5A6SB

Crystal structure of the ctp1l endolysin reveals how its activity is regulated by a secondary translation product
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
MENLVVYNDGADQRAAEYLADRLACPTINNARKFDYSNVKNVYAVGGNKEQYTSYLTTLIAGSTRYTTMQAVLDYIKNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Ctp1L Endolysin Reveals How its Activity is Regulated by a Secondary Translation Product.
pubmed doi rcsb
source organism Clostridium phage phictp1
molecule tags Structural protein
molecule keywords ENDOLYSIN
total genus 25
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2015-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12090 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5a6sB00
4CU2A 5A6SA 4CU5A 5A6SB
chains in the Genus database with same CATH superfamily
5JT1A 1PQYA 2ISQA 4GP9A 2DQZA 3FGNA 1YZKA 1GRRA 4B71A 3EIFA 3UAWA 2PWBA 5AK0A 3ZDXB 4F4JA 5HOEA 5COBA 3GBPA 4PEVA 2ZYTX 1Z0SA 1AS2A 4DA9A 3EH2A 5IDQA 3PXEA 1QHXA 4R3NA 2OXCA 1WUKS 5C5DA 3E3MA 1W4RA 2B0CA 2PFGA 4Z4FA 1LDNA 4W6QA 1HOTA 4DYVA 3BTVA 3QIAA 3RYHB 2W6PA 3A58B 4C0LA 1MAVA 4UZSA 5E2BA 4FHEA 3H5OA 4DM3A 4UTVA 1C4XA 2RI6A 1M1NA 3PFGA 5AW8A 1Z2EA 4FZ3A 4ZYWA 2R8YA 2GEDA 3OZTA 4DMFA 1X9HA 3OJEA 2XB2A 4X92A 3W5CA 3MD9A 4B47A 3RD5A 3MAAC 1DSSG 2CMDA 3ESYA 4L1KA 4XWTA 4MI3A 4DJ5X 5JCJD 4GM0A 1KI4A 3B1FA 1WOMA 2FZGA 2RGYA 3DUWA 4QU5A 3OEWA 3AEQB 4KUHA 4IG4A 3U61B 4Q3AA 1AA6A 3DE4X 1V11B 4GL4A 4WNYA 3SXPA 2X1HA 2ZJ7A 3OPNA 5MGNA 3GK3A 3IA7A 2GWHA 3DKIA 3PIDA 4HO1X 5GV7A 1CNFA 3HBLA 5ALTA 4PCLA 5LDHA 3R5TA 2Z2ZA 3T3HA 1F2DA 1ZVMA 3M81A 5HE9A 2IVFA 1F2UB 2XXBA 2XVXA 4BVJA 2OD9A 4M87A 4XJXA 1AKQA 2QJTA 1RLIA 3BMNA 2I91A 4J0KA 4RKYA 1U7HA 1B0PA 1MFPA 2IHYA 4RVGA 1HNNA 3RC9A 5K8JB 1BHJA 3WNVA 2CC2A 3I34X 1ZWKA 4DDHA 1OV4A 1RHUA 2W2KA 3MMXA 2QQEA 3W3AD 3G9UA 1E2LA 1DKOA 4LYDA 2OQVA 5JU6A 1BHQ1 2DUWA 2QZ9A 4JP5A 3GFTA 1JA9A 3RVPA 2BW0A 1A7UA 5TEVA 4AUEA 3HJNA 1QFSA 2WKPA 2DT5A 4ZEOA 2DU8A 5ERXA 3WISA 1QB7A 1RJDA 1ICIA 1M72A 3H2SA 5DTRA 1FFXB 4CCYB 1ISSA 3DZJA 4AKEA 3ZDEA 1PVOA 1H42A 2FWPA 1C5KA 2RHOA 3H17A 3OY2A 4C21A 3FCSB 1YL5A 4OAPA 3BA1A 3ZHUA 4I9GA 4EFNA 4RZ2A 1JSZA 1YVEI 2R7MA 3EDCA 3DHEA 1R64A 4OXIA 2GM5A 3LVQE 2VF5X 2YMMA 3E1KA 4UU0A 3TS1A 1QIFA 2KPOA 3SAJA 3Q87B 3LO8A 3IE0A 3IHTA 1P75A 3N5CA 3RCBA 4BFTA 4EABA 1JA0A 3AVUA 3FYCA 3ICPA 4TZTA 3KEGA 1SIUA 1VB3A 2GBIA 2HPVA 4UAJA 4IDBA 2FF7A 3ML1A 1DOAA 2WSIA 2ZRFA 4YRRA 3WV4A 2HA4A 2VTDA 1EXWA 1Q74A 1BU8A 4X8HA 4CUJA 2J4FA 1QCDA 1GTJ1 1OYYA 2LWIA 2O2CA 4UHEA 3W1EA 5KYYB 3K4HA 3QZUA 4KDFA 1UQRA 1TKRA 4H1VA 4MP3A 1PLLA 4DHEA 4DS3A 1QYWA 1UZNA 4QQNA 2GXAA 2CMKA 3DF9A 2YWDA 1XRRA 1DJOA 1LDEA 2Q3EA 3K16A 2V3VA 3QEMA 1RLUA 1ZOOA 1KERA 2OXFA 1SXIA 3CLUC 1Q3TA 3R75A 1ZAYA 5CK5A 4XUCA 2AGVA 4EITA 2CN1A 4PGFA 3SC2A 4MX8A 3RJZA 3DUFB 2WT4A 1T29A 2JJ1A 4TN5A 5BPHA 2WOOA 3C43A 2P2LA 2JLUA 1HE8B 1IZ8A 3OP1A 3U7FB 2AR7A 2XADA 3PEYA 1LY1A 3KELA 4P53A 1ULHA 2QTCA 1N6LA 5ALKA 5I7FA 1SVSA 5TQJA 5A06A 3LP8A 2J67A 4Q4AA 4DHWA 1E77A 3BCSA 4M7OA 4MZDA 3GJXC 1RWKA 2PBLA 1AKWA 4GH5A 1G63A 4ARZB 1ZIXA 2HRBA 1PYGA 1A4IA 1R4ZA 3DA8A 2CHUA 3OEHD 3R3YA 3HY3A 3RSOA 4Q0MA 4PC6A 1VP9A 2YY5A 5JECA 1O0BA 1W94A 4Y2TA 1E1NA 2ZJ5A 4PZCA 1YSCA 4AKSA 3EZ9A 1A9OA 5E4FA 3GLGE 3HUEA 1O8CA 2O8DB 4H7KA 5GJWC 2DHCA 4HG2A 5U4XA 5KNCH 3R5XA 1RW4A 1YRLA 4FR2A 1KQOA 2PY6A 2D2IA 3BWDD 4CYMA 1ZW1A 2F1KA 1J2UA 3AYZB 4R6WA 1VKOA 1DAHA 1PWZA 1JDVA 2W6ZA 3JQGA 4B09A 1RAAA 4DCVA 3RANA 3PNVA 3LT1A 3PLRA 2AZTA 5L3ZA 1XC7A 1M0SA 3N2KA 4LV6A 2H5JA 4MUFA 2PVCA 2H2AA 3EW9A 3OJXA 1G2QA 4JBNA 4ZALA 3DAGA 1NSTA 1L1FA 3E58A 4LY9A 1B16A 1R6BX 3LT0A 1V48A 3ZHYA 4EHJA 2XBMA 2X0JA 1EQUA 4JL5A 3HJFA 1MPTA 2AUTA 2QVLA 1NW4A 3CZQA 3LFHA 2H51A 5K3DA 4K3VA 3ZWDA 4EB0A 3VUEA 2FLKA 2FSVC 1SBQA 1XF9A 4KAJA 1P73A 4IHQA 4TL7A 4DT1A 4S2EA 4BMXA 1CR4A 1CUBA 1U7DA 1IHOA 4D8XA 4N54A 3ANNA 2VTKA 4P2GA 3D3JA 2X0DA 4UNRA 4G01B 3G2NA 1XZQA 5BN4B 1U2SA 1YD7A 4C4RA 1RAEA 2O07A 1Y6ZA 3AMVA 4OAOA 4PQRA 2P4QA 1KEPA 4H4EA 1WCYA 3WLOA 4QATA 2BZ1A 3T9CA 2RHRA 3LAWA 3SKXA 2C4NA 1R27A 4RGVA 3I04A 1R6AA 2VYVD 3AH8A 3RC8A 3FNHA 3K2BA 4D4KA 2DHEA 3WL6A 1ECJA 3KJEA 4QYMA 1EHYA 4CFSA 1E9VA 2J6HA 1CE8A 1ID1A 3F96A 4HQLA 1RDFA 3IEXA 1RJWA 3T54A 4FK8A 1E9RA 3M0EA 3NHJA 1CETA 1UBMS 3E18A 3M6IA 4Q7EA 1JQAA 1ZU5A 4G63A 5ALXA 3B6KA 3IAS1 2FLWA 4IUDS 4UUPA 2BF4A 4KIFA 1FYEA 1PTJC 3L4EA 1JR3D 3JALB 3ICVA 4D8TA 1FA9A 1ZD3A 1KI8A 2YNMD 1T2CA 4Y7CA 3NOVA 2QR2A 1NF9A 2X0RA 2EC5A 2DQSA 4KGXA 2FZCA 1YR7A 2NAPA 4UUBA 3EFHA 2V7GA 3ILXA 3KXIA 5JJBA 1T9BA 2G71A 4BLRA 1VIVA 4O4LF 4RTJA 5CGQB 1Q0TA 4MDFA 2AEMA 4CG1A 1SR8A 3OWHA 3KWFA 1K63A 2XTAA 1VCOA 2BL4A 2CFSA 4EWLA 1MF7A 4H35A 3OLZA 3BIFA 1AN9A 1XEXB 2YYAA 2XCSB 1KPHA 3PRHA 3WNDA 4C08A 1BEUB 4P7KA 2OBMA 3VHRA 3LPCA 1XTIA 2YYSA 1XK6A 2BFMA 4JA2A 4V0ME 4EKYA 4UQPA 4LVCA 1UJBA 1NXXA 5D01A 3ZE7A 2A84A 4R2IA 4YCNA 4X65B 1LC0A 1JF8A 2R6DA 5CBKA 1SOVA 1DQSA 2DJIA 3PDIA 4AW9A 4CM7A 4PHGA 1TMGE 1H4SA 3N0WA 1HLFA 2C7GA 4QFDA 4KPGA 1EA5A 4FGSA 4MR9B 3RTAA 4L28A 4DG8A 4EQZA 3C1UA 3IT0A 1LQ2A 4XCXA 4OYLA 4GSLA 4F46A 2ZP1A 3SHTA 1DUVG 1VKRA 2G40A 2P2CA 1P2DA 4R1UA 5LP1A 4E07A 4CQMD 1UBGA 3N9IA 3H7IA 4H2DA 4WLUA 3IUQA 4MWZA 3H9EO 1IRIA 1CJTC 2C2GA 3DAHA 2WF5A 3NWJA 1KZGB 4KO8A 2NVBA 3QLVA 2BGUA 4UTNA 2OM2A 3FPLA 3W2GA 4C2UA 1IXZA 4XD7A 3EE6A 3BE6A 3VYUB 3V55A 4OJKA 3WVNA 3T1OA 4MV7A 1G38A 5EIWA 1NW5A 2IYRA 2Z57A 4MGKR 1JH8A 3I2HA 4EHAA 2WW8A 4NPAA 3GLHA 3F8TA 2BHSA 3SX0A 1V43A 3ZWAA 5A1JA 5KQMA 3LT4A 3THXB 3CRVA 1O4WA 2B4QA 2FMXA 3GARA 3ETHA 4QQFA 4S0XA 4JLUA 5AI4A 3IDFA 5DISB 5HFNA 5AW1A 1T2VA 2XBUA 1G4HA 5FADA 2PUHA 4W5WA 4FN4A 1CRQA 1UIMA 2WWIA 4BLPA 1MX1A 4EQ6B 5CFMA 1GZHB 1HDYA 2G9NA 1C3XA 2HQOA 2EERA 4U9IS 1MDBA 2BM8A 1LBHA 5F52A 3T9EA 4DCCA 4DEVA 1IBMB 5EE0A 5T8KC 3ILYA 2D62A 4Y6PA 2XDQA 1X7YB 2AFIA 4FMPA 2JLCA 5ENDA 1EVYA 3J81A 2C99A 1P45A 4NZOA 1EM8B 2C5GA 1KHTA 1XHFA 3IAS6 1GITA 2I1VB 3LC2O 4G5HA 4LPSA 3PHCA 2X5JO 2F4VB 1RI1A 2Y99A 5DI9A 3Q11A 4YCBA 3TR6A 4OK5A 3DVQX 3TQIA 2P3LA 2ZRJA 3HVRA 1OTXA 2WNHA 1YT5A 3EGDB 4FS3A 1XRJA 1EI9A 2XPCA 4MKHA 4EHHA 5B30A 2JJ8A 1CZLA 3OQJA 4HF7A 4OI0A 3K5IA 3ER8A 4FKMA 2C5AA 4G4GA 5K8VA 4LDJA 3QKTA 4KPUA 4ZPXA 4W7HA 1FNBA 2JCBA 1C1DA 3A4VA 5A7FA 1BX1A 1RYYA 1EVLA 1M2WA 2XCUA 2Z3WA 4JBGA 4U2EA 4BV2A 3NUZA 2GTPA 5K0BA 2UXDB 9ABPA 1WW2A 4N3CA 1YCFA 4Y2PA 4DBVO 5JFOA 2C9DA 4JXZA 4GWLA 5HKKD 2ZBDA 5KTOA 1DADA 1ZRNA 1Q1ZA 5LOVB 4RQAA 3RS9A 3CRNA 5A6VA 5FV4A 4MDEA 3I28A 2YQ4A 1B6RA 1NOIA 1T8PA 1ZM3A 4C4ZA 1QG6A 3SFZA 4RMGA 3EF3A 2Y2VA 1O9HA 1S9DA 4ER5A 3UUGA 1K7EB 3N0VA 2ZRCA 4RESA 2B2NA 2GKGA 2J4CA 1NN1A 1QIHA 4TV9B 3TFWA 1WB9A 3WJAA 4RKQA 5JRDS 2SKDA 3GEDA 2VWPA 1ZUNA 1ODJA 2G0AA 5G40A 3C8DA 3BVPA 2WM9B 4N7BA 2HRRA 1YH3A 2C4UA 1CQIA 3D7MA 3K8YA 2ZZMA 3EFBA 4ITRC 1BDMA 5CB6A 2AZDA 3I2KA 3M6WA 1BEEA 1E2GA 2HWWA 1QORA 2G5GX 1YGYA 3EIOA 4R16A 4EJ6A 1A8SA 1QH8A 2VFAA 4Z54A 4B75A 1UFQA 3DC7A 1FMTA 1O6CA 2YFHA 3X2SA 1N7HA 1H2BA 4H1WA 2OWDA 3BIWA 4I50B 4XX1A 1VLLA 2QU7A 3EZLA 4MRRA 1J2YA 3HSSA 5TT1A 4G97A 1L7VC 3KEFA 4WRRA 3TLMA 2V97A 1OBCA 1KEVA 4KN9S 1JSXA 2Q3FA 4HQ6A 4PFJA 1LZLA 1JQDA 3NP9A 1A1SA 3O4FA 4RVCA 2AX3A 5EAIA 1AMUA 4N6OA 4P3NA 3K15A 1ZRSA 4M0EA 5ES4B 3G89A 3IKMB 4CI0B 2X8JB 1EWYA 4Q1EA 1XYGA 4HFNA 3G1WA 2RAFA 4D0SA 3ZGZA 5FO1A 4B3TB 3Q8MA 3CJTA 2J3EA 3IBCA 3UMFA 4XTRA 5KNLA 4YRAA 3IKVA 5CA0F 2PNJA 3AZOA 3GUCA 2NP7A 5AK3A 1Z5OA 4E0BA 4RD6A 4G8BA 3VYSB 3TBFA 1KP3A 1O2DA 2JLSA 4FW9A 4J0FA 1ACLA 4KZPA 4QU9A 4ZOBA 3T3DA 3EY4A 5CPBA 1FW6A 3R7BA 1G8AA 5A4MS 1ZI9A 1NYLA 2XF2A 3D3WB 2OYSA 4UFOA 2C2YA 3SQDA 2I3AA 3DNFA 3CRZA 3NEPX 4KIJA 2LD4A 4BNYA 3A2MA 4CKWB 1O94A 2FSUA 2FOIA 1G8HA 1H1TA 1TOAA 2VNSA 3GVPA 3P52A 4DOMA 1E7YA 2GZAA 1JU9A 4ND4A 2FFBA 4KMRA 1L4FA 2QZPA 3SFVA 3LV8A 4Q9NA 4Z7JA 5KOHB 1B8NA 5KMGA 1KGSA 2AR0A 4MV8A 3D0QA 1Y3FE 4GRDA 1O0SA 3AX6A 5JCXA 1ESMA 1SCUA 4C05A 3WRYC 1C50A 5JSFA 5C7OO 3MS4A 3W04A 1KYVA 3MWFA 5ITZB 2FW6A 2GJAA 2CJFA 5JLJA 1R15A 2G3YA 3ECCA 3L8HA 3U7QB 1EUZA 4F4HA 3L82B 2NP6A 4P7JA 3IIJA 4L8VA 4LJSA 1WCIB 2IZ1A 4KSBA 4U3JB 4ERXA 4X7BA 3W1VA 3BREA 1CC1S 1DBIA 1FFSA 2H3EA 1H8HD 1EM6A 3I42A 5D6OA 2FP4A 5FOSA 5CBPA 2B0JA 3DDHA 5T6MA 1EBUA 3GCWA 4CNBA 1T3GA 1F8XA 4KQ2A 2PUCA 3LK6A 1P7ZA 7YASA 3EZFA 4QZVA 4KE6A 4KE7A 2H2GA 2WSMA 4H31A 4QXPA 2BEVA 3FR8A 4NR0A 3M9WA 5AXAA 4Y9DA 2HDWA 2GPYA 3SHQA 3WXMA 2O8EA 1KRWA 2O3UA 2O9JA 4G1BA 3TSYA 2Q2NA 3JALA 5K6RA 2FPLA 1PJQA 3A31A 2YQZA 4L3VA 4AMUA 4PV7A 4GOOD 2B6NA 3K6KA 4GQBA 3OA0A 4TTRA 4AY5A 2E87A 2F3TA 2QVGA 3GGOA 4D2IA 5HSGA 1NT2A 1BCRB 1ZJJA 4IHAA 4D0GA 3IV6A 3VTKA 3ZGOA 1P4SA 4B3GA 2QTGA 1RM5A 3FB4A 3JQFC 4LDZA 4BQEA 1ZYUA 1E7RA 1N6NA 3CX8A 3AHDA 2X9LA 1ULZA 4YNBA 3U48A 2DHQA 2VF7A 5KYGA 3LUJA 3HDJA 4CGZA 1YZ3A 2NQ8A 3I4CA 4UU8A 1EK6A 4YRZA 2EBFX 4U7WA 5DU2A 1RPTA 3U1VA 3DJYA 2WSBA 4QTUB 3NHSA 3NV9A 4I1UA 2R4QA 3C3EA 4IYRA 1V4VA 5JIBA 3RAGA 5K0JA 3H2HA 2NUAB 3NC1C 1G5HA 1YVRA 3CY6A 3HDYA 3U4IA 2HCJB 1C8LA 3CUUA 2PYIA 1YA6A 2WFLA 2QL5A 4QFMA 1XDGA 3HDTA 1UAYA 4QASA 4JU9A 2BDTA 4KJXA 3R7DA 2WZDA 2QBYA 3OFVA 3KFLA 2VT3A 2QGNA 2R6AA 2QRPA 5LP6B 3BF8A 4QYIB 4GEKA 4L6AA 5DLDA 4NAVA 2JGLA 1CDZA 5CYOA 4AYWA 5JAMA 2WLTA 3SZUA 1W52X 4LQDA 2I80A 1G8MA 2HRZA 1B26A 2WIKA 1T4DA 1AQNA 2Q0HA 3HK2A 3MTJA 2W6OA 1H9AA 2F9MA 3G0DA 1YMVA 2O5CA 3KQKA 4X90A 4H77A 1WOYA 3C0KA 4KODA 3CLRD 3WLHA 3F4LA 3BB4A 3OQ1A 1W0CA 4O2BF 3K0FA 1R37A 4XQ0A 5EUBA 5TLSA 5EKUA 5IUKC 2JI8A 2NTJA 4NMLA 4EHIA 1KMNA 5AP9A 1E2FA 2W4IA 3B7PA 3MIZA 4X63A 4NEGA 2CUZA 3FFAA 1I30A 2H2HA 3NHKA 5FWXB 4NCIA 4OUDB 2XOEA 2H4YA 3IMEA 4WMLA 3AEXA 5G4LA 2NSHA 3GLKA 3CNLA 2CZQA 5IULC 2XSZA 3GEMA 2DQ4A 4YV7A 5CA0B 1EB8A 1Y3BE 2BH9A 4TGLA 2QP4A 1GN9A 1I3MA 1R4NA 1WXFA 2YHBA 1ZNYA 2O7QA 5DOVA 1WZIA 4F2WA 1Q95A 1XQXA 2OFWA 3ULKA 1KF0A 3DS8A 2WHRA 1X1DA 5JQGA 3Q4GA 1EM8A 2DECA 2AI3A 1UDXA 2AA3A 2I8LA 4FGJA 2KHZA 1G42A 4BAZA 2V45A 1L5KA 1HFEL 1XVUA 1JG4A 3P9YA 2J3JA 3JTEA 2JLYA 1ADYA 3UJ9A 1Z88A 4X1IB 5TDHA 1HORA 3VBEA 1Z0DA 4BNKA 5EMHA 4FYIA 1ZCJA 4YT4A 3TCNA 1PJ2A 2JK1A 1KH2A 1R3DA 5T67A 3KOYA 1CFZA 1LSUA 4ENPA 1RWVA 1IOVA 4FYVA 1I5OA 1JVBA 4OSOA 1I0IA 3FDJA 4J03A 1JHYA 2Q3CA 5IFLA 1ZH0A 2RJNA 4YIKA 1ZOSA 1KSFX 4X9XA 4H6XA 5ALUA 3E8XA 5LOVA 2R86A 2VLIA 2ONJA 1S7CA 1E1DA 1NJ5A 2HHLA 2WMNB 2GBFA 2ZJ8A 5E1BA 4EDHA 2G6TA 4LECA 1OFIA 3AKDA 3TNLA 1T2UA 4OHUA 3W4KA 3AFIA 4EJSB 1DAEA 3T3IA 1CR6A 4BVLA 3GAMA 3ZU6A 2GF9A 5L6LB 1J8FA 3INYA 4DMCA 2JLQA 3D6TB 5AOBA 1XKTA 2SBTA 1TM1E 4DLXA 4RZHA 4LC0A 1FJXA 2VCHA 2VBFA 1WMDA 1PSWA 2XNKA 3DSRA 1DS6A 2FPKA 1D9ZA 2QTVB 3DPUA 1D6NA 1E1MA 1MJHA 3S2UA 1P81A 4YJKA 1NW9B 1BGVA 3D1VA 5G2OA 5G4KA 1KI9A 5B1HA 5B3JA 3CLTC 3I52A 4JYCA 4KIWA 4LXIA 5JAQA 4DFDA 5KB3A 3IUNA 4G5XA 3RVOA 1GRCA 2ZRGA 1F0PA 1TFUA 2FUNB 1RQPA 4HEA6 3LBIA 5FL7A 2I4TA 2D0DA 5K3AA 3MTGA 4MW7A 3UGQA 5LPNA 3L7CA 4A82A 2DPYA 5K5EA 2WICA 4OLBA 5DSTA 1BW9A 3TCXB 4I6JA 3QLUC 5KIAA 4IDAA 5G0UA 3K09C 2D0PB 4S3MA 3VV3A 2H4JA 5JHHB 1VHDA 2GN6A 2YOFA 3MUFA 4Q1CA 5EHXA 1CLUA 1UBCA 4IDGA 1IONA 3IC5A 1Y3AA 1R10A 3D43A 4I9UA 4XEHA 2OQIA 4DREA 5KSOA 3L6UA 3P8ZA 2PMFA 1GGJA 4QT4A 3GYBA 3TINA 3BEOA 5F7XA 2KM1A 3WQSB 3AUTA 2YXLA 2NG1A 1GV0A 1IUNA 2ZUCA 2I8AA 1FDUA 2W2LA 1EFVB 1VHLA 4YRTA 4A10A 4AK9A 3KT8A 2IOYA 1G21B 4C14A 4QDTA 3AF1A 4GPAA 4IS2A 3STTA 3RRJA 3L6DA 1U0FA 1MR3F 1YBMA 1Z4PX 5JBQA 2ZSDA 4QYWA 3K6SA 4HAZA 2OV6A 2OHIA 2RG1A 4WCDA 1Z2AA 4FYXA 4F3CA 3GUVA 3HDHA 4HQRA 4MQMA 5H9WA 1SC1A 2XCRB 1DFGA 1X1BA 3CZ9A 3ZUGA 2OAQ1 1XTZA 1L7AA 4IQGA 2Q4EA 3ECAA 3T5PA 1JGTA 1OMOA 1ZM2A 2B36A 1T3ZA 3GA7A 4MIOA 4Q4HB 3ZHCA 1A7AA 3SZ3A 3LUFA 3PPWA 4DIOA 3BQMB 1ULBA 2DH6A 2PJZA 2H4XA 3A6ZA 3LUDA 4OQZA 5WRFA 1TA9A 1QH1B 3CYFA 2ZTSA 4ZQIA 4D97A 1UOQA 4AS3A 4OB8A 4OQ4A 2G77B 2YJ6A 1P9WA 3LVFO 1DQPA 1RFLA 1KJJA 1WKBA 1NVVR 2CEKA 1V3QE 3QV1A 1ZCBA 2JJYA 3QWIA 1X2BA 2H17A 1C0LA 1SCDA 1TKCA 1R5BA 3G7NA 3LHIA 4FQ5A 1H2RS 2ATCA 3WLRA 1P4RA 2WPDD 1SG6A 1FDOA 4MB6A 1DC5A 4L0MA 2Y2UA 3UT0A 5GZ3A 2OFXA 3SVLA 2Q9CA 5HX7A 1E2BA 1S3FA 1KP9A 4MVJA 4WLEA 5HKLA 3ECSA 1E63A 3S44A 5A4FS 3CRQA 2FWAA 1NVTA 2EKQA 2GUWA 3UQZA 2PPVA 2B34A 2ODAA 1I6WA 2PFSA 1P2GA 3CPHA 3JYQA 1LVHA 3LF2A 3QPVA 3GFVA 4RU1A 4YRQA 4KKXB 2Q7XA 4X8MA 5KTNA 3NFYA 4KQFA 3IXQA 1WEHA 1BH6A 2BDEA 3FTDA 4QIHA 5TS2A 3VR4A 2UZ0A 4J1NA 2E37A 4QQRA 4MWSA 1T0UA 3AT1A 3LW7A 3C1AA 2YBDA 3VGPA 4UM5A 1OIVA 4HDOB 3HSKA 4S1WA 5JY6A 1QZUA 5HG0A 5SZIA 2FPMA 2FPUA 2TYSB 4WBNA 1PJ3A 3NVAA 3EMDA 3HB4X 2JGRA 2JFWA 4HVLA 5IM4F 3AR3A 3RUAA 1U7TA 3CX6A 3M70A 4JWKA 4OH7A 5MN6A 3ZY6A 4ZA2A 5IT4A 3ZVNA 4BIMA 3THWB 1TK3A 2UXCB 3N2GB 3O3NB 4HMPA 1KRHA 1K5DA 4M0CA 3LDAA 1Y37A 1YR6A 4Q3OA 4TM7A 5EGSA 4MI1A 4HDKA 5CIQA 1QQ6A 1J5EB 2RGGA 4GAEA 4JP3A 3ZW9A 1XZLA 2ZJ1A 2Z6AA 1U5AA 2V3WA 4PTYA 3QE0A 5INTA 3GPLA 3VX3A 2IYLD 3KSDO 4MGIR 2UVPA 1XZCA 2WQZA 5I7OA 5JSUA 2Q5JA 1QFYA 1U28C 4IZIA 5LKAA 2F1OA 1JPUA 1E3IA 4JC0A 5B55A 4ESVA 4GRIA 4NECA 3BMXA 1KP2A 3H8WA 4N0EA 2JH9A 4NJOA 2AEFA 5B3JC 1XELA 1ISMA 4D99A 3I12A 1EGVB 3C7AA 3MAJA 3V5NA 3KVRA 1PS8A 3SEZA 4F3NA 2VYNA 2G7MC 3WLQA 4R1OA 4BJHB 4B2YA 1XVLA 3SP1A 4P0QB 5JAZA 2R5NA 2CJXA 4F45A 3O8QB 3KQLA 3P0JA 4JSTA 2FN3A 4BWYA 4H60A 2O7SA 3AXTA 1E5XA 2ZIGA 3UK7A 3JD4A 3R9XA 5BSMA 1MQ8B 3OT4A 4N1AA 4AT1A 4ZTBA 5JXJA 1DAIA 1RQXA 2OAP1 3FDZA 4ZT3A 1BEZA 1UBHS 4GWGA 3QWBA 4EKIA 4MDHA 1SXJC 3NGMA 2EARA 4FHDA 2PUBA 1QRDA 1Z47A 3O0TA 1D1TA 2HHJA 1S9HA 1GFZA 1XCGB 4HPWA 4PCUA 1ORDA 2C77A 5DW0A 3UFXA 4WKNA 3N1UA 1PJ8A 3DAOA 2A5FA 4QM7A 3OFND 3NWOA 1JFSA 1DDOA 2VDRB 3PGA1 1VG0B 3PQEA 3B48A 4D6PA 2VPYA 4EY5A 5FLXA 1R0SA 4KDEA 4NYJQ 4OBXA 2QD4A 3TGWA 2HEGA 2C4MA 4N47A 5LWQA 1RZ3A 3ZNOA 1DAGA 2ZIZA 4ARIA 2M9MA 1X92A 1GUDA 3QG5A 1EE9A 2DC1A 2I62A 4LZOA 4RJKA 5HVNA 1F7VA 2OBLA 1HSZA 3KEQA 4Z4GA 3H7AA 3C3WA 1WHTB 1LRKA 2FSSA 2WWFA 4LDQA 4X8OA 2ORYA 4ZVQA 1LF5A 1YHNA 4FX2A 1AS3A 3C41J 4GGPA 4ND6A 5IF3A 1JHMA 1Y6GA 1PVVA 4UOZA 1NV8A 1OXTA 1RPZA 2BFCB 3FNGA 4ILEA 1FRVA 3DYVA 4MGHA 5TJHA 3M82A 1F2TA 1L7NA 2AN9A 1PR1A 1M5UA 3GP3A 5J4LA 5IH7A 3U5ZB 1W36B 2C8JA 3DOJA 4PG6A 4UEQA 2FK8A 3OQMA 5DK6A 1ULAA 4DCPA 1I2AA 4FDUA 4O4JB 5IARA 1I4WA 1C41A 1YACA 1YBVA 3I1YA 5ECDA 2XODA 4JQYA 1SXQA 4ZOCA 1GPBA 1RWOA 1Y1KE 2R65A 3D3EA 1WULS 2DQKA 3AR8A 1CUIA 1T3LA 3H2BA 4GPIB 5T57A 1RJFA 1AKTA 4AUKA 5JD4A 1KDZA 4OY3A 5MDHA 2OGUA 4KVAA 1XX6A 5DGTA 2QMYA 4OP3A 4E31A 4XGKA 2VYND 4RGBA 1FXWF 1KQNA 3THRA 3EY9A 4MHTA 2XKKA 3QVOA 1H2AS 3FKJA 3WTBA 1SC3A 3DE7X 3EIXA 3ZCPA 4FDTA 1WF3A 1TIKA 3TQHA 3U2QA 1YMQA 4DQ0A 1ZOPA 2DLNA 2YXDA 4FFMA 1XVVA 2HIMA 4PLPA 2CUKA 3OOJA 2XZLA 3FWPA 1MZPA 1YR2A 1CPYA 4DCJA 2ZG6A 3WQBA 4BBAA 3LHSA 3D8SA 1T5DX 4BO6A 5CJ2A 1XALA 3RS8A 1IEWA 3LS2A 1NONA 2BMDA 1KEUA 1G8SA 1SVOA 4UVIA 1HDIA 3RYFB 3TIVA 3ICQB 2B82A 2D59A 2O0HA 3BERA 2NZ2A 3HDGA 3THSA 3SIRA 4AZWA 2PGIA 3A9VA 3WLMA 1VPTA 5ES3A 3EQZA 1WM1A 2NO1A 4HNGA 4YRIA 2XQJA 1ZZGA 4Q00A 4HBZA 4B7ZA 3AL0C 3H75A 4TKMA 3RYCA 4KR0A 5CDUA 1PX0A 2L19A 4XWAA 3OFNA 4LY3A 4CKBB 1KSHA 2WVJA 2PUDA 2UVDA 1WWKA 4LSMA 4F96A 1FNCA 2BP7A 2PS0A 1PUXA 3GJSA 4QO7A 4ZZ0A 5BMVA 3ICWA 5C18A 5BN3B 4ZVNA 2HI0A 1GPKA 3GRPA 3ITDA 1U04A 5BUSA 1B8VA 1WXDA 2MTBA 3JYNA 1N4AA 4P54A 5HM6A 1OI4A 3R0VA 2QM3A 4PRYA 6PFKA 1IOWA 4L9WA 3DOOA 5FDFA 5G41A 3TF5A 1Z0FA 2I4OA 3PC8C 3MSXA 5ESXA 1G21A 1HYHA 2DJ5A 2VJKA 3DT8A 3EVFA 2Q27A 2VL7A 1FDIA 1R6DA 2G6BA 3HWWA 4JR1A 4Q7JB 3WJ2A 3OPMA 5B58C 2EJUA 5EJ6A 1CJUC 3EBPA 4NU0A 2VA9A 2GI4A 2QOEA 3ESXA 4NWIA 1QYCA 1FJGB 1ZJYA 4D98A 1KI2A 1R0LA 1ZGGA 4PBRA 1G6OA 2R1VA 2IIVA 3VR4H 4CLDA 1YRWA 3BIXA 3NEJA 1FNDA 3DDCA 4TZ0A 3STWA 3ORSA 1IDOA 5L3QA 4XR9A 2HIAA 2JIPA 1C9YA 1UM9A 3OQHA 5LQNA 4HWKA 1N9ZA 3UYLA 3T3NA 1LVGA 5FPYA 5HJEA 3FPCA 2O8CA 4MVJI 1WW8A 2XHEA 1UZUA 3KXDA 1NLMA 3IAHA 1V9SA 2QQGA 3F5QA 4EIWA 3KLOA 2AH5A 5B57C 3UN1A 1M6HA 3FRJA 3E5MA 3WRXC 3Q3IA 4UQLA 3W5BA 3TJZA 4KPEC 4B6SA 2C5LA 1V8FA 3CCFA 4HRYA 4LYFA 3UKJA 2X41A 5D3ZA 3WDSA 3NWBA 4ZJZA 4DSTA 3OE7A 3V46A 5LKRA 1P0FA 2Z9BA 4KR7A 4AI6A 3I62A 3LKZA 4FZVA 2JEZA 1C3OB 3O38A 2J3DA 3E7DA 4TVOA 4XDGA 3E1GA 3VKWA 5G1NA 1ISPA 3HRKA 3L05A 6NULA 1PR2A 3TX6A 4DXAA 3AUJB 2A5LA 4AVYA 1SQGA 4OVKA 2E48A 2JFFA 3PEEA 4F56A 2GPBA 3S8YA 2FR8C 1I3OA 5K3OA 3ZD8A 3TMKA 2DUNA 1TVCA 4X71A 3U7IA 1KQFA 3IP9A 2G04A 3LUGA 4BC1A 4E6PA 1LB1B 2VHXA 4ZVMA 3TEFA 2PEYA 3EW7A 1Y9ZA 4ZVLA 2JLVA 2RKWA 3I4FA 1H1DA 2JPDA 3IR5A 1EXVA 5DTIA 4MK4A 3VYTB 3GC6A 3PYMA 4G1VA 3B52X 3Q0IA 1RP1A 3UV6A 3P0RA 3SIWA 5A3RA 4RXUA 5FLEX 2D54A 1AQUA 1UXGA 1R0WA 1BXGB 4RK4A 3OCYA 1RMTA 4I5GA 3GDOA 2OKGA 4QXAA 4NFLA 1NXPA 2WKWA 3DHYA 1N0IA 5DBEX 3P2JA 3TUIC 2O0KA 2PKCA 3EMKA 3OE4A 3ETJA 3HN2A 2BH2A 4BMCA 1Z38A 4RTSA 1TEXA 1EQ2A 1THZA 5EPOA 2BCJQ 3CZRA 3IXLA 3L77A 4JLOA 5AKIA 5JY1A 5I9MA 2O23A 1W25A 1YBHA 4FONA 3MCAA 4YP7A 3UG7A 2PUEA 2FMTA 4RORA 3DEJA 3AP2A 2VJCA 4ROSA 1BVHA 3A10A 4JJ7A 3H19A 2BTQA 4M1EA 3I37X 2EJTA 2G17A 2JIRA 4BMSA 5SZHB 2HA0A 2Q6IA 3OX3A 1YDFA 3MTQA 1VG9B 1XRMA 5M5BA 4NOJA 3SQOA 4LAFA 1IY1A 4KXLA 1NFFA 1N5KA 3RUPA 5FOQA 2AZXA 1AF4A 4F5ZA 2MINA 1ZP6A 3N2YA 2Y77A 3BPSA 2F3PA 1VC2A 3WTCA 4D4GA 4RZSA 5JSQA 4K9LA 4PYNA 2Z3VA 3PGMA 1NJSA 1Z6YA 3W8DA 1QJ4A 1VBNA 4DA6A 1BU5A 3HJTA 5LXTA 1GWNA 2YNMA 4ESEA 2I2AA 3TZHA 1U3DA 4EYQA 1MB0A 2OSVA 2FPOA 4CR6A 4F6LA 4V1CB 1ONNA 4B1FA 3PFWO 4MUMA 5GAJA 3QI7A 1NN0A 1TZCA 4QUIA 4CODB 3DFKA 1YB6A 2Y05A 1ZH4A 4B79A 4Q4DA 2X22A 2ZIWB 3AM5A 3ASZA 4JYBA 3KQMA 5EWMA 3TOZA 2F8SA 1DEKA 5SYNA 5DBGA 2ZDGA 2BHNA 5KKNB 3IKLA 5LM3A 4A2QA 3E82A 4JI0B 5DM70 1LFAA 1ZH8A 5A5FA 3HB7A 1K7XB 2NTNA 3HM2A 3LPDA 4BFYA 4L72A 4OI1A 4Z4HA 4X62B 1QR2A 1J42A 2B37A 4NYIQ 3A25A 4IUBS 4YJ3B 421PA 4KPUB 2IOQA 2PVSA 1ZGBA 4HWOA 3F5DA 3QRWA 4R1SA 4WOKA 4E22A 5KYUB 2FMKA 3VYWA 2I6TA 3PPYA 4YCCA 3GLIA 1MEOA 1F06A 1BA3A 3T0FA 5TS3A 1A88A 5JJKA 2G08A 1PR4A 5BSEA 1NNI1 3T1QA 3VVBA 1H0HA 4KXVA 3J7TA 1VHQA 5F5LA 4WHMA 4CQMA 5EJ5A 2I7TA 2XGSA 1FUEA 1YUBA 3K0FB 3O3CA 3T5GA 4H4CA 3TTSA 2O14A 5HYVA 4GGMX 2MHCA 3Q3GE 1M6VB 1DV1A 4XUEA 4RYLA 4QNMA 1NY6A 2ZYUX 1F8GA 1Z29A 2WVHA 3PJRA 3USZA 3IHWA 5FWXA 5K01A 1TYAE 2HFJA 2HNAA 3R6DA 2H07A 5JNRA 2Q9UA 5JSZA 1LPAB 1NL3A 3R24A 4IIUA 3D5TA 2OCAA 5JW6A 1ZSYA 3IHLA 4MB0A 3RC1A 1T9AA 1UXKA 4RVUA 2EX1A 4NEHB 1SH7A 3BBPA 3R41A 4KL8S 4N65A 4XZ3A 2HY7A 4QFBA 4R5MA 4RKFA 4YT2A 3VNUA 5JVDA 1PD0A 1PCXA 2PRIA 4FI3C 4INJA 3TOCA 3ZWOA 2ZR8A 2BEWA 5EMJA 5I7VA 4CR8A 3A28A 1XJCA 3WHLA 1N6PA 4AC9A 2A4KA 2ZANA 5JANA 4NG5A 3MCVA 4ZO9A 4TKVB 2PE5A 4O29A 3COVA 1HDZA 3DMFA 1DJNA 1U0EA 3OY7A 2G9RA 3EVTA 2HLPA 2UZ3A 4FUQA 1YU9A 4PQFA 5U4QA 1E5DA 4MR7A 1GGNA 3CF6R 4CIWA 2Y4OA 4K87A 1E5VA 2I2DA 5CITA 1BFUA 2HU7A 1PWXA 4TQ9A 3L7YA 1I4TD 4PRLA 5H02A 3RYFA 3AI7A 1H69A 4FJ0A 3FSRA 4GSKA 1Z6QA 3V4FA 4K9MA 2IS2A 1XFAA 1CQJB 4XEUA 1AKRA 1PZMA 3G9ZA 3NDPA 3HZHA 3P4YA 4KNVA 1P44A 2M6LA 3HJGA 4EG0A 3LT2A 4EW2A 2P6PA 5IG2A 4RPHA 3MWKA 4LGYA 1MAUA 4XM2A 1QOQB 4Y2SA 3QYFA 4DDMA 3T0IA 5K6AA 3OOHA 2B4AA 3OTWA 4NG4A 5B4TA 1P33A 2ZWMA 4XIIA 3QKSA 1DRWA 1Z34A 3FIUA 1TJPB 4AQYB 2M32A 5KCMA 2P30A 3QF4A 2ZE6A 3L6CA 4AN1A 4PCAA 3AF6A 4FWBA 4DR6B 5BRNA 4ZT6A 5FKJA 2AOUB 1PWHA 1BMFD 1R0KA 5SICE 2XDYA 3SOZA 2W6IA 1KL7A 3TFQA 4QDKA 4HY3A 3CZ5A 3H87A 5BWOA 3K53A 1P7WA 3KSZO 3GH1A 3L7DA 1YOVA 1W581 3QVTA 4CG2A 1DXHA 5CDHA 2W8ZA 5DM4A 1RKXA 4K86A 3QE3A 3ZN2A 1KZ1A 3L8CA 4FMDF 2X8WA 4NAUA 3RVKA 2ACVA 4BN0A 4LQLA 4TZKA 4GBGA 5AW0A 5U1PA 5JALA 4HZUB 4QTXA 5L51A 2QGFA 5E38A 1USVA 5JR3A 1PEDA 1WXXA 2CYCA 4LA4A 4ZVTA 4ER0A 3R6GA 4X93A 3NT5A 4B8YA 1XMJA 1LX7A 2HUNA 5CLLA 1XA4A 1WLSA 3P32A 5E7IA 1EK5A 2OG1A 3KM0A 4HL6A 4YT8A 4RV5A 2YWJA 1X77A 3S5JA 3W05A 4XGIA 3ZU5A 2RDMA 3CLSD 3A7DA 3AYXB 3OI7A 1E1KA 1I51A 2RKOA 3WDKA 2G1UA 5ADUS 3G2OA 2J3KA 1EFHA 1LU9A 2VJPA 4S1VA 3GFFA 2HWYA 4RM2A 4OGGA 5GMOA 5ALLA 3GV0A 3G5LA 4EGFA 3KVNA 2WU3A 5TEWA 2R97A 1MX9A 2LV8A 4WXEA 3FYUC 2VTVA 4NEQA 1FQOA 2EKDA 3Q3VA 3AETB 4L4UA 2E4UA 3BD8A 4MA0A 4NLLA 3OIWA 4WH0A 1D4OA 3K6SB 3S1AB 1G9XA 4FKBA 2EGGA 4CKWA 1WBBA 4HFMA 2GH1A 2FH5B 3MFYA 2YFQA 1DIHA 1XNHA 4XLLA 2CLHB 3DD5A 3VU9A 4WJLA 3OSZA 5F1PA 5FUBA 4G0VA 2AIRA 2CDNA 1U9CA 1LS1A 4PZPA 2GZSA 3LBNA 2OE2A 3I9LA 1PFQA 5HM8A 1QTNA 2F3RA 3KB1A 1EINA 2GVZC 3S2IA 2A94A 1SCBA 2ORIA 2XVZA 4CLRA 4DBZA 4F9FA 2C5SA 1JJ7A 2IU0A 3ZHXA 4FIZA 4GPTA 4GG1A 4LRSB 2C54A 3GLQA 3ICOA 4G4JA 3ELWA 4G8CA 2VDWB 4MI9A 3U7EB 3L2OB 4QWMA 2ESRA 5CR9A 3T4PA 1KU6A 3QLVC 2LKDA 4MYSA 3OQVA 3KWJA 4B2IA 4IXWA 4AO6A 2RE8A 1Y4ZA 1N8SA 4A2CA 1NY5A 5KTRA 1QR6A 1DIGA 3KWMA 2H0RA 1SCIA 3T4UA 3E9RA 1WQ4A 4TXLA 3D6VA 3S8EA 2GF2A 3MWLA 4GP6A 2PGDA 2NZ8A 3I92A 1M1YA 1XYYA 1QHGA 1XAGA 3OZSA 3WWDA 4PANA 1MX3A 4DJDC 5FUVA 5L4SA 3KQTA 3JARB 5K8IA 1UMCB 1FQKA 1XROA 2EJCA 2PA0A 3DEKA 3QW2A 4GQAA 4R1LA 3IALA 4IIJF 3LQQA 3PF8A 1NFRA 1VZ3A 3ER9A 3T1VA 3A1NA 1DPGA 3OEHA 1MVOA 3LDUA 5EUCA 5ELXA 1T5IA 4CIVA 1G98A 4UC0A 1OF1A 5IAGA 4O33A 3SS8A 2WP8J 2O3QA 4OP2A 1WKVA 1TT5B 2NXJA 5AOAA 2XLBA 4O2BA 4DMUB 4OKIA 4TRNA 4CM1A 1ZKDA 3KOOA 4BB6A 1L4KA 5LMZA 2Z6UA 4GLBA 4BIIA 2RK4A 4WFQA 3KJFA 5IKPA 4L5BA 3PC3A 5A3VA 1GTG1 3FNEA 1JA1A 1MW8X 3TFOA 1RRMA 4C04A 2JIOA 3VNBA 2A33A 2A6PA 4WZBE 5CURA 1HX7A 4TKZA 1CY2A 1T0HB 2WUWE 3HE3A 4JCCA 5CEFA 3K2QA 2ZVPX 3V1UA 2P6OA 3BT7A 2QRQA 3LG2A 2C83A 5FT9A 1AC5A 2FU5C 2FSGA 4JT8A 2W00A 4PG5A 4PS0A 1XPUA 2B9EA 3RUIA 1SCAA 3OTQA 4BASA 1XTUA 5JC1A 1ZXLA 1CNEA 3HJHA 1W35A 3RKRA 1T6ZA 2DBYA 4WZAA 1NXSA 4C7VA 2GK6A 1KYQA 2I6XA 3AV3A 4G5QA 4R83A 4MI6A 3VAZA 2VUTA 5JCZA 1IRXA 4I4NA 1ZZEA 1FYDA 5CGZA 5AJYA 2JJ2A 5KWJA 3CWZA 3ZJUA 1SCNE 4Z1OA 1IBLB 4BNDA 1W7AA 1GTL1 1PGPA 1PNVA 4DADA 3ZQUA 5K8CA 2P2DA 3BMCA 1MIHA 4MUXA 4HN4B 2JGAA 1VIAA 1UXIA 2P2NA 3AB3A 5IASA 1KIFA 2EATA 3IQZA 2VRCA 3KO8A 2DLDA 4NZ9A 2C58A 3AM4A 1A9YA 2IX3A 1C80A 4ZOAA 4FCTA 1DC4A 5CFOA 2XNDA 2OBFA 2VDVE 1GAXA 3AVYA 3Q2IA 1RRVA 3V4VB 5I4IA 2VPXA 1Z22A 1VPEA 4MOWA 3EZ6A 3C3PA 5K6TA 1L4YA 2QU8A 1ZVQA 3A3YA 3U44A 3M1AA 3IV9A 4AU1A 1G291 3JQAA 4YDHB 3T7JA 4BJ5A 2QJWA 1MB9A 3ONFA 1OTHA 5FNZA 4NQZA 2DGDA 3IL2A 1BMQA 3KLNA 1LA2A 3H5IA 2R47A 1IL0A 1JQKA 3I9OA 3GLFE 3PNOA 2IUFA 4B17A 4S0ZA 4MPTA 5CAEA 1H65A 3K3PA 4J2TA 4H3HB 4JP2A 3BTSA 2O1SA 3VU1A 2QTTA 1AU9A 1XZFA 2FK7A 3KLPX 4OQNA 4G07A 1IPEA 4PLYA 3U7JA 1LRJA 3BN3A 1Z0AA 4GO1A 3RT9A 3W6UA 2NO5A 1LDYA 4M53A 2J9RA 1XZJA 1YB5A 3DBHA 3I6ZA 2FFQA 4BYMA 5TIIA 3MWDA 4E5KA 4H1UA 3FVVA 3ICCA 3OFJA 4JI3B 1RBMA 4R0VA 3QMMA 1ZM9A 1A76A 4PAQA 2GPTA 1DGQA 6GPBA 5ALQA 3SJ7A 2IELA 1X7DA 1OLOA 1S2LA 4U0JA 2A59A 2BRUC 3CG0A 1HH4A 1ZN9A 3GZ4A 3D7NA 4AN4A 3AUUA 4PZUA 1TIPA 3FOZA 4POAA 3PJFA 1Z17A 1PK8A 1U1CA 3LQ2A 3ZQ6A 3ZU2A 1C7ZA 2XMPA 1OREA 1NPTO 3LHDA 4QPNA 3DOHA 4IIFA 3I9NA 5LMNB 3EX7C 3OTIA 4LY6A 3OLXA 5LFAA 1HLGA 3WIDA 2OCXA 1PZFA 2PD4A 3QOFA 5EE5B 3CEPB 2VSYA 5JE8A 4BVAA 2GZ2A 1WO8A 4M4SA 2D6FA 1NW3A 1HUQA 4GPEA 2DT8A 3KT3A 2ODTX 5LP6F 2B25A 4BFLA 4XI9A 1AGYA 1C4OA 3BGDA 4AZTA 3WAGA 5F1KA 1EFKA 2GZDA 3HVKA 1JDJA 3JYOA 1W5SA 1Q0QA 5AVSA 5D7NA 4Y6OA 2GK4A 2CWDA 2Q5CA 5KOIA 5DYTA 1QH0A 3GMSA 1G8JA 4HB4A 2CL7X 4GFDA 1EDDA 2PL5A 4L57A 3AFOA 1OW3B 3AHIA 4N40A 4D3SA 3CN9A 1CV2A 1QV6A 4KXXA 5DCLA 1BW9B 4I81A 4URXR 1X7WB 2XQIA 1Z5GA 3SJCA 2BSQA 2RH4A 2BBWA 5EP2A 3VR6H 2QTBA 2EZ9A 3WHIA 4ZI7B 1NUTA 2JCVA 3DMTA 4J4TA 3RVNA 2O8CB 1YKSA 2PVPA 3PF9A 2RHGB 1ENOA 3RIGA 1KDVA 3PNLA 3QXCA 2GETA 3AONB 1ABBA 5B1IA 4BP3A 4PNHA 3DNPA 4F92B 4HX2A 3WMEA 3OIUA 1EGAA 1Y1SA 3G59A 1ZNWA 3WHPA 4DM7A 4WKOA 2Z04A 4DIBA 4EPXA 3UK2A 1N5LA 2JAPA 1ULTA 1AQIA 5UKDA 3F7OA 3BZUA 5E6UA 2MT9A 4O25A 4YMUA 1JEYB 1A7KA 2Q1WA 1U1EA 3EGEA 1UPFA 2LDBA 5JISA 4E6EA 1P1CA 3D7RA 2LNDA 2XQGA 1PT5A 3QXJA 1WCWA 1UPCA 4B3CA 3AIKA 3DMHA 2XTNA 2PKXA 4LV5B 4Q39A 5ETJA 3D2BA 2XD9A 2JANA 2Q4BA 3TXYA 5FV7A 3TSWA 2BF7A 5BMVF 4RIHA 5CUQA 4RDHA 4YCLA 1H0KA 3M4ZA 4WXPA 5DMXA 4KLRA 1YZHA 3UA4A 4P2BA 1YVPA 1G4UR 4MVWA 3WYFA 3L8ZA 1KH3A 2AE1A 5AVKA 4F9EA 1NJGA 2QRVA 1S2MA 1P39A 4HDRA 2ZYSA 1OA1A 2G5PA 4K6CA 2IBMA 2CNKA 3DR5A 3MB5A 6REQA 3R7AA 2ZIUB 3E22B 2JRCA 4HDKB 1M0EA 4I4TB 2JASA 3FPJA 1ESZA 1QH1A 3FAKA 3G85A 2VTEA 2ZWPA 3A3NA 3A6KA 4OGFA 3D2LA 1P1JA 4W63A 3RBVA 1DOZA 1ADJA 2QZ4A 4H1TA 1AKNA 1UBNA 4QT0A 5JSHA 1NYQA 1P2SA 3WHKA 2QRMA 2FMIA 2VWHA 4LF6B 3IEKA 5KZMB 3QFRA 4DAOA 3FBWA 1OLSB 1NQ5A 4MJXA 3JATA 3G0GA 4IV8A 5ESDA 1M9NA 1AV6A 1W87A 5DLEA 3VR2A 5AJXA 2C7VA 2OAEA 2Y1CA 1UOOA 2Z8XA 1T9GS 3K20A 5DRYA 1XNJA 4F72A 4EQ6A 1JJFA 2HT6A 1RJ9A 4OL9A 5E3IA 3WB1A 4LTDA 4RZUA 3LTNC 1FLAA 1LNSA 2ECQA 3OZXA 3R3XA 4Y1RB 4CIBA 2JLZA 1FSGA 2OCYC 5EHGA 4D8YA 2YJ4A 1P2TA 4YAOA 3C5VA 3E27A 3NJ8A 4WNAA 3N5KA 1VGVA 4ZCTA 1QX3A 3ZLVA 2R0QC 1PFVA 1X80A 3FDZB 4DV6B 3OQBA 3CNEA 3MK31 1TZBA 3AIOA 2W58A 4MRMB 1EJ2A 1A5AB 1BWSA 1R00A 1TVKA 2H4WA 3F74A 5LVAA 4IDOA 5E9QA 3U3ZA 4D9CA 3MJHA 4KQ6A 3RW9A 1YA8A 4IKPA 1T1EA 4EGAA 5IVIA 1M54A 3WICA 3FTQA 5A0FA 4GI7A 5C8YA 3S2ZA 5B6IA 1ORTA 3KQOA 3SR3A 5FUQA 5LCXA 4GPZA 1NQXA 4G09A 3ZJYA 1D1QA 2QSJA 4F1KA 2WU8A 1WUTA 3T4XA 3VX4A 3LGXA 5B1EA 4JQCA 2BFNA 2AUMA 3I0MA 4I4CA 2WQ7A 1BJTA 2FPGA 1GNLA 4P84A 5K4AA 4N8EA 5DNCA 1QU2A 1R4MA 4NDNE 4EY7A 2H1RA 3WP1B 1VMDA 1CEYA 3F73A 2IYWA 5DCYA 1O77A 4DGQA 3MINA 4HMQA 2I3BA 1DKQA 4FGKA 3KQWA 4FZ5A 3LNTA 1QFXA 4CU5A 2GEVA 2MIIA 1U63A 4Q01A 4DLWA 4OBWA 1ECPA 4R9RA 2H3HA 4EB6A 1I7SB 4M9QA 3TVDA 3TGLA 4KFSA 1ODFA 5C4GB 1VJRA 1ZRHA 2FPSA 2I87A 3RFVA 1L3CA 2W37A 2IUTA 2H08A 2YICA 4KK3A 5GM2A 1H2XA 2D2EA 3BMCB 1WG8A 1FUYB 1C2YA 1P2FA 1Q17A 2EFGA 1ZMOA 1IMJA 1W5TA 1RE0A 2LZ0A 1P5RA 2G82A 3A4NA 4U7PB 4J3NA 5JH7F 5GINE 2XGGA 3BZBA 1FTNA 1KZHA 3IPAA 1I8TA 3CF2A 1Z3IX 2CDAA 1S3IA 5F5XA 1HYGA 2YXBA 3I5UA 3KYDA 2ZULA 3QJYA 2IXAA 2P9QA 4GLFA 3HCAA 1TM7E 1PR9A 3D0OA 3ZW8A 4OX9Y 2Q6OA 4Y3UA 4PTZA 4QVKA 5TGDA 3LOQA 5T3UA 1DMSA 3EIWA 3IP8A 2XA9A 4LBVA 2GJSA 3PR3A 1VCMA 2BGKA 2FUG1 3DR3A 3VYRB 3UZUA 3DL7A 2VUHB 4UE3S 4DQVA 3SN6A 6ABPA 1E9EA 1UWVA 5I9SA 2GASA 2DTDA 2HNKA 2QYOA 1GZSA 3E9QA 4UCXA 3VUFA 4IO1A 3SJAA 2YS7A 4NATA 3O8CA 4RETA 1QIEA 3ZE1B 4A0RA 1L1QA 2G88A 4XFJA 5DP2A 2FN9A 2YWRA 2YY6A 1E59A 3EVZA 3NUGA 4PSVA 1V6CA 1AY0A 4K46A 4ER3A 3Q8LA 4AECA 2FEWB 4UUMA 1KNQA 1Z7WA 1DHRA 1NI3A 2DBQA 2VAPA 4EY6A 1RXUA 5EERA 4EH1A 1KC1A 3WLKX 2E1RA 3ND8A 4NE9A 2PQ6A 4G25A 3O26A 4R0NA 4BEBA 1EBFA 4ZT2A 3PHJA 3LTEA 4MQ5A 2J87A 3V1YA 4MKIA 3U1TA 4UVGA 3TX2A 4BFWA 5FAXA 3BFKA 5ICCA 2ETVA 2WI8A 3GCZA 4DLUA 5JHGB 1MC4A 1R0CA 1GVNB 1RE1A 1XDWA 1XZNA 2ET6A 2AYYA 2J85A 2NM0A 1HG0A 1GCUA 1G20B 2OB2A 2GD6A 1P9NA 3L1HA 4EEXA 1CD5A 1W1UA 4EMBA 3B5EA 3NVMB 3PE4A 4MH0R 2X23A 4FQ7A 1L7QA 2X7XA 4LXUA 4OCZA 4G9BA 5CYGA 2Z8YA 4LBYA 1XLWA 2A7QA 3F9RA 1BHSA 4MLDA 3ZI0A 4QC2A 4Z51A 1GEGA 1VJTA 2VQDA 2O6LA 1YOBA 3R2JA 3INRA 4N3GA 3ORFA 2BONA 4QFCA 5BR8B 1TF2A 4WESA 3U4HA 1MJGA 1VSUA 3DC2A 1JLKA 4R2HA 1TW3A 1V16A 3I5MA 3DEHA 4G36A 5I7AA 2J5KA 5THQA 4Q24A 2YUIA 1WF6A 3OIVA 1EUCB 3U3XA 3N0RA 3N70A 4Q7KA 5BPFA 3E3LA 1CDDA 2X42A 3I30X 4HS9A 5JS8A 1Q83A 5HIAA 1O87A 5CNIA 4EI9A 3W06A 3E48A 2PZJA 3GPDG 2BSAA 2YW2A 4CLOA 3DLBA 5FUMA 4UTPA 2JDIA 1K6XA 2EYQA 3NAZA 1IN6A 3ONWA 3P9RA 3ER6A 1NHWA 2JFGA 3IA2A 4AJHA 1H2EA 1OBVA 3V7FA 2W90A 1AKVA 1DQYA 3LYHA 4W7IA 3L7OA 5JJ5A 2C96A 5E3JA 4AUNA 4BX8A 1KI6B 3HKDA 3SC4A 5BV0A 5BN4A 1K8ZB 4FWIB 2XJ4A 1MA3A 1UQUA 1SURA 4YRSA 1IAVA 1DP4A 1PQ4A 3I2YX 5EZQA 2OK8A 3I4LA 4N4AA 3EUAA 3NRJA 1WXWA 4ZQBA 3CH6A 4QDZA 5DIZA 1FFGA 1RT9A 4YIHA 3ONDA 3QBDA 4NS4A 2QRNA 4J1QA 5IWAB 1P1HA 2DE0X 7REQB 1E18A 2CMHA 2VQSA 4Q1FA 5HRAA 3IE2A 4PM4A 5TMPA 1QGUB 2PR2A 5FWNA 5CM8B 3L1KA 5KI6A 1G8YA 4N9WA 3I5XA 2FETA 2A67A 2E4YA 3GOQA 2NYRA 4PYJA 4GS5A 4P81A 1ZUHA 3IP5A 2ZIVB 2W6QA 2GRAA 3MM4A 1IG3A 3VFDA 2R00A 2YRFA 3C98A 1U1GA 4V0LA 1UM9B 4LDNA 5H70A 2AQIA 1JEDA 2ZI9A 3BMNB 4WLOA 3TE7A 2B92A 3ZE6A 1SK8A 4ZO6A 3IIIA 3PPVA 2GN1A 1IIRA 3DKRA 5TY0A 1KU0A 4J3FA 1IJKA 2Q7OE 1K6MA 2AFVA 1IZ9A 3BILA 2X6QA 4A6XA 2NT4A 4X20A 1N2ZA 4BV8A 4Y1GA 3ZH9B 4RSHA 2AN5A 3LFUA 4DV5B 1SUCA 3WFJA 3PXXA 2XYRA 4I1IA 4RO0A 4TTSA 1UPAA 4LDPA 5HDQA 3X1KA 2NU8B 3W2EA 2OL4A 2DUUA 3LP6A 2WJZB 4MMYB 5J5AA 1KOGA 4QGAA 4CL8A 3EG5A 2XMGA 5K0SA 2OBBA 1MXFA 1NNUA 1KK3A 3DZKA 4PO8A 2ASVA 3U3OA 2BLLA 2VHZA 3K1TA 1XG5A 3IEUA 2OHVA 2JFXA 3NHWA 3R9IA 3RE1A 1PR0A 3F71A 1L5MA 4YP1A 3A0RB 2NVOA 1L7OA 4BZXA 1I3NA 3A6JA 1IAQA 2GF0A 1A8PA 3DTVA 4KZKA 4QBKA 5HTOA 5EPUA 1ECBA 4C6SA 1T6NA 3WLFA 1MLDA 2CV2A 4NX2A 4X95A 5E2IA 3TW8B 5DM1A 3ZY3A 1N2IA 4Z0PA 4PZ0A 5EQJB 1XXHB 2JAHA 2KSQA 5D7BA 4WWHA 3DFFA 3TNJA 2WFMA 2WT9A 4UAVA 5EMLA 1UDAA 3TLXA 5CFNA 1X7XA 3TKLA 3QVJA 1Y6QA 2ZUUA 3DEYX 1USKA 4XLTA 2H59A 4FYWA 1X7HA 2P11A 3B89A 3O1JC 1GU7A 1BOOA 5DT9A 4P32A 2HMYB 3REFA 2Y4NA 1K75A 2MOKA 3CVJA 2ZRKA 2HSDA 1TPZA 2CFTA 2I2FA 2C4HA 3DDNA 4HXEB 5HBRA 5CTAA 4CM4B 2NYUA 4EPWA 3ZDDA 1GPWB 1EHCA 3ENNA 1MMFB 5KTYA 4Z0TA 3G8YA 2C7QA 1UINA 3QEMB 1O9GA 1ODKA 1OHHA 1WDWB 2VH2A 1GUFA 2ZYDA 3KSMA 5KSZA 5HK8A 4D3FA 1ND6A 3D8NA 1JEAA 3A27A 3DCYA 4FFWA 3I9MA 4LTMA 5FOXA 3R8FA 1D3AA 1WZEA 1YWGO 3DDOA 1VLVA 4NENA 3CR7A 3WBFA 2V5AA 4NTZA 1AXEA 2IC5A 1R9NA 1E2QA 2EZTA 3O7MA 3CKKA 4UM9D 4EY4A 3L4JA 4CGYA 1E66A 1VJ1A 4FINA 2ZDQA 4AJEA 2IK8A 3KU1A 4Z9FA 3EGXB 1D0IA 4I3HA 5LNK6 2QTZA 7AT1A 2Q5QA 1OU0A 1D5CA 1DKMA 3IQWA 3JVUA 2XWSA 3OO0A 3URMA 5B64A 4XWGA 1OA0A 2IL1A 3CH5A 3RBZA 2ZI4A 1YE5A 2VKTA 3ZWCA 4GT1A 3K71B 1IVYA 2PGNA 3CTPA 3QEKA 1GG2A 1Z4LA 3AUAA 5DFAA 5A4AA 2ZSIA 5DE3A 5K8LA 4RULA 4IZOA 2Q3BA 3A2NA 4A73A 4KU4A 4DSNA 5KU1A 2HWXA 3PCXA 4ME6A 1ZJWA 2TSYB 4C7OB 4G26A 2WPDA 3NS7A 4P35A 4Z3OA 1AOXA 2WSSA 2P69A 2EJWA 3D0RA 3WSWA 1EFDN 3GJ5A 2H18A 3UMJA 4UMVA 1VKJA 5JD5A 2XGJA 4D57A 2A1UB 3I8XA 4TUYA 3VI3B 3E2PA 3COJA 2NLOA 2O05A 3LL7A 1IBSA 3JQ9C 5B3AA 4AG3A 4UTXA 4D9KA 4O4IA 3TE6A 2V7UA 3AW8A 3LZCA 4U5XA 1XTSA 2NQTA 3OZBA 4EO9A 2QRGA 1IXYA 4UMEA 2R8EA 1Z62A 3FUUA 4ABYA 1Y1QA 2G80A 3PUWA 5A03A 4RA9B 2GN9A 4OX9B 1FTGA 5E95A 1Z26A 4RPKA 2GD2A 3W9UA 4CLHA 3EXHB 2G67A 5HQTA 2W8BB 4ESOA 2VZ8A 4AX8A 1TLFA 4K0KB 5DHAA 2GPSA 3QMVA 4YALA 3WGKA 2AZMA 5CA1B 4NNJA 1I6LA 4FNAA 1GPNA 2Q41A 3ES9A 2KMLA 2NPOA 4GGOA 4AWBA 4BO7A 3VR5D 2PSDA 4LV8B 2Z5VA 3BGVA 4BQPA 2XT6A 2C0QA 5DULA 2VJQA 1LLUA 4B6OA 3DM9B 1JAYA 3A6HA 4AMZA 4F85A 1M66A 3LCJA 2I1LA 5G02A 2W2TA 2HQRA 2RHBA 3ZNPA 1V1RA 2CNBA 4BMDA 3JQAB 4RENA 4BRZA 3ABIA 3PE3A 3VKFA 5BW5A 4HNRA 3BKWA 2GZHA 3AB8A 3AERA 4HAOA 4J9UE 1JLRA 4KQEA 4GC9A 4KN6A 4M36A 4RKRA 2HYDA 5CH5A 3JD1A 5DTEA 1IN1A 1M1XB 3MLEA 4H16A 1OI2A 2Q8QA 1V7QA 4FJ1A 3QVUA 3KJXA 3B5IA 2A57A 4MRPA 4PAMA 5ER9A 1SG0A 4KUGA 1ZITA 3TO5A 5JTTA 2HHHB 3F3YA 1QM5A 1CUJA 2H92A 1K86A 2QNRA 3FTEA 3W2FA 1U7WA 3AEKA 4PBSA 3BRWA 1DELA 4WY5A 3ZCTA 4RD4A 4C43A 4C7JA 3C3MA 4D25A 1XD2A 3OZDA 2I2BA 5LU9A 2WWRA 3IMCA 4ILKA 4ARAA 5B1YA 4LOHA 4YCDA 2W2NA 5FNVB 3E35A 4X6LA 4KMMA 5T4EA 5K05A 1T1IA 3LI2A 5CH8A 1HNXB 1RZUA 1N92A 2A88A 3EOZA 4RCYA 1Y4SA 1TYEB 4J1TC 4YTEA 5THKA 3BXZA 4ZK6A 3TRJA 1XEXA 4LZPA 2IYYA 2RH5A 5IW8A 5AVOA 1R88A 5ALMA 4DIFA 5BNIA 1OVMA 3GCXA 3RHTA 2GCIA 1C7QA 2YIMA 3JPYA 1CEQA 4R98A 3QVKA 1KYXA 4BWVA 1U3WA 3JAKB 1YVDA 1MIOB 1NVAA 1L7EA 1TVMA 2FEXA 2X15A 4I5FA 2V9CA 4KLZA 3UMCA 5CDTA 4JLAA 5IK2A 1U9IC 1KAHA 2D7CA 3L7AA 4M9SA 4DPLA 5MN5A 2ZCJA 3AM1A 1CUCA 5E6SA 1PWEA 2ZQZA 2Z8YM 1MN6A 2OGZA 4WFJA 3KHKA 3RSZA 3VHLB 3W2TA 1Q50A 1Z82A 2YJNA 3U40A 2GERA 1B3BA 3CG4A 3HPQA 4BE9A 1E9AA 2ZSEA 3P45A 2P5YA 3H6HA 1MA0A 3FNQA 3IEIA 2IXDA 1X74A 3FDIA 3HUUA 4UXJA 1OFUX 1NP7A 5B36A 5KNCA 3TUZC 1OJ7A 2IP1A 4PXSA 1P9LA 2VSNA 3SDBA 3WC4A 3R09A 3VR5A 4O4JF 4OIFA 3P2KA 4XIGS 2X8AA 3B2QA 1H9CA 4OHXA 4EM6A 4AZVA 4M0DA 1DQNA 1D9XA 3AY0A 2H1SA 1NZDA 4CUZA 5EESA 2PX2A 1DRKA 2WWVD 5FJIA 3GLHB 2XRYA 2XSZD 5DPMA 4B5LA 4LBZA 2C57A 1RBQA 2IIPA 2R5FA 3M6AA 2R8BA 2RGEA 3NNDA 4FNMA 4PPNA 4YJHA 3UAVA 1SXPA 1PZNA 5IBCA 2IH4A 1U7ZA 2QRUA 1NULA 5C53B 1OXXK 3H4VA 4QD3A 2ECFA 1JIJA 2A35A 2JJMA 3VSCA 4E14A 3IUJA 2IUYA 4E4RA 3PQ3A 3BH7A 3QU9A 1VJGA 4DA7A 1E9DA 4CUKA 2QLNA 3ESQA 3TN7A 1Z3CA 3SE0A 1NG1A 4ETNA 3QTLA 2IP2A 4J16C 1KQ3A 1LF0A 1FS6A 1BVYF 4N3AA 4LJ6A 1TUBB 3N2ZB 3MGKA 2GB4A 1QKKA 3B1ZA 4AP9A 1ONOA 1YONA 2MYTA 3TLYA 3OZIA 3IR6A 2NUAA 2F59A 3V4PB 1W2GA 3ZDRA 2IITA 3ELDA 3RRBA 3EGDA 3BG5A 5IJ9B 2EKLA 2HMTA 4BAGA 3N86A 3IBTA 1CUFA 1V8ZA 2PKQP 3WWZA 5BRAA 2V65A 1XA3A 1E62A 4XQEA 3VVMA 1YBFA 2BFWA 3K31A 4CTNA 2YV3A 2H1FA 3KKOA 3OCVA 4K9KA 1BQ4A 1T1GA 2AC2A 5EJ9A 4TVSA 3KPWA 3AJEA 4RK1A 2XKAA 1AXRA 3CUKA 4XYBA 4AJNA 1G9TA 3K9WA 1DAMA 1B8UA 2JIMA 4JYMA 3D8HA 2ANCA 4E1BA 4TQAA 2OENG 1BHO1 2H63A 2VHQA 2JGMA 4J7AA 2XRZA 4HRVA 5I3ZA 3OH8A 3ONVA 2D2XA 2O0MA 3KKZA 3SU8A 3FVRA 1AXGA 1SUPA 4OQFA 4A0HA 5H80A 3KAQA 4WVFA 2MDTA 1WNFA 3AI2A 2W6JD 3QI2A 3TZ6A 4I8IA 2FWMX 1JHDA 4E1VA 2K2QB 3MG9A 1O6BA 2HTEA 2QG9A 3JW8A 3VMMA 3VNQA 1ZVJA 2V55B 4OHBA 3CUYA 4AXBA 1IEVA 2EWVA 2QPOA 4HCJA 4CIAA 2NVWA 3E9NA 4HNAA 2I4NA 2GN4A 1AB6A 1Q12A 4B73A 4U7JA 2PTGA 3FMFA 1S01A 1UPUA 1KJ8A 2JH8A 1Y8QA 3M6MD 4M8LA 3EFOA 5D87A 5TE9A 4A8PA 2FDRA 2BE9A 2WNSA 3NXSA 4MW0A 1NW8A 3DWFA 2EQ5A 4U4AA 5I47A 3FFXA 4I50A 2PX5A 4MVJF 4Q3NA 4XB6B 4ZI7F 5AVVA 1G2OA 4L6IA 3U9LA 1IK4A 1GUAA 2P9FA 1RKQA 1B7GO 2J7PA 1WV1A 1WE2A 2K87A 3NHZA 2YJZA 5TB5A 5THXA 2EKBA 5CB4F 4PNEA 4U7GA 2VYQA 5J4HA 3OQPA 5J2UA 1J07A 2GCGA 2G4VA 2HLHA 2Q4TA 4H0CA 5F21A 1Q7BA 2Q6KA 1O96A 3OVMA 3VMFA 1FNMA 1TADA 2P90A 3BCRA 1JFFB 3NDJA 1XRQA 3L8GA 3JR7A 4JKIA 4KQGA 3EF1A 3SKYA 3PKZA 4AZSA 1XWFA 4DMRA 2Q8NA 1HE2A 1KK2A 5D1NA 4BE4A 2CLEB 3CVXA 2JFQA 4RLFA 4JJZA 2V98A 1QC5B 2UU9B 5IDWA 3AUYA 1ZY2A 3NHBA 1L4HA 3UJBA 3P20A 3N6RA 4HXGA 4G1FA 1MB4A 4XXHA 5IVDA 4FD3A 4DRZA 2NTVA 4NMWA 3KXLA 4B33A 1J24A 2F00A 2O50A 3TPZA 5F64A 4CT4B 4BZQA 5BMVB 1X1QA 2C31A 4QBHA 2ZYAA 3VSBA 2QMUA 3E9MA 2VHCA 1KO7A 4JI6B 3PL1A 3H0EA 3DZBA 1T3HA 3MN1A 4QOGA 4BRSA 1IM5A 1YR1A 4B9AA 1I1QB 3WK6A 3GZJA 3RHZA 4K81B 4ARBA 1ST3A 3HKBB 3JQ7B 1L9XA 1Y9EA 3FOWA 3UY4A 2OV4A 3IUBA 2D5CA 2J6IA 3P4UA 2CDCA 3EBOA 4GQIA 4URHA 5ALYA 2BYTA 4HWPA 5CT4A 3UJ7A 2DR2A 4LOIA 4RIGA 1HE1C 2REBA 3TZCA 3T8YA 3ROPA 4EZBA 2WV9A 4RVOA 1D2MA 4FDLA 1QP7A 1NBMA 3GJ3A 3MBOA 4MHSA 5F2OA 5BN5B 1J09A 1JWAB 5IWCA 4A8JB 3GRKA 1CS0B 2XUGA 2YIDA 3EC7A 4X3CA 1NMXA 1QRTA 1GGFA 2B8WA 3UKOA 3GEPA 2OBYA 2GSWA 2R6FA 3LYAA 4BZWA 2O57A 5JH7B 1GCGA 2HK6A 3DB1A 2XNDD 1A98A 1EK1A 2D5AA 2OHOA 3WOVA 3SD7A 2ZTUA 3COWA 1HK7A 3NH6A 1TO1E 3S5UA 2N0SA 4D92A 4JKOA 4UBNA 1M1ZA 1XU9A 4RK6A 5HQ3A 2ECPA 1II9A 4DJJA 4ZV7A 5BRJA 2C5EA 4DG9A 4GHWA 1EFUA 4ODIA 5IC4A 2CJYA 3ZLBA 3K1AA 5HF9A 1FXWA 1JSLA 2I03A 1SUBA 1MJFA 1FYVA 2MSEB 4OI4A 5A5EA 1XJ0A 3T15A 2DPMA 1H22A 1CWUA 1G8KA 1L6IA 4GI3A 3U26A 4CFYA 1WHSA 2EP5A 4D56A 1HE3A 4BX0A 3KWLA 2QTFA 3KEMA 2HXSA 1JIUA 3UUWA 2WYOA 3H18A 2NTEA 3QM1A 4UFPA 1QX4A 3CVUA 1ZEJA 5C3MA 5B2FA 3PHIA 1J20A 2AK2A 2WJHA 2WV7A 3F4KA 5KJEA 5JG7A 5JUWA 1XR3A 5J47A 3HG7A 4G1MB 5A05A 1M34A 4NU6A 1KK0A 3UANA 1E69A 4MV5A 1R9MA 3BJRA 3G2PA 4RTPA 1TQ2A 1ECFA 4ZU6X 2XMBA 3SCZA 1JHXA 2Q50A 2ZYGA 3MC1A 2Y27A 2APJA 3AJ9A 3CLHA 5HZMA 1YDMA 1XLTA 1V41E 4D74A 3VH4A 4AIRA 1PT9A 5BSFA 4IBOA 5HKKA 4EG6A 3BJZA 2YV2A 5DLPA 1VYUA 3V1TC 1Z5UA 1TQDA 1IWOA 3ZR4B 2ACEA 2OECA 1LPBB 4CDNA 1N2SA 1SUDA 8OHMA 1Z4KA 1EWQA 2R3SA 4IGAA 5HXAA 2WBLC 3QPDA 1Z4IA 3KG2A 1UZMA 1SHUX 2WC1A 4CM3A 2AFHB 2VPIA 1SD1A 3L7KA 4I4IA 2AEJA 1IHXA 1EG2A 1P5ZB 4UXHA 1RPNA 2VUIB 3V2IA 2XRMA 5B6PA 1F0NA 2NUPA 5DBFA 2UZ1A 1V35A 1D5WA 1PHPA 3FFTA 3LCUA 4NP6A 3KZNA 2ZUTA 4R8VA 3VPGA 4ETWA 3QTBA 2WTNA 4Q7LA 4EPYA 2PX4A 2ZJ0A 2LR0A 1EWKA 4I1PA 1SMKA 1Z56C 2J46A 2VP0A 5ALIA 3SJBA 4P3PA 4QSHA 2IH5A 2IS6A 4C4TA 3PSAA 2YJTD 5B7QA 1UP4A 1F38A 3KZVA 3L0BA 3JD3A 4G0PA 4LRYA 4CKCB 1N0WA 2C4WA 1ZU4A 1TC2A 4QAQA 2LW7A 3NVDA 4ENTA 1PIWA 1VSBA 2P7IA 4ERNA 1IQPA 3ACBA 4XUDA 1AKEA 5JDCA 1M7HA 2IOHA 1NBHA 1QZ3A 3KBBA 3QMWA 1XCBA 1H9BA 3H2GA 3VJLA 3UGJA 2XUPA 4RTMA 2CYAA 3NIFB 5J63A 4A8HA 1TQ8A 2FPRA 4AG5A 4PPFA 4C2AA 2X4GA 1FMLA 1UBUS 2QPTA 3ZWBA 4Q03A 4EOGA 1PL0A 4QXQA 2X2EA 3FFBA 4TV8F 1S4MA 1SA0A 4V1CA 5KWSA 5C81A 4D81A 5EWLA 3SHWA 5LN1A 4XDYA 3QXGA 1Q2XA 4U2BA 1GAEO 1GZ4A 4QG7A 2DVMA 2LDXA 3PTLA 5LQJA 1OQAA 4CMGA 1N2CA 4DMKA 1T4CA 4F8YA 4X0EA 5CM2Z 4R31A 1JFLA 3LXXA 3R0ZA 3RSFA 3U31A 3KPVA 3KS9A 3U39A 3ME5A 2QTNA 4RANA 5ERYA 4RABA 5FA6A 4Z86A 2AJCA 1NWCA 3A4MA 4AS2A 2M6KA 1OB2A 1YJ8A 1N25A 2VYFA 2R2AA 4JLDA 4Q34A 3PGXA 4X1KA 3KAPA 5BVHA 2FG6C 2PH7A 2H1CA 1IK6A 3GX1A 2Q6TA 1VIDA 2ZPUA 3KL4A 3CX7A 3QXHA 5H4GA 4GZ5A 4BKOA 1JALA 1CZRA 2JIBA 1K3UB 1PJSA 3PFCA 3Q3JB 3IVCA 4IWXA 2O7VA 4DMGA 2H11A 3MINB 1MXHA 4PSKA 1D0SA 1G6KA 2II6A 3PGLA 4PFSA 2ZXEA 4AB1A 4D3ZA 1I1NA 4YMTA 2HB6A 4WK0B 4G0NA 3WIVA 2VQ3A 4YASA 4GOXA 2Q0XA 5A3SA 4BBJA 3SNHA 1BCSA 3DE2X 1ORWA 2A58A 2P4UA 4UEOA 1ML4A 3F0TA 5CK4A 1IM2A 3RDPA 3WDMA 3R3SA 4PU0A 2W2MA 4ISCA 4MV6A 1KYIA 2Z9CA 2FZVA 1GPMA 4FD2A 3L0IB 5FHQA 3OCZA 1X0VA 2ZCUA 1RCFA 2X40A 2YRXA 3H9CA 2Q0QA 1SJ9A 1T34A 1U4OA 1VE1A 1GTSA 4KG7A 1CP2A 1DB3A 1T3SA 2PLNA 1GG5A 3X1WA 2I55A 1A4XA 3K4PA 1UP7A 4HWSA 4NESA 4F11A 2RGNA 3H1GA 2CCGA 3V1KA 4XDZA 3H04A 5FI0B 3S70A 2GCOB 2V4MA 3A3PA 3NHFA 2TMKA 1XXHA 5AHRA 2HSEA 4XQCA 1NQWA 2Q5OA 4N03A 3LIIA 4NYJR 3VSDA 1CUXA 1YC5A 2QX9A 4MJLA 3Q7RA 3D2AA 4M60A 2DHRA 1JDBB 1XJWA 4L95C 2AOTA 3UAYA 1X9IA 1OZFA 3A4TA 3FDFA 2PSJA 4QNRA 4TXMA 4M9ZA 4BKMA 1RC8A 1T26A 2JATA 1E3LA 1MC1A 3B13B 4HGPA 1EIZA 1STOA 1QC5A 4GIBA 3RODA 4OXXA 2E89A 4L2IB 4LVOA 1ZMTA 2FOLA 5AO9A 5GWXA 5HPYB 3SX4A 4LHVA 2PCJA 3TQSA 3RREA 3UCFA 1QLHA 1J1UA 4XASA 5A9SA 1BGXT 2DCMA 2QN2A 3CF4A 4Q6BA 5KTMA 4AF8A 1LJUA 3JASA 2QP3A 2B30A 4OG2A 3L04A 2XTMA 3TSAA 3EEQA 3LRTA 3ZEIA 5CFRA 2X4LA 3PWZA 4F86A 5KYWB 3LKDA 4IQ0A 4DR7B 1ZNXA 1KYWA 3AVXA 1J5XA 2R6CA 5EE3A 4POOA 1CR2A 5MGBA 3BXOA 3H2KA 1V8BA 2P41A 3A1TA 2BJHA 1EIWA 3K0KA 2V9ZA 3JVDA 2OFPA 2IEAA 3H8VA 2HDNB 2WF8A 2FQXA 4TTJA 2H52A 4IRMA 3SBDA 1X15A 4ZZ1A 1O89A 4TYNA 3GGJA 2B21A 2BGIA 2WB4A 3Q2KA 3LUAA 1CVRA 4GW3A 3Q41A 1QGDA 1N1DA 1EJ6A 4BVFA 4HNSA 3CZCA 4HDMB 2OESA 3FG9A 2AJDA 3V4LA 4F9GA 2WDZA 2ZVDA 1J90A 3T94A 4KPYA 1Z6GA 5DNYB 1TA4A 1V3VA 3HHPA 3GLVA 1E9FA 1RC0A 4QUBA 6YASA 1QYXA 2V58A 4IHJA 3RSLA 2GA8A 3GCDA 2FPXA 5F2EA 5HMLA 1GRQA 3SLRA 4BNJA 1G1MA 2Y0PA 3KLBA 3LZ6A 4MA4A 3N8DA 4N39A 3PHGA 4ZC8A 2GWRA 3T1NA 721PA 1NC3A 2J3MA 2N1BA 5EUMA 3LLSA 1IOZA 3JQPA 2WJIA 3RVDA 4L8LA 1X7ZB 5C37A 1NMQA 3MRXA 2VHEA 2I3ZA 3GDGA 4KCGA 2NO4A 3EF0A 3KQUA 5AVXA 1AV7A 1ENZA 1DNPA 4BXOB 4HB3A 3IUEA 1PSZA 4TRJA 5B7PA 3HGQA 2DWUA 1DFIA 1GNTA 3CW9A 4BOYA 2UAGA 3F47A 1JHVA 1MRZA 5CT9A 4DMLA 1MC5A 4ADSG 2B83A 2Q49A 3ASUA 4JX9A 4F6RB 2VQFB 3PDCA 1QWOA 2ZSJA 3IIKA 1BTOA 3AW9A 4KO2S 4PO3X 3STVA 4EBBA 2PANA 2ECKA 4MWOA 3HNRA 1DLIA 1UWLA 2FY8A 2ZJ2A 2K4MA 1D6MA 4FGLA 4O63O 3RAJA 1Z5PA 4FFBB 4A16A 1RHKA 1PJBA 4LDRA 1MDFA 3O03A 3U6BA 4KNWA 4HD8A 3WY9A 2PWYA 3O4IA 4F5YA 2COEA 3R5HA 2EFCB 3HHEA 1OROA 2CF6A 2H5EA 3BAFA 3EAQA 1ESEA 2GMWA 2VZ9A 4M76B 3QWHA 4Q4JB 5HUHA 1EEHA 2CL5A 1JWBB 3EPHA 4E88A 1ZQ1A 3TZEA 4PONA 1Z2OX 2GN2A 4WBSA 5F4BA 5NULA 4KVGA 1JSRA 4HH0A 2CJPA 2V7BA 5DHSA 5BSRA 3WE7A 4ZOLA 1L2TA 2B94A 4LFCB 1SUEA 1PFKA 1H5UA 4R8MA 1D03A 2XB8A 3OQNA 1JHPA 1CUSA 1ZCZA 2V96A 2Y3IA 2W42A 3KDAA 1G5FA 1K6IA 3BGWA 1I0LA 4OQYA 2VJMB 3SBEA 3W6OA 5HZKA 1E2KA 2K7FA 4JJGA 3AF2A 1MU0A 1RP7A 2YX1A 2NUTA 2CBGA 2Q7DA 2W93A 4Q9IA 3UJ6A 4E30A 5KYKA 2CHEA 1GZ3A 5KHOC 3PQ2A 4X1YA 4GL2A 1HZZC 2P6RA 4JNCA 4X20B 5JFTA 1CVIA 4FQ8A 2ZWOA 3OJCA 3DE5X 4HC4A 1YFLA 2FG5A 1W47A 3L8EA 2RGNC 3ZCQA 3NBUA 4XIJA 1KGDA 1KKMA 3KNZA 2IYXA 2EQBA 5GZ1A 5LYYA 1R0ZA 4TWJA 1FS5A 4YAFA 3U4DA 3TVYA 2ZCVA 5HS4A 4K3UA 2ZS8A 4FUTA 1SGWA 3MJEA 4WEOA 5FFNA 5G0SA 3U7GA 1ZJ5A 2BMJA 3PR1A 4WKPA 1E98A 1NSYA 3OFKA 4ZC1A 1UCFA 2HMVA 3LX6A 2FR8A 3GMTA 4LI0A 2VRBA 5FBWB 1COWA 3HKDB 1TMKA 2IE8A 4TTVA 5E1OA 1SC9A 5ALGA 3OF5A 3AHFA 3OTHA 3SIPA 2GDZA 1TM3E 4JLWA 4CNQA 2CVHA 4PE5B 3BTOA 4A6PA 1KYYA 3KYBA 1KY4A 3PQ4A 1WSAA 4FHCA 1SVUA 1AO3A 1EAYA 3BGIA 4DMMA 2WUFA 3H4MA 1NBOA 3GDFA 2FN4A 1EAMA 1P5HA 4R9VA 3D7LA 1C14A 2I3GA 3P19A 4KC0A 4QRHA 1JS1X 4U39A 3EEFA 3CX3A 1ZX1A 3GFGA 1GQRA 3QY9A 3G5TA 4LOAA 2NADA 5DGXA 4FNOA 2IV7A 1B0UA 1B1CA 3ID6C 4KN5A 4OMCA 4JP1A 4ALKA 3IESA 5CXXA 1TAGA 4S2UA 3OIDA 3R7WB 4GDFA 5L4NA 1A4RA 4ZYVA 4WL0A 2C42A 2RC5A 2EEZA 4MMXB 1SOAA 1TT7A 1YRAA 5AW7A 2I71A 4R68A 1GARA 1XP5A 5AW9A 4LX0A 1XCMA 4B2PA 3CPEA 3RHFA 2BJWA 2PSEA 5HCIA 4IPTA 4PAOA 1NR7A 4GXRA 4QXRA 3R7FA 4L15A 3H8JA 4PYQA 5LZ8A 2P40A 3W34A 4AFNA 1MUUA 4IOKA 4DE5A 1MKYA 2ANBA 5FBZA 4YMVA 1KORA 4YRNA 4IMJB 4RYDA 2Q5FA 4L50A 1AX9A 1G18A 1JU4A 4H15A 3RADC 2B8NA 2JIQA 1QB8A 3BZWA 3LHKA 2Z43A 1X8LA 4F3RA 4IHJF 3R77A 4YAIA 1EX6A 3RS0A 1WSDA 3FHCB 4Y9SA 2VHVA 1GEEA 2C7BA 4CF3A 3YASA 4KN8A 1RLTA 4WPGA 2QR3A 4CKEA 2WHPA 3WZ2A 1CRLA 1M1NB 2OCDA 4MCAA 4MRMA 5EIBC 4C89A 4CRWB 1VPLA 2VPWA 3T7IA 4R54A 3HFSA 1B0AA 1XZEA 2B9VA 5C7IO 1KOJA 5KO2A 1ZD2P 4O2LA 5FBRB 3A3OA 4RJTA 1KS9A 2RGDA 2ZVJA 4RQBA 4G0WA 1RJGA 1I9GA 4OYYA 1WCV1 2DZDA 1N33B 1ZKMA 5CHEA 2AC4A 5MN4A 3FUWA 5A5VA 5LD2B 4OJTA 2NUBA 3ENQA 1T4MA 3ZIAA 4AX4A 2G72A 2P6NA 4H7JA 4QICA 3P1JA 5GJVC 2O2XA 2X5OA 4PQGA 1NLYA 5K20A 5YASA 1V9LA 1LPMA 4KWTA 2XZOA 4D02A 4LOLA 3E5RA 1SG9A 2YBEA 2FMFA 4S1PA 1YDEA 3R5KA 2FCAA 4EJ2A 1J1IA 4U0KA 5E1MA 4YRBA 5IYZB 5JRJA 1BFDA 2W6ID 3D7KA