5A6LA

High resolution structure of the thermostable glucuronoxylan endo-beta-1, 4-xylanase, ctxyn30a, from clostridium thermocellum with two xylobiose units bound
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
389
structure length
389
Chain Sequence
MASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTAVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
molecule keywords CARBOHYDRATE BINDING FAMILY 6
total genus 137
structure length 389
sequence length 389
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5a6lA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5a6lA02
1DTUA 2PBGA 2GVYA 3OLEA 2J74A 5HPOA 1QPKA 3WEMA 1E4LA 2A3HA 1VFUA 4HA4A 2UY5A 3BAKA 1GQKA 1W91A 2WC3A 2WVVA 3ZR6A 2DT2A 4U3AA 3AISA 3IJ8A 1HTYA 4H2CA 3DC0A 1QWUA 4XV0A 4DUVA 2JIEA 3VDAA 1EA9C 5IHRA 2GSJA 2CHOA 3MANA 1XGZA 4F8XA 4CVUA 3DDFA 4P8WA 1CXFA 1GQIA 4PTWA 1BG9A 3G6LA 1JGIA 3ZR5A 3ZT6A 1KXHA 4D6EA 3WBEA 4EK7A 2FHBA 3NIYA 1CGXA 1GHSA 2D2OA 3VU2A 2DGAA 1J0ZA 3MUZ1 4CCEA 1ZL1A 4UCFA 3KEHA 5LA2A 3SUVA 3CV5A 1IT0A 3WDRA 3ARZA 3S2CA 3F5JA 5KEZA 2J7GA 1V3LA 2ZXBA 5FKYA 4W85A 3CGTA 3DX0A 1GQLA 3GNOA 4CGTA 1MQRA 2BNJA 1J11A 1TQVA 5BWFA 1UHVA 3OBAA 1FOBA 2ZXAA 3RO8A 2J47A 2PWHA 2GJPA 4P7QA 4P7LA 4TX6A 1E73M 1KQYA 1IZKA 1W1YA 2YLLA 3DYMA 1US3A 3CMGA 5E0FA 4JCMA 2UY2A 4V27A 1GOKA 3BCFA 1W1VA 2Y4SA 5EMYA 1M04A 1SR0A 2J77A 4OBSA 1G9HA 1R47A 5FL1A 2VVSA 3MUIA 2XWEA 3CZNA 3WF2A 2A3CA 5CJ5A 1E5JA 2ZICA 3M46A 2ZUWA 2WVSA 4NSBA 3HMCA 2VX7A 3CUHA 5DT7A 4KRTA 1OINA 4FNSA 4JAWA 1BYAA 3L4YA 3AJ7A 4TUFA 1R87A 4H8VA 2WMIA 1E1EA 4OJYA 4DWSC 3GXMA 4FNQA 3L4WA 1AQ0A 4A3YA 1B90A 4F66A 2D0FA 1CDGA 1EH9A 4UQ9A 2WZHA 1NOFA 2G3IA 1LL7A 3HG5A 4AMCA 3PZOA 2YDQA 4AZCB 1OM0A 3ARUA 1M01A 4NZJA 3U7BA 4D6IA 1TR1A 1R86A 1QNSA 4X0VA 5DF0A 4PMXA 2DH3A 1TFVA 2VX5A 4ZXOA 1BYDA 3WF3A 3WL0A 4RE4A 4HZ6A 1V3KA 4Q7NA 3W82A 4MJ2A 4PMYA 4WSJA 1VAHA 3A21A 3EMCA 1CXLA 2J7HA 2YL6A 1HT6A 1LG1A 1U33A 1FFRA 1U2YA 1NWRA 5ECUA 4N0RA 1B31A 1ECEA 3WD0A 4S3JA 1JF5A 3K4AA 3VGHA 4XB3A 3MMWA 5CQ1A 2WMKA 1OCQA 3HG3A 1I1WA 2JEQA 1GUVA 4HPGA 2XJ7A 2YKKA 3EDFA 2QMKA 1YQ2A 3AHXA 1CGWA 3N17A 1E0XA 2J8GA 1LL4A 2VC9A 3RJXA 4AIOA 1BQCA 1LWHA 4E2OA 3LRLA 3I3DA 3DX4A 3L4ZA 3AMDA 3ZMRA 1HKJA 5JBDA 3K8KA 4HOXA 2DT1A 2ZXDA 3ZJ6A 1TQSA 1E6SM 4W7WA 2D3NA 3DYOA 1TQTA 2GDUA 3WENA 3MU7A 4JKMA 2XGIA 3M07A 4IISA 2D3LA 1BFNA 3GH5A 3LPGA 1BPLB 1MFUA 3VIHA 2WNWA 4HPHA 1CTNA 1NP0A 4HMEA 1R8LA 3AICA 5AC5A 1BLIA 4MAVA 1ESWA 5A8NA 2WXDM 1VEOA 3ARVA 3U5YA 2EABA 4AMWA 1E0WA 3AIQA 2WC7A 1W2PA 1GOQA 2VOTA 1W9XA 1FA2A 1OT1A 2CKRA 4LXFA 1QNQA 2NSXA 3L2MA 4ZE5A 3WNKA 4K68A 4PEEA 4BS0A 3WMCA 1WZAA 2OWCA 1CPUA 3LPFA 5AYIA 2WMJA 1Z32X 2J7EA 1GJUA 3WMBA 3WQ8A 4AZHA 4J7RA 3WY3A 3AXXA 3WEZA 1UR0A 3T2QA 1LF1A 1DWIM 4KH2A 2JE8A 1E6NA 3PN8A 3EJUA 3A3HA 5I23A 1CWYA 3WF1A 5ABEA 3SCWA 4ZE4A 4HU8A 3GBDA 1JYXA 2F7RA 3AOFA 4W8AA 2WC4A 4CCDA 2XFRA 4F9JA 2CITA 4L4PA 5A2CA 1FFQA 4WKFA 1G0CA 2VO5A 2AMGA 3RM9A 2WKGA 1E6QM 3T08A 2DSWA 1F4HA 2E9LA 2WVVB 4YHGA 4JFUA 1H3GA 1QHPA 1C7TA 3TTSA 4GZJA 5BXPA 2WHLA 2ZUSA 1HKMA 1TMQA 1PEZA 4NRSA 1V0KA 1E3XA 5M17A 1V0MA 4MNMA 3GZAA 3AS0A 3TTQA 1VEMA 1UASA 2DQXA 1NWTA 1SFSA 3RCNA 2GJXB 2AOSA 1GCYA 5A6SA 2BY1A 3NCOA 4HA1A 3W26A 1CGYA 3PTQA 3PZTA 3DHUA 1FH7A 1BHGA 3K46A 4DO6A 1OSEA 2E3ZA 2YL9A 4QAWA 3W4RA 1R7AA 4JKKA 2VRKA 4V2XA 1EDGA 1CXHA 1E71M 4KRUA 1DWJM 5CSYA 4WKAA 1QHZA 1JL8A 4EANA 2PWEA 1SMDA 1GQJA 1KGXA 1UWTA 5E0CA 3JUGA 2OW7A 3VSVA 1NM9A 1JZ3A 1ZJAA 1EOKA 1H5VA 1QOXA 1VENA 4DUXA 1QNOA 1CLVA 2CPUA 3ZT7A 4UFMA 1GHRA 4PMQA 1KTBA 2VR5A 3SURA 1JAEA 3IGUA 1C8YA 1XCXA 1M03A 4JFVA 1UZ1A 5A8MA 2XVNA 2XWDA 5GQBA 2YBUA 1GOIA 1EIBA 3N9KA 1ZS2A 2J25A 3WIJA 4QFUA 1MWOA 4YHEA 3VILA 2IXVA 2YJQA 1WNOA 3VVGA 2DIEA 3LXBA 4C7FA 3SCVA 4UOZA 3D4YA 5D8WA 4AW7A 5IFPA 2J79A 3BVVA 1OD8A 3L4TA 4PMVA 2D22A 1UH2A 3PTMA 3VGDA 2CCRA 1UKSA 3VNZA 2C0HA 5D9PA 3W27A 4ATWA 4AD3A 1VJZA 4OOZA 1HJQA 3OB8A 3WY2A 1ODZA 2DSKA 4D6JA 1JD9A 2J7DA 2ALWA 3GTNA 3KWXA 1XRVA 1QBAA 1R33A 1V3HA 3VOCA 1WKYA 1WZLA 2EO7A 4D6DA 5CPSA 2VQUA 2C8NA 1MXDA 1C91A 5CXPA 3WNMA 4M82A 4BZYA 2JALA 2G3NA 1ZU8A 1ITXA 1PX3A 1W1TA 4URIA 1GZJA 3CZLA 3DX1A 1EQPA 3UG4A 2O92A 1EO7A 3T09A 4AZIA 1OGBA 1ZBCA 3NDZA 2ZIDA 2BVTA 1WZKA 2WB5A 3GXTA 4UR9A 1C7SA 1B3WA 3RILA 4CKQA 4DM2A 4CD8A 5A6AA 2DSUA 3BAIA 1FHDA 4PTXA 3L4UA 2XYLA 1Q6EA 1CZ1A 4WK9A 4UOJA 3W38A 3EDKA 4UFJA 2EPLX 1XC6A 1J0IA 1UR2A 3LRMA 4QDMA 5I79A 4PBGA 4GPNA 4MB1A 2XSBA 3W53A 4P7RA 2WHMA 1JZ7A 2CIPA 3MMDA 2D73A 1R34A 2ZUNA 3CUFA 3D4ZA 1WE5A 1TCMA 2E4TA 3RIKA 2W61A 3MSGA 2ZUVA 2EEXA 1IZJA 5EFDA 2X0HA 1V02A 1Q6DA 3ARYA 1EDQA 2EBNA 3BAWA 3N15A 2YDSA 4AZGA 2VZVA 4CD7A 4LYPA 2ZE0A 5CLTA 1UWRA 5A1AA 2F18A 2V3DA 3ARPA 1J0KA 1XSIA 3ARTA 2EXOA 4AIEA 4PSRA 5KZ6A 4IM4A 2CESA 4FLOA 2BXZA 1HJUA 3AI0A 3NJ3A 3EYPA 1JZ5A 2Y8VA 3WD1A 1B2YA 2W62A 2WKLA 4TVUA 3SCRA 3PZMA 3DDGA 4Z2HA 4ACYA 1KQZA 4LYQA 4ZXLA 4C7GA 1GNXA 2Q8XA 2WSPA 5CLWA 2WBKA 3W6LA 2YFOA 3GBEA 3BCDA 3WFZA 1Q4NX 2UY3A 3VD4A 3FN9A 1K9DA 2ESCA 3PZVA 2CKSA 2J4GA 4V28A 3N13A 4PMRA 2OWWA 3VDHA 4U2ZA 2EAEA 1JD7A 4JFWA 1LG2A 2BXYA 3PBGA 2NT0A 1BVZA 1LWJA 1VBRA 1PJ9A 4BQ2A 1UKPA 1E3ZA 1EDTA 2B31A 3A24A 2J75A 1J0HA 3POHA 1QWNA 5BRQA 1UKOA 3DX3A 3F5LA 4U2YA 4FK9A 3BMVA 1YHTA 1EO5A 4GKLA 3WD2A 1CXEA 4PMNA 1VJSA 2D0HA 4DWSB 3WQ4A 4KMQA 1A3HA 2UY4A 2PF0A 1GW1A 3G6MA 2GFTA 2BHUA 4R27A 2WCAA 3SUTA 5I6SA 4AZ6A 4MAZA 1V0NA 1HJWA 1W3LA 4ML4A 4HU0A 2VCCA 4JCLA 4GO8A 3WQWA 4AC1X 3KL0A 4MNJA 1KFWA 1VEPA 5A8PA 1JZ4A 4JFSA 3A5VA 3H55A 3VKKA 3SIMA 4KWUA 1Q6CA 1SYTA 3B9DA 3WQVA 4Q22A 3D52A 2O9TA 3CZEA 3LX9A 2VZOA 1QI0A 5EFFA 4AD4A 5BXSA 1BG4A 1WZMA 6A3HA 4OZOA 3TOPA 2WMFA 2GJXA 1H4PA 4GI6A 2F8QA 1B3XA 1JDCA 3VDBA 5D8ZA 9CGTA 2V5DA 4AYSA 1JXJA 3MS8A 3UEQA 1FP8A 4D1IA 1DP0A 2IGTA 2XPKA 3AHZA 4WJXA 1JI1A 1PBGA 3BMWA 3CPUA 1V02E 5I24A 3CHCA 2TAAA 2A3AA 3ZIZA 2Z1KA 3O6AA 1QBBA 5DMYA 4TXEA 2GK1A 1HL8A 1B9ZA 5HBFA 3KL5A 1VFFA 2WBGA 1JXKA 3OGSA 3WUFA 1J9YA 3AFBA 4W5ZA 3GXIA 5E6ZA 3I3EA 2FE0A 4W8LA 4ZFMA 4UNIA 4D1JA 2W67A 3KLKA 4AWEA 5ABHA 4MDOA 1W3JA 3CZSA 1C92A 4W7UA 3ZQ9A 4PTMA 3DHPA 3VINA 2YIHA 4P8XA 4GIAA 2VRQA 1EXPA 3EBVA 1OD0A 1FHLA 1TVPA 1MVYA 1V08A 2W92A 1JI2A 2XFFA 1B3ZA 1JZ6A 3OLGA 4GI9A 1QI3A 1XD1A 3VSUA 3VIOA 5A95A 1BAGA 5CSUA 1ODUA 3VMNA 3CZGA 3A47A 1UG6A 3VX1A 4BQ4A 2ZOXA 1PZ2A 2F1BA 4D72A 2GK1B 1NOWA 3HZ3A 3BVUA 1ISXA 5CPQA 2D0GA 1UR1A 4PUDA 5AC4A 4JFTA 3BUPA 1JAKA 2EPNA 5I2UA 2DEPA 3RM4A 2X2HA 2F1AA 2X2IA 5M03A 1UUQA 1QI4A 2G3MA 2YA1A 4PMUA 3N04A 3ZSSA 1X6LA 2CXGA 2WSKA 1WDPA 1MW2A 2ZX7A 3MKKA 1DHKA 2V38A 2YOCA 4LGXA 3TTOA 1JYNA 1MQQA 3O9NA 4CD4A 2VZUA 2EACA 3CHFA 5AYBA 5GPRA 3CUIA 3EDJA 1DWHM 3WY1A 3BLPX 1RP8A 5A94A 3N1AA 1H49A 1W1PA 5A3HA 1XSKA 4WSKA 4P7NA 4EE9A 1UH3A 3QR3A 2JEPA 4UFHA 3I3BA 4B15A 7TAAA 3AIEA 5I77A 4MNKA 1NH6A 5BCAA 5JIPA 2DH2A 1GVIA 2J7CA 1NARA 5C71A 3BAXA 4P8UA 2VQTA 1D3CA 1SZNA 1KGWA 1GVYA 2QLYA 1UA7A 2BY0A 4DM1A 4RE2A 2ZUUA 2XIBA 2OSYA 1JYWA 4M8UA 1LQ0A 2BY3A 2W63A 3F4VA 3WDQA 3GH7A 1X1NA 1TA3A 3W6MA 1AQMA 1L0PA 4GXPA 1JFXA 2WVTA 1KXVA 1QHOA 2XTKA 3MV11 8CGTA 4FF5A 4NX0A 2BHYA 3FHQA 3WH6A 5HOSA 3EJQA 2EPKX 4M29A 5BRPA 1E5NA 3GH4A 2YL5A 4EAMA 3T0AA 1UH4A 3PTKA 1OGGA 3WDJA 3H53A 1TE1A 1UZ4A 1VB9A 3PZQA 1J01A 3VMOA 3VIPA 4WKHA 2DT0A 5A8QA 1JFHA 4OGZA 1GORA 2WAGA 2ZX9A 3AIBA 2J8FA 3BAYA 2JIWA 4GQQA 3AIUA 1UR9A 1ISWA 4QLJA 2A3BA 1UD3A 4D6GA 1HWWA 3VUPA 3AXHA 3SCUA 2G8ZA 3BUBA 4W5UA 4B3KA 3BH4A 4AISA 3ARWA 1I75A 4PRWA 1BF2A 1UWUA 4BF7A 4GZIA 2XVLA 2J7BA 2ZWYA 4U5IA 3ALFA 2Y24A 1US2A 4PCSA 4A4AA 1UR4A 3BVXA 4FLQA 1CXKA 1MFVA 2JFEX 4AD5A 1KCKA 5D4YA 4AIUA 4D6CA 4PMOA 4H41A 3CIVA 3W29A 1KWGA 2UWFA 3AZSA 5AY7A 3RDKA 1VIWA 5HDRA 3KL3A 3NYDA 1HJSA 3PZNA 4TTUA 2PI6A 2VCAA 1WAWA 1JNDA 3NDYA 1TZ7A 5F7UA 2JF6A 2XVGA 4XUYA 3OG2A 4AZ5A 1KR0A 2V3FA 2BHZA 2W66A 4Z2JA 1HIZA 1O7AA 2FH8A 3VSTA 2OYKA 1B3YA 1FH8A 3MSDA 1VRXA 4U31A 4LYRA 1CYGA 4MDPA 1MW1A 1IV8A 3A23A 3GXDA 4XX6A 3LXAA 1KXQA 1H2JA 2BS9A 3VO0A 1K6AA 1SMAA 3ARSA 3IJ9A 1ZBWA 3BSHA 5ABGA 4XZWA 3MV01 5GNZA 2FH6A 2J62A 1J0JA 1J18A 3QOKA 4DWSA 2WW5A 1JDDA 1UKTA 3GDBA 2RGLA 4DWSD 4R5EA 4D71A 1QW9A 2F7PA 3HG2A 1UR8A 4QCFA 5M3WA 2GDVA 4E8DA 1TQWA 3L4XA 3ZJ8A 1E6XM 5GNYA 3EMZA 2VX4A 3J7HA 5M5DA 1S46A 3QGVA 4DUWA 4FMVA 4UTFA 2WYSA 3GXPA 3FY1A 4CU6A 3FW6A 4NI3A 3WH5A 3AQUA 3VD7A 3VTRA 2CETA 2ZUTA 3BSGA 3CLWA 2XG9A 1R7OA 3W37A 1RH9A 1QNPA 1CGUA 1KR1A 2J7FA 3RJYA 4UOQA 3K4DA 2QHAA 1MQPA 4MJ4A 1BYBA 1E0VA 4OUEA 3UETA 1DEDA 3UG5A 2BV9A 4HP5A 2D24A 2VVNA 1WDSA 5HPCA 1CIUA 3N18A 5A6JA 3CZ8A 2BY2A 2CERA 3WDPP 1UWQA 1R46A 3WBAA 7CGTA 2XIIA 4YPJA 4JKLA 2DIJA 2PWDA 4HOWA 1V3MA 3EJRA 1WDRA 2ZUMA 4PTVA 3KLLA 3BC9A 1AQHA 1KWKA 3BXWA 4JZ5A 3SCTA 1TVNA 4D6HA 4AD2A 3TONA 4XZBA 1C8QA 2QMJA 4Y7EA 3EJSA 1OIFA 1N82A 1M53A 3CZJA 2ZXQA 6TAAA 2V3GA 3D50A 2HVMA 3KE0A 2WK2A 4HZ7A 2QPUA 1VFOA 1E9LA 4H04A 1ZBVA 1ZB5A 1L8NA 2F61A 4FNRA 3PHAA 1PAMA 1LLOA 1Q6GA 3H54A 4FNUA 1G94A 4HZ8A 4DO4A 1DWFM 1E43A 3B8SA 3THCA 3WQ6A 4J3UA 4D6FA 4AD1A 4BQ5A 3WUEA 4CCCA 2FYVA 3B9AA 3SUSA 2E40A 1UD5A 2OW6A 4MB5A 3AXIA 5JUVA 3WSUA 1CENA 2X0YA 1XH0A 3ZJKA 1U30A 4UQAA 1KTCA 3WN6A 4B9YA 1MYRA 3ZSTA 5E70A 1CBGA 4EKJA 1V6VA 4ATLA 5TD4A 1GOOA 5FCZA 3IJ7A 1CNVA 3GNPA 3L2LA 3RM8A 3T0DA 4CN1A 4AYGA 4U33A 2X2YA 3VMPA 2RGMA 3AS2A 3VIMA 5D9MA 1CGVA 5JBEA 3EDEA 2X1IA 3UERA 2HISA 1G5AA 3S6TA 2CHNA 1C3FA 1TA3B 3CZKA 4NZFA 1HKKA 4AZ7A 3M6DA 1JF6A 3BVWA 3VM7A 4TVCA 2XN0A 1XH2A 2FDMA 3GM8A 2EPMX 3WH8A 4F79A 1UQZA 1I1XA 3LRKA 2WCSA 2JF7A 5BXTA 4UFLA 4PSPA 3MMUA 1PX8A 1ISYA 1OWQA 3VDCA 4CD6A 3LPPA 1G1YA 4FLRA 2XM1A 1K9EA 1DWGM 3QHNA 3MUAA 3O2LA 3EMQA 1H11A 3APGA 4RE3A 3VM5A 1G01A 2VX6A 3B9EA 1QI5A 3CHDA 1W9UA 1JDAA 2PWFA 1CXIA 1ISZA 1R75A 1W9BM 2OLHA 3ZJ7A 3RMEA 2O9RA 3UR7A 1VBUA 1V3IA 1J0YA 3CMJA 1UD2A 2OYMA 2XUCA 3EDDA 4AMXA 1C93A 5HNNA 1ZJBA 4OBRA 3FHAA 2EPOA 3W24A 3BLKA 1AMYA 2CBJA 2W4XA 1XV8A 5BROA 3PZ9A 1R85A 4ATDA 3SCQA 1AVAA 4BQ3A 3U7VA 3AMKA 1CGTA 1XCWA 3QOMA 4AEEA 7A3HA 2DSVA 3GYCA 2WWCA 3MI6A 3IAPA 1HVXA 1HN1A 2WWDA 2VR4A 4JL1A 2YL8A 1E15A 3SEPA 4CU8A 4JL2A 1OT2A 3POCA 2XM2A 2YFNA 4FNPA 1ITCA 3A6OA 2GUYA 4W88A 5DO8A 4Z2GA 2D23A 3AHYA 1E6ZA 1B1YA 2EADA 4CN4A 4NRRA 1F4AA 1M7XA 4BA0A 5I0DA 1HX0A 4GZEA 4M81A 4P7OA 2NT1A 5C70A 3PZGA 2VL4A 2QF8A 1JZ2A 1OGSA 2X8RA 1X6NA 1WPCA 3HU7A 1H41A 4DO5A 4QLLA 5LA1A 4JIEA 5E1QA 1MXGA 5IDIA 4NF7A 3EJTA 1E6RA 3VIFA 3OLDA 3CUJA 5BXRA 5ABFB 3F5KA 2ZX5A 1HJVA 3AS3A 4AY1A 4AXNA 5CZKA 2IXUA 2WZIA 1EHAA 1W9VA 1BVNP 2E0PA 1V6YA 3VD9A 5D9OA 5A6MA 1EHNA 1BYCA 1GJWA 5FOOA 1P6WA 2VT0A 1E72M 1UWIA 1FH9A 4W84A 3AIWA 5JIWA 2D20A 4WF7A 1BGGA 1D7FA 1UD8A 2F2HA 4IPNB 2VZSA 4B16A 2OSXA 4J3VA 3UCQA 2X2JA 3VGGA 5CPTA 1RP9A 2ZWZA 3LPOA 5IFTA 4E4PA 4PYSA 4U3CA 1XH1A 5BYWA 3A4XA 4HA3A 3WFLA 1E4NA 4AD0A 3AIRA 1E4MM 1NOUA 4J3WA 1UOKA 5A6BD 3WDHA 5DEZA 2XN2A 4WIWA 1TQUA 3W0KA 1JG9A 3BUDA 4TOQA 5ABFA 2WHKA 3HG4A 2G41A 4NXKA 3IAQA 1B30A 4NXSA 3AYRA 1PIGA 4L4OA 3ZO9A 1CECA 3SCPA 8A3HA 2VNCA 3S5YA 4LX4A 2E9MA 4QP0A 3VD3A 1O7DC 1FP9A 2EJ1A 4UQBA 3T0BA 1XD0A 3QHMA 2WPGA 2BVDA 1W3KA 3AHTA 4W87A 2FHFA 1ZBKA 4M80A 4MB3A 1OB0A 3QHOA 4ACZB 3OA5A 3BUIA 3FNDA 3WD3A 4C7DA 5E9AA 3WL1A 1DWAM 1Q6FA 3NSXA 4UFKA 3AIVA 4X0NA 4UFIA 2CYGA 4QLKA 3CBWA 5A6KA 1C90A 2G4FA 1E6PA 3LMYA 3WQ5A 3OIHA 1NP2A 1OIMA 4AEFA 1XHGA 4M56A 3SUWA 4W93A 2F7OA 3WNNA 4H8UA 2CBUA 4UZSA 1WDQA 5EBAA 4HOZA 3VNYA 1E4IA 4MNLA 3EJPA 4IPLA 3KZSA 1BGAA 3AMGA 4CU7A 1GPFA 3WMSA 1TG7A 4M24A 4A3HA 3VGEA 2CBVA 5E6YA 2XFYA 1HXJA 3GNRA 3VX0A 2VCBA 2QPSA 2YBTA 4M1RA 5GNXA 3SUUA 3UR8A 1HP4A 4OOUA 3U57A 1QW8A 3FAWA 5FD0A 3ZT5A 1H0IA 2VURA 3DYPA 2VRJA 1KB3A 4P8VA 3THDA 3HJEA 3WF0A 5A69A 4UZUA 5FIPA 4HMCA 3RPMA 3WUGA 4W7VA 4N42A 4AZBA 4YN5A 1H09A 1B0IA 3D51A 2Z1SA 3WNOA 1V03A 4CVWA 3WUBA 3SCSA 1KBKA 4X9YA 2GJRA 2BVYA 1W9PA 3ECQA 2IUZA 3TV8A 1GONA 4PN2A 2WVUA 1K9FA 3A22A 3UESA 2E9BA 3D5HA 1VF8A 1W32A 1CLXA 4B3LA 1HJXA 1LJYA 1E1FA 3CUGA 3N12A 2AAAA 3VIJA 5CG0A 3GXNA 3OGRA 1W3HA 1TUXA 1E55A 4PMDA 3SCNA 3DX2A 1CEOA 4UQEA 4NZCA 1W2VA 2QV4A 3BAJA 3VGBA 2WMGA 4ZENA 5I78A 3A4AA 2VUYA 2O9PA 6CGTA 4JHZA 2WLYA 3AYSA 1V6WA 2YDRA 3WNPA 1EQCA 4J3SA 1UWSA 4AZCA 2A3EA 2DSZA 1XYZA 1UYQA 2FGLA 3SCOA 1ISVA 1A47A 4PMZA 4J27A 3W81A 1Y7VA 2E8YA 4ACZA 5LYRA 2D1ZA 1BTCA 3OZPA 3TA9A 1UA3A 3ALGA 3ZOAA 3FAXA 1QI2A 1RD6A 2Y2WA 3BGAA 4W86A 3LXCA 4IUGA 3VD5A 3VIIA 1JIBA 1C8XA 5FL0A 1HVQA 2XSAA 1BSIA 2C7FA 3S5ZA 3IK2A 1WP6A 3W28A 2V5CA 2VZTA 1V0LA 1VFMA 4B9ZA 2OWXA 1KBBA 4GQRA 4KGJA 5E09A 4QCEA 2PWGA 1HKIA 4OKDA 3ARXA 1QVBA 4F9DA 1MW3A 5EB8A 5HXMA 3MO4A 3ARQA 2O9OA 4UQCA 3E1F1 4JHOA 2DPEA 1O6IA 2PC8A 3CO4A 1NWSA 3WDIA 3AMLA 5CGMA 3ZM8A 3DECA 5A6LA 1E40A 3WNLA 1GOWA 1V3JA 3BUQA 1HP5A 3N11A 5JBFA 2DT3A 4H7VA 1NQ6A 3TTYA 1XSJA 1T0OA 2X09A 4J28A 5IHSA 3FXYA 3AZTA 5I5RA 2WANA 3AS1A 3WEOA 4Z2KA 3VIKA 1QX1A 3UG3A 2XVKA 3WF4A 1E56A 4GINA 4J3XA 3OLIA 2FGZA 1UD6A 4MB4A 1UQYA 2PB1A 2E8ZA 4TX8A 4OIFA 5A2AA 2DDXA 1OBAA 3NSNA 3TP4A 5C8BB 3WKZA 2YLAA 1MW0A 3K8LA 2BFGA 2J78A 3OZOA 1WCGA 1PZ3A 3CH9A 4CUCA 5DFAA 5A8OA 2VJXA 2EQDA 2CNCA 1PPIA 3OGVA 2VTFA 2XN1A 1GOMA 3HN3A 3VIGA 4BCEA 3K8MA 3CTTA 1WO2A 4MPKA 1KGUA 4CD5A 4W89A 3BVTA 2W91A 3PZIA 1W9DM 4GI8A 1J10A 2VI0A 2VMFA 4MTVA 3CHEA 4KGLA 2WCGA 1HXKA 3MUY1 5DT5A 1WB0A 2CEQA 2WMHA 3AROA 2OSWA 3NUKA 4GO9A 5IXEA 4J3TA 4PUEA 3GXFA 2YA0A 1QNRA 4CN6A 2ZX8A 2WZEA 1PIFA 4FNTA 3VGFA 3WH9A 3WY4A 5LA0A 1V6UA 4U5KA 2XVPA 5I3DA 4FLSA 2FHCA 4ZEPA 2MANA 3AZRA 1E70M 4MADA 3NSMA 1LL6A 3M7SA 1KCLA 3PZUA 1J12A 5CGTA 4W8BA 2WLZA 1XYFA 2XGBA 3CC1A 5A2BA 2WM0A 1HF6A 2X05A 1EGZA 4H8HA 2Y8KA 1JNEA 1UKQA 2F7QA 4UQDA 1PS3A 1B3VA 4LPCA 3W25A 4WLCA 3AMCA 3WELA 1PX4A 4LQ1A 3T2PA 3WH7A 4RL3A 2YA2A 5A6BA 3AHVA 3D3AA 3ARRA 1HNYA 1D2KA 1JYVA 2ZX6A 4HTYA 3II1A 3K1DA 4S3KA 1H1NA 2OYLA 3U5UA 4E8CA 2XHYA 2WHJA 3IANA 3A4WA 1H0GA 2G3JA 4HMDA 1EOMA 1HL9A 3T2OA 2V3EA 2NW0A 4TTGA 1NWUA 2PBOA 1V6XA 4Z2IA 3WD4A 2W5FA 3BLBA 4TVDA 4Z2LA 1K9TA 4PCTA 3VPLA 1UD4A 2Y5EA 1RPKA 2CBIA 2WMIB 5D9NA 1JZ8A 1KXTA 3L4VA
chains in the Genus database with same CATH superfamily
2PBGA 2GBAA 4B90A 3NAAH 1Y8BA 1UVQB 2ENQA 3AGWA 3K0WA 3NSCA 4OB5H 4OLVL 1TLMA 4UOW0 3WEMA 4BH8B 5HPOA 4GP8B 2VDLL 1W1IE 4O57A 1PXGA 1VFUA 4KWWA 1A3LH 2UY5A 3LBCA 3ZR6A 4IBQA 1PFCA 5IW1A 4YTSA 4KKLD 4NCC2 2YD0A 3PG2A 3DXAD 3AISA 2EDFA 2NY3D 1NF0A 2Y1AA 3OSKA 3LUTA 5JW5A 5L4MA 4DUVA 3W9ZA 4UV7L 2IQAB 4QTIL 2H9GB 4X6FB 1W16A 3GGWB 3PGDA 3T0EA 3HA1A 5A2JH 5IHRA 4R90L 2NQZA 2ZOLA 1AHWC 1IC7H 1QFUH 2F54B 3RTQD 2X40A 1XGZA 1TQBC 4DZBB 3DIDA 3L9CA 3DNKA 1CDYA 5B7ZA 5KYXA 2X41A 5HYEA 2J27A 4NWUL 4U6YB 3VNLA 2DD8L 5GGQH 4E5XG 5LGZA 3FYIB 4F15B 1CS6A 1MZZA 2BBFA 3H7VA 3G6LA 4QRUA 3VFNA 1JGIA 4F93B 2CHZA 2Z1VA 3VI4B 2DQJL 4KUZH 5CJBA 5HNTA 1SJEB 3F65A 2Q6WA 2RDWA 3CUZA 1QLEH 3B2VL 4NRYA 3JYCA 1AHMA 4Y9NA 3QIWB 4JKWA 5IBXA 1F11B 4JFED 4JDZB 3VFVA 4NKDA 4UCFA 3U6RB 3UA3A 5D2NB 3BFQG 1WAAE 2KDGA 2W65A 3ARZA 3S2CA 3KM8A 3TT3H 5BZDB 1NAMH 4KQ3L 5A3ID 4HK6A 3UJFA 5KEZA 1IIIA 5D9SB 4AJ0A 4KQNA 1P53A 1FF5A 2AEIT 3LRHA 1Y0LB 4P5KA 3AC0A 5DCBA 5CKSA 1LL1A 4LIQL 5TK2A 3MUJA 4HCFA 1HHJB 5T33H 3ZKQD 3LBMA 2GB2A 4BWLC 2IALB 1N8FA 2Z26A 5EZPA 4V1XA 4LNVA 4PJAB 1ZKAA 3KLSA 4U3SB 3V10A 5BXSA 1FGNH 2DZPA 1H3PH 1YEFL 4FQIL 3GR8A 2IXQB 1Q7MA 3TWAA 1C16A 4CGTA 2VLLA 3UXIA 2BNJA 4DIAA 3QZMA 2J8OA 1FLRL 3BQUA 5FM8A 1H9DA 1UHVA 2XTJD 4YHYB 1FOBA 4G8EB 3OMAB 2ZXAA 3WV0A 2J47A 4YDIL 1XUZA 4WJ8A 4DKFH 3KMDA 2WOYA 3OTTA 2PC4A 3EUDA 4P7LA 4TX6A 1KQYA 1W1YA 3TIEA 1YNYA 2YJLA 4O19A 2Z1PA 1KRBC 3GJEA 3IMRA 1FNGA 3U7YH 5D2YA 1A4LA 1YN6A 3S1GA 2YRZA 2Z1BA 2OQJA 1MCWW 5E8DL 4V27A 1EFXB 4JE4B 2FL5A 1W1VA 5B22A 4RGMB 5AOZA 5M94B 4X5RA 1DXEA 3BP6B 4LRIA 1EGMA 1M04A 3QQ3A 4HALA 4WI0A 3QS2A 5D1QB 3NZ8B 4NNYB 5MEPA 2A79A 4IQLA 3EX4A 3TO2A 5A2IH 3AYTA 1U2HA 5I00A 1G9HA 1R47A 3GS4A 4KI5F 2A6IA 5C0CE 4WDUA 3MUIA 2XWEA 3RUGE 4HJEA 4XWUA 3RVUC 1D7CA 1MNSA 2ZUQB 5L7XH 3CAKA 4LAOA 3HI5L 5D30A 3TDFA 3TIMA 5DQJA 1J8HA 2DEXX 3D69A 2QT3A 4Y7MA 3GJFA 2Z2AA 3CM4A 3PPEA 4HZLB 1RCOB 2NQ9A 3QCUH 4F0MA 5E9DB 5KTLA 2P80D 4MXQD 3HMCA 3TSBA 1K5NB 2VM4A 1I7UB 2G4EA 2W0PA 3MUXA 3VI4F 2PCYA 1DBJH 1J88A 4Q2ZA 1BYAA 1E8XA 2ZUYA 3GLZA 4XO4A 2EILB 2JNZA 1QYGL 2MCG1 1KYDA 4OM0L 3NURA 1R87A 4LNYA 4TUFA 3GMPB 2WMIA 1XPGA 1JFQL 1I9RH 1G7UA 4RX4D 5CSSA 5CLZA 3WJWA 4FQQB 4DWSC 4R5XA 4H0GA 5AVRB 3LZ3A 3GXMA 5T5FH 4AITA 5IG7A 2WOQA 3TA3C 1Q8MA 4JIPA 5LNUA 1KKRA 5F1IA 5I18H 4YSDA 3ZE1E 2G60L 5AHNA 1NLBH 2FBJH 4J3OG 2A73B 5DRWA 1QLFA 1A66A 3N9GH 5D5MB 4AW4A 2CZVA 2PTWA 4F66A 4CQ9A 2EKSB 1EH9A 5IROC 4JZNA 3RR4A 5DJDA 4FADA 3HG5A 3B34A 4XN8A 3WKYA 3K72A 2J8TA 4MXWH 2YDQA 3OJGA 4LAJH 3RFRA 4L64A 3GIPA 3ARUA 1Q0XL 1M01A 4DQWA 4H9XA 4I6KA 2UUDK 3DMMC 4PJ9A 3SECA 3NAVA 3PFUA 2I9TB 1XDLA 4NZJA 2WQRA 2ORBL 4BKNA 5LCVL 2ZOLB 1QLRA 1OD7A 2YPVH 1OZUA 1AQDA 3CH8A 4U6VL 5KVFH 1H7OA 4D6IA 5DVNA 4NSKB 4EI0A 1VP5A 1RUKL 2RCSH 4HLZH 4I9XA 3VI3F 1VRSA 4JTTA 3TZVA 1FJ1A 3AWGA 4JTIA 2DBJA 2PNDA 1K8CA 4H5SB 1BD2B 2P48B 5AYTA 4PMXA 2DH3A 2DM2A 3FCBA 5GRUH 1TFVA 5DHVA 1PAZA 4WJG3 4DJEC 3IJEA 3WF3A 3WHXB 3DV4B 1MVFA 1QD0A 3LQAH 3KBMA 4HB7A 3I2CL 3UMTA 4RE4A 1TNMA 3NT0A 2NY5C 3HI1A 3ABOA 4FFYH 1P7BA 1ROCA 2H26B 3PHQB 3DG7A 1GVFA 2XUWA 4MJ2A 4S2SB 1JP5A 3VNJA 3AAZA 2CUMA 4JFEA 4NUQA 1FE8H 4NZRH 4RMQA 4CADB 1VAHA 4WDWA 3WHE1 1HAUA 4KDWA 5DDHB 3ZO0A 4YLCA 3EMCA 4N6EA 1D6EA 3S1XA 3LKOB 2XG5B 1U33A 1FFRA 5CZRA 5K93A 1LG1A 1IR1A 3UXFA 3PPFA 2YZ1A 3KWWB 4Q4MA 4BWUA 4TV3A 6REQB 2X88A 1YCSA 3K6OA 3QI9B 3F4NA 3E3QC 2NW0A 4LAQL 2AEQH 2YD4A 2WQWA 3FT3A 3K4AA 3LGDA 1RZIA 1S5VA 4X2PA 5F8RC 3F7JA 5LQBL 4GRMA 1OCQA 3BOFA 3HG3A 3CHOA 1AJZA 4CQCA 4XKMA 4FXKC 2F58H 5HYIA 1RJZA 1KCSH 4JFDA 3TMLA 2QQKL 3ECWA 4LTSA 2XJ7A 4TM9A 5I82A 2DVUA 3HJZA 3FOKA 1I3UA 2YKKA 3TNNA 3EDFA 2V5JA 3SW6A 2FVLA 3EYQC 4WU7A 3R06A 4QJ4B 5HUOA 2B2XH 2OMVA 4Z3TA 1QLRB 2VDLH 1Q45A 2ZCHL 3F58L 1E0XA 2YXMA 4G6KH 2J8GA 2PEVA 2DZTA 1T1YB 2VC9A 3N17A 5C0RL 4E2OA 5DMKA 3ZDXE 3ZMRA 2A1WL 2BLEA 5JBDA 3P4NA 5GRYA 3BQVA 3O0FA 3JWDH 5ANME 4P46D 4B9JA 3F03K 2H47C 3QDMD 5I8EA 1TQSA 4QOKD 5IJKC 3KPNB 3JTTB 1XCFA 4P57B 1CIDA 1CD8A 3I6GB 4W7WA 4WQOA 4BFEA 5HMFA 2NLJB 4IKLA 5BZAA 2VN6A 3DYOA 1KBGL 1NZRA 3B3IB 1FSKB 4KKAC 4BSWB 2GDUA 1RL1A 3FFOA 3DSNA 2GVGA 3NSYA 3WENA 3OPSA 5JXQA 3CDGA 2W95A 4QY8A 5F0MB 4KKPA 3JWOC 5BOPA 4GG8B 1S8DA 1MCPL 5T1KB 2BDNH 2DOCA 2ATPB 2BRQA 1WCBB 5LAXB 5HYJE 3HBQA 3MRJA 3M1OA 4V2CB 1O7VA 3LPGA 1XR8B 2B7PA 3NABL 4WEBL 1FLTX 4QXTA 5B1BB 2PDBA 3P8IA 4BD4A 4X6EA 1ML0A 2QSVA 4FI8A 3LPWA 2N0KA 5FOBA 4QRQA 2V37A 4GUHA 4XNAA 4Z7NB 5EU7E 4Q8BA 1ESWA 3QDJD 4PJ5A 5CEXA 1QPNA 3MCYA 1POJA 1TIMA 5CIPH 2CLIA 2WXDM 2AQSA 5A8NA 3ARVA 5EOQL 1G7HB 3U5YA 2EABA 2KBGA 3DFTA 4DI8A 2CKBL 4OZHF 4PB0H 3NG3A 1IM3D 2Y8KA 1S7RB 3VWJD 5JNYB 5A3IC 2DV0A 1T89C 4I3RH 4M1CD 5CR8A 5C2XA 1VHPA 4AWSA 3AU6A 1W2PA 2VOTA 1Q66A 1KLUB 1A14H 1H61A 4DVRH 5KVGE 2FATH 4OR1A 3SGEI 1ACYH 3CSFA 5I0YA 3LOWA 4JTFA 4H44C 1GZPA 1OE2A 1QW7A 3LHPL 3TC7A 1RUKH 1R5YA 1NGWB 3OODA 3ZWTA 3WNKA 2ABBA 1WFOA 4WIQA 4S1SL 4UTBL 2BSSB 4BS0A 2H8ZA 2NXYB 2BCKA 3SYCA 2AABL 2FDBP 3Q44A 2DS4A 4M8RA 5HJ3B 1BJ8A 1YHPA 4Q8PA 1CPUA 2B59A 1Z32X 2E56A 3K3QA 3PWJB 2J7EA 3IEBA 5JW5B 3LN9A 4YXGA 4OLUL 1PF3A 3KYAA 2A38A 5EO0B 3WMBA 3WQ8A 3FKRA 3OAUH 2Q8ZA 2YPKA 1IR2A 3M43A 4URTB 5I1LB 1EEXA 3E2HB 5AB3A 3SFKA 4E9VA 2R2HA 2DI7A 1XGTB 1MI5A 3FT2A 4KK6C 2JCCA 5FAJA 4FQXC 2CDEA 2WZPD 4DHLA 4HJIA 5I23A 4ODVL 4GABA 4PRDB 4PTTB 2A7PA 4OI7A 3BP5B 2PWVA 4IPPA 3JVAA 3SGGA 1AD4A 3QAQA 4XPBL 5D7IB 3U48A 3UJTL 4LCYB 3EBHA 3GBDA 4O51B 5HHOD 4IOSD 4HU8A 4K39A 1NEZA 4XBMA 1YPZA 4DGYH 1UXLA 4DTGH 5LKYA 4DVBB 4Q8TA 2A0LC 3HR5B 4NO2A 5I1DA 5DMNA 2GQ3A 4CCDA 2XFRA 4URKA 4OGAD 4F9JA 1IAII 2KS0A 1KTDB 1AZUA 4KZ0A 2P0IA 2PPDA 1JF1A 2CGRL 3WD5L 4Z7WB 1J96A 1UP3A 1S7XA 3THAA 1SM3H 1G0CA 5E6IC 2IPUG 4AC7C 4LPWA 1J5DA 2VO5A 4HIEA 5T9BG 1S1RA 3C75A 4DO7A 2GT9B 3V4PA 4C6BA 5D71L 4WW1A 5E6RB 4J35A 4WNQB 2DSWA 3MP3A 5DHMC 2FWOA 4R3SB 2QT6A 4PU2A 4LVGA 4MJZA 2OZ8A 2E9LA 4B97A 4IQEA 2MQCA 1J1PH 2LU5A 4QLKA 3QIBA 4L37A 4OLEA 1H3GA 4O58H 4XPAL 1QHPA 3L16A 4S0HA 3OA3A 3E9UA 1Q85A 4TQTA 3FOMB 4MDJB 1M2VA 1RLWA 2QGDA 3PTDA 5BXPA 3PL6C 3QA3A 1EJVC 5JPMA 2WHLA 4HZMA 2LTQC 4KKQA 5DJ8A 3URNA 4N8VA 1P2CA 4D8OA 5FFGA 2PF8A 4NC1C 1OTTC 1V0KA 1E3XA 2VDPH 3LIZA 3NFPA 1AGDA 3BKML 4GW4A 4PJIE 2BDQA 3OX8B 3EH4B 2PTZA 1BRLB 4N68A 4UDTB 5IB3B 4FHKA 2YCEA 3IDXL 3FMGH 2VEFA 5AVWB 3R94A 4GMTL 1GZQA 3BW2A 4ZX5A 4L5FE 4MWFB 4H0IA 5F7FA 4YXLH 2X4NB 1RSCA 3DHUA 2JI3A 4KKCD 4A3UA 2Y3AA 4PV8B 1BHGA 3S37X 3K46A 3UXAA 1XINA 3MA7A 4L05A 3S5NA 1G7PB 4IBYA 2R1KA 2P5WE 2Q76B 5CJ8A 4JKKA 3GMLA 5T33L 2WXOA 1I3RB 2VRKA 5GSVA 4V2XA 2V81A 3MRBA 5FKPA 5EIIA 1P1ZA 5CSYA 5BNKA 1QHZA 3TJXA 3RTLA 5D96C 2ADGB 4F8QA 2ZCZA 4FFZH 3G5XB 3DIFA 2WCPA 5T1KD 2JCCF 5FO8B 1G9MH 2YCLA 4MPQA 5FJOA 2CM6A 4ECLA 1PZCA 1DYSA 4B5ZA 4JZOB 3QG6A 4KTDL 5HYSA 3ORWA 1EDYA 1SFLA 1NM9A 5AVTB 4UINH 5GS3A 4AK2A 3B9NA 4NN6C 2XH7A 5D4HA 4XCNA 1Q65A 5D7JD 1CLVA 4OKVB 1MCOL 2NX5E 2Z7KA 5MHSE 3KTCA 4XNUH 4UFMA 2NY3B 1GHRA 1D9KC 4HC1A 2QJDA 3UTTB 1XF4A 3NOYA 1MN4A 3QDJB 3FPXA 2EXWC 2X4UA 4FS0A 4NUJA 4WFFE 1F5ZA 4XD3A 3PE9A 5DUMH 2XC8A 5DJ0B 3CSYB 3OZ9H 4PUMA 1GS6X 4HXAH 5IB2A 3DX5A 3OQEA 1MUMA 3HNSH 1WWCA 1UC6A 2R0LL 3FUDA 3OGOE 3FB7A 4HZAA 4JFVA 4WTWA 3ELQA 3EGDA 4B9GA 1OFAA 5GQBA 1Z41A 2YBUA 5HNUA 1TTGA 3MP5A 5HJ3A 2YOAA 3B9KA 2ZPKH 4AC4A 2X87A 1S7TB 1TVLA 2PTXA 3N9KA 1IEHA 2CO4A 3BE7A 5ITFA 3WIJA 2ZZ3A 1TTRA 5FA3A 4HUVA 1MWOA 5DR5H 1J8VA 4YHEA 1YMMB 3R12A 4Q3MA 3LXBA 1CB4A 1MFCH 1BZ7B 4H1LB 1DORA 4J8QA 3D4YA 3QPXH 3QRFM 2V0TA 4QCIB 1AH0A 3ERPA 3HLAA 4A6YB 5IFPA 4UIMA 1ZHNA 4JFZH 3L23A 3A4JA 4DPQA 3OJVC 3N44B 2ZCKL 3KVQA 3O3DA 4MSSA 1OD8A 2J88A 3R25A 1F05A 5CIPA 4CILA 5A6IA 5IWLA 3GHRA 1PLGL 3STPA 4F3HA 1XIJA 6FABH 5CKAA 3PV6B 5EMKA 2I9LB 5GJPA 5KVMC 4GKNA 5LWYL 2OAAA 4KKXA 1XR9B 2WXLA 4H1LH 2D22A 3DUGA 2OO0A 2ALRA 3QFDA 2ARJQ 3V0FA 3W5MA 2A9CA 25C8H 1J5SA 1Q9WA 2NY5L 2LQRA 1FL5A 1PGRB 3G6DH 5K59F 2DSKA 4CSZA 3ZYIA 1RZKL 1XRVA 1FNAA 3KWXA 3LH2L 2DZSA 4PV9B 2DY2A 2RHGA 5F89A 2LVEA 1W0VA 4FXLA 5I1LA 3R43A 1UROA 3FA5A 3DX8B 1V3HA 2YN5A 3VOCA 4LHUD 2W8CA 3W1RA 5B1KA 3UWWA 4IHCA 2GG1A 1HK6A 3TNMB 2C8NA 5F7LB 3QULA 3Q8FA 2V4LA 4P0DA 1MQKL 3T0XA 4LOCA 2DM3A 4O02L 1N8OE 2J6EA 1C91A 1KJ2L 5AZ2H 1LP6A 4NKQB 4HC1H 4U1SB 4BZYA 1S7VB 1JUKA 4JQIA 4HCLA 2GWGA 1DJNA 1P6FA 1FVCA 1G4MA 2G5BB 2F58L 4LGSB 3V5KB 1LQ2A 1PX3A 2DMCA 3MRIB 4AX3A 4X60A 4GX8A 4MZ3A 3MV8D 5CJOL 1A7QH 4UAHA 1M6JA 1W6WA 2HFTA 4MY9A 3N29A 3VCCA 3CZLA 3SE6A 1VFSA 2VXVL 5KANG 4V1DE 4KCUA 3T09A 4J1OA 2HLFC 4AZIA 1MZRA 1QZNA 1J1XL 2DWTA 1KCRH 2O72A 4YXKL 3RB5A 1CBJA 3ONBA 3M0VA 5B7MA 3Q1SL 1XF5B 2QJNA 1ULVA 1E8YA 2BVTA 3OHXC 1WZKA 2E6PA 2GJJA 1NGZB 1BM3H 5FSEC 1Q7ZA 4PP2A 5CJXA 1USZA 2JSFA 1AJ7H 4O2FA 1K3IA 1E90A 2IFGA 4S1QL 1KOAA 3MV9E 3FO0H 2H6PB 4NQVA 4NUGH 4C56E 1N2RA 3ZFHA 2J12B 4AMAA 4OLYL 2DSUA 1TZ8A 1RULH 3NMEA 3PP4L 4G1MB 2PYFA 4AVHA 1HINH 1Z69A 4HK7A 5JO5A 5TJWK 1ZMYA 5IGXH 2V2HA 1N59B 3F7KA 3PWLA 4JEGB 4PGCB 2RJGA 3W38A 1OAXH 5EEVA 4S3FA 1JGUH 1RZIB 3ESUF 4M03A 3UYRL 1UR2A 5DT7A 3AUJA 1VBJA 5EC1B 3HZVB 4JRXE 5DFWH 4MB1A 3IMBA 4M4RB 3OXSB 4P7RA 4F0RA 3NSDA 4YHML 1G67A 1T3FB 2EH8L 3C6LA 5DJ0A 1JZ7A 4ZTPL 1U91B 3TV3H 1RURH 1JCMP 2BX7A 3CUFA 5CN3A 2ZUNA 3MMDA 5C9ZA 2XG4B 3FU6A 2ZBTA 2J6EH 1CU4H 1T1XA 5EU5A 1OB1B 4X50A 5EC2B 3RIKA 2W94A 1QSED 3UIYA 1DUZB 3URBA 5IOKA 3G5YB 4EO5A 5JHDE 3GSUB 4M1GL 1V02A 3FB5A 1N70A 1T1YA 1W15A 2GTZA 3HBZA 4Y4HC 4ZT1A 1DXFA 2QJMA 3VC5A 2JXMB 4LESA 5IJDC 2NUWA 2G96A 1IKOP 2PO6B 3U46A 1IC0A 2VZVA 2B9BA 1FWCC 4OFDA 4LYPA 2ZE0A 3T0CA 1UWRA 3DGGB 5I0XA 1NGWA 1JZJA 5BS0D 4H5SA 1J0KA 2BNUB 4HKBA 3X1BA 1KEMH 3ARTA 2EXOA 1I3RA 4QITA 3Q8EA 4PSRA 2HTKC 1E9IA 2X4TA 2HG0A 4BHUI 1AE6L 3H1ZA 2PRMA 2JJSA 1XIHA 1HJUA 4P5RA 2R1NA 4MA1B 1HESA 3E9TA 2V68A 1U83A 1PEWA 4XPFH 4TVUA 4RJEA 4LRIC 2DQIH 1JWSB 4XP1L 5SWSB 4QD2E 5DD0H 3ULAB 4Z2HA 4KHXH 2MOVA 5CZXD 4C58B 1TIWA 2HSAA 4RWYH 1ZV5A 5FF6B 2ARWA 2ED7A 3GRWL 4DOHE 1GNXA 2AJUL 4QKTA 4KJQD 1H63A 3G1SA 2NVCA 3N1QC 2WSPA 3GJFK 5LBGA 5JW3H 1DHPA 4YDLB 1F3JA 4HUWA 4MQXD 5D7HA 4M62H 2Z1XA 4ADIA 3H26A 3P4OA 4PIRF 4NJAL 3RVVC 3V5CA 4DQOH 2NY7L 3GBEA 3D30A 3GBLA 2V7HA 4TQPA 2J1KA 1AY1H 2OMNA 3GU1A 1PU0A 1CTMA 2DPKA 3TESA 2YW3A 3VD4A 1CL7H 4ZSOE 2FX9H 2CKSA 4R9XA 5FYKD 2INEA 4V28A 1C5CL 4U4MA 3THMH 1K4DA 1M5WA 2Z00A 4E2BA 2OCCB 1XH3B 4PGBB 5D1XB 5EEXA 5T5FL 3QLLA 1LG2A 4JFWA 1EZSA 5KS9E 3D6NA 4DKDC 4F9LA 4MNQE 1U1HA 3MRCB 4P4KC 2NT0A 4Z3IA 4YFEA 2XWBB 4X4XB 1G1OA 2R8WA 2VUNA 3K13A 4A7TA 2MPVA 43CAB 2V2WB 3FK3A 3OR7A 4FEIA 3J2PA 1K7FA 1NEZG 4BEIA 1U3ZA 1W8EA 4TXVB 4ZFQA 4XOAA 1VBRA 1BQGA 3G1AA 2ARJB 4E9XA 3UFYA 3DI1A 3FULA 3GSXA 4FOMA 2B31A 4XZUA 3PSWA 1TO5A 1I8MB 3DGDA 4HIPA 5DD6B 4OIIH 3HPXA 3T81A 2ISDA 1GWJA 4RNJA 4A7SA 2J75A 2HKFH 1NANI 3ZZQA 3B2XA 5BRQA 1GGBL 4M93B 1AE6H 1AP2B 1JPHA 4P2VA 5G4HC 1N64H 5DT1H 3IVTA 4FALA 1QUPA 4ELME 5FPIA 3PWPA 3D07A 1PVNA 2QCNA 4YSCA 4NO5A 4U2YA 3P30H 3DVNB 3TZVD 5L2KB 1J5HA 2Z25A 5AWNH 3F7RA 2AQRA 4L1WA 4Y16C 3BQ6A 1EHKB 4JRYB 2YHGA 3HHSB 5LVEA 3BCJA 4G1MA 1T5XB 3WQ4A 3DK2A 2ZOOA 3QFJE 1DJHA 2BP8B 5D93C 3G6MA 3AWEA 1R6WA 1R0AL 3ITXA 2WUBH 1RU9H 2R1XA 5L8LB 2IWFA 1OAZL 1A4KB 1R3LA 4NSKA 2BHUA 3HUJA 3RIFK 1DANU 4PVNA 4ZUSB 1SZFA 3ULVD 1X5JA 5I6SA 2HH0L 2A21A 4IIEA 2PMZA 1SZRA 3O2VH 1IFHL 1TPWA 2F8OA 3A64A 1V0NA 1W3NA 4I2XB 1ZOXA 5FYJH 3TO4A 1FWSA 1HJWA 2VDGA 1ZPTA 2P5ED 2RQEA 4H88H 4LPYA 5I71B 2Z92A 3IFOA 3JW7A 4PJ8B 1CE6B 1E2ZA 4WZ9A 1TJGL 1KRAC 1T7WA 1BG1A 4HX1A 3KL0A 3L9YA 3N0AA 3Q1EA 1TV4A 1IBBA 3IEAA 2HTMA 2JB5H 1LDPH 2ZZ4A 2XFXA 4XNYL 4M6NL 2YYUA 5C0FB 1ORSB 2VIRB 3EYVB 1BXCA 3O2VL 3N43B 1TO3A 3U7WL 2Y7OA 4A2LA 4KWUA 3SIMA 2X9ZA 1BFOB 3D52A 2VZOA 3CZEA 1Z3NA 2QKFA 3L0NA 1BG4A 4U1KB 1FWDC 4BV1A 1CLCA 4TQHA 3QJUB 4OZOA 5GZOD 2VR2A 2X3AA 4PGEB 3L2NA 1ETZA 4P5MA 2CKBH 4PB0L 2D69A 2GJXA 2WMFA 4A7QA 3QR1A 1TUPA 2PCPA 4HIHA 5DJCB 4YBQC 3RWCB 1H4PA 5ISZD 2C79A 3UTSA 2F8QA 3JV6A 4EOWL 4S1DC 4JEJA 1CK0L 8XIMA 1B3XA 1F7BA 2Z28A 4JK0D 4YSPA 5D8ZA 2G9HB 1MVUA 1OJXA 5EU6A 3ITCA 4M7LL 4OF0A 4HF5L 1AA1B 3MS8A 3MRFB 3O07A 1UA6H 4GLRI 3V7AG 2DQTL 1NINA 4L8SC 4IUOA 2VERA 2ZZUT 4L1BA 1NGQH 5HQMA 4D1IA 3VRIA 3IGSA 1I1AB 1LMKA 3EJJX 3QUMB 4UBPC 3KJ4C 4GNKB 3MYJB 2XPKA 3VOGA 5F93C 1JI1A 4X6DF 5EZLA 2VDOH 1PHWA 3UJRA 2CHWA 2W0KA 5FYLL 1Q0EA 3T65A 2CA3A 1GVEA 5C0AB 2HPMA 3ZIZA 3FZUD 1MCDA 2F9BT 2Y1VA 4RGNC 2QQLH 4UTHA 2LU3A 1IQWL 2O4QA 3QH3B 3PV7A 4X5WB 1KY6A 3CSBA 3GMQA 4JX0A 4AVJA 5KSAA 4DI9A 1KYFA 2XPGB 1Q8AA 4EZLA 2UZXA 3W00A 3EPMA 3M0KA 2GK1A 1MCJA 3STLB 1KM6A 2QPXA 4JY9A 5HBFA 4Q56A 1SYVA 1SDDB 3KL5A 3KXQA 5E2UL 2WBGA 2VDKL 3QZWB 5BUGA 2ICWI 3HPJA 2P8CA 4NNAA 1LO5A 2APTA 2ANUA 3T4YA 3WFCH 2ICES 5IBTH 2NY1D 3OJDA 5EMJA 3GJFH 1NWOA 4IGBB 3PXHA 1UFUA 1XGRA 3HKFA 3ARDA 2V17H 1H15B 3O6MH 4KJPC 3ZKSD 3FOLB 1FO0L 4PW4A 2W67A 1ZAGA 4O1BA 1FWRA 1XYLA 3EO0B 4K23H 4A67A 4MDOA 4LVOC 1G4EA 2DJUA 5JYLA 2GCYB 5DUJA 4HJWA 4IL2A 5J0BA 3WJMA 4IEFA 1ZLPA 3H12A 2P42B 3PNZA 3DHPA 2AJUH 3VINA 1MH5A 2YIHA 4WWKA 4WY7L 4GIAA 3COOA 3ENEA 3MRDA 5EMLA 1XIIA 3IJSB 3EBVA 1I8KA 3L3HA 3QEUB 1TVPA 4FG4A 3CXFA 1Q5MA 1XIEA 3MSYA 1OM3L 1DJXA 1TCDA 5ID1A 4MMZC 4AUJA 2EXWD 4JO1H 1G7QA 2FVNA 2DJMA 4DP1X 4K36A 2BSRA 3B43A 4MNHA 5D70L 1AKJD 1OD9A 4TPRH 1I0DA 4PJXA 2WJ7A 1MCFA 3NTCL 5EORH 3V6ZA 1VHCA 1K77A 5T1LB 1HHIB 1WC7A 1JZ6A 3KW3A 3VIOA 5CSUA 1BAGA 3TZVB 5I8KH 5L2KD 3CZGA 1Y0LA 5T3ZD 4RWHA 2EG8A 1UG6A 3A4DA 4BDVA 3K1GA 4BQ4A 1T21B 1A21A 4A2FA 4F3FB 2RDXA 3STZB 1EVTC 2P50A 2QJGA 1UBPC 2WP3T 1PZUB 1L6PA 1PD0A 1U8QA 2APWA 5E2JA 1XH3A 5GJSL 4N90D 4GUOA 5CBIA 4OGYH 4KKLC 2CM5A 3WMLA 3II3A 1R24A 3QCVL 1NOWA 2GK1B 4JDBA 2BVQA 4DHGA 5HPMB 1ISXA 3PJXA 1Z6KA 1QSEE 1TYGA 3CV1A 1T2XA 3DHDA 5I1IL 4IJTA 2Q86B 4MGXA 1ROWA 4XXWA 4JFTA 3TW7A 1H3UA 5BOOA 5ACMA 4LBRA 1ZZMA 3CFIC 3MO1B 3AYVA 3G04A 3O6DA 5E7FA 3QORC 5CLYA 3O9WD 3RM4A 2YKLH 4RCXA 4OZGA 1X5YA 2WM1A 3QDGD 4YNYA 1OP9A 4BQ9A 4PJ8D 1U8CA 1ASOA 3R5EA 1JK8B 4IIBA 4JY4A 5DO2D 2G3MA 2Y0FA 3BJLA 3WX7A 2WSKA 3PUUA 3DRTB 3PV6A 3MKKA 1DHKA 3UBXB 1OQXA 3VRLE 4EI5A 4YUEH 1GZ1A 2V38A 4DELA 2OL3A 5M95B 5CGYC 5LNEA 5FFLA 4DJDA 3MBWB 5DTFB 2EE6A 1AS8A 3B3BA 4JKPH 4DTGL 1MQQA 3U6WA 4CD4A 4A6YA 1AJ7L 5FYKL 4N0CC 5B38G 3JXAA 5I6KA 1TWDA 4FQ2L 3KJ6H 4P2OC 4G1KA 4QX4A 4R2GD 3GTXA 3US9A 3Q2VA 4P2RA 5DI8A 1X1ZA 2VDNL 3PWVA 3VGAB 1NGYA 3IMSA 4ICXA 3N1AA 3CXHJ 5FYLH 5FHAH 3D46A 4X9GA 2EXSA 2GGGA 4Z1BA 5C6WH 2CKBB 1A5BA 2Z2BA 2X4QB 1A0QL 1JV2B 1UH3A 2OTUA 2NYYD 3MCG1 4NNXB 4X7SL 4C55A 5M1TA 5D7LB 3QUXA 4UFHA 1YE4A 1J9SA 3O45A 3TC6A 4E3TA 4XPAH 1I45A 3AIEA 2WLNA 1CE6A 3OKNA 4L2LA 1KIQB 5HJDA 4MNKA 3QFEA 2XTJC 3LD5A 3CH0A 4YN3A 5BCAA 2NY4C 4GRLC 2J7CA 4A1RA 3HQ1A 3BE1H 4P8UA 2XETA 1AIFB 1QLFB 2EDRA 2YPVA 5KYUB 1TVBA 5DVKA 4HHMA 5J6HA 3GX9A 4WO4B 4P2YA 2E77A 4RNFA 3GTFA 3QUMH 1S38A 3C2OA 1TETH 2HX8A 3CFMA 4GSDL 5DYOA 4DP0X 3TA4D 2OSYA 4IIQC 4XN7A 5GGVY 4DF9A 1LQ0A 1ZA6B 3F4VA 2R2BA 3APTA 3U9UA 3WE6A 1IE5A 2JGYA 2HT4D 2E5DA 3ULSB 1FO0A 2NXZD 3OMNB 2XN9E 2LFEA 4YIQA 1EYEA 3O9WC 2B5IB 3SE8H 3U2ZA 3LSBA 4BFJA 4PJ8C 1Q72L 1KJ3H 3F83A 1IAMA 1OAUH 1MRFL 1Y6KR 3OMZA 3ZPDA 1DJQA 5AAWC 4U1MA 1I7RB 4PJ5E 1K8IB 4HSCX 4JO3L 2BHYA 4N0YH 3Q2WA 3KZ8A 2Y88A 1BVLB 1UFGA 3CFDA 2HZHA 2EPKX 1NPJA 4DWHA 1LO4L 4R4FL 5BRPA 4PRTA 1I2PA 4GX9A 4FTVA 4ODWB 4RZ6A 3GH4A 2QUVA 2WWKO 4GUJA 1DQLL 1WAUA 4LLWB 2CXKA 1NAL1 4XCEB 35C8H 2LLEA 1RK0B 1E4WH 1UH4A 4CVZB 5TF1H 3PTKA 3MGAA 1CU4L 4Q6YA 2VDMB 3NJHA 4S3AA 5F2MA 3PWIA 4FB7A 1JPSL 2CJSA 1TE1A 2HDJA 2CRMA 3ARGD 3LV3A 4JM2C 4O1DA 4FJYA 2CUIA 1L9PA 1VIZA 4YMZA 2OP4L 2WV3A 5IWLC 3RYSA 1F97A 3OAYH 3H2MA 2V5YA 3G6JE 1JNNH 2Z7WA 2GEQA 3LEXB 1X5AA 4J2QA 5IMOB 1GORA 2I69A 3GMMA 3KOWA 1QABA 3Q13A 4NY2A 3PL6A 4L6OA 3AIBA 5CZVH 3BAYA 3IJSA 2CGYA 5EUKA 2O6CA 4HK3N 3SOBL 4GQQA 1WYIA 1UR9A 1NMAL 1I3GH 4GXUN 3TR2A 2GY7B 3QT2A 4HKJB 1I9IL 2DQCH 12E8L 3NCJL 5J13C 1YE6A 2IW0A 1WCQA 2IALA 3MROB 1QK2A 2MRYA 1QT1A 4IX2A 5C3IA 1OAZH 2N1TE 2ILLA 4JFXA 1M3IA 1KPVA 5F9OH 1EAQA 5BOJA 2G8ZA 4FQXD 4KFZC 2DJ4A 4YS4A 2Y7MA 4MA7L 5BS0B 4HNTA 2Z4QA 3HR6A 4MM1A 3RP1A 5GZNC 4AISA 4CA4A 4HISA 1RY8A 3RK8A 4BF7A 3P2VA 4GZIA 5FK9A 2XVLA 3JV4B 3AY4A 4N9CA 4XZHA 1BKHA 1R3JA 1Z1WA 4LBUA 4PRDA 4UIOA 3C3UA 4A4AA 4UM9A 4WW1B 4ZUUA 4W9EC 2PSNA 2A1YA 1CGSL 4FLQA 2P3YA 1YNKH 1BQSA 3RFZC 5CFAA 1UMLA 3HE7B 2EDQA 3G1YA 3R6IA 1NKOA 1JRHH 1MFVA 2NW2A 5B7EA 3OC5A 1ZLSH 3WN5A 2UXFA 1GPWA 4ML9A 4PMOA 4H41A 4QNWA 4WHTA 3CYVA 3KPRE 5FHAL 2UWFA 3AZSA 1UENA 4M6VA 4KZCA 1DQMH 4F7PA 3L45A 3NCYS 4Z1PA 3DEQA 4R5TA 5IBUG 1WWBX 3GO1H 3RA7H 3RZCB 5CFHA 3NTYA 1TTPA 5LXGH 3QR0A 3QXAA 2PI6A 2XX0A 4PJXF 4YBHA 3P1VA 4H8WL 3TO4D 4L61A 2DICA 3JR2A 4LP8A 2E7BA 2YQ2A 4PB3A 1RK1A 3K6NA 4M61A 1NDMA 2XVGA 3CNKA 4G8AC 5D2LF 2DVXA 4CQBA 1TU2B 3FFCA 1IVTA 2XZZA 3ARFB 1YTDA 2BSDA 2W88A 3OG2A 4AZ5A 2JH2A 1DCLA 1NC4D 1KR0A 3EPNA 4Z2JA 1M2VB 1I3VA 4HPJA 4X5XA 3VNIA 2I17A 1OANA 4ZUTB 1OCBA 4K3HA 4K8RL 3NIFE 3HS0C 1ETB1 4FI7A 4KWVA 4NC1E 5E4OA 2AC0A 4HGWA 3FRUA 5ICYA 4ZFFB 2LGNA 1BQHB 4K5NA 1ZAIA 1XRSA 2B14A 4LAQH 1RCYA 4L4TB 4MDPA 1RPXA 1AW5A 4WWID 3ML9A 3A23A 4DKEL 3BZEA 2AQNA 2I5QA 1MIMH 2DQGL 2CUHA 1FUNA 4OV5A 1XQ4A 4HU2A 3KHDA 1V93A 3LHTA 1KXQA 5CPMA 5I17A 2BS9A 3VO0A 1X38A 1SMAA 1FWHC 1JR1A 2FTPA 2X4NA 4QNPF 1R3JB 3V0VB 3WN5C 2OZ0A 4XN1A 3GSQB 3RX9A 1HH9B 3C08H 3BSHA 4CC4A 4L56A 1J9QA 4PV8A 1OXYA 3MV01 4I0KA 2C9RA 1ZTXL 2FH6A 5C0JA 1XLEA 3FT4A 1J0JA 4H3DA 2AFNA 4KO7A 4NJIA 1EO8L 5LGXA 1AJ0A 4RNRA 1E6OH 2P80A 3F7VA 4Z7WE 3QJSB 5HI3C 2VOMA 1B3IA 2G2NA 3VYLA 3MCKA 4JRYD 1OY3B 2O5XL 3GDBA 1XS2A 2RGLA 2ZZ2A 2ZKMX 1QRNE 3VUAA 1QW9A 3DV6B 3SKUD 2F7PA 4JTHA 3QZOA 4PJEE 3HPLB 2UY7A 3NQ6A 5K9XA 4NVTA 4WJ5B 3NOEA 3ILQC 4MD0A 4DPRA 4PEKA 4CD8A 1R3IH 4X6DA 4BI6A 4E4FA 4O2CB 1HZLA 4EJ1C 4Z7OF 3V4VA 2A85A 5T3ZL 3NDOA 4E8DA 4H26B 2E25A 1E6XM 5GNYA 3DHMA 4QF1B 4K3EH 3C2AL 4LARL 2N3JA 3J7HA 4B95C 1VPYA 3E5PA 4YTRA 1AZZC 3II2A 3U4AA 4BKLB 4DUWA 2R23B 2DMHA 4E68A 1OV8A 1UACL 2EIZA 4EXQA 3GVVA 3RZWA 5D1ZD 3CQQA 4B7IA 4F33A 3FY1A 2QJJA 4ZQKA 3WSQH 1Q0YL 1ET8A 3WH5A 4X8JA 3DX7B 3VTRA 2CETA 2VDNB 3RGVC 5SWZD 3V6OA 5KW9H 3OZKA 2GT9A 3BKMH 2H8PA 4C1NA 3V0AC 1QFWH 2FWOB 2FX9L 4N2OA 3H9SA 3LJ3A 3ZUCA 3RJYA 3K4DA 2QHAA 3HFTA 4DSYA 1BDYA 2FTAA 1HI6B 1IGMH 3UETA 4X4MA 3UG5A 4JR9H 1R3KA 3GW3A 5ENWB 3VB9A 1DBAH 1MLBB 3KPRA 3NQMA 3EUUA 4U1LA 1QEXA 1ZDSA 2CRYA 3YPIA 4EDXA 1KIPA 1BVLA 3RWHB 1A7PL 3RVVD 4NS0A 3TCLB 3N18A 3JTBA 5A6JA 1CFMA 3HUJE 1P7QA 3IXTA 3UO1L 1WBYA 3EGSB 3H56A 1Q9OB 1I2NA 1C5DA 2QCDA 5LXXA 2YQGA 3WBAA 5D7EA 4DPAX 2PW2A 2XIIA 4KDVA 2DJXA 4HOWA 1MH5B 2HVKB 1Q1PA 2CZEA 3MLWL 2WBJC 1TR7A 3EZ4A 1J05A 2VDPL 2Y7QA 4TNGA 2ZUMA 4PAZA 3EHBD 4WFHD 5HDOA 4PTVA 4AVIA 2FZBA 4E0RA 4P23B 1KTRL 5FFOA 3EOTL 1KWKA 2NXZC 3H2QA 4M6OL 3RWEA 1T8QA 3BXWA 3MCLL 3W71A 3FRPB 1P1XA 5AALA 1IGCH 2YAMA 1N8IA 1Z7JA 5C0AD 2ETWA 4UMGA 4JTKA 3PCYA 4M7LH 2BSEA 3MRHB 1QRNA 4TTDC 2CGZA 2CLVA 4ZJ9A 3TONA 3LK6A 1C8QA 4WV1B 1S2UA 4NCDA 4M7TA 4XZBA 2FVMA 1TTIA 2VIRA 5A5WA 2CXEA 3BRDA 1ECQA 5HHNA 3V7MA 3CZJA 1M53A 5C0AA 1DZBA 4BFAA 1NCBL 1BWKA 1XLGA 1Z8AA 1NAMB 1WT5A 2GAZB 3D50A 2HVMA 4O53A 3WQPA 5FF0A 1XGEA 4DBWA 3ZR4A 2X70A 3MPCA 2BVPA 4DFIA 1N3NA 2YB4A 7ENLA 4HJSA 1YNPA 3FSWA 2VKZG 5A6TC 1YECL 5DHVB 3HE7A 4R7NA 2P10A 3MQTA 3R79A 1Z66A 2Z4QB 2OXNA 2WO4A 2WYIA 4EPEC 1OP4A 1VFOA 2A74A 2H6UA 3K5XA 1ZBVA 3HC2A 1AXSA 4HK0A 3KYNB 2YRBA 1JNNL 3LS5L 4AE0A 2PE4A 3DXIA 4P2QB 4BJHA 3UZZA 5AC8A 4GFTB 3S34L 5EIIG 3A6BL 4ZX6A 1HCZA 1PSKH 3IJQA 5FEZA 3ZVHB 2EP6A 1GS7A 1IGSA 4FNUA 1P7KB 4NM4H 1G94A 4EZMA 1QWGA 2V30A 4HZ8A 3SQOL 2O93L 2WXJA 2CDEB 2J2ZB 3FS9A 4DO4A 7TAAA 1TYJA 2ZP0T 5HYSG 1DWFM 1GVRA 1S7UA 4X7TB 3GFZA 5CLXA 4F8NA 4BR1A 4R97B 4X7EC 5I9QC 3S36H 4GGBA 4ZQRA 4J3UA 4J5NA 2IH3B 4QPEA 4AD1A 5DRZA 2OXHA 5DS8A 1MHEB 1T1ZA 2QSQA 5H4ZA 3AW5A 1PJWA 4WR3A 4P2RD 3O63A 2X0UA 3B9AA 3NZSA 1BOYA 4DBSA 3PQYE 1DBKH 5DUBB 5E8EA 2UZYA 5ELIA 4YJZL 1RU9L 3DH7A 3UT0A 4EI6B 3MRMB 4HK3J 1ADSA 2ZC8A 2ENPA 3Q67A 4F3FA 4R88A 1CENA 1MFCL 4Y9EA 1XH0A 3KRBA 4RR4A 2NQ5A 4HIEB 1U30A 1YJDC 5BO1H 3MCLH 2WKJA 3WN6A 5DWPA 4B9YA 1MYRA 1QFUL 1SOKA 4FERA 5DMGC 4EZJA 2KC0A 1MLCB 4KZDL 1HHIA 1MKFA 5JDJA 5HYQA 5HPMA 1E51A 2AJYH 2WYZA 4YVPA 2IBZY 2NQ3A 3O3EB 4A6YL 4J3OF 2OTUB 3SPHA 1F2QA 4F27A 5FYJU 5DC0A 3WUWG 1NEYA 4X80H 4OCYL 3HG0A 4AENA 4ATLA 5K2ZA 5MI0C 2GQHA 4LDLB 5TD4A 3QYQA 2AEPH 3Q8AA 4LCQA 3QUML 4IJCA 5E56A 3T4AA 2DZEA 1U9KA 3P9MB 2YAEA 4DESA 5C97A 2SEBB 3NPVA 3QVAA 1SLWA 1CNVA 4YHNA 3CU2A 5EV7A 2V5TA 3O9WB 3T71A 1OGAB 4XQ6A 2X4PB 4OD2B 5CC7A 4ZQTA 5M7QA 2Q6ZA 1TPB1 4RGNE 4Z7WA 2X2YA 3GC3A 15C8L 1ED3B 4NC0B 5DZ9A 3RNDA 3VMPA 3CSPA 3QEQA 2RGMA 3VIMA 1CGVA 3QQWA 4QE5A 1IAKA 5FHBH 1WCBA 5G1TA 5FYJD 2CHNA 2EIEA 4KNUA 4L3EB 4BGLA 3VD0A 1C3FA 2O4MA 5J8OA 2HRPL 1TZZA 4DP9X 2MH4A 3E6FB 3UAAA 4R53A 3STFA 4NZFA 4AZ7A 2VDNH 1QACA 3M6DA 1U8CB 1WVZA 4RGND 1ETJA 1OT4A 5DS8B 5DRZB 4BF5A 4GJTB 1EHLH 4PJHA 1YDYA 5JPNB 1E67A 4K3GA 2X1WL 5C2UB 1P0NA 5AHIA 1HGWA 4JHWH 2FGWH 1J1PL 5E8EB 4CNOA 1WHOA 5BQ7B 3M0LA 3ROOA 4JDYA 3OIXA 4W6WB 4PSPA 1AR1B 1O66A 2HUEA 2XINA 3UC2A 5HHPA 3HN5A 4KHXL 2GK2A 3LPPA 2NQCA 3FTGA 3ZE2E 2OQHA 1A6WL 1V6TA 3HIZA 1SDDA 3T4AC 3B8IA 6ENLA 3QNZB 1D5MA 3PNUA 2VLJE 2BIOA 3NK3A 3HPJB 3QHNA 2O5XH 3V8CA 3MUAA 5DWUL 3CQ0A 1AGFA 4JG5A 2NZ9D 3EMQA 4K9EL 4JZNB 1H11A 3TUUA 2JKIS 3VXMB 3D0AA 1H1YA 5HI3D 4P4KD 1XF1A 1HL4A 2Q3RA 1XLCA 1NCDL 1G01A 2VX6A 2XKNB 1GEQA 3S4SG 2A2IA 4LEFA 4KWOA 3ZXWA 4XAZA 3I84A 1FYTE 2JMRA 2KLSA 4R7NB 2B0MA 4LS2A 4I48B 2PWFA 2VKXA 5DMJB 1EIXA 2MWCA 4Z0XA 4HFWB 2BVOB 1R75A 2RA1A 5ABTA 2OL3B 3ZJ7A 3UTOA 1M56B 5EOTB 1EBPA 3BO8B 4XE5B 3DVGB 2A6LA 1UIPA 4MZYA 1P6BA 3KPSA 3UR7A 4GKTA 1U1UA 1HHKB 1V3IA 3IRCA 3GHEL 3HTLX 2VQ4A 1MJJA 3HHSA 3K30A 4JG0L 1F6PA 1A7OL 1B0RA 2HKHL 4U6HA 3E6FA 1V7ML 3U2IA 1BVOA 1LBMA 1PZ5A 3FHAA 3TN4A 5K9JL 1EX5A 4F80A 3QW4B 3VOIA 1AGBA 1Y5VA 4WGHA 1XV8A 5LHFA 1AP2A 3NNTA 4AY7A 1W1ZA 4E0RB 1E8WA 1NLDL 4RCAA 5BRZA 4P61A 2DLIA 5C7XL 4WI0B 5D1QA 3NJNA 1TKKA 8RUCA 1KCXA 1T21A 3TH4T 5E5RB 3AMKA 2HRLA 3GYCA 3MI6A 4ACPA 3WJYA 2XKUA 1QR4A 3LZLA 2VR4A 3RDTC 3QMSA 2ASHA 1QUNA 3FUKA 1E15A 3OG4B 3MUUA 2AZAA 3CEPA 3VYOA 4CU8A 4YSAA 3TJLA 3ARBC 1MCSA 2AW2A 2YPLB 2NRDA 4A04A 9XIAA 3GZKA 5D6CB 1L5GB 3I4KA 4D9PA 3CQFA 5A2FA 2XM2A 4FX5A 5AKSA 3X3FL 4FNPA 4QHPA 4HNUA 1ITCA 4W9IC 3JWOH 3A6OA 2W0UA 3WQOA 3URQA 1ZLWK 4Y19D 2AKZA 1HHGB 4TL5A 1E5AA 5DO8A 3RRQA 3MRPB 4NQXB 4LLDA 4TQEH 5JHDA 2HJPA 1PKLA 3AHYA 4HNOA 5J3HD 3RNQA 4PHZA 4AL8C 3GC5A 3OZYA 5DQDH 5AZEL 1CFSB 2FATL 4P06A 1M7XA 3QQNA 3DFYA 4WUKL 5EO1B 4M81A 3PF3A 1G4SA 4P7OA 1SVZA 2EDXA 4NPJA 4RGMC 5DHYB 3RHWK 1A9VA 3JTSB 2B9AA 1KFEA 1YJDH 3P3RA 3Q6GH 1MVUB 4ASTA 4G5ZH 3RCYA 5DVOA 3PK7A 4FNLH 3ZDYB 2PODA 4DFHA 2Z31A 1B0RB 2WIMA 4U6HB 3DWTA 4YZFF 5F1UA 1J93A 3W1MA 4FQLL 2I5YH 2WQUA 3IPWA 3WLPA 2ZZ5A 3WG6A 4DGVL 4TSAH 4U1HA 1TENA 2X8RA 5HAOA 1IKFL 3SJNA 3JWDL 4LSBA 3TYCA 1WPCA 3HU7A 3RVTC 3HRPA 2N0MA 4KI5C 4OQTA 4XX1G 1H41A 4DO5A 1PE1A 1F4WH 3H2EA 1YMHA 4LL9A 3GSWA 2ZDRA 4PI0A 1GJPA 1CTOA 3GIVA 1F61A 1PKYA 3VKDA 3OG3A 3AXKA 3IIOA 3M1BB 2BDNL 3MKGA 3IPEA 4L48A 5E1QA 4KIRA 4HS6B 1IFGA 4RVBA 1NL0L 2UZXB 4WUUE 1DN0B 2APFA 4C56D 2PDGA 2AERT 4A6GA 5A8GA 3PIQA 4OCXH 4MOZA 2X30A 2YPLA 4OCMC 2PTDA 5ECJE 1MNUL 3VFUB 1EHAA 3QUGA 5AW1B 1C9DA 1BVNP 2E0PA 4HJFA 1EJ6A 4ODSL 1HW6A 5ESVB 5D32A 4UT7L 4N2BA 1K7EA 1XBRA 3WBWA 2R29L 1NBVH 1EHNA 1D2OA 4I0PC 4DW2H 3JYBA 1WYJA 3LEVH 4MXVF 1Z9NA 4N2CA 2BW5A 4P23A 5KBMA 1BYCA 3ORJA 4GAJH 4PWEA 4NLHA 2ATSA 2VT0A 3DETD 3FT1A 1VBGA 4XR8C 3BPLB 1LUCA 3AIWA 3W1QA 3KPMB 4PLKC 1SQ7A 5DMMA 4WF7A 4ZQMA 3W86A 5JIWA 1SBSH 4R96A 3N5AA 4XPTH 3UPAA 3NGBB 3GBML 4XD6A 3WAKA 1A9EA 5ID0B 3H2OA 1G7LB 3S36X 2HQAA 4ZSUA 1LE5B 4FI4A 2X2JA 4UT9H 1FCQA 3Q6GL 3E0LA 4S3DA 1B4EA 3LPOA 5TH2B 2YMOA 5IFTA 4L1SA 5IOBA 1XAUA 1ZT7A 1CD1A 1RD5A 4EWJA 1O6SB 1YYLL 3FCTA 2AF2A 3BZFA 2ZNWA 3MLYH 4EI5D 1PKMA 3MLTB 1P4BH 2O7QA 1P4IL 3MLUH 4JPKL 5C0CA 3PUEA 4QRPD 5FKAB 3SDAA 3MJ9H 4XPTL 1E4NA 3PWPE 2UZIH 3QMRA 3RGTA 3UP1A 1PQZB 1ORSA 2EVFA 5MI0B 2IQTA 3WDHA 3GKWH 1TSIA 1TJMA 1JHTB 3D25A 1JG9A 4ILSA 3S3CB 3LAFA 1AOZA 3TEWA 5ABFA 5HHXH 2OKMA 2R0ZH 3OHMB 2WHKA 3HG4A 4XIAA 3I9IA 5DLCA 3CHSA 2AQQA 1R3SA 4FQHB 5I1AB 2A3TA 2BW4A 2JXMA 2VN4A 4G7VH 5CD3B 3N6JA 5GZNA 3AYRA 4DN1A 4TNFA 1K8XA 4LASH 3BT0A 3T3PF 4GO6B 4HWBA 1F1AA 1W2KT 4NZDA 5TE7H 2GWNA 1V05A 4GY1A 3W57A 5ABDE 1OB1A 5EOCH 2E6DA 3SPCA 1FDYA 1O7DC 5HD8D 3CNYA 3T0BA 4MD0B 5GZND 3GG0A 5EWIL 1KDJA 2WAQA 3RNKB 2BVDA 1NQBA 3EOAA 3AHTA 3IN2A 2H8PB 1S3RA 3GY1A 1T1WA 1ZBKA 4FKKA 4M80A 5DBUA 2GGJA 5E4AA 1NJ9B 2AXFB 3FH8A 4B7LA 3NN8A 1A5CA 1QK0A 3CJPA 1D5BA 2Z8RA 1J79A 3UPRA 1TPC1 1JN6B 1T96A 4OHQA 1JWSA 2AAVA 2KERA 3GMOA 1RQHA 2W9DH 1TEGA 3NSXA 2Z6IA 4UFKA 3RU8H 4WJEA 3WO4C 3MV7D 3IFLL 3GI9L 3DROA 1H7WA 3I6KB 3CBWA 1IEQA 5C0IB 5F7KC 1I8MA 3PREA 1B3OA 2NW2B 3FC8A 3LMYA 4C6MA 1IT9H 1LD9A 2OSLB 4E41B 3UBGA 1PYWB 5EUOE 5T5NF 1NP2A 1CG9A 3APNA 5E2TH 3UIZA 1ZEAL 3QFJD 4C6NA 1X9UA 1IGWA 5E9XA 3FUFA 3KXFA 2P49B 3IDMA 3SUWA 1A7BA 2XCMC 3VRJB 1P7TA 1DEEB 3VXSE 2R6OA 4H8UA 4XP1H 2CDGB 4TO8A 3KLAA 4NO0D 1N7ML 4OZIB 4I77H 2PMQA 2YBVA 3VNYA 3P4OB 4IGSA 5CSGA 1MCRA 1RV6X 2EYRA 4L1LA 1JBJA 3GZ3A 2NX5D 1NFDF 4MNLA 4OAWA 4IJRA 2A83A 3E5BA 4CU7A 1OF8A 2VLRE 3MNVB 4NNPL 4WV1A 1TG7A 3VI4A 3FFCB 1ID2A 2Y5TB 2PDKA 3P5YA 3HFML 2ZYIA 2R0WH 3QQ9D 3LQLA 2P5PA 5IQ7H 1FRBA 2VCBA 3IDJA 3WLBB 2WINA 3WYRA 2BP5M 3SYQA 5IR1A 2YBTA 3S6DA 3UR8A 1FIGH 3MTRA 1Z9SA 5HDBF 1CB7B 3ANVA 1I8JA 5AOLA 1LOSA 1HP4A 1XGYL 4ZGYA 3QXVA 5SWZA 1QAPA 3TIDA 3TNOA 4YHYC 2PFHA 2YCIX 1JF1B 3ZT5A 3EKLA 2VRJA 4WO4A 3VA6A 3ABGA 3DTXA 3DGGA 5E8PB 1AW1A 2GC4C 4AJWA 2OBGA 4OCRL 3THDA 1OWWA 1BIHA 1TNNA 2FEJA 2NNRA 3AM8A 1F1GA 3MRRB 4NAJA 3CFEA 5H35B 4ZFOB 5ABAA 2O6DA 3ASOB 4MXWL 1XFCA 4TSBH 1KCBA 1XTLA 2C1HA 2DKSA 4N42A 2TSBA 4LHUA 5J57B 4ADSA 1AC0A 3FCTB 4GXUM 3NJMA 5DUPH 3ZZLA 1H09A 3BARA 4OQVA 1AC6A 1YEYA 1UIOA 2VXTH 4MZ8A 5C07A 3PWNB 3GSNL 5KSBF 1EPXA 4DQAA 3QJZA 3IJLA 3WUBA 1KBKA 4PRAA 1UADC 2AXGA 3RAJL 4FQJH 2HJKB 3NACH 1HNGA 2GJRA 2BIQA 2J71A 2MCAA 3T1WA 4JANA 1HJBC 3G6JF 1SEQL 4JQ1A 1W9PA 3ECQA 1XLHA 5D1ZC 2GC7C 3MJ8A 2IUZA 4OJFL 3OU8A 4C6EA 4DVOA 3GFUA 4M9PA 5EG6C 1VH7A 4U0RB 1OZMA 4KZDH 1GONA 4YDLC 2CNYA 4QR7A 1K9FA 3PM6A 1DBJL 2MMXA 2Z4TA 1VF8A 5FJRA 4RRPG 1I8AA 5ANHA 2HZGA 4OFVA 3L12A 3V5DB 1A5MC 4K5PA 2X3BA 4DF1A 5G4NA 2V9DA 3IWVA 2ATKA 4LPTA 2IV8A 4F1ZA 4L80A 3AREC 3WQEA 4UB9A 2WMPA 3NCXA 1OLLA 4WY0B 1MFBH 4MLRA 3GXNA 5E2VL 2ERJC 3U3HA 1TPXC 2IAMC 2HLAB 3B40A 3NIGE 4NWUH 5L6YL 5KWYC 2YYTA 2KQNA 1Q2SA 4R96B 4ZBJA 4PMDA 1TVDA 5H8UA 3IIXA 3DX2A 4QO1A 3TN3A 2EEDA 5GJMA 3M88A 2QCEA 3BPCB 4Q2ZB 3NCFB 3TBYB 5BV7B 5AOUA 3O3AA 1JVLA 3M1CA 4ONOA 2QV4A 2YARA 3HNTL 1YY8A