LC 3O0FA 4HJJH 3SCSA 3WFBL 3GVGA 3SAZA 1NLDH 2CWRA 1OTTD 2B16A 3QQNA 3T5WA 1VGAA 4CU8A 1FWAC 1FKXA 4GABA 1KM6A 4K7YA 4ZEPA 3KS0H 3RPIB 3A21A 2R4RL 2ADGB 1WLHA 2WYIA 4FQHB 4NO5A 1UZ4A 3NSMA 3WFZA 2XBTA 4GY7A 3UFYA 1AJ7H 3GIYA 3CVHA 5BO1H 1DPMA 2WP3T 2ICWA 2PTVA 2DIEA 1RHFA 1ZRUA 2A6KB 3ARDA 3HVDA 3LQZA 2CKBL 4KXZI 5CN2A 2P53A 2IPTL 4OTXH 3D85D 2DJ4A 3EGSB 3FL7A 1OFDA 3GTXA 3PQYA 4AJYV 1R3IL 3T3PE 3P82A 2B5IB 3VNIA 5B4MD 1XEUA 2F54B 1XH3A 2XZAL 5AOZA 3RMEA 5DJXB 3UCCA 3ITXA 1RULL 5LXVA 2Z31A 4M3HA 4QHNA 5GRJL 2AMGA 3A6OA 3T3PB 2JTYA 3U1SL 1EZVY 1TNMA 4LPUA 2WN3A 5T1MA 5IM7A 1CU4L 2UZXB 2F53D 3BP7B 1E30A 3O4LD 4NQCD 4KK8D 3HV9A 1MCPH 3P2TA 5K93A 3QSKB 1TTCA 2OLAA 4PRPB 5A16B 1CL7H 3N43B 5FEBA 1B3YA 5KUKA 5E6RB 3NPWA 4NHUA 2VX6A 2ZRWA 4TSBH 2Z0UA 3FQ1A 4QY8A 5BQDA 1N19A 2L3BA 3RILA 5FO7B 5A6LA 4HF5L 2CYGA 4N68A 3R8RA 1IHIA 1Q8JA 1VA9A 4EPBC 3L2MA 1CT5A 2WVVB 1EJ8A 1SM3H 2OJEA 4ONGL 4M82A 5FYJL 2IWEA 4C4KT 5E9DE 4HBQA 2H3XC 2X7LB 4JGJA 1IU1A 1MAJA 3KL5A 4G9DA 1A6AB 1M71A 1GOHA 1RK0B 2AEPL 2C3VA 3EDDA 3H2PA 1ZGLA 3DG3A 4MNMA 1AGFB 4LSQH 4CN4A 3UWWA 5FO9B 3UJSA 4KFPA 3IDGA 4JZNA 3T8LA 3OB0H 5CGBA 1QMLA 2OR9L 1Q1JL 2A73A 5LHFA 1VPYA 1DQLL 2KPNA 4XNDA 4IMCA 4X4KA 4IP7A 2C9AA 2Y36L 5D96C 4NNPL 1OGAD 1XFPA 2V2CA 3LTSA 5A8OA 4FQXB 5DK2B 3BG5A 4JX5A 1G4MA 3Q2VA 3HGOA 4ZMLA 4BCXA 3OBKA 3Q65A 1KZQA 1J11A 2ICES 4HKXA 4X8CA 2QIIA 4D1IA 1HEZA 3GSNH 3IGAB 4JHBA 4NQVA 3NIGE 1S7TA 4I5BA 4JANA 4WZHA 5EL1A 3RLHA 3SM0A 3S5SA 5A95A 1ADQL 1TJIH 4QTIL 3NQBA 3VKBA 1NUFA 5AD0B 5C9UA 3VX0A 2D7TL 1R75A 3EJZD 2PYEB 3EHBD 1UR2A 3CFUA 4OLUL 4M7SA 1OHLA 3HE6C 3U4KA 2WKOA 3L4TA 5CFAA 2BTMA 3FULA 3LMYA 5L4MA 4LCYA 3DFQA 1MDAA 3U9UA 3WIAA 2ZUUA 4HNVA 4X6BA 4WO4B 1B9ZA 1C9SA 5HYQB 1BYDA 2W81C 4GSXA 1JN6B 3I7SA 3EZJB 3GS4A 3PL6A 4ODTL 5DO2D 3AMGA 2ZXGA 5BO1L 1WGOA 5HI4C 4ZW3A 1N67A 5LDUA 1PVHA 3LN3A 3OP2A 4P7LA 3FUJA 4R3SB 1QLFB 4HSAC 4RBPH 4CVWA 2OLHA 1F3DH 2ZXEB 3QZAA 3VC6A 3O6KL 2A99A 5FO7A 1RAMA 3TYUA 5IVZA 3FA3A 1W3JA 1KFCA 5CZVL 1U8LB 3WFAA 1CD1A 1POKA 1W72H 2IBZY 3ZE2B 3B9EA 4B3VA 5CJOH 4P06A 4NBXB 3T0EC 2JMRA 4H3DA 4FKHA 3VFMB 3JSSA 4JTFA 5IJBC 4DZAA 2WQPA 4EPDC 3ARGA 4LLWB 3EX1A 1BIIA 4XO4A 3KLLA 5I74B 4IGSA 1AGFA 4PMYA 4B9PA 1THAA 3GSUB 3L2NA 3OKEA 1OKEA 3E6HA 4GSDL 3MLZL 2HT4C 2YAFA 3W0WA 3PV6A 1JZJA 4F7TB 4KTYA 2B59B 3HBPA 3F6IA 1CFNB 4OBTA 3GC3A 4KNTA 4BFAA 5EFFA 5D7EA 3RQ3A 4Z2HA 4UCGA 4K9JA 4PRIE 4TULL 4Z7VB 4X5PA 5IJCC 4N8VB 4YSCA 3GLZA 1HH6A 2DZPA 1AS6A 4XMUA 3LA4A 1DVFD 1NJ9B 1X7QB 4OAWA 2BVOA 3B0PA 3T6QC 3BRDA 3CV1A 3LS9A 3ATYA 3PZMA 2RFXB 1IEBA 4GIPD 2WNGA 2WMPA 3DYOA 5CUSH 4ZDHA 1OX5A 3AG3B 5BRZA 4V27A 4TYUA 4Z2GA 2XBDA 3UG5A 3K71B 1X1ZA 4AIBA 2JCCA 1OZMA 2E9LA 3HPFA 3ILQD 4GQBA 1CLKA 4JTIA 1T1YA 3KWWB 2Y61A 1EV2E 2OR8A 4NNYA 1MCHA 4RGMB 4UF7C 2XN9E 4B50A 2X8RA 2MQ0A 3H22A 2EEAA 3GO1H 1PYMA 3DI0A 2OX4A 3MV8D 1AVAA 1P43A 3BGGA 1OV8A 1DE6A 1YMYA 2I5QA 1KF9B 2W6RA 1T80A 4R3SA 2GVJA 4I87A 5LBGA 3GSNL 3SGUA 4N0UA 3W25A 2AL2A 2UUDH 2R1XA 2XKNA 1HKLL 1YMHB 3EDFA 4R4BA 5KVMC 3W02A 2ZE0A 4LAMA 4MNQB 2DTMH 2MCPL 3WO8A 2DWEB 3QZLA 5EORH 3IFOB 1QSEA 3P77A 3BZGA 1FFOA 1XPGA 3QPYA 3TK7A 2Y2TA 3ZSTA 1F6YA 4N9EA 2EDWA 4NPJA 4WHCA 9XIMA 2IDTA 2GJZA 5FEWA 3MV11 2X4TA 3DGCR 3SE3A 4WF7A 3TWYA 1J8HA 1S5IL 2BZCA 32C2B 3TP4A 3UZVB 1JYNA 1JPHA 3RG6A 2FIRT 4MFHA 1FZJB 2YPVA 4HHMA 5HAOA 2MUCA 4ZQPA 4DPQA 4UQ3B 2GC4C 3OGVA 1NDMA 1QPQA 1K5WA 4KRMB 3TBTA 5LGHL 2DT1A 2IDQA 5F3HB 2WC3A 4MYWB 3WHXB 43C9B 2DZEA 5TBOA 2AGJH 3CHRA 4AVNA 1FGNL 1BGAA 4V2CB 4UNVA 2X1UA 3C2EA 3E2SA 5FLUA 5CLWA 4M48H 4E41B 1BKHA 2C9UA 3ZRSA 1A4JA 4BFRA 1QHZA 4FQ2H 3Q1EA 5HJ3B 1HZLA 1G4EA 4XVUD 1K72A 4X4ZA 2VDKH 3MODH 5JIPA 4PLNC 1REQB 3WUWA 5EN2B 3NYZA 4M43L 3ZR4A 4LBEB 2HMCA 2OEKA 3F2CA 4HUCA 1PY4A 4JR9H 4UINH 1WUFA 3LM3A 3HPLB 4CBPA 1R3RA 3ZT7A 4O4WA 2A9CA 3GMQA 5B7ZA 1Q2RA 4U33A 2Y5SA 2VMDA 3QQWA 4TUOB 1YC8A 1T0NB 4E9LA 1ADOA 2FQFA 2WIIB 1KELH 4D6DA 1FDLH 3AOFA 4RSYA 4L9LC 2FO4B 1MRCL 4TULH 1ZUAX 1U83A 1VH7A 1FZMB 4OGYL 2N0KA 5EO0B 1SDDB 4BDVB 2JQZA 4ELDA 5AAWC 1W9XA 1OGSA 4URIA 4NQDE 5KYXA 1VACB 3D9AL 4KUZH 3L9RB 3U6RB 3N17A 4Z3JA 4NXKA 1HH9B 3GSOB 3CHOA 2NXZC 3RI5K 4ZNEA 4H26B 4ZUSA 4N0CD 1TCRA 5DS8B 3APMA 4K8RC 4LB4A 4LVEA 2REQA 4J2QA 2XVNA 4GSUA 1LRNA 1KFAH 3F83A 4FB7A 1B9KA 2AXGA 4P46B 4R7NA 3A12A 3NNTA 2GJRA 3H9SD 3U9IA 1TRIA 3GHTA 3F05A 1EZ2A 2FIKB 4R7WA 5CHNA 1J2BA 4JTGA 2Y3NA 1ID5I 3DXAB 1MFMA 1EC9A 2PBOA 4C56A 3LHTA 1PX4A 4BWWA 5D96B 4L9XA 5D72H 1FSKB 1RUPL 5DGRA 4JZ5A 5E9XA 1OP3K 2R94A 2G2PA 4OQTA 4PTUB 2Q7YB 3SYCA 4G7EB 4OU1A 3UJEA 3GSRA 1N3NB 3FB7A 4KKLC 3IFLH 2Y8KA 1U8OA 5IBLD 3Q6FB 1YMMB 3IGHX 2DJMA 5IROA 4FR1A 3UEQA 4LNYA 2OVLA 1QFHA 1YYLL 1RJRA 4N9CA 2AANA 2WWKT 3P02A 3PBGA 2DWEA 5LNWA 4WO0A 3LPOA 4LSSL 1QWUA 5CZXC 3SKNB 1JNDA 1SMOA 1UWIA 4Q8OA 4HA4A 4W70A 5LB1A 3MP4A 2GJPA 2QIWA 1ZBCA 4HEMA 1E71M 1JGUH 2H0FA 3NCWA 3V5KA 4R34A 1FQ9C 4FG2A 3N34A 2A6DA 2OQLA 4YSOA 4A7SA 3N2JA 3RUBL 4CD5A 2G5RA 4J3UA 3LEYL 4ATDA 3OSKA 2QGEA 3PZIA 3V7AE 4HCLA 4C7DA 4I7WA 3WNKA 1ED3B 3MX0A 3I75B 4KJWD 2BHZA 4FNQA 4MAVA 1R34A 3K0WA 5TE4L 3AFLA 3EXLA 3H2MA 3JTSB 5ICZA 3V10A 2X2GA 4BGDA 2Z8SA 3WSQL 3KPRA 4KO9A 1GKRA 1OCZB 1ADQA 3I6GB 3HKZA 2J27A 2QUVA 4MM1A 3GC5A 3GBEA 4IS6B 2R1NA 3E0LA 4NX0A 3ES7A 4YDIL 4PRAB 2OMBA 3BN9D 3RWEB 3WEMA 2AKZA 3VGAB 3E0VA 1U3HC 5H2BA 1LEIB 4AY7A 3OAUL 2FECI 3QHFL 1T41A 1QOQA 3PGCB 4AMKL 3HE6D 2ALRA 4CC4C 4WK0B 1I82A 2CK0L 1ISWA 1O9WA 3OG3A 4TSCH 2FIKA 1S7VA 2A4EA 5K39B 1F90L 3IJLA 3TT1H 5J13B 2D0GA 1HHKA 3C3NA 3W0WB 3FO1A 3D39A 4JRXB 4LXFA 4OLWH 3U9WA 3CIXA 4MA3A 5EIVA 1QNIA 3WBEA 4AD5A 1FVDA 2H9AA 3H23A 3NZRA 3UA3A 5EO9A 5AVQB 5FIEA 3FU9A 1BVLB 3D25B 4MDRA 5EUKA 1UWXK 1YEWA 5D2TA 3FQUA 4RLIA 1YVLA 1AZVA 4JFPA 5EA0H 4H83A 2PYFB 2CU9A 4OI9A 4A3UA 5G4NA 2J24A 1KJVB 1Z5YD 4ZO6A 3WN5A 5EF3A 3T4AB 2VLMD 1TTQA 3MTWA 2G3NA 3NSFA 1ZA6B 1NC2A 4AJVA 4ZTPH 3BH4A 4JM2D 5T3ZE 4BJHA 1ZLDA 5JW3H 2JEQA 4FNTA 4GT7A 4NO0D 3PZ9A 3L7EB 4A2FA 1M7UA 3AB0B 3FTGB 2P10A 1V5XA 1KN4H 3MLXL 2OSWA 4KESA 2X05A 4YXGA 3RZCB 3NL2A 2O6PA 3SDOA 1G4SA 1KXHA 1OM0A 3INUH 5DRWB 4FQIL 3SCMD 3G5VA 4DBSA 3OBAA 4JRYD 5HHPA 3R1GL 1E5JA 1TMHA 2NQCA 3VI4A 1F4XL 4WI8A 2IADB 4EJ1C 4CEUC 4BK4A 5DFTA 4BY3A 2WJZA 2WTRB 4KK8C 2ED6A 2LLGA 2G2RB 4P2QD 2KPWA 5MI0B 4IUGA 4PULA 1ZNNA 3MANA 5IEHA 3D3VE 3CJPA 3EB2A 3V9CA 4GBXD 1GTNA 4KIRA 2MQ3A 3FO0L 5FDWA 4G80A 4JY4B 1RUSA 4HPHA 4HC1A 1RJLB 3PWLB 2OFQA 4QR7A 3VG9B 3ZR5A 2QEJA 3QFGA 3VE0A 3NL3A 5H37G 2CDGA 3RUGB 4H20L 2IH3B 2XTJD 4U1LA 3S97C 4QLLA 2EPOA 2VT0A 3ZXAC 2YUZA 2PCFB 1UCTA 2IANB 3ITYA 4AVIA 4OF3A 3MRQA 2Y72A 3QRGL 1NEZB 1YDPB 3BJLA 5B38B 1BGXL 2YA2A 3VE9A 5DJAA 3FQXB 2AL2B 1CBGA 3CQHA 2Z4TA 2PDJA 4PWEA 4NKCA 1VCBC 5AYUH 3SGZA 1HXKA 1Q0YL 2YEVB 2YAHA 3N0AA 2AS5M 5CSSA 4N86A 3K5XA 1DBBL 3CSBA 4JM4H 3SGJC 1KCXA 3TT1L 3L23A 5CPSA 1YQVL 3PULA 4XNZC 2VDNH 3TXAA 2C9QA 1EOKA 3B7TA 1TZAA 4F37K 4CD6A 4JQIL 1IAII 2V38A 3TZVC 4YHZL 3X1EA 2EVIA 4H04A 3NCYP 4NFDA 4U3SB 1TSHA 1TUPA 4Y2DB 5JHLA 1T04B 3CV7A 4ZW8A 2WKJA 1TKWB 2IGFL 3WTSA 3FGCA 4MVBD 1EO8L 1YEHL 2R1WA 1CYGA 3D85B 4GRLA 3ROOA 3VCLA 4WW1A 1H1NA 1H3WM 3WHE0 3BXNA 1KFGA 2ATAA 2O72A 2CZDA 3PG8A 3VCRA 1M68A 2OCJA 3VRJB 1PS9A 2K3TA 1X3DA 4QJ3B 3BVTA 5CNHA 5IP4A 1KBLA 3BAWA 3QGVA 5CKAA 4B91A 3QNXB 1RA0A 3GKWH 1CN4A 2XTLA 3H7RA 4LBSA 3BVJA 4M3PA 5JIHA 4EOWH 1ZHBB 5K59F 4G70B 1V02A 4NO2A 2RGMA 4LTSA 4YSDA 2VDRL 3UXLA 1ZSXA 3M45A 3TCXA 1XGZA 1HYRC 5F7BA 1U8JA 3PF2A 4IW4C 1J5DA 3GIZH 1H5YA 4JHMA 3ZVHA 1P7KA 2LLLA 1H7RA 1B3IA 1A02N 1XR8B 5SWSE 1FP9A 1F3RB 4GQRA 4HCDA 4QXIA 4KDTA 4Y9EA 4Q2ZB 3TFKC 4AL8C 1BKSA 3TV3L 3ULUC 2WXMA 3QO0A 3U4BH 1EQCA 4P2RB 3RY4A 4M80A 2VKXA 1I1FB 3CLMA 4UTHA 5E8EB 3LRKA 5BU6A 1QATA 3LEPA 3BEVB 5EZJA 1DQML 2QHRL 3FUNA 4QXVA 4YIQA 1D8WA 2NXYD 2IH8A 3JZ7A 2Y22A 3NCEB 4RMVA 1CLZH 3OGOE 4LCVA 5ELIA 2ZG1A 5FUOH 3QB7C 2CAKA 1XFCA 4JFOB 2F2HA 3HIJA 3P4MA 4GUPA 5E9NA 1WWWX 5M7QA 4ZTOL 4PSPA 1SFHA 3SQBA 4D2NA 4I9XA 4PG2A 1F0LA 4OR1A 3FCUB 3GJEA 4F27A 2QUMA 3T0EB 3OZOA 2R1LA 5FYLH 4HCFA 2KT6A 3FONA 4JFHD 4DTGH 4LEXL 1MJJA 3VGBA 4F9LA 3VU1A 2BWDA 3CV5A 4A7QA 4W7VA 1NBVH 2F1BA 4P5MA 5I1LA 4UFMA 4YSPA 5FEXA 5G4OA 1ZCOA 1BGXH 2A21A 1FFNA 4NC2B 3Q05A 5IB5A 4KW2A 4YHKH 4IIQC 4ZXBB 5A3ID 4QAMB 4B5ZA 3I6GA 3ARTA 4D6CA 4A22A 1TR7A 1IAKA 3BQUD 1EWEA 4MY9A 2YD3A 4GP8B 2M2DA 3WKYA 3R25A 4TTUA 4C6OA 3STPA 3WUEA 3HQPA 1SLWA 2DDQH 2XWDA 2QGBA 4M6MH 2PR4H 4GXWA 1TTBA 5EOCH 3UC0H 1F6FB 2Z7GA 4HKJA 3VE0B 5I8OH 1XLIA 1DQKA 2ARJA 3SOBL 4DP0X 4XK2A 2SEBA 1T6MA 4AEHL 7TIMA 2VISA 1LNUB 4M8VA 3HUJF 1WFOA 1HYSC 1ISZA 2GDQA 4D6HA 2ZCLL 5I8EA 1JZ8A 4G7EA 5DWPA 2DWYA 3BSZH 3H21A 1DZ0A 2YPKB 2X4QB 5D4IA 2C16A 1TTUA 3W1AA 3D51A 2PLCA 3I3BA 5J6GB 3MGTA 2N56A 4OZHB 5HYIA 4W4QA 4A21A 1Q9WA 4G9FE 2Q3XA 3QUXD 1RZPA 2FLRT 3TMQA 3H2WA 4M1CC 4QUOA 3C52A 4PCKA 2Y7DA 5JOPD 3L1EA 2EG7A 4P9HC 1RQEA 2WYTA 1XDTT 5HYJE 5C0EB 2C9SA 2A74B 4M7ZC 3VFNB 3G1VA 2CJSA 2F38A 1B88A 1K8ZA 4IJCA 3FEQA 4NVTA 5K1NA 3C60B 1UD5A 3SRDA 1EK3A 5DWUL 3TZVD 1A0QL 3JWOC 3BCJA 1QYGL 4GKLA 4W9EC 1PZ5A 4X98B 4NUMA 3EYPA 4E0RB 1XCQA 1WDSA 4HS8H 1PHQA 3SJNA 4UIKH 3IMRA 2WINA 4ISVA 4PBFA 4EX4A 2B0SL 2Z93A 3FKRA 6CGTA 1JXKA 4WRLA 4AV0A 5M95B 4L4PA 3BUPA 4J3OF 4X7EC 2EDFA 3CN4A 1A7OL 4ODUA 4KQ0A 5FF4A 3NCJH 1PKLA 3LZQA 4ELMF 2L4OA 4GNJA 4YEFA 4Z0JA 5C0QA 4C90A 2AF2A 3ARDB 4JVWA 1SXAA 5E70A 1XIDA 1Y6KR 2IIJA 2R69H 5GS2D 4FP8L 1WXZA 1S7SA 1ZHAA 3C6CA 3IPEA 1E6JH 3OZ9L 2BY2A 5KAQG 4UT7H 2WZAA 5BV7B 3AREB 4HCIA 3H6JA 2OR7A 4MDIB 2YKKA 3THMH 2FZNA 3DV6A 3H9HA 4JFDE 1NM9A 1SJEB 4HWEL 4QRFA 1FV1A 7TAAA 3DEQA 5LVEA 4IOTA 2YXXA 2A38A 3RU8H 3U36B 2GQ8A 2VXSL 5T1KA 2XWRA 5IW3A 2GITA 2INFA 5KWYC 4P2OB 1UH2A 3ALXA 1GZHA 1P7QA 3UTSA 4IBTA 1XGYL 4MQXD 5FA3A 1C91A 3Q4DA 3OQ8A 3TDFA 4NAJA 3BW3A 2EDHA 4ORGA 2Z1BA 5TE7H 4YFLF 3QXUA 2PP0A 2FEJA 2NY6B 3KWXA 5CMAA 3RM4A 2ADJA 4PRNA 1FFNB 1XGDA 4NQDD 2BMKA 4QRRD 3L67A 1NCUA 5AVYB 4M7KH 5AEAA 1YJDC 2DLFH 4EZLA 1FO0B 5DUPL 1IAKB 1K4GA 2J7FA 3GTVA 4N2MA 2CU0A 1JPDX 1AE6H 1UGKA 1W8OA 2WXIA 1F3EA 1W37A 1KV7A 3FVMA 4O8AA 4CNNA 4LOEA 1NL0L 1YEDB 4MCZA 4DZBA 4D6IA 5I78A 2ACQA 1KRAC 3TIMA 2CO6A 3TOPA 2Z8VC 5A6JA 4BA8A 4QROA 2XFXA 3FDWA 2APWA 5GHWL 4ADJA 1W9BM 3CLWA 3MBEA 4R5EA 2CIKB 2OL3A 5IFHL 4HUXB 1JGLL 4LQFH 5U7SA 2A9DA 3GSNB 1WHPA 4G9FB 5ID1A 3QZOA 1H61A 4ANWA 1E72M 2CO3A 3EBAA 1PS3A 1USQA 3NJKA 3OC5A 5D8JL 4O2EA 5L88H 2XZ9A 3D0LA 2DQDH 3O9WC 1CI1A 4ZXLA 3OF6A 5H4YA 3VQ1C 5AECA 1RJYB 4AQOA 1RSCA 5C09D 4JB9H 4ZUVB 3V5FA 1JGDA 4MD0B 1QOKA 2N4IA 4YQXH 5IHZB 3QFDA 1UB5A 3N6YA 2WBXA 1GGBL 4K7FA 1JNLH 3HMXL 1K02A 1QSFA 2FWLB 2Z3FA 4IBQA 4JG5A 4FF5A 4RE4A 4W5UA 3BAEL 4HQQL 5EU3B 3Q8AA 5D93B 4RCAA 1WWBX 4C1NB 1RSYA 4FMKA 4WKHA 1E51A 5AB1A 1U3HD 5F7LB 3WH8A 1LO2L 2XRAL 1W17A 3H4GA 2F53A 3O4LA 4XX5A 3VGGA 3EJTA 4PJ5E 1DSWA 4AG4H 5ABZA 1OIMA 1V08A 3GUWA 4RFNB 1WA2X 4ORMA 4DJDD 2HPMA 4FP8H 4C59B 2JIEA 4N2KA 5DXXA 3ILDA 2K4WA 1KC7A 1GGCH 1BYNA 3R4IA 1YO4A 4AZIA 4A8NA 3T3MB 5E8DL 4C7FA 2BNQD 3SQOL 3EYOA 3QUZD 2EVGA 3QUXA 1KXQE 3QCUL 1DN0A 4TUJB 5LXGL 2XZAH 3LKSA 2BM3A 2G3JA 3FK4A 4PMFA 1ZE3C 4IL2A 4CLMA 5C0NC 1IYXA 2BP0B 2D22A 1B4LA 4WNQB 4XSLA 3WDQA 1EJ6A 3LXBA 4PEKA 5C2XA 3U1SH 1KFKA 2YBTA 4QKTA 4LPYA 1E1CB 1NFPA 3CQIA 5IOPA 1LE5B 5D2LB 1Q13A 1QNVA 1YN6B 4L8BA 1SY6H 2AERT 4X9GA 4AD4A 4ODBD 1F11A 3ZKMD 2NVDA 4DAGL 5JXQA 2NY3C 3QQDB 5CJBA 2NY0C 1WH0A 3H1ZA 1FNGB 4N28A 1T66D 2PAJA 4UWMA 5IZ7A 1A7PH 2ZXBA 1AANA 3EDJA 1EX1A 3PC0A 1G7HB 5FF2A 1E1EA 5FOBB 2R4SL 3RCYA 4F93B 3EFOA 2ESVA 1TZGL 3WMPA 2Q8XA 3ARSA 5DQ9A 3VFPB 2HJKA 1JVKA 3HE7D 2BOBB 1OY3B 3QNZB 4WCYH 5AW7B 1D9KA 2K0RA 4N5ED 1P7TA 4BHUI 1H60A 5C0CA 1KLZA 3D34A 1FO0L 1SXBA 1D6EA 3LQAC 3B7SA 1TJHL 3GIVA 2D2HA 4HNUA 4MHHI 1VZWA 1UD3A 4EUPB 4S2SB 1FWGC 2SFPA 3H70A 3TW7A 2QJNA 3L21A 1LOLA 4P04A 2XU2A 4R90L 1J9YA 3L3IB 1B0GB 1UT1A 3G5XA 3TEWA 2X1IA 4ELMA 1RZ8A 1CS6A 4U7SA 5LN4A 5BS0B 1BYBA 2QKFA 4S3BA 5BUPA 2A73B 4GO9A 1ORSA 3VFOA 5IW6A 1YDOA 3AIVA 5E9DA 4K2UL 4JDVB 4MJZA 3O45A 3GDTA 2OSYA 5KBNC 3V4PL 2ZZ5A 3KBSA 2V3FA 3WFEL 4FO4A 2E7MA 2O6EA 5MEPA 1EQPA 4HOMA 1WNOA 5CIPA 4D8ZA 1ECEA 1KACB 2BWIA 2QCLA 4EKJA 2UXFA 3KPRD 2VDQH 4ZUSB 1HO1A 1C5CH 1RJZA 5FJTA 4N26A 3G2GA 2WXKA 1KBBA 4U1NB 5L2KB 3EFFA 4NRZA 5KSVA 3TN0D 1ESOA 2VL5B 3GFUA 3BEWB 2FBJL 4AUJA 3OD3A 4XBGA 1AR1B 1R3LB 1UXSB 3AREC 1XBVA 4OIAA 4NY2A 1IF2A 3SR7A 3WS6C 3TO4C 2WMGA 1ECZA 5HI3D 5ITBH