5A6XA

Structure of the lecb lectin from pseudomonas aeruginosa strain pa14 in complex with alpha-methyl-fucoside
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTQFGVTAFANSAGTQTVNVQVNNETVATFTGQSTNNAIIGSKVLNSGGGGKVQILVSVNGRSSDLVSAQVILANELNFALVGSEDSTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOSE-BINDING LECTIN PA-IIL
publication title The virulence factor LecB varies in clinical isolates: consequences for ligand binding and drug discovery.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 24
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 5a6xA00
2JDNA 2JDYA 2WRAA 5HCHA 2VUDA 1W8HA 2JDMA 1OUSA 2CHHA 2VNVA 1W8FA 2JDPA 1OXCA 5A3OA 4CE8A 4UT5A 5A6XA 1OVSA 2BV4A 5A70A 1UZVA 2XR4A 5A6YA 2JDUA 5A6QA 1OURA 1UQXA 2BOIA 2JDKA 3ZDVA 2BP6A 1OUXA 1GZTA 2BOJA 3DCQA 2WR9A 2JDHA 2VUCA 1OVPA 5D2AA 4AOCA 5A6ZA
chains in the Genus database with same CATH superfamily
3AZYA 5C5UA 1RJ7A 1UYXA 2RJKA 4GH4C 4HSLA 4LIVA 4C91A 3TRSB 5ISLA 2MHFA 4UBHA 1S0DA 2YU2A 1DGRA 2R1BA 4GAZA 3ACLA 4ASKA 2UYAA 3B9IA 2WT1A 5EJZB 4UF0A 4MXVA 5FREA 3RNSA 4COUA 3NVCA 1V0AA 4QQPA 1CN1A 4OHXA 4FQZA 2WWJA 2BGPA 1VBC3 1FMD1 3BPSA 2QQWA 5F5AA 1Z0HA 3T4VA 1UD1A 1IQAA 4B3NA 1D2SA 4LO5B 3HQXA 5A7SA 3ZIXA 1WZXA 2RS11 5DPNA 3K75B 5BNPC 1BMV1 1WA4A 2GP3A 2HWC1 5FYTA 1V6LA 2UURA 1VAVA 2LW8A 5BNNA 1OQDA 2W2IA 2ZHKA 4EN6B 1H8TC 3LDKA 4UI9L 4FI9A 3RI9A 3USSA 2VR4A 1NUKA 4AGRA 5EJ3A 5FP9A 2B42B 3DPRB 1KRIA 2ZACA 3ZFFC 3KHCA 4J1WA 1CJDA 1EP0A 3GYDA 5J7MA 1RUC2 2BZDA 3QD6A 4YW7A 5F32A 1LGBA 4B7EA 3I2HA 1AJOA 3GGLA 4F3JA 3U14A 1H2LA 1FYUA 5FZHA 2ES3A 4IETA 3VV1A 2B45X 1ZRFA 4V1PA 5FBZA 1HB2A 1N3OA 1QJX1 2P2KA 5LBEA 3VGIA 1Q8VA 4UW4A 4JAAA 1F8VA 1OBNA 4U2AA 4NHXA 1PGW2 3VBSA 2JDYA 3R4DB 2V4VA 2W52A 5DZFA 1DZQA 1BVP1 1V6IA 3FFQA 4R4ZA 3ZFGC 4NMIA 3ZFEA 3GZTB 3UKTA 1AF9A 1SCRA 2X5IA 4BK5A 1W6NA 4ES9A 2EIDA 3O1SA 1PVXA 4IV3B 5E1RA 1OKQA 5L7OB 4F8AA 2C4XA 4CDUB 3VL9A 5JVVA 1E5RA 1Q8SA 4WVVA 5J96B 4AFMA 2B7YA 5LA0A 4Y1YA 4CXWA 3IAQA 4WVMB 4QT6A 5CFCB 2JECA 3LEMA 2GAUA 2Q1MA 4XBQA 3ZDVA 3O1OA 4RGAA 3T0DA 1GBGA 4B4RA 4JVAA 4OI1A 1F9KA 1XE8A 4OHYA 4URTA 4W6YA 1ZBA3 5FIXA 2D44A 2WDBA 4F7ZA 1SFYA 4WM7B 4YGCA 2YHJA 3OCPA 1NY71 1W0PA 4KGGA 3MUY1 3CJIB 3LE0A 5KC5A 3RZMA 4FFFA 3PNAA 3WW3A 3QCWA 5EFUA 5I0DA 2VVDA 1TG7A 1MEC1 3ZMOA 1A8MA 4LUMA 4JRAA 3T09A 2PHWA 3LIHA 1PX3A 4WVWA 1OF3A 1C8M3 1RXFA 1NZCA 2C26A 3KB5A 4XABA 2A75A 3K51A 2WFPA 2AH2A 3VKMA 1ULFA 4GZ9A 3SC7X 2ZABA 5F6KA 1UIKA 1OLQA 1PM7A 5ABJA 1XXNA 2LUWA 2NN8A 5A3UA 4UFJA 4AQTA 4N7UA 5D21A 2WC2A 5BNNC 2GC0A 4LK6A 5AC91 5BNOB 4YZ5A 5C8CA 1JYIA 3C3VA 2D3PA 1VRH3 2FDJA 2D40A 2MEV2 3I8TA 4LO4B 5C5TA 1W2AX 3DF0A 3PUSA 1OPOA 2BNMA 5FXZA 1COV2 3JQXA 2DTWA 4W4ZA 2VCAA 4LTAA 5F5CA 1FT9A 4Z2AA 4NHLA 1YHFA 1J3QA 5T3NA 2CV6A 2RMU3 3H1WA 3KGLA 2J1AA 1JYTA 4O61A 2DCJA 2G19A 2D5HA 4XIOA 5BYNA 1DGRN 4DZGA 2Z79A 5DG2A 2CWMA 2OUJA 2W94A 2VVEA 5IFPA 2ZPXA 1O59A 1R081 1MS4A 4YW3A 3VBSC 4FP2A 3WUDA 3NNMA 4LA3A 2R063 3V65A 4CU7A 5C33A 2IC1A 5DAVA 2PHTA 2RS53 4UW6A 4CUBA 2VBBA 3TEWA 3ZFEC 4HANA 2X5IC 5LBCA 1LU1A 3N9MA 5FLJA 3HN1A 1R1ZA 1XRUA 2WO7A 5DXDA 4AAXA 3CQOA 4IEZA 2LS6A 4PBOA 4X8NA 3DYMA 2OXBA 1DQ6A 4Z82A 1E57A 3OPZA 4HKOA 1ZZ7A 5GALA 4BJ0A 3WCSA 4W50A 4FPKA 1F5JA 1RC6A 2ZEZA 4JRLA 3MDPA 4MADA 1W9YA 1Y4WA 3H1MA 3LEKA 1DYPA 3WW4A 3HBZA 4Y5SA 3OEBA 4EE2A 2D3RA 2GDFA 3R4UA 3VLBB 3PDQA 5GLWA 2QQUA 4BISA 3OG2A 1KQRA 4KH9A 5FZCA 3AYAA 1EPWA 3AL5A 3EHKA 3FJSA 1BXHA 3IPVA 3ITQA 3WT3A 3AL6A 2D93A 2FDFA 1RUH3 4YG6A 1N47A 4DQAA 1YQ5A 4L97A 5CKQA 5FZIA 3JU9A 3O0XA 5FZFA 4RA0A 4COYA 3KV4A 2GP5A 3R6SA 1GNYA 3Q8EA 4RL7A 3AKPA 3C7OA 2CWSA 1NOVA 1QOTA 1QJU2 1XB9A 3LPGA 4TLFA 1HV0A 4CCJA 4E4ZA 4RR3B 5FZBA 5ABJC 3D4KA 2W46A 1Z7S3 4CUCA 1DU3D 5LA1A 2ZMLA 5FXXA 1CQ9A 5C8CC 1S0GA 4NWVA 4E2GA 3ES1A 1LU2A 3VB9A 3NV4A 1CX1A 3I4IA 4I09A 1GV9A 1SLAA 5ACA2 2VUDA 3BTAA 4PQ9A 3H42B 2WS92 4IV3A 5FYZA 3RMYA 5L7OA 1SFNA 2HWD2 1SLIA 3PUHA 4XJAA 1PIV3 1H0BA 4YM0A 1TME2 4JHTA 1IQDC 4WVMA 3TN92 1C4RA 3FLPA 5CFCA 3WDTA 1AR71 4CEYA 5JPMB 3NQHA 5EIYB 2DCYA 4MGZE 1YQ8A 2W91A 4P00B 2A3YA 1GOFA 4R8HA 4SBVA 3UETA 1PMJX 2DCZA 1UWWA 4YW2A 1IOAA 1RL3A 2Q8DA 5FK7A 4WM7A 3THTA 2FZ2A 3HNMA 2WFF3 4LK7A 3BUCA 3T1LA 4IE4A 3CJIA 1S0IA 3NWKA 3VUOA 5F5IA 3HD8B 1JU3A 1POQA 2Z42A 5IFTA 1AX0A 2DDUA 1DZRA 3T08A 4CEWA 4K9SA 4D7TA 1S1AA 1IS3A 2CDOA 1F15A 3SMHA 4LO6B 4XJ8A 2Y6FA 1CIYA 2ZEXA 3FHIB 4QHBA 2TUNA 3AP9A 1WMDA 4DS0A 2RJLA 1R1A1 2ZX4A 4PF5A 3I3MA 2BGOA 4Y4YA 2ZTNA 1OQEA 2GC3A 5IJRA 5GLUA 2WZ8A 3E5QA 4EZHA 2FCUA 5BNOA 2GU9A 1AL22 5FYSA 1L7QA 5L9RA 4AFDA 3OSDA 2RS31 1D0GA 1NLSA 3H9AA 4G4FA 4P08A 4Q8KA 5LB6A 3DPRC 4J1XA 4BIFA 1OUSA 3WNXA 3BI3A 4XCBA 2YG0A 5FYHA 3PVNA 1A78A 5KHKA 3D82A 1V6OA 1VR3A 3W5MA 2W1SA 3FC0A 4QD2A 4AFBA 2UY8A 1AHSA 1WLTA 3NJZA 2O8OA 4MXWA 4FXGB 4K1ZA 1LNSA 2WT2A 2AUYA 1RUC3 1HW5A 2ET1A 3FLTA 1HB4A 3JB4C 4WZCA 2R041 1SACA 4P9XA 4Q4X2 4DUVA 3ZSLA 4IGPA 3SEEA 4CCEA 3TB0A 2QQJA 2F6BA 1C28A 2BTVC 4IE7A 4OMDA 5ANNA 3IMNA 3VBUB 5HCAA 3OTFA 5FO8B 1UPIA 4RQPA 4YGBA 5A3WA 1G9FA 2IXKA 2YFUA 2Q0AA 4EWAA 2CDPA 4IV3C 5L7OC 1EPZA 3AZWA 4INDA 4CDUC 1O3SA 1UMHA 1S4CA 4IEXA 4XTPA 4M4PA 1HV1A 4LLFA 4M3CE 3KQRA 1HB3A 3DL3A 5CFCC 1ULPA 1CZSA 2KD7A 4XCAA 3VHPA 4FVVA 3GBGA 4YG3A 3UKNA 3MW2A 3ZKYA 4HBNA 3U11A 2WZEA 3C8XA 4WVZA 1SBDA 2P4EA 4WM7C 5FY0A 4PIZA 4D3WA 2R071 5FP3A 5I93A 3ZYFA 2YPJA 3AMQA 3CJIC 2A73B 3BIWE 5DQ0A 2BFUS 5F6LB 3AXEA 5A6ZA 2PELA 1LHVA 3WW2A 5CU1A 3LWCA 4Q0QA 5D8AB 5GJ6A 1JUHA 5JMOA 1AR81 3ZYIB 1VMFA 1JN2P 3QACA 2R0HA 3WNNA 3RWNA 1H1MA 2VCCA 4K21A 3H7JA 3RYKA 1IZ3A 5A6QA 2DURA 2JG8A 4XFCA 1G9DA 1BKZA 2ZGOA 4JTOA 4RR3A 1RUOA 2YROA 2JXAA 3ETQA 2ZOEB 3OUIA 3WXPA 1JZ3A 1NXMA 4LHNA 5L9VA 1PVC2 4OUSA 4J25A 5BNOC 4JQTA 3N36A 3BPZA 4COZA 3DXUA 1KFXL 3QBQA 1RUE2 5FPBA 2ZS6B 3LEIA 1ULGA 3WG4A 1PO22 4W6XA 4XPVA 2MNGA 1YQ6A 3RZJA 2KR2A 1Q8PA 2Q1ZB 1T2XA 1UIJA 2RHPA 2KXLA 4LOTA 2VBDA 5BV6A 2WWSA 1OVSA 1YXWA 3E6BA 2MEV3 1WGPA 1X50A 1HQNA 3QH6A 2QQIA 4QB1A 4TYSA 3ZXKA 3ZXLA 1CESA 1COV3 3RWKX 2PAEA 5KBFA 3AYCA 3T2PA 3VZMA 1UY1A 2LTNA 5GLVA 1PGL2 2TNFA 1DP0A 3HPNA 4KBBA 5FZ8A 2JIGA 3C2UA 3N7LA 3T4HB 4ZXEA 2R1DA 3U07A 3LCPA 2NQYA 5HI0A 4KI5M 4Q1PA 1RTVA 1H2NA 1SPPA 4OQ8A 3OBZA 5F39A 1X33A 2CNAA 4RQPC 4SLIA 2PA7A 4QPYA 3VN4A 3AVSA 4LHKA 1OFNA 3W5NA 5I91A 2E26A 4CCKA 4JKLA 2NM1A 5FQ0B 2I74A 3H8OA 2UWCA 4P9LA 1ODMA 2OZJA 4QXCA 5FUNA 4K8FA 1WBLA 4Q4V1 4EN8B 3AJZA 2X53S 1C5HA 1Q56A 4TZDA 4JGYB 5FMOS 2HEVF 4PI2A 3W20A 4BQXA 4LKDA 3W59A 2BOIA 5SV8A 5KXEA 4QXKA 5KXDA 1K5JA 4EN7B 4NIIA 1R092 4D7SA 3D6EA 4XEZA 4MSVA 5A7WA 4GXLA 4FAGA 2OS2A 1G7YA 1YI9A 2ILMA 4XETA 4XQDA 2DU0A 1WMFA 2BU9A 4NWWA 5CBLA 5C9AB 3UK9A 5AVPA 5JSOA 3BTXA 2EXKA 3K3OA 1YFUA 5F1RA 3P3PA 1WCDJ 3VBFA 3I2KA 1RGSA 2XKOA 4RR3C 5FLHA 3D0JA 2P3IA 4N53B 3EO6A 1W2TA 3O7OA 4DFSA 3JD72 2CSGA 2WA4A 1I5PA 1ZVFA 4K20A 1VLNA 2J7MA 3OGGA 5FO9B 1C8NA 1QJU3 2VQAA 3RMXA 1QOOA 2IFWA 3VBUA 1UL9A 2PYTA 2VM9A 3AMHA 3MLKA 1TMF2 4PLOA 4W6WA 2JDNA 2BVBA 5LA9A 4XXAA 2BNOA 4LKFA 3CO2A 4B4QA 1WA6X 1FI2A 3HBKA 3VZLA 4WV8A 2P3YA 1N3QA 1XE0A 2YC4A 5ACA3 3WDYA 3WV6A 3ACHA 2WS93 4ZS2A 1YEWA 2Q8CA 2WZPP 5FZAA 2HWD3 4OVEA 1GU3A 4JDOA 2QQVA 2SLIA 1TME3 1IGOA 4Q2FA 2VGDA 2TEPA 3TN93 2V09A 2WIIB 4O7XA 4XF0A 1JODA 2GH2A 4I3GA 1A34A 1KJRA 2WR9A 1DDLA 1JZ2A 2P6CA 2X8KA 4RGGA 1ZBE1 3AMMA 2OPKA 5F8PA 3H50A 4Y5TA 1AYM1 5A32B 4IEWA 3O1VA 4Q4W1 1JZ8A 3B5LB 2RS12 1PGSA 5D8AA 5DUWA 1BMV2 1WCKA 2W1UA 4PQQA 4MLOA 4ZPIA 2GC1A 3KVAA 4NPLA 1EAH1 2R6QA 1DG6A 3MEPA 4E4DX 3VDBA 3M2MA 1LCLA 5DAWA 4AR2A 2GNDA 2WNUB 5JIAA 5BUVA 1I5ZA 2ENRA 5F9TA 1UOBA 1X36A 2AGSA 3RI8A 1RB8G 1TNFA 2QQLA 1YFXA 2E53A 3MFAA 4OFGA 4P14A 2EIEA 5DABA 3LOBA 3OGVA 1ZX5A 4AQ6A 4ZU4A 1JYNA 5CKNA 1W03A 3OBTA 4BMBA 1OVPA 3MF6A 2AEZA 3ETPA 5K4LA 1GP4A 5A3TA 1I3HA 1LJ7A 4YM2A 5E16A 1AL23 4PDWB 3MPPG 2RDSA 2VOVA 1IHMA 1GSLA 2WQ8A 4QXBA 2VMCA 1XSRA 2XL9A 3SCHA 3V0BA 1S0FA 2XOMA 5LY2A 4RSUA 3O0VA 1XYNA 1RUI3 2BERA 5F2SA 4O9EA 4PJYA 3I2OA 1C1FA 5EPAA 4M00A 1QXJA 4HVQA 2BQPA 4IEOA 1JU4A 1EYBA 4R9DA 1VIWB 4DXRA 2YGMA 1SDWA 2Z4FA 3MPBA 4FPEA 3BVCA 1GMMA 4QGLA 5FLIA 3BTYA 4IEVA 2ARCA 5A1LA 3VBUC 1WW6A 1BBT1 1NCQB 3VZOA 1B09A 2NMOA 2OZ6A 1CJPA 2QDNA 4KGQA 3VZNA 4Q4X3 4D7YA 4HT1T 1BK1A 1JOJA 2DTYA 2ZHLA 4AVAA 5CAZA 1OA4A 3M3CA 4BQ1A 4XILA 4A2UA 5C6CA 3VBSB 1H1IA 4Y3OA 4D6RA 3SLIA 3HNBM 3O1UA 4GIQA 3VDAA 1I1EA 2FDHA 2D3SA 2V5DA 3H3ZA 4LHLA 4XF4A 4CU8A 1NY72 5BNQA 2D6KA 5FP8A 1EV11 4JGYA 1KJLA 2NYYA 2QUOA 4MX3A 3TEXA 3PURA 5BPXA 1W6NB 1UU4A 1V9U2 1L3JA 3DXTA 3SCFA 3WHUA 5J1XA 1J59A 2ZJCA 1G6NA 3WG3A 1XC6A 3E1F1 2A1XA 3AZZA 1MEC2 1C57A 3AP6A 2ZGPA 2QE3A 1CR7A 3LA7A 2H6CA 3P3NA 4Y26A 2ARAA 4BQ5A 1JH5A 2Y6GA 4FPJA 1UF2C 1W0NA 2ZZQA 3NV1A 5D2AA 2WNVB 3PUIA 4R9BA 5D8AC 2RM23 5JUVA 3SITA 3ZN4A 3THPA 1VMJA 1CPMA 3MIFA 2K46A 4GJYA 3CL1A 5IVJA 5AC92 1OOPA 1REEA 4QHZA 4N53A 4JGZA 1VBE1 4NHKA 1IPSA 1JXNA 1WLCA 2JB4A 3C7FA 2VZVA 4DOUA 2IZWA 2VO5A 5IK4A 2E7TA 4HL0A 4N90A 3U75A 1UQXA 2D6NA 4BQ2A 4OI4A 1AX1A 4BXFA 5FR3A 1NT0A 2XLFA 4QQ2A 3Q8FA 2A6WA 3U1XA 4E27A 3AP4A 3J7MA 3HJRA 2AREA 1W8NA 2G9FA 4ZU7A 1PVC3 1DQ4A 1LOAA 3NMBA 5JZGB 2G4IA 4HKLA 3VHNA 2XVKA 4XVHA 1RUE3 4ZZ5A 4BM8A 4P9WA 1RVF2 1CAVB 4D69A 1PO23 1VBB1 4LLOA 4Q0VA 1QXRA 3MBWA 3KV5A 1YWKA 3HIFA 4JTNA 5FPXA 5EYXA 2VOKA 1A8DA 2ZHMA 2QQMA 2OT7A 1JBCA 2VMHA 1UX6A 5LZ6A 1IG0A 4CUGA 3WG1A 1W6PB 2EAKA 2R16A 3ZXJA 3UGFA 1IS4A 5IVEA 3IKWA 1NKGA 4MGKE 2ZHNA 4BOWA 5IAVA 3RZZA 2PLV1 4GMP1 3I2JA 4FOYA 3AM2A 5F2WA 3PU8A 5A32A 4Q26A 1RYYA 4XF1A 5EP9A 2GC2A 2XH6A 1AR91 1EY2A 4HKWA 2AR6A 3VKLA 1MZ5A 3N9OA 2WRAA 2EIGA 5GZEA 1DGLA 3POFA 4A42A 2PXJA 4MHUA 1JMUB 2J1VA 2WNUA 3BYWA 4FAHA 1OXCA 3M3QA 4JGYC 1LOEA 1OH3A 3DECA 4V2WA 1OLMA 2OQ7A 4KU7A 4DEVA 3N7MA 4IDZA 2F4LA 3VBRB 3EYPA 3IDAA 3U10A 3GBFA 3AKTA 4FCAA 5JSPA 1AJKA 3CHXA 4XUPA 5IK7A 2BOJA 4QX7A 4XFIA 3LDBA 5DN2A 1I6XA 3ZYBA 5KHJA 5KR7A 4PDWA 2R7EB 2XUMA 2IXLA 5C9AC 4A7KA 1H9WA 1R093 3IAPA 3VKFC 5SV5A 4A7ZA 1SDDB 1JUIA 4QX1A 2DVGA 2XQXA 3ALQA 3I54A 4LO7A 4EROA 2EXIA 3SISA 1OOPC 2PN5A 3RSJA 1FNYA 2VTXA 4JGZC 4N53C 3IPVB 1ASJ1 3PTYA 3WY6A 1W6QA 1LOGA 4XUNA 4N9HA 3GM8A 1CZVA 1H2KA 1W6OB 2ARBA 4D6SA 3A4UA 3AZVA 2NP0A 4C8DA 5A1FA 3AMNA 1XNDA 3MW3A 3ZYHA 1LGNA 1JS9A 4AVBA 3I3DA 2IVIB 1NCQA 2GALA 1HRV1 1XPWA 4CCNA 3JD73 4S2DA 1F2NA 1AR72 1LHWA 4KBZA 2E63A 2K2SA 5AFBA 1CONA 1C8M1 2XLGA 1QNWA 1NLRA 2UWAA 1LKNA 1OD5A 2XBO1 1TMF3 2JDMA 4QKDA 1W8ZA 3ZSKA 2CHHA 4Q0PA 3WNOA 2BNNA 1FV2A 2KA3A 1W39A 5JR7B 4OHZA 4JCKA 4E4SA 2IXJA 3HN3A 2GMEA 1TE1B 4L2NA 3H1YA 3OD4A 4A3ZA 1WD4A 4LQRA 1CAUA 2XJRA 2W0XA 3OGRA 1RUF1 1MZ6A 3D5OA 2PHXA 5CA6A 1D0HA 2W3JA 5FPZA 5FZ3A 2FQPA 3CEWA 4LNVA 2Y26A 3IT8A 4CEYB 2BDRA 2ORZA 2WNVA 1DCSA 1HKDA 3POBA 4Y1UA 3ZR6A 2C6SA 4XE9A 1MVEA 4HXCA 2RMU1 2E6VA 5I0RA 1YQCA 2VNOA 2VU9A 1S0JA 2WNUC 5I0SA 3WDUA 2RS13 1QJY1 2JKBA 5A7NA 4CEWB 3I49A 4A45A 4AF9A 1UY0A 2W95A 3J7HA 3AZXA 3PMEA 3ACFA 3OJBA 5FZ7A 1YI7A 5T52A 2WQZC 1OH4A 1X8EA 4MOAA 1JZ7A 3SQOA 2HYXA 4Q4Y3 2QZ3A 2BEOA 3SCGA 4PDWC 5JZGA 2BVVA 1OLRA 2YB7A 1WMXA 3WOGA 2HLEA 1TQ5A 3JZVA 5F3EA 1W90A 2R042 2QDRA 4Y4RA 4DUWA 5EQUA 1CAVA 4GKYA 3INAA 5LRSA 3POJA 1WMEA 4AEMA 5C70A 5LASA 5A3LA 2WSVA 5JPNB 3HMYA 3RZGA 1L7LA 2LROA 1G9AA 2IVJA 1ZYBA 1IS6A 3WNMA 1W6PA 1D4VB 3HVDA 2DUOA 3HAGA 1E5SA 1NCQC 4MXWB 4Y24A 5LY1A 2K9ZA 1S2BA 1IS5A 1UY3A 4OUMA 4XQWA 3LDRA 4LKEA 2ZX2A 4CUAA 1LRHA 4UOJA 4JC1A 3DKQA 1W04A 5A3MA 2ERFA 3G6JB 2R072 2R49A 4GWMA 4IL7A 5A7OA 3GBWA 2V4AA 5FDBA 1HXS1 4RQPB 1W99A 2N7GA 1K12A 2JE9A 2PHFA 5C3RA 2W9XA 4I30A 2PHUA 2CTVA 4MGIE 3ZLIA 3VBRA 1BJQA 1UW8A 1Y9GA 1AR82 1JHNA 1OMIA 3MW4A 3O12A 3UJOA 5AFEA 2D6PA 1V9U3 4XZUG 2HYKA 2W1WA 2ZCWA 2WNVC 3ILNA 4FTEA 2Y0IA 1XU1A 1MEC3 1PIV1 1H2MA 1XNKA 4XDPA 5CEHA 5JOZA 4IEQA 1AYN3 1CIWA 2XDVA 1WW4A 1CAWA 2A6ZA 1H6XA 4NAMA 5FJKA 4BQ3A 1HRI2 4LORA 4GA9A 2G1MA 3GF6A 4YFZA 1UU5A 2D6OX 2O0OA 3WP6A 5KC6A 4QX2A 2XJUA 4UBGA 3VD9A 1HX6A 2WAOA 3P5BA 2WT0A 3WUCA 2JD4A 1HN1A 1QH6A 1W6OA 4AI9A 3JBG2 2WQ4A 2WFF1 2ZAAA 4C0HA 2VH9A 1CX4A 1XE7A 4IQPA 1VBD1 2Q4SA 4XUQA 4ZZ8A 5AC93 1YYNA 2Y38A 1S2EA 4BE3A 2WNOA 2VMDA 2JDZA 4LULA 5EV7A 1U5IA 4LJHA 1VRBA 1OF4A 3KV9A 2Y6KA 2BUKA 2P5BA 4AI2A 2JG8B 3ES4A 5EWSA 3WX5A 2EXHA 2IFRA 1XYOA 5JZGC 2XB6C 4ATFA 4HK9A 4ATEA 1JYVA 1KD7A 2E9QA 1XNTA 2CGOA 1GANA 4LE3A 4X8PA 2RJ2A 1LENA 3ACIA 5FTTC 1D7PM 1W2UA 4EV0A 1UXZA 3EB7A 3BU0A 3B7MA 4QM8A 5J48A 4M0NA 5FMCA 2PAMA 1VP6A 4BMEA 2A7AA 3ZX7A 1AUYA 1JOPA 4IE0A 3WP5A 1RVF3 2FMDA 1FAYA 2R0FA 5HV4A 2V5YA 4K40A 1OPMA 4RFT0 5FZ6A 4UFMA 4K6BA 1DF0A 1YIPA 3FHQA 3HEIA 5T5OA 2OPWA 2D6MA 4Q4V2 3SKVA 2ZX3A 3LSDA 2H6BA 3NNFA 4BQWA 1FXZA 2DCKA 1W8OA 3DN7A 1GWLA 2B46X 2J1TA 5EYYA 2EF6A 4MZUA 5IVVA 3R0RA 3CMGA 3ROUA 3V64A 3FX3A 1OSGA 3CKHA 1FPN1 2ARXA 2VMIA 2VZQA 3MICA 4UXAA 4FOWA 1VB4A 1SPPB 3M4FA 2XG3A 1RHI2 5JMCA 2CAVA 1WLWA 2GNTA 4YLZA 5CYYA 2VG9A 2C9KA 3C7EA 2AEYA 3IMMA 3JUUA 3MIBA 2P34A 3MV11 4I01A 3ZVXA 4CP9B 1CVNA 3QOPA 3VBRC 3CZJA 1ODNA 3LOIA 1A6CA 4TWTA 4QB6A 2J1SA 5CNAA 4E2SA 3BB6A 1S0CA 4HVOA 3WDXA 3D8CA 1WLDA 1KDKA 4O65A 4XYXA 3WF4A 5LBBA 1H4HA 3VBHB 3A7QA 3OGSA 1LESA 2D5FA 1N1TA 3CZUA 2VULA 3ZPYA 2B9VA 2FCTA 5A7WB 2W1QA 4KWUA 2J1UA 1P8JA 5CG8A 2VC9A 3IIIA 4X6RB 1UXXX 4FT8A 3WW1A 4NRMA 1UO9A 3QLQA 2FCVA 4QQHA 3LSEA 3RYPA 1GP5A 1LEDA 4CVUA 5FZ4A 3VBFB 1W9TA 4TTGA 5A33B 4P9YA 1N1YA 2RDRA 1W0OA 2KM2A 4XJUA 5D1IA 3WNLA 4DY5A 3ZSJA 1GWKA 5J37A 4A6OA 4QHOA 1Q5OA 3KCCA 4OHWA 3T0AA 1DGWA 5HCBA 4FTBA 2WWUA 2WKKA 3NRUA 4Z07A 1AR73 2VW2A 3GZAA 3APBA 4MGQA 1BZWA 5JXJA 5HCFA 2DVFA 4Z1VA 5LA2A 4CCOA 1AXKA 3POEA 4URAA 1AYM2 3FZ3A 4QQOA 3OF1A 4XFFA 2JICA 2EALA 3GALA 1RXGA 4IXLA 1UKRA 1QKQA 4PIXA 4YVWB 2YXSA 1OLME 1OURA 1UOGA 3AYDA 4FOQA 4YGDA 3WEZA 4CEYC 1UOJA 5FWEA 3LPFA 4DXSA 1Z78A 4U36A 3ELNA 2XXZA 4QU2A 3ATGA 5GKAC 1GZWA 1VAKA 3ZPOA 2ZGMA 3OD0A 3MHZA 1XNBA 4CDWB 3F2ZA 5FXVA 3DUIA 3NJYA 1J1LA 2VY0A 3FBYA 3N7JA 3POGA 5A3PA 5DUVA 1W28A 2K0GA 4MYEA 1X82A 5F7UA 4B7KA 2QQKA 4PBPA 2X10A 3THCA 3B02A 3ZKUA 2VAUA 4PI0A 4YGEA 3PL0A 3VZJA 4D6QA 4CEWC 1MVQA 2XJTA 4NR1A 2FDKA 2DYCA 4Y1ZA 4UFHA 4B1MA 1QJFA 4CDXB 5KXCA 2H0VA 4GWJA 4WBBA 1J83A 1QQP1 2JE8A 2BGCA 1VJ2A 1I9RA 1STMA 3O1RA 3KWVA 4S2HA 3OGJA 4UFKA 5HBAA 1O3RA 4GB31 2YC0A 2VQTA 4KWLA 3RRDA 1NXD1 1ZZCA 2JENA 3AYEA 3K48A 1IG3A 3S30A 2PAKA 1K5MA 4JKMA 1S0EA 4NJ4A 4LIUA 4ZXKA 4NRPA 1N3PA 5KWRA 1EUUA 4YARA 1BBT2 1GQHA 1ALYA 1PX4A 3PVEA 3BKZA 2R043 2ADDA 1ZZ8A 4BU2A 4CSWA 4XBNA 2EIBA 3KM5A 2VTFA 4AEKA 5JXIA 1TZOA 1UCXA 3AXDA 3V0BB 3ENRA 3I2DA 1ULEA 2D7FA 1QJZA 3E6DA 1QOSA 4CU6A 1E5HA 1H6YA 2VQ0A 1RMU2 1M06G 1J3RA 1MQTB 1EV12 2W5FA 3I2FA 3J4UH 3KQ4B 3D3AA 4ZONA 5DUXA 3BTZA 4N8MA 4MG2A 5C3SA 3K4ZA 1JTZX 1RUG1 3FN9A 2J22A 2O8QA 2VNGA 3R4SA 2W68A 5E88A 4E4HA 3WZ1A 5IHRA 3AC0A 4OI2A 4KMQA 3ZN6A 1DGWX 2HWE1 5I8SA 3O1PA 1UMIA 2Z69A 3RJRA 5G04L 5K0UA 4OULA 3H7YA 3GNEA 4CP9A 1MS9A 1H8VA 4O9GA 2DVDA 2XJPA 2RR11 3FHAA 3LB9A 3NJVA 3WDWA 5B4NA 3U4SA 1LB2A 1MS1A 2NMNA 2R073 3K3NA 4EWEA 3WINE 2E32A 1ND2B 4R9CA 4XACA 2GNBA 2CGPA 1QGLA 3N35A 4LXLA 2OX0A 2VE1A 2HWB2 2XWJB 3M70A 2YPDA 4NPMA 4OUEA 1GQPA 4ITCA 1VBE2 3BALA 4HETA 3Q8AA 5GZFA 4E8CA 1AR83 1RUD1 3VBHA 2FDGA 2QZ2A 1F5FA 2JDHA 4N43A 4QDSA 1QDCA 2HWD1 3Q9OA 1HIXA 3H0OA 4YVSA 1XQNA 2PHRA 3OPTA 4UFLA 4JQRA 1TME1 5BY5A 2VJXA 2WUHA 4Q0SA 4QPGA 1YRZA 1O8SA 2Y8KA 1HRI3 3B9CA 4QPIA 2NLRA 4EYUA 4DMIA 1XNAA 4K3UA 2VNRA 1VBA1 3I59B 5A6XA 1BEV1 2D97A 3KT4A 5ERLA 4KNCA 1OOPB 5A33A 1U0AA 2JG8C 2I07B 1O4TA 5FFOC 3JBG3 4JGZB 3WNPA 4CCCA 1SHWB 1VBB2 3U78A 2HKXA 3MIEA 4TN7A 5J09A 4MVTA 4Z2WA 5H9QA 2FD8A 2AENA 1Y9QA 2F17A 2WINB 3DCQA 4CXYA 2HWF2 2AC1A 4BA6A 3N9LA 5J36A 4XOGA 2RG4A 3SNMA 3KMHA 4XFGA 4CDQB 1GWMA 4OHVA 4BIOA 1FOD2 5HCHA 2PLV2 1JI6A 4GWNA 3SEPA 1ENXA 1KGYA 4Q8LA 2DVBA 4YPJA 3IZOA 2DBIA 1AR92 3KF3A 5A3OA 2WN3A 2QQNA 1MPXA 3UJQA 2DVAA 1D4M1 2G9GA 4BLJA 4YVWA 3UL2A 1MS3A 4AFCA 1WWYA 2JDUA 3MV01 3KSCA 4DNYA 4M0HA 3TYJA 4UYBA 5FPAA 4A3XA 1PO11 1FV3A 3FUQA 3ILFA 4XMIA 4A6SA 4AHXA 4CDWA 1Q3EA 2BP6A 1N1SA 3LF7A 1W9FA 4IEYA 1RUI1 2E7AA 4LEJA 2ORXA 4QWNA 1FMD2 5BXXA 4Y1XA 1ZREA 2A6XA 4Q4V3 4FPFA 3WF3A 2WZR1 1OD3A 3ZXGA 1RUJ1 1CWPA 1WUVA 3WF1A 4L8QA 5K0UC 1PZ7A 4RHV1 3KS7A 3HWJA 4YZ4A 2E31A 4OQ9A 1AR61 3WCRA 2DBNA 1DBNA 3ZOIA 1XBFA 2HWC2 3TBDA 4XJ9A 4CDXA 2CL2A 3ILRA 5K7PA 5K8SA 3IWZA 2VCMA 1RHI3 3LGRA 5DDJ1 2EXJA 2VZRA 5A70A 2DUQA 5FYVA 2EA7A 4NRQA 1LHOA 2VOWA 3SH5A 1ND3B 5FKBA 1NX9A 4A41A 1IKPA 4AVCA 1BYHA 3K46A 4QU1A 1ASJ2 4JHZA 3VBHC 3P6BA 4AVSA 1W9WA 3J7LA 4QB2A 5GZDA 2XJSA 2VUCA 5JSRA 2MPFA 1WD3A 2JE7A 3VDDB 4BQYA 3V0AA 3OBRA 3A23A 3ZN5A 2D6LX 1HRV2 1OFSA 1QJX2 2JDAA 5FCCA 4NAOA 3WD5A 1GR3A 1CGPA 1DLCA 2JDPA 2YC2A 3H8UA 3MO4A 5FY8A 1UZYA 4AHYA 2E33A 1V70A 4OMCA 3VBFC 4YM1A 2D98A 2XBO2 4DB5A 1FX5A 5CFDB 4YZ3A 2RM21 3CDZB 2WO3A 1MQTA 1W6QB 4GKXA 1NAEA 3HQRA 5FZDA 4PLNA 3SH4A 3WQ0A 4ONUA 3RZKA 2JG9B 1WBFA 2BYVE 4QDRA 4QX0A 4AE2A 2UYBA 1V6MA 1RUF2 5C8WA 2P3KA 1CAXB 3K4DA 3L2HA 4XJZA 2OA2A 4AOCA 1RJ8A 5IYYA 1B35A 4ES8A 4IUGA 5FV3A 2YBKA 2ZMNA 3HQUA 1GNHA 1X8MA 2ZGUA 4CZSA 4YZ1A 2ZBJA 1K3IA 2YBPA 3V56A 5FZOB 2J1EA 4NHYA 1ND2A 5IVCA 3POYA 3AFKA 4YVWC 2RMU2 3GZEA 1GOHA 2A6YA 4FSJA 3AP5A 4P5HA 1AYM3 4IGOA 4NROA 3RDIA 1O4ZA 4MO3M 1CAUB 4CDWC 4KWKA 5CB7A 4CRQA 1POV0 5I0TA 4BCUA 4XTMA 1F35A 1QJY2 3J8F1 1UN1A 4DRRA 3WHTA 2P3JA 1LGCA 3USUB 5IUQA 3I3BA 3MYXA 4NO4A 4DEQA 3PJYA 4FFHA 1U5XA 4X6QB 2BFUL 4CDXC 1IPJA 2J1RA 5CG9A 2DCTA 4H3WA 4BXSV 2VOTA 2E51A 4AI3A 3I59A 5E8AA 4NN0A 3U4XA 1NQDA 1T6BX 2EAAA 1LULA 4YW6A 1H30A 1POV3 5T5LA 4YG0A 3AMPA 5F37A 2C5DA 5T5PA 3G7DA 1OKOA 3AKRA 4XW3A 1O7FA 2JDKA 4Q5OA 4CP1A 3S6PA 2Y60A 3KGZA 4B4PA 4D94A 1UZWA 3A0KA 3WF0A 2GN7A 4YSFA 5JR2A 1ZRCA 1KITA 2BW8A 4CDQA 1BCXA 5JDBA 1CD3G 1VBC1 4AI1A 2O1QA 1H8TA 1G86A 3CJXA 1LOFA 1R082 1Y7BA 3WQ7A 4AK3A 3EXUA 2RDQA 4L0PA 4QDQA 4ZS3A 1Q8OA 2VQUA 2IXCA 1BBT3 4I0WB 5H9PA 5FY9A 1JYXA 5L73A 4OZXA 1MQTC 5A6YA 2CGNA 1QIQA 1HXS2 1R091 3OY8A 5LBFA 3MGUA 4XURA 3EQEA 4BB3A 4B29A 1KFUL 4LKSA 3W58A 5FY1A 2LRPA 2ZEYA 2ZZJA 3BCWA 1VPHA 1YLLA 1RMU3 4FOVA 5JOYA 1EV13 2WAAA 5C71A 5CZKA 2HBUA 4AAPA 4C1WA 3M3EA 4HN1A 4LBKA 1PZ9A 4NIGA 1SFPA 1UPSA 3KD4A 5F3IA 3B3QE 3ZO0B 1W8HA 1V00A 1UKGA 4XJWA 3PTRB 1ND2C 1UYPA 4I2OA 2CAUA 3JD71 1YC61 3E97A 1G9BA 1ND3A 4XAEA 3M3OA 3AB0A 1MZEA 3PHMA 5IVFA 1MZFA 1HB1A 2QFEA 1UOFA 3I97A 2VUAA 3MIHA 2ADEA 2VXRA 4IEUA 3M7AA 3ECQA 1XU2A 3GHMA 2HWB3 2ZX0A 1VBD2 5FMOL 4FQ4A 3ZR5A 2BPA2 5IAXA 3VDDA 1RUNA 2Y34A 3FL7A 5IK5A 1ZNPA 5HPOA 1ST8A 2Y0OA 1NA1A 3UESA 4ARYA 4PHZA 4H2AA 1SLLA 5LK5A 1SEFA 4MH0E 1O3QA 1CAWB 2Y64A 4EWDA 2RV9A 4CXXA 3OPWA 2XL7A 4M3CA 1UY4A 2I45A 3WLUA 1O4YA 2YUEA 3KHBA 4YFWA 5CFDA 3IDCB 4CYDA 1NYWA 1Q43A 1AVBA 1ZBA1 4BHPA 3RS6A 3D0SA 4GMP0 2V73A 4QKBA 5FYMA 4BQ4A 2JG9A 4AQ2A 4XFBA 4AHWA 2HJIA 5FKCA 2PTMA 4I0BA 4LBQA 3FMGA 4HOOA 1CAXA 2JJ6A 4BWOA 1VBB3 4IV1B 2NPIA 4CDQC 1BQPA 3PMSA 3GJAA 4GALA 5FYCA 4RD7A 2ATFA 3OB8A 5A7QA 3VHOA 2HWF3 4FP3A 1YCIA 1AL0G 1LOFC 2L9LA 5FZOA 4DRVA 5IATA 3TNPB 4XC9A 2WO2A 3RYRA 3GXUA 4NHMA 1FOD3 3TAYA 2PLV3 4GMP3 2EVXA 1FPN2 2WLPA 4Q4Y1 1H9PA 5DZGA 4ZY9A 3E6CC 1VB2A 2X29A 5HV0A 1GZCA 3IDEA 2NZ9A 2G9ZA 1AR93 2UWBA 3NV2A 4S2FA 1UZZA 4UW3A 3A22A 5T55A 3GCWA 3RJ2X 3ZXEA 4LA2A 4CPBA 1VRH1 4NIAA 1O5UA 4TSVA 3SKJE 2P1BA 3N9QA 3USUA 5JXHA 1AXZA 4QKNA 1OA3A 5FMDA 3ON7A 1DYKA 5FYUA 4AEDB 1QU0A 3WQ1A 3T0BA 1R1A2 3RGBA 2OVUA 1FMD3 2JIJA 2QNKA 4FPOB 5C3QA 3JCIA 3N7KA 3RZLA 4G9SB 4UWDA 4Y33A 5FBJA 3NW4A 4M01A 1ND3C 2RS32 3ZSEA 2Y6HA 3PJQA 1W6MB 1KS4A 3JB8A 4L99A 2HWC3 4OYUA 3LFMA 3T1MA 2WN2A 5FK8A 1N1VA 4LUKA 2R061 1DLLA 3KF5A 2RS51 5LW9A 3KCXA 2VZSA 3S5AA 3URFA 3VDDC 3ZIWA 3LAGA 3U37A 4Q0UA 2P6HA 1ASJ3 2ZX1A 1BLZA 1NA1C 1JHJA 2Q8EA 1GNZA 3KLSA 1SLBA 1XYPA 2PHDA 2BRTA 3VKNA 2P17A 1ULDA 4RS5A 3IBMA 1JZ5A 1V9U1 4FO9A 1GLHA 3VDCA 3O5SA 5DZEA 3N9NA 5A80A 5CFDC 3VD4A 1HRV3 3F95A 3UYJA 1O91A 1QJX3 3T2OA 4LMFA 4XDQA 1AYN1 2VZ1A 5FUIA 2VPVA 4XMAA 2XR4A 3FFZA 2JG9C 4XXPA 5GZCA 1JZ4A 1NCRA 4W8JA 2XBO3 4LPLA 3FBMA 4P02B 3TNQA 1LTEA 4B8EA 2F4PA 3AJYA 3MFCA 5FO7B 1RUH1 2A3WA 4ZU5A 1RITA 3PUQA 4HFSA 3VBOA 4AI8A 5FZMA 4MV2A 3I3EA 3P1IA 4HG6B 1KS5A 4PF1A 1RUF3 3MLLA 4PT6A 2C9AA 4XHBA 4ZKTB 1PHMA 4N7IA 4E9KA 3LKJA 1Z7S1 4YWAA 1AZDA 3NO8A 1DIWA 2Z5WA 4Y22B 1DQ1A 2E7QA 4GULA 4BDVB 2PMWB 1A3KA 3WDVA 3Q8CA 2B4KA 5KHHA 4ISRA 4AHZA 4ET7A 1YFYA 3WNKA 3TWIA 3BU7A 1GYKA 1X9PA 3UGHA 4QGNA 2QJVA 3DEMA 4UAPA 5JLVA 3AKQA 2X09A 5FZKA 1ZRRA 5FY7A 1QQP2 2W39A 4CP0A 4DXZA 1QJY3 3UV9A 1RVF1 5DAPA 5L19A 4Q29A 5FZEA 1GZWB 3NKTA 4NOTA 4GB32 2HEWF 2Q5TA 4LT5A 2J42A 2YY1A 4BZ4A 1MR5A 1FATA 2ZGNA 3SH3A 1W06A 4KU8A 1G9CA 4GQ7A 1V6JA 1U5ZA 5GZGA 5JOWA 3IM0A 2AACA 1X7NA 4LBQD 4RYDA 4YW1A 3A21A 3NL1A 1UAIA 2VMEA 4YYOA 1PMHX 3PVOA 4TXWA 5EHDA 4EN0A 2IUWA 2ZGRA 4EZ4A 4IE6A 4IV1A 5JXGA 3ZYRA 4Y5Z0 1C1LA 2RE9A 4GWIA 2O14A 5FY5A 2TBVA 1YNAA 2GNMA 1TVGA 3EBRA 3PIGA 3GDBA 4RS5C 1OQ1A 3KT1A 4LE4A 4NE9A 1K5MB 2ET7A 2WA3A 3DPRA 3HNYM 5L9BA 1RUG2 1YIFA 5KHIA 3NSTA 3J26N 5L36A 1YFWA 4AL9A 4JDMA 2VW1A 3LEGA 3NAPB 1JYWA 2HWE2 5FY4A 1R083 4CPBD 2VZOA 1NCRC 1VMHA 5AVAA 1JW6A 2RR12 2PFWA 1K45A 2HBTA 3BN6A 2X05A 4G3YC 3OOXA 4XQ4A 3WSOA 1E5IA 3B94A 1HXS3 3VBOC 1YO8A 2ZA9A 3B01A 4JX0A 4OCTA 4AEDA 4R4XA 1UX7A 4XF3A 5FYYA 1W8TA 3OYWB 5B2GB 1HQLA 3CNAA 3T2QA 1OHFA 1BK0A 1KXGA 4XIKA 3T2TA 4C1XA 3O1MA 3DYPA 3H8RA 4DUXA 1RUD2 4COWA 2XPJA 3PVBB 1REDA 4H55A 2VCBA 2WJSA 1RUC1 2VNVA 3LA3A 5FAXA 2WO1A 3SXWA 1W6MA 4MGYE 3ZN6B 2WABA 4CDUA 4D8MA 5K0UB 1FNZA 2XJQA 4CE8A 1GOGA 4QQLA 1LHUA 5LEKA 1YUDA 3BOPA 3JXSA 3S57A 2BBAA 2ZGSA 1ENSA 1WKYA 4AG4A 4C0BA 2YZ4A 4F83A 1VBA2 4QKFA 1PGW1 5A1AA 1BEV2 5FUPA 5EXOA 1SCSA 4QMAA 4LOSA 2QQPA 1GZTA 3B69A 4YM3A 3MI8A 4I3PA 4AYUA 4IW3A 1VBD3 4FPGA 3GZUC 4HVRA 5LRRA 4M3CF 4N43B 4HSJA 2D43A 4YVSB 4YW5A 4YNIA 1NZIA 2OYZA 1RINA 4LBMA 4QPGB 4AFAA 3L2YA 1ZZ6A 2BJSA 3ZXDA 5ANQA 3IIAA 2Q8OA 5CADA 4QPIB 3AK0A 3H8XA 1UZ0A 1R64A 1PNFA 1J84A 3FLRA 4AVVA 5IVBA 1WCUA 2BWCA 1UYZA 4IV1C 1NLQA 3RG0A 1D4M2 2ZGTA 3UGGA 4NIDA 4XFAA 2XHKA 4XUOA 4NVPA 1XJAA 3KV6A 1HLCA 2JKXA 4DXTA 3S5QA 3T30A 4PCRA 4PLMA 4XAAA 5JCTA 4Y1VA 1PO12 2VD7A 1VAMA 2JWPA 2PQSA 3BIEA 4ORFA 1RUI2 1DFQA 1ONAA 3POWA 3VL8A 4IEPA 2CYFA 4LHSA 3O14A 4QPWA 5G05L 1AX2A 3HR9A 3PUAA 2CU5A 1ZBE2 2WZR2 4R9AA 4L11A 1RUJ2 2ZEWA 4Y22A 4CP2A 1CZTA 1QMJA 2YBSA 1JOBA 4RHV2 5FZ9A 3HT1A 4Q4W2 3ZYGA 4BH9A 5C7GA 1AR62 1Y43B 1FPN3 1J58A 3Q8BA 3WR0A 4JKKA 3A0NA 1QY4A 1EAH2 2DF7A 2FBEA 3DYOA 3VD5A 3ACGA 5DDJ2 1C5IA 3CIHA 4AEDC 4E2QA 1OUXA 3EMRA 1J3PA 5LCWL 1UYYA 2XHNA 3CBNA 1SBEA 3NNGA 2GMPA 4AVTA 4S2GA 4ASLA 2C24A 4KWJA 4E8DA 1XSQA 2MEV1 3ZYPA 5CKMA 2ZXQA 4AW7A 2YV8A 2Q1FA 1COV1 2DV9A 3HOBA 4R52A 3POIA 1EUTA 1R1A3 4LBNA 2VTXJ 2WNEA 4LO8A 4YW4A 4CU9A 4Z8BA 2XWBB 4XF9A 5LATA 1JZ6A 2FMYA 3L9JT 2QQOA 3RQ0A 4UT5A 1SBFA 5T54A 5KXBA 2RS33 4FTSA 1O6UA 2UY9A 1Q8QA 4XDOA 5IVYA 1YJKA 3UNPA 4C90A 1ZA7A 5FMBA 1W05A 2QTWB 2OQ6A 2XJVA 5FZ1A 1PK6B 1Y9MA 4HPKB 3VD3A 2RM22 5GLZA 2A6VA 1D2QA 4Q27A 3ZXFA 5EZWA 2R32A 2WLQA 1BHGA 1T6GC 5CVRA 3UT0A 1UU6A 4QX3A 1HJGA 3S7IA 3IN9A 3NJXA 4JV4A 2ZAHA 4JZRA 4BPZA 4IESA 2VXJA 4DPNA 3V0AB 1SLCA 2AYHA 3E5XA 3NAPA 4MHRA 3MZHA 2ZGQA 2IXIA 3M8LA 4M4RA 4LITA 1V6KA 5IT6A 2FDIA 1K42A 1OI6A 3R05A 4UW5A 2FZ1A 3CU7A 4K1YA 4KQ7A 3PIJA 1WCSA 3VHRA 2CY6A 3ZXAC 1U12A 4META 5C3PA 2VZTA 1HRI1 2UU8A 3OYWA 1HDKA 2C0ZA 3M1HA 5HXMA 2XKPA 2BBVA 2ETEA 2QKDA 2WYFA 3TEYA 4D0QA 3AX4A 4DIQA 2VOXA 3AFGA 4Y20B 4RGKA 4CCDA 4EJRA 3JBG1 4ARXA 3J8F2 3I2IA 4HN0A 1ENQA 3ORJA 1LECA 4MGTA 3MIDA 2PQQA 2GZWA 2WSUA 1B35B 4XHXA 3TEZA 3B93A 4ASMB 5DMYA 4RN5A 1JYCA 3AVRA 1QJU1 2WYSA 3VD7A 4HK8A 4BYYA 1VE0A 3EJKA 3LFIA 4HONA 3FUOA 3CF6E 4P9GA 1NQJA 2I2SA 3N9PA 2OW4A 1MS5A 4Z92B 1GUIA 3FWEA 3J7NA 1SZBA 3N3HA 3WP4A 1HN0A 3C7HA 1X9TA 4EQVA 5C4WB 1GZ9A 1LOCA 2Q30A 1QXPA 2Y6LA 3IB3A 2VVFA 3I7DA 3KVBA 5I0UA 5ACA1 4OZOA 2ZKLA 4H14A 4V2VA 2LM3A 4AEJA 1U5YA 2WS91 2Y33A 4COVA 1W3VA 2XLAA 3S7EA 2ZMKA 4WM8B 1QQP3 4IE5A 2BWAA 4L92A 5J98B 3WG2A 5IW0A 2C1FA 1QHDA 4GB33 3TN91 1S55A 2IXHA 4GH4B 1VBC2 4QX5A 2B39A 2Z2SB 4MGSA 5KHGA 5FP7A 1XOYA 2RVAA 4IGQA 5JI7A 2JEMA 4FPYA 5FZGA 1QJEA 2QVSB 5C3OA 1DQ2A 1OC1A 4OLLA 3CLPA 3NNLA 1ZA4A 2VZUA 3LZZA 2ZGKA 2YGLA 3QH7A 4AQSA 3LIGA 2B5HA 1RHI1 2WBKA 1ZRDA 1K5MC 4LBJA 2DFBA 4QGMA 4B1LA 3X29B 1J1TA 5BNPB 3WQBA 4CA9A 3GJBA 4DY3A 4KL1A 3NAPC 4NPRA 3W9AA 4A4AA 4HLTA 2YU1A 2W47A 1H8TB 5JAXA 1RUG3 2JX9A 3MUZ1 4K7JA 4XFHA 5JIUA 1KDMA 4GD4A 4FFIA 1S2KA 5FXWA 5FOJB 2W92A 2HWE3 1HJFA 4CCMA 3ZFFB 2GN3A 3RZHA 3ZSMA 1GKBA 1WW7A 1AL21 5B4XA 2VBPA 2RR13 1DQ0A 3OY8B 2DUPA 1QH7A 5FYIA 3NNJA 1L7RA 3NV3A 2DU1A 3OUJA 1KEXA 1QWRA 1TEIA 5FP4A 1XNCA 3K4AA 4DO0A 1MS8A 5TSWA 4Q1RA 4P9JA 2A70A 4DINB 3RVHA 4H7LA 5JOXA 5I8TA 1RUD3 2YFZA 3I2GA 2VW0A 3ZFGB 2H0BA 3O1TA 2IWGB 3ZYJB 3K2OA 2JB8A 4FPCA 1QNYA 5DAXA 2YYOA 4Q4X1 1LAJA 2A71A 1ZRIA 3U0ZA 2XUEA 4YRDA 3ME2A 1LODA 4ZHNA 4GJZA 5GM0A 1PK6A 3VZKA 4HPKA 4AZZA 4NIHA 2B9UA 5T5JA 1ZBA2 1YQ2A 1DQ5A 2DWRA 5A3NA 5JI9A 4CCLA 3KCYA 1DZTA 3VKOA 1ZZBA 4XZPA 3DGTA 2AZ5A 2VECA 4P9IA 1VBA3 4N9IA 4QX8A 3RPQA 4N43C 3RFRA 1BEV3 1W9SA 4CTEA 5FPUA 3OUHA 3JQWA 4YVSC 2XVGA 4J6GA 3UKVA 3ZDSA 3W21A 5FOBB 5GLTA 1QDOA 1W3XA 4QPGC 3LQCA 2B8MA 1NA1B 2DFCA 2RDNA 2XGXA 3ABZA 4AWDA 5LWBA 3AKSA 4QPIC 1W8FA 4I02A 4W65A 1QF3A 4KG0A 2W87A 3C7GA 2ID4A 1C8M2 5F3CA 2PHLA 1OA2A 1VALA 1TNRA 1WCQA 4M3CB 1ULOA 4UF0B 2VZ3A 3POSA 3ZMNA 4RFRB 4Q4Y2 5J3UA 4LBOA 5CIRA 3OEAA 3MLJA 1ACCA 5FJHA 1QEXA 2XONA 4LBQB 4Y20A 1D4M3 5FZ0A 1POV1 3ZM8A 4AI0A 1ZM1A 1DYOA 1ULCA 1US2A 1VRH2 2OUHA 3TOJA 1W8UA 1PO13 2WL1A 3NKGA 5BNNB 1IKQA 1W2OA 1LHNA 5IWFA 5A7PA 4FBFA 2A3XA 1AXYA 3WP3A 1BVVA 1NG0A 1UNBA 2WZR3 1F4HA 1ZBE3 2W08A 1RUJ3 1MACA 1PVC1 3KT7A 2V72A 5C4WA 4RHV3 2GSYA 4EN9B 4Q4W3 1AR63 1M4WA 1F31A 1SQ4A 3AP7A 5I8YA 1NE4A 2JD9A 2YMZA 3DKWA 1SLTA 5HXVA 1RUE1 2FHRA 2HH9A 4LBLA 5M0TA 2GMMA 1EAH3 1GP6A 1PO21 2R062 5EJ1B 1Y3TA 5DDJ3 4WM8A 2RS52 1REFA 2EICA 2VUJA 2XQRA 5DG1A 2VMGA 3I3QA 1ENRA 5FQ0A 1MS0A 3BGAA 4GH4A 3KZ4C 3MF9A 4P5YA 3BODA 4I0AA 3B00A 5F3GA 1PMIA 1YJLA 2ZKNA 4LR4A 1RMU1 1IPKA 5JWPA 4NUBA 3ZFEB 4OI0A 1PGL1 4XUTA 1ZZ9A 2X5IB 2YDEA 3GHNA 3H3UA 4QM9A 4HZFA 5H9SA 1H4GA 3MIGA 5E89A 1PK6C 4FPHA 4TLGA 1LOBA 3PU3A 3WVJA 2SBAA 5F5QA 1AYN2 1UMZA 1W8WA 1SMVA 3H3LA 5DAQA 2OIIA 3LA2A 1GICA 5FPLA 4FPLA 1UY2A 1LR5A 3PLQA 5BNPA 2LALA 5FWJA 4UFIA 4WZFA 3FE5A 1GFF2 1NE6A 5FPVA 1OT5A 1RUH2 5C9AA 3SHRA 1SG3A 5CISA 4QAWA 4QXHA 5FZLA 4AXOA 2HWB1 1O8PA 4RS5B 4KG8A 5APAA 2VZPA 3DV8A 1URXA 3J9SA 5FRAA 4ISQA 2BV4A 5LK7B 1W2NA 4XBLA 3BOWA 3ZFFA 1PM4A 1DHKB 5E6HA 4BK4A 3WF2A 2QCSB 1Z7S2 2OKXA 2A5ZA 3K77A 4YZ2A 4MUVA 4AGGA 4A44A 1GQGA 5DUUA 5K9YA 1NCRB 2VMFA 5IK8A 4JDNA 1PZ8A 1S0BA 2VL4A 4AGVA 3THDA 1C3HA 5ABJB 1LEMA 3GCXA 3VBOB 1B35C 3ST7A 3N4MA 3LD8A 4IERA 1US3A 1F4AA 2ZGLA 3T3YA 5C8CB 1APNA 1O5LA 1PIV2 3J8F3 3ZFGA 1V6NA 4BLIA 5T50A 5LEJA 3IDBB 5C4WC 3OBAA 1UZVA 4HMZA 4FXKB 4H7MA 3M3IA 1PNGA 3ASIA 2HWF1 2GH8A 4FFGA 4A7YA 1G8WA 5H9RA 3S0MA 1HQWA 3HT2A 1TMF1 2P37A 3O0WA 2WFF2 1FOD1 2HEYF 5FYBA 1WW5A 1CPNA 1H1AA 4K8RB 4WM8C 2R30A 3E5UA 4L9BA 2Y6JA 2XVLA 4PIYA 1O3TA 1VBE3 2QBXA 2XMLA 1RIRA
chains in the Genus database with same CATH topology
2JDNA 2JDYA 2WRAA 5HCHA 2VUDA 1W8HA 2JDMA 1OUSA 2CHHA 2VNVA 1W8FA 2JDPA 1OXCA 5A3OA 4CE8A 4UT5A 5A6XA 1OVSA 2BV4A 5A70A 1UZVA 2XR4A 5A6YA 2JDUA 5A6QA 1OURA 1UQXA 2BOIA 2JDKA 3ZDVA 2BP6A 1OUXA 1GZTA 2BOJA 3DCQA 2WR9A 2JDHA 2VUCA 1OVPA 5D2AA 4AOCA 5A6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JDN A;  2JDY A;  2WRA A;  5HCH A;  2VUD A;  1W8H A;  2JDM A;  1OUS A;  2CHH A;  2VNV A;  1W8F A;  2JDP A;  1OXC A;  5A3O A;  4CE8 A;  4UT5 A;  5A6X A;  1OVS A;  2BV4 A;  5A70 A;  1UZV A;  2XR4 A;  5A6Y A;  2JDU A;  5A6Q A;  1OUR A;  1UQX A;  2BOI A;  2JDK A;  3ZDV A;  2BP6 A;  1OUX A;  1GZT A;  2BOJ A;  3DCQ A;  2WR9 A;  2JDH A;  2VUC A;  1OVP A;  5D2A A;  4AOC A;  5A6Z A; 
#chains in the Genus database with same CATH topology
 3AZY A;  5C5U A;  1RJ7 A;  1UYX A;  2RJK A;  4GH4 C;  4HSL A;  4LIV A;  4C91 A;  3TRS B;  5ISL A;  2MHF A;  4UBH A;  1S0D A;  2YU2 A;  1DGR A;  2R1B A;  4GAZ A;  3ACL A;  4ASK A;  2UYA A;  3B9I A;  2WT1 A;  5EJZ B;  4UF0 A;  4MXV A;  5FRE A;  3RNS A;  4COU A;  3NVC A;  1V0A A;  4QQP A;  1CN1 A;  4OHX A;  4FQZ A;  2WWJ A;  2BGP A;  1VBC 3;  1FMD 1;  3BPS A;  2QQW A;  5F5A A;  1Z0H A;  3T4V A;  1UD1 A;  1IQA A;  4B3N A;  1D2S A;  4LO5 B;  3HQX A;  5A7S A;  3ZIX A;  1WZX A;  2RS1 1;  5DPN A;  3K75 B;  5BNP C;  1BMV 1;  1WA4 A;  2GP3 A;  2HWC 1;  5FYT A;  1V6L A;  2UUR A;  1VAV A;  2LW8 A;  5BNN A;  1OQD A;  2W2I A;  2ZHK A;  4EN6 B;  1H8T C;  3LDK A;  4UI9 L;  4FI9 A;  3RI9 A;  3USS A;  2VR4 A;  1NUK A;  4AGR A;  5EJ3 A;  5FP9 A;  2B42 B;  3DPR B;  1KRI A;  2ZAC A;  3ZFF C;  3KHC A;  4J1W A;  1CJD A;  1EP0 A;  3GYD A;  5J7M A;  1RUC 2;  2BZD A;  3QD6 A;  4YW7 A;  5F32 A;  1LGB A;  4B7E A;  3I2H A;  1AJO A;  3GGL A;  4F3J A;  3U14 A;  1H2L A;  1FYU A;  5FZH A;  2ES3 A;  4IET A;  3VV1 A;  2B45 X;  1ZRF A;  4V1P A;  5FBZ A;  1HB2 A;  1N3O A;  1QJX 1;  2P2K A;  5LBE A;  3VGI A;  1Q8V A;  4UW4 A;  4JAA A;  1F8V A;  1OBN A;  4U2A A;  4NHX A;  1PGW 2;  3VBS A;  2JDY A;  3R4D B;  2V4V A;  2W52 A;  5DZF A;  1DZQ A;  1BVP 1;  1V6I A;  3FFQ A;  4R4Z A;  3ZFG C;  4NMI A;  3ZFE A;  3GZT B;  3UKT A;  1AF9 A;  1SCR A;  2X5I A;  4BK5 A;  1W6N A;  4ES9 A;  2EID A;  3O1S A;  1PVX A;  4IV3 B;  5E1R A;  1OKQ A;  5L7O B;  4F8A A;  2C4X A;  4CDU B;  3VL9 A;  5JVV A;  1E5R A;  1Q8S A;  4WVV A;  5J96 B;  4AFM A;  2B7Y A;  5LA0 A;  4Y1Y A;  4CXW A;  3IAQ A;  4WVM B;  4QT6 A;  5CFC B;  2JEC A;  3LEM A;  2GAU A;  2Q1M A;  4XBQ A;  3ZDV A;  3O1O A;  4RGA A;  3T0D A;  1GBG A;  4B4R A;  4JVA A;  4OI1 A;  1F9K A;  1XE8 A;  4OHY A;  4URT A;  4W6Y A;  1ZBA 3;  5FIX A;  2D44 A;  2WDB A;  4F7Z A;  1SFY A;  4WM7 B;  4YGC A;  2YHJ A;  3OCP A;  1NY7 1;  1W0P A;  4KGG A;  3MUY 1;  3CJI B;  3LE0 A;  5KC5 A;  3RZM A;  4FFF A;  3PNA A;  3WW3 A;  3QCW A;  5EFU A;  5I0D A;  2VVD A;  1TG7 A;  1MEC 1;  3ZMO A;  1A8M A;  4LUM A;  4JRA A;  3T09 A;  2PHW A;  3LIH A;  1PX3 A;  4WVW A;  1OF3 A;  1C8M 3;  1RXF A;  1NZC A;  2C26 A;  3KB5 A;  4XAB A;  2A75 A;  3K51 A;  2WFP A;  2AH2 A;  3VKM A;  1ULF A;  4GZ9 A;  3SC7 X;  2ZAB A;  5F6K A;  1UIK A;  1OLQ A;  1PM7 A;  5ABJ A;  1XXN A;  2LUW A;  2NN8 A;  5A3U A;  4UFJ A;  4AQT A;  4N7U A;  5D21 A;  2WC2 A;  5BNN C;  2GC0 A;  4LK6 A;  5AC9 1;  5BNO B;  4YZ5 A;  5C8C A;  1JYI A;  3C3V A;  2D3P A;  1VRH 3;  2FDJ A;  2D40 A;  2MEV 2;  3I8T A;  4LO4 B;  5C5T A;  1W2A X;  3DF0 A;  3PUS A;  1OPO A;  2BNM A;  5FXZ A;  1COV 2;  3JQX A;  2DTW A;  4W4Z A;  2VCA A;  4LTA A;  5F5C A;  1FT9 A;  4Z2A A;  4NHL A;  1YHF A;  1J3Q A;  5T3N A;  2CV6 A;  2RMU 3;  3H1W A;  3KGL A;  2J1A A;  1JYT A;  4O61 A;  2DCJ A;  2G19 A;  2D5H A;  4XIO A;  5BYN A;  1DGR N;  4DZG A;  2Z79 A;  5DG2 A;  2CWM A;  2OUJ A;  2W94 A;  2VVE A;  5IFP A;  2ZPX A;  1O59 A;  1R08 1;  1MS4 A;  4YW3 A;  3VBS C;  4FP2 A;  3WUD A;  3NNM A;  4LA3 A;  2R06 3;  3V65 A;  4CU7 A;  5C33 A;  2IC1 A;  5DAV A;  2PHT A;  2RS5 3;  4UW6 A;  4CUB A;  2VBB A;  3TEW A;  3ZFE C;  4HAN A;  2X5I C;  5LBC A;  1LU1 A;  3N9M A;  5FLJ A;  3HN1 A;  1R1Z A;  1XRU A;  2WO7 A;  5DXD A;  4AAX A;  3CQO A;  4IEZ A;  2LS6 A;  4PBO A;  4X8N A;  3DYM A;  2OXB A;  1DQ6 A;  4Z82 A;  1E57 A;  3OPZ A;  4HKO A;  1ZZ7 A;  5GAL A;  4BJ0 A;  3WCS A;  4W50 A;  4FPK A;  1F5J A;  1RC6 A;  2ZEZ A;  4JRL A;  3MDP A;  4MAD A;  1W9Y A;  1Y4W A;  3H1M A;  3LEK A;  1DYP A;  3WW4 A;  3HBZ A;  4Y5S A;  3OEB A;  4EE2 A;  2D3R A;  2GDF A;  3R4U A;  3VLB B;  3PDQ A;  5GLW A;  2QQU A;  4BIS A;  3OG2 A;  1KQR A;  4KH9 A;  5FZC A;  3AYA A;  1EPW A;  3AL5 A;  3EHK A;  3FJS A;  1BXH A;  3IPV A;  3ITQ A;  3WT3 A;  3AL6 A;  2D93 A;  2FDF A;  1RUH 3;  4YG6 A;  1N47 A;  4DQA A;  1YQ5 A;  4L97 A;  5CKQ A;  5FZI A;  3JU9 A;  3O0X A;  5FZF A;  4RA0 A;  4COY A;  3KV4 A;  2GP5 A;  3R6S A;  1GNY A;  3Q8E A;  4RL7 A;  3AKP A;  3C7O A;  2CWS A;  1NOV A;  1QOT A;  1QJU 2;  1XB9 A;  3LPG A;  4TLF A;  1HV0 A;  4CCJ A;  4E4Z A;  4RR3 B;  5FZB A;  5ABJ C;  3D4K A;  2W46 A;  1Z7S 3;  4CUC A;  1DU3 D;  5LA1 A;  2ZML A;  5FXX A;  1CQ9 A;  5C8C C;  1S0G A;  4NWV A;  4E2G A;  3ES1 A;  1LU2 A;  3VB9 A;  3NV4 A;  1CX1 A;  3I4I A;  4I09 A;  1GV9 A;  1SLA A;  5ACA 2;  2VUD A;  3BTA A;  4PQ9 A;  3H42 B;  2WS9 2;  4IV3 A;  5FYZ A;  3RMY A;  5L7O A;  1SFN A;  2HWD 2;  1SLI A;  3PUH A;  4XJA A;  1PIV 3;  1H0B A;  4YM0 A;  1TME 2;  4JHT A;  1IQD C;  4WVM A;  3TN9 2;  1C4R A;  3FLP A;  5CFC A;  3WDT A;  1AR7 1;  4CEY A;  5JPM B;  3NQH A;  5EIY B;  2DCY A;  4MGZ E;  1YQ8 A;  2W91 A;  4P00 B;  2A3Y A;  1GOF A;  4R8H A;  4SBV A;  3UET A;  1PMJ X;  2DCZ A;  1UWW A;  4YW2 A;  1IOA A;  1RL3 A;  2Q8D A;  5FK7 A;  4WM7 A;  3THT A;  2FZ2 A;  3HNM A;  2WFF 3;  4LK7 A;  3BUC A;  3T1L A;  4IE4 A;  3CJI A;  1S0I A;  3NWK A;  3VUO A;  5F5I A;  3HD8 B;  1JU3 A;  1POQ A;  2Z42 A;  5IFT A;  1AX0 A;  2DDU A;  1DZR A;  3T08 A;  4CEW A;  4K9S A;  4D7T A;  1S1A A;  1IS3 A;  2CDO A;  1F15 A;  3SMH A;  4LO6 B;  4XJ8 A;  2Y6F A;  1CIY A;  2ZEX A;  3FHI B;  4QHB A;  2TUN A;  3AP9 A;  1WMD A;  4DS0 A;  2RJL A;  1R1A 1;  2ZX4 A;  4PF5 A;  3I3M A;  2BGO A;  4Y4Y A;  2ZTN A;  1OQE A;  2GC3 A;  5IJR A;  5GLU A;  2WZ8 A;  3E5Q A;  4EZH A;  2FCU A;  5BNO A;  2GU9 A;  1AL2 2;  5FYS A;  1L7Q A;  5L9R A;  4AFD A;  3OSD A;  2RS3 1;  1D0G A;  1NLS A;  3H9A A;  4G4F A;  4P08 A;  4Q8K A;  5LB6 A;  3DPR C;  4J1X A;  4BIF A;  1OUS A;  3WNX A;  3BI3 A;  4XCB A;  2YG0 A;  5FYH A;  3PVN A;  1A78 A;  5KHK A;  3D82 A;  1V6O A;  1VR3 A;  3W5M A;  2W1S A;  3FC0 A;  4QD2 A;  4AFB A;  2UY8 A;  1AHS A;  1WLT A;  3NJZ A;  2O8O A;  4MXW A;  4FXG B;  4K1Z A;  1LNS A;  2WT2 A;  2AUY A;  1RUC 3;  1HW5 A;  2ET1 A;  3FLT A;  1HB4 A;  3JB4 C;  4WZC A;  2R04 1;  1SAC A;  4P9X A;  4Q4X 2;  4DUV A;  3ZSL A;  4IGP A;  3SEE A;  4CCE A;  3TB0 A;  2QQJ A;  2F6B A;  1C28 A;  2BTV C;  4IE7 A;  4OMD A;  5ANN A;  3IMN A;  3VBU B;  5HCA A;  3OTF A;  5FO8 B;  1UPI A;  4RQP A;  4YGB A;  5A3W A;  1G9F A;  2IXK A;  2YFU A;  2Q0A A;  4EWA A;  2CDP A;  4IV3 C;  5L7O C;  1EPZ A;  3AZW A;  4IND A;  4CDU C;  1O3S A;  1UMH A;  1S4C A;  4IEX A;  4XTP A;  4M4P A;  1HV1 A;  4LLF A;  4M3C E;  3KQR A;  1HB3 A;  3DL3 A;  5CFC C;  1ULP A;  1CZS A;  2KD7 A;  4XCA A;  3VHP A;  4FVV A;  3GBG A;  4YG3 A;  3UKN A;  3MW2 A;  3ZKY A;  4HBN A;  3U11 A;  2WZE A;  3C8X A;  4WVZ A;  1SBD A;  2P4E A;  4WM7 C;  5FY0 A;  4PIZ A;  4D3W A;  2R07 1;  5FP3 A;  5I93 A;  3ZYF A;  2YPJ A;  3AMQ A;  3CJI C;  2A73 B;  3BIW E;  5DQ0 A;  2BFU S;  5F6L B;  3AXE A;  5A6Z A;  2PEL A;  1LHV A;  3WW2 A;  5CU1 A;  3LWC A;  4Q0Q A;  5D8A B;  5GJ6 A;  1JUH A;  5JMO A;  1AR8 1;  3ZYI B;  1VMF A;  1JN2 P;  3QAC A;  2R0H A;  3WNN A;  3RWN A;  1H1M A;  2VCC A;  4K21 A;  3H7J A;  3RYK A;  1IZ3 A;  5A6Q A;  2DUR A;  2JG8 A;  4XFC A;  1G9D A;  1BKZ A;  2ZGO A;  4JTO A;  4RR3 A;  1RUO A;  2YRO A;  2JXA A;  3ETQ A;  2ZOE B;  3OUI A;  3WXP A;  1JZ3 A;  1NXM A;  4LHN A;  5L9V A;  1PVC 2;  4OUS A;  4J25 A;  5BNO C;  4JQT A;  3N36 A;  3BPZ A;  4COZ A;  3DXU A;  1KFX L;  3QBQ A;  1RUE 2;  5FPB A;  2ZS6 B;  3LEI A;  1ULG A;  3WG4 A;  1PO2 2;  4W6X A;  4XPV A;  2MNG A;  1YQ6 A;  3RZJ A;  2KR2 A;  1Q8P A;  2Q1Z B;  1T2X A;  1UIJ A;  2RHP A;  2KXL A;  4LOT A;  2VBD A;  5BV6 A;  2WWS A;  1OVS A;  1YXW A;  3E6B A;  2MEV 3;  1WGP A;  1X50 A;  1HQN A;  3QH6 A;  2QQI A;  4QB1 A;  4TYS A;  3ZXK A;  3ZXL A;  1CES A;  1COV 3;  3RWK X;  2PAE A;  5KBF A;  3AYC A;  3T2P A;  3VZM A;  1UY1 A;  2LTN A;  5GLV A;  1PGL 2;  2TNF A;  1DP0 A;  3HPN A;  4KBB A;  5FZ8 A;  2JIG A;  3C2U A;  3N7L A;  3T4H B;  4ZXE A;  2R1D A;  3U07 A;  3LCP A;  2NQY A;  5HI0 A;  4KI5 M;  4Q1P A;  1RTV A;  1H2N A;  1SPP A;  4OQ8 A;  3OBZ A;  5F39 A;  1X33 A;  2CNA A;  4RQP C;  4SLI A;  2PA7 A;  4QPY A;  3VN4 A;  3AVS A;  4LHK A;  1OFN A;  3W5N A;  5I91 A;  2E26 A;  4CCK A;  4JKL A;  2NM1 A;  5FQ0 B;  2I74 A;  3H8O A;  2UWC A;  4P9L A;  1ODM A;  2OZJ A;  4QXC A;  5FUN A;  4K8F A;  1WBL A;  4Q4V 1;  4EN8 B;  3AJZ A;  2X53 S;  1C5H A;  1Q56 A;  4TZD A;  4JGY B;  5FMO S;  2HEV F;  4PI2 A;  3W20 A;  4BQX A;  4LKD A;  3W59 A;  2BOI A;  5SV8 A;  5KXE A;  4QXK A;  5KXD A;  1K5J A;  4EN7 B;  4NII A;  1R09 2;  4D7S A;  3D6E A;  4XEZ A;  4MSV A;  5A7W A;  4GXL A;  4FAG A;  2OS2 A;  1G7Y A;  1YI9 A;  2ILM A;  4XET A;  4XQD A;  2DU0 A;  1WMF A;  2BU9 A;  4NWW A;  5CBL A;  5C9A B;  3UK9 A;  5AVP A;  5JSO A;  3BTX A;  2EXK A;  3K3O A;  1YFU A;  5F1R A;  3P3P A;  1WCD J;  3VBF A;  3I2K A;  1RGS A;  2XKO A;  4RR3 C;  5FLH A;  3D0J A;  2P3I A;  4N53 B;  3EO6 A;  1W2T A;  3O7O A;  4DFS A;  3JD7 2;  2CSG A;  2WA4 A;  1I5P A;  1ZVF A;  4K20 A;  1VLN A;  2J7M A;  3OGG A;  5FO9 B;  1C8N A;  1QJU 3;  2VQA A;  3RMX A;  1QOO A;  2IFW A;  3VBU A;  1UL9 A;  2PYT A;  2VM9 A;  3AMH A;  3MLK A;  1TMF 2;  4PLO A;  4W6W A;  2JDN A;  2BVB A;  5LA9 A;  4XXA A;  2BNO A;  4LKF A;  3CO2 A;  4B4Q A;  1WA6 X;  1FI2 A;  3HBK A;  3VZL A;  4WV8 A;  2P3Y A;  1N3Q A;  1XE0 A;  2YC4 A;  5ACA 3;  3WDY A;  3WV6 A;  3ACH A;  2WS9 3;  4ZS2 A;  1YEW A;  2Q8C A;  2WZP P;  5FZA A;  2HWD 3;  4OVE A;  1GU3 A;  4JDO A;  2QQV A;  2SLI A;  1TME 3;  1IGO A;  4Q2F A;  2VGD A;  2TEP A;  3TN9 3;  2V09 A;  2WII B;  4O7X A;  4XF0 A;  1JOD A;  2GH2 A;  4I3G A;  1A34 A;  1KJR A;  2WR9 A;  1DDL A;  1JZ2 A;  2P6C A;  2X8K A;  4RGG A;  1ZBE 1;  3AMM A;  2OPK A;  5F8P A;  3H50 A;  4Y5T A;  1AYM 1;  5A32 B;  4IEW A;  3O1V A;  4Q4W 1;  1JZ8 A;  3B5L B;  2RS1 2;  1PGS A;  5D8A A;  5DUW A;  1BMV 2;  1WCK A;  2W1U A;  4PQQ A;  4MLO A;  4ZPI A;  2GC1 A;  3KVA A;  4NPL A;  1EAH 1;  2R6Q A;  1DG6 A;  3MEP A;  4E4D X;  3VDB A;  3M2M A;  1LCL A;  5DAW A;  4AR2 A;  2GND A;  2WNU B;  5JIA A;  5BUV A;  1I5Z A;  2ENR A;  5F9T A;  1UOB A;  1X36 A;  2AGS A;  3RI8 A;  1RB8 G;  1TNF A;  2QQL A;  1YFX A;  2E53 A;  3MFA A;  4OFG A;  4P14 A;  2EIE A;  5DAB A;  3LOB A;  3OGV A;  1ZX5 A;  4AQ6 A;  4ZU4 A;  1JYN A;  5CKN A;  1W03 A;  3OBT A;  4BMB A;  1OVP A;  3MF6 A;  2AEZ A;  3ETP A;  5K4L A;  1GP4 A;  5A3T A;  1I3H A;  1LJ7 A;  4YM2 A;  5E16 A;  1AL2 3;  4PDW B;  3MPP G;  2RDS A;  2VOV A;  1IHM A;  1GSL A;  2WQ8 A;  4QXB A;  2VMC A;  1XSR A;  2XL9 A;  3SCH A;  3V0B A;  1S0F A;  2XOM A;  5LY2 A;  4RSU A;  3O0V A;  1XYN A;  1RUI 3;  2BER A;  5F2S A;  4O9E A;  4PJY A;  3I2O A;  1C1F A;  5EPA A;  4M00 A;  1QXJ A;  4HVQ A;  2BQP A;  4IEO A;  1JU4 A;  1EYB A;  4R9D A;  1VIW B;  4DXR A;  2YGM A;  1SDW A;  2Z4F A;  3MPB A;  4FPE A;  3BVC A;  1GMM A;  4QGL A;  5FLI A;  3BTY A;  4IEV A;  2ARC A;  5A1L A;  3VBU C;  1WW6 A;  1BBT 1;  1NCQ B;  3VZO A;  1B09 A;  2NMO A;  2OZ6 A;  1CJP A;  2QDN A;  4KGQ A;  3VZN A;  4Q4X 3;  4D7Y A;  4HT1 T;  1BK1 A;  1JOJ A;  2DTY A;  2ZHL A;  4AVA A;  5CAZ A;  1OA4 A;  3M3C A;  4BQ1 A;  4XIL A;  4A2U A;  5C6C A;  3VBS B;  1H1I A;  4Y3O A;  4D6R A;  3SLI A;  3HNB M;  3O1U A;  4GIQ A;  3VDA A;  1I1E A;  2FDH A;  2D3S A;  2V5D A;  3H3Z A;  4LHL A;  4XF4 A;  4CU8 A;  1NY7 2;  5BNQ A;  2D6K A;  5FP8 A;  1EV1 1;  4JGY A;  1KJL A;  2NYY A;  2QUO A;  4MX3 A;  3TEX A;  3PUR A;  5BPX A;  1W6N B;  1UU4 A;  1V9U 2;  1L3J A;  3DXT A;  3SCF A;  3WHU A;  5J1X A;  1J59 A;  2ZJC A;  1G6N A;  3WG3 A;  1XC6 A;  3E1F 1;  2A1X A;  3AZZ A;  1MEC 2;  1C57 A;  3AP6 A;  2ZGP A;  2QE3 A;  1CR7 A;  3LA7 A;  2H6C A;  3P3N A;  4Y26 A;  2ARA A;  4BQ5 A;  1JH5 A;  2Y6G A;  4FPJ A;  1UF2 C;  1W0N A;  2ZZQ A;  3NV1 A;  5D2A A;  2WNV B;  3PUI A;  4R9B A;  5D8A C;  2RM2 3;  5JUV A;  3SIT A;  3ZN4 A;  3THP A;  1VMJ A;  1CPM A;  3MIF A;  2K46 A;  4GJY A;  3CL1 A;  5IVJ A;  5AC9 2;  1OOP A;  1REE A;  4QHZ A;  4N53 A;  4JGZ A;  1VBE 1;  4NHK A;  1IPS A;  1JXN A;  1WLC A;  2JB4 A;  3C7F A;  2VZV A;  4DOU A;  2IZW A;  2VO5 A;  5IK4 A;  2E7T A;  4HL0 A;  4N90 A;  3U75 A;  1UQX A;  2D6N A;  4BQ2 A;  4OI4 A;  1AX1 A;  4BXF A;  5FR3 A;  1NT0 A;  2XLF A;  4QQ2 A;  3Q8F A;  2A6W A;  3U1X A;  4E27 A;  3AP4 A;  3J7M A;  3HJR A;  2ARE A;  1W8N A;  2G9F A;  4ZU7 A;  1PVC 3;  1DQ4 A;  1LOA A;  3NMB A;  5JZG B;  2G4I A;  4HKL A;  3VHN A;  2XVK A;  4XVH A;  1RUE 3;  4ZZ5 A;  4BM8 A;  4P9W A;  1RVF 2;  1CAV B;  4D69 A;  1PO2 3;  1VBB 1;  4LLO A;  4Q0V A;  1QXR A;  3MBW A;  3KV5 A;  1YWK A;  3HIF A;  4JTN A;  5FPX A;  5EYX A;  2VOK A;  1A8D A;  2ZHM A;  2QQM A;  2OT7 A;  1JBC A;  2VMH A;  1UX6 A;  5LZ6 A;  1IG0 A;  4CUG A;  3WG1 A;  1W6P B;  2EAK A;  2R16 A;  3ZXJ A;  3UGF A;  1IS4 A;  5IVE A;  3IKW A;  1NKG A;  4MGK E;  2ZHN A;  4BOW A;  5IAV A;  3RZZ A;  2PLV 1;  4GMP 1;  3I2J A;  4FOY A;  3AM2 A;  5F2W A;  3PU8 A;  5A32 A;  4Q26 A;  1RYY A;  4XF1 A;  5EP9 A;  2GC2 A;  2XH6 A;  1AR9 1;  1EY2 A;  4HKW A;  2AR6 A;  3VKL A;  1MZ5 A;  3N9O A;  2WRA A;  2EIG A;  5GZE A;  1DGL A;  3POF A;  4A42 A;  2PXJ A;  4MHU A;  1JMU B;  2J1V A;  2WNU A;  3BYW A;  4FAH A;  1OXC A;  3M3Q A;  4JGY C;  1LOE A;  1OH3 A;  3DEC A;  4V2W A;  1OLM A;  2OQ7 A;  4KU7 A;  4DEV A;  3N7M A;  4IDZ A;  2F4L A;  3VBR B;  3EYP A;  3IDA A;  3U10 A;  3GBF A;  3AKT A;  4FCA A;  5JSP A;  1AJK A;  3CHX A;  4XUP A;  5IK7 A;  2BOJ A;  4QX7 A;  4XFI A;  3LDB A;  5DN2 A;  1I6X A;  3ZYB A;  5KHJ A;  5KR7 A;  4PDW A;  2R7E B;  2XUM A;  2IXL A;  5C9A C;  4A7K A;  1H9W A;  1R09 3;  3IAP A;  3VKF C;  5SV5 A;  4A7Z A;  1SDD B;  1JUI A;  4QX1 A;  2DVG A;  2XQX A;  3ALQ A;  3I54 A;  4LO7 A;  4ERO A;  2EXI A;  3SIS A;  1OOP C;  2PN5 A;  3RSJ A;  1FNY A;  2VTX A;  4JGZ C;  4N53 C;  3IPV B;  1ASJ 1;  3PTY A;  3WY6 A;  1W6Q A;  1LOG A;  4XUN A;  4N9H A;  3GM8 A;  1CZV A;  1H2K A;  1W6O B;  2ARB A;  4D6S A;  3A4U A;  3AZV A;  2NP0 A;  4C8D A;  5A1F A;  3AMN A;  1XND A;  3MW3 A;  3ZYH A;  1LGN A;  1JS9 A;  4AVB A;  3I3D A;  2IVI B;  1NCQ A;  2GAL A;  1HRV 1;  1XPW A;  4CCN A;  3JD7 3;  4S2D A;  1F2N A;  1AR7 2;  1LHW A;  4KBZ A;  2E63 A;  2K2S A;  5AFB A;  1CON A;  1C8M 1;  2XLG A;  1QNW A;  1NLR A;  2UWA A;  1LKN A;  1OD5 A;  2XBO 1;  1TMF 3;  2JDM A;  4QKD A;  1W8Z A;  3ZSK A;  2CHH A;  4Q0P A;  3WNO A;  2BNN A;  1FV2 A;  2KA3 A;  1W39 A;  5JR7 B;  4OHZ A;  4JCK A;  4E4S A;  2IXJ A;  3HN3 A;  2GME A;  1TE1 B;  4L2N A;  3H1Y A;  3OD4 A;  4A3Z A;  1WD4 A;  4LQR A;  1CAU A;  2XJR A;  2W0X A;  3OGR A;  1RUF 1;  1MZ6 A;  3D5O A;  2PHX A;  5CA6 A;  1D0H A;  2W3J A;  5FPZ A;  5FZ3 A;  2FQP A;  3CEW A;  4LNV A;  2Y26 A;  3IT8 A;  4CEY B;  2BDR A;  2ORZ A;  2WNV A;  1DCS A;  1HKD A;  3POB A;  4Y1U A;  3ZR6 A;  2C6S A;  4XE9 A;  1MVE A;  4HXC A;  2RMU 1;  2E6V A;  5I0R A;  1YQC A;  2VNO A;  2VU9 A;  1S0J A;  2WNU C;  5I0S A;  3WDU A;  2RS1 3;  1QJY 1;  2JKB A;  5A7N A;  4CEW B;  3I49 A;  4A45 A;  4AF9 A;  1UY0 A;  2W95 A;  3J7H A;  3AZX A;  3PME A;  3ACF A;  3OJB A;  5FZ7 A;  1YI7 A;  5T52 A;  2WQZ C;  1OH4 A;  1X8E A;  4MOA A;  1JZ7 A;  3SQO A;  2HYX A;  4Q4Y 3;  2QZ3 A;  2BEO A;  3SCG A;  4PDW C;  5JZG A;  2BVV A;  1OLR A;  2YB7 A;  1WMX A;  3WOG A;  2HLE A;  1TQ5 A;  3JZV A;  5F3E A;  1W90 A;  2R04 2;  2QDR A;  4Y4R A;  4DUW A;  5EQU A;  1CAV A;  4GKY A;  3INA A;  5LRS A;  3POJ A;  1WME A;  4AEM A;  5C70 A;  5LAS A;  5A3L A;  2WSV A;  5JPN B;  3HMY A;  3RZG A;  1L7L A;  2LRO A;  1G9A A;  2IVJ A;  1ZYB A;  1IS6 A;  3WNM A;  1W6P A;  1D4V B;  3HVD A;  2DUO A;  3HAG A;  1E5S A;  1NCQ C;  4MXW B;  4Y24 A;  5LY1 A;  2K9Z A;  1S2B A;  1IS5 A;  1UY3 A;  4OUM A;  4XQW A;  3LDR A;  4LKE A;  2ZX2 A;  4CUA A;  1LRH A;  4UOJ A;  4JC1 A;  3DKQ A;  1W04 A;  5A3M A;  2ERF A;  3G6J B;  2R07 2;  2R49 A;  4GWM A;  4IL7 A;  5A7O A;  3GBW A;  2V4A A;  5FDB A;  1HXS 1;  4RQP B;  1W99 A;  2N7G A;  1K12 A;  2JE9 A;  2PHF A;  5C3R A;  2W9X A;  4I30 A;  2PHU A;  2CTV A;  4MGI E;  3ZLI A;  3VBR A;  1BJQ A;  1UW8 A;  1Y9G A;  1AR8 2;  1JHN A;  1OMI A;  3MW4 A;  3O12 A;  3UJO A;  5AFE A;  2D6P A;  1V9U 3;  4XZU G;  2HYK A;  2W1W A;  2ZCW A;  2WNV C;  3ILN A;  4FTE A;  2Y0I A;  1XU1 A;  1MEC 3;  1PIV 1;  1H2M A;  1XNK A;  4XDP A;  5CEH A;  5JOZ A;  4IEQ A;  1AYN 3;  1CIW A;  2XDV A;  1WW4 A;  1CAW A;  2A6Z A;  1H6X A;  4NAM A;  5FJK A;  4BQ3 A;  1HRI 2;  4LOR A;  4GA9 A;  2G1M A;  3GF6 A;  4YFZ A;  1UU5 A;  2D6O X;  2O0O A;  3WP6 A;  5KC6 A;  4QX2 A;  2XJU A;  4UBG A;  3VD9 A;  1HX6 A;  2WAO A;  3P5B A;  2WT0 A;  3WUC A;  2JD4 A;  1HN1 A;  1QH6 A;  1W6O A;  4AI9 A;  3JBG 2;  2WQ4 A;  2WFF 1;  2ZAA A;  4C0H A;  2VH9 A;  1CX4 A;  1XE7 A;  4IQP A;  1VBD 1;  2Q4S A;  4XUQ A;  4ZZ8 A;  5AC9 3;  1YYN A;  2Y38 A;  1S2E A;  4BE3 A;  2WNO A;  2VMD A;  2JDZ A;  4LUL A;  5EV7 A;  1U5I A;  4LJH A;  1VRB A;  1OF4 A;  3KV9 A;  2Y6K A;  2BUK A;  2P5B A;  4AI2 A;  2JG8 B;  3ES4 A;  5EWS A;  3WX5 A;  2EXH A;  2IFR A;  1XYO A;  5JZG C;  2XB6 C;  4ATF A;  4HK9 A;  4ATE A;  1JYV A;  1KD7 A;  2E9Q A;  1XNT A;  2CGO A;  1GAN A;  4LE3 A;  4X8P A;  2RJ2 A;  1LEN A;  3ACI A;  5FTT C;  1D7P M;  1W2U A;  4EV0 A;  1UXZ A;  3EB7 A;  3BU0 A;  3B7M A;  4QM8 A;  5J48 A;  4M0N A;  5FMC A;  2PAM A;  1VP6 A;  4BME A;  2A7A A;  3ZX7 A;  1AUY A;  1JOP A;  4IE0 A;  3WP5 A;  1RVF 3;  2FMD A;  1FAY A;  2R0F A;  5HV4 A;  2V5Y A;  4K40 A;  1OPM A;  4RFT 0;  5FZ6 A;  4UFM A;  4K6B A;  1DF0 A;  1YIP A;  3FHQ A;  3HEI A;  5T5O A;  2OPW A;  2D6M A;  4Q4V 2;  3SKV A;  2ZX3 A;  3LSD A;  2H6B A;  3NNF A;  4BQW A;  1FXZ A;  2DCK A;  1W8O A;  3DN7 A;  1GWL A;  2B46 X;  2J1T A;  5EYY A;  2EF6 A;  4MZU A;  5IVV A;  3R0R A;  3CMG A;  3ROU A;  3V64 A;  3FX3 A;  1OSG A;  3CKH A;  1FPN 1;  2ARX A;  2VMI A;  2VZQ A;  3MIC A;  4UXA A;  4FOW A;  1VB4 A;  1SPP B;  3M4F A;  2XG3 A;  1RHI 2;  5JMC A;  2CAV A;  1WLW A;  2GNT A;  4YLZ A;  5CYY A;  2VG9 A;  2C9K A;  3C7E A;  2AEY A;  3IMM A;  3JUU A;  3MIB A;  2P34 A;  3MV1 1;  4I01 A;  3ZVX A;  4CP9 B;  1CVN A;  3QOP A;  3VBR C;  3CZJ A;  1ODN A;  3LOI A;  1A6C A;  4TWT A;  4QB6 A;  2J1S A;  5CNA A;  4E2S A;  3BB6 A;  1S0C A;  4HVO A;  3WDX A;  3D8C A;  1WLD A;  1KDK A;  4O65 A;  4XYX A;  3WF4 A;  5LBB A;  1H4H A;  3VBH B;  3A7Q A;  3OGS A;  1LES A;  2D5F A;  1N1T A;  3CZU A;  2VUL A;  3ZPY A;  2B9V A;  2FCT A;  5A7W B;  2W1Q A;  4KWU A;  2J1U A;  1P8J A;  5CG8 A;  2VC9 A;  3III A;  4X6R B;  1UXX X;  4FT8 A;  3WW1 A;  4NRM A;  1UO9 A;  3QLQ A;  2FCV A;  4QQH A;  3LSE A;  3RYP A;  1GP5 A;  1LED A;  4CVU A;  5FZ4 A;  3VBF B;  1W9T A;  4TTG A;  5A33 B;  4P9Y A;  1N1Y A;  2RDR A;  1W0O A;  2KM2 A;  4XJU A;  5D1I A;  3WNL A;  4DY5 A;  3ZSJ A;  1GWK A;  5J37 A;  4A6O A;  4QHO A;  1Q5O A;  3KCC A;  4OHW A;  3T0A A;  1DGW A;  5HCB A;  4FTB A;  2WWU A;  2WKK A;  3NRU A;  4Z07 A;  1AR7 3;  2VW2 A;  3GZA A;  3APB A;  4MGQ A;  1BZW A;  5JXJ A;  5HCF A;  2DVF A;  4Z1V A;  5LA2 A;  4CCO A;  1AXK A;  3POE A;  4URA A;  1AYM 2;  3FZ3 A;  4QQO A;  3OF1 A;  4XFF A;  2JIC A;  2EAL A;  3GAL A;  1RXG A;  4IXL A;  1UKR A;  1QKQ A;  4PIX A;  4YVW B;  2YXS A;  1OLM E;  1OUR A;  1UOG A;  3AYD A;  4FOQ A;  4YGD A;  3WEZ A;  4CEY C;  1UOJ A;  5FWE A;  3LPF A;  4DXS A;  1Z78 A;  4U36 A;  3ELN A;  2XXZ A;  4QU2 A;  3ATG A;  5GKA C;  1GZW A;  1VAK A;  3ZPO A;  2ZGM A;  3OD0 A;  3MHZ A;  1XNB A;  4CDW B;  3F2Z A;  5FXV A;  3DUI A;  3NJY A;  1J1L A;  2VY0 A;  3FBY A;  3N7J A;  3POG A;  5A3P A;  5DUV A;  1W28 A;  2K0G A;  4MYE A;  1X82 A;  5F7U A;  4B7K A;  2QQK A;  4PBP A;  2X10 A;  3THC A;  3B02 A;  3ZKU A;  2VAU A;  4PI0 A;  4YGE A;  3PL0 A;  3VZJ A;  4D6Q A;  4CEW C;  1MVQ A;  2XJT A;  4NR1 A;  2FDK A;  2DYC A;  4Y1Z A;  4UFH A;  4B1M A;  1QJF A;  4CDX B;  5KXC A;  2H0V A;  4GWJ A;  4WBB A;  1J83 A;  1QQP 1;  2JE8 A;  2BGC A;  1VJ2 A;  1I9R A;  1STM A;  3O1R A;  3KWV A;  4S2H A;  3OGJ A;  4UFK A;  5HBA A;  1O3R A;  4GB3 1;  2YC0 A;  2VQT A;  4KWL A;  3RRD A;  1NXD 1;  1ZZC A;  2JEN A;  3AYE A;  3K48 A;  1IG3 A;  3S30 A;  2PAK A;  1K5M A;  4JKM A;  1S0E A;  4NJ4 A;  4LIU A;  4ZXK A;  4NRP A;  1N3P A;  5KWR A;  1EUU A;  4YAR A;  1BBT 2;  1GQH A;  1ALY A;  1PX4 A;  3PVE A;  3BKZ A;  2R04 3;  2ADD A;  1ZZ8 A;  4BU2 A;  4CSW A;  4XBN A;  2EIB A;  3KM5 A;  2VTF A;  4AEK A;  5JXI A;  1TZO A;  1UCX A;  3AXD A;  3V0B B;  3ENR A;  3I2D A;  1ULE A;  2D7F A;  1QJZ A;  3E6D A;  1QOS A;  4CU6 A;  1E5H A;  1H6Y A;  2VQ0 A;  1RMU 2;  1M06 G;  1J3R A;  1MQT B;  1EV1 2;  2W5F A;  3I2F A;  3J4U H;  3KQ4 B;  3D3A A;  4ZON A;  5DUX A;  3BTZ A;  4N8M A;  4MG2 A;  5C3S A;  3K4Z A;  1JTZ X;  1RUG 1;  3FN9 A;  2J22 A;  2O8Q A;  2VNG A;  3R4S A;  2W68 A;  5E88 A;  4E4H A;  3WZ1 A;  5IHR A;  3AC0 A;  4OI2 A;  4KMQ A;  3ZN6 A;  1DGW X;  2HWE 1;  5I8S A;  3O1P A;  1UMI A;  2Z69 A;  3RJR A;  5G04 L;  5K0U A;  4OUL A;  3H7Y A;  3GNE A;  4CP9 A;  1MS9 A;  1H8V A;  4O9G A;  2DVD A;  2XJP A;  2RR1 1;  3FHA A;  3LB9 A;  3NJV A;  3WDW A;  5B4N A;  3U4S A;  1LB2 A;  1MS1 A;  2NMN A;  2R07 3;  3K3N A;  4EWE A;  3WIN E;  2E32 A;  1ND2 B;  4R9C A;  4XAC A;  2GNB A;  2CGP A;  1QGL A;  3N35 A;  4LXL A;  2OX0 A;  2VE1 A;  2HWB 2;  2XWJ B;  3M70 A;  2YPD A;  4NPM A;  4OUE A;  1GQP A;  4ITC A;  1VBE 2;  3BAL A;  4HET A;  3Q8A A;  5GZF A;  4E8C A;  1AR8 3;  1RUD 1;  3VBH A;  2FDG A;  2QZ2 A;  1F5F A;  2JDH A;  4N43 A;  4QDS A;  1QDC A;  2HWD 1;  3Q9O A;  1HIX A;  3H0O A;  4YVS A;  1XQN A;  2PHR A;  3OPT A;  4UFL A;  4JQR A;  1TME 1;  5BY5 A;  2VJX A;  2WUH A;  4Q0S A;  4QPG A;  1YRZ A;  1O8S A;  2Y8K A;  1HRI 3;  3B9C A;  4QPI A;  2NLR A;  4EYU A;  4DMI A;  1XNA A;  4K3U A;  2VNR A;  1VBA 1;  3I59 B;  5A6X A;  1BEV 1;  2D97 A;  3KT4 A;  5ERL A;  4KNC A;  1OOP B;  5A33 A;  1U0A A;  2JG8 C;  2I07 B;  1O4T A;  5FFO C;  3JBG 3;  4JGZ B;  3WNP A;  4CCC A;  1SHW B;  1VBB 2;  3U78 A;  2HKX A;  3MIE A;  4TN7 A;  5J09 A;  4MVT A;  4Z2W A;  5H9Q A;  2FD8 A;  2AEN A;  1Y9Q A;  2F17 A;  2WIN B;  3DCQ A;  4CXY A;  2HWF 2;  2AC1 A;  4BA6 A;  3N9L A;  5J36 A;  4XOG A;  2RG4 A;  3SNM A;  3KMH A;  4XFG A;  4CDQ B;  1GWM A;  4OHV A;  4BIO A;  1FOD 2;  5HCH A;  2PLV 2;  1JI6 A;  4GWN A;  3SEP A;  1ENX A;  1KGY A;  4Q8L A;  2DVB A;  4YPJ A;  3IZO A;  2DBI A;  1AR9 2;  3KF3 A;  5A3O A;  2WN3 A;  2QQN A;  1MPX A;  3UJQ A;  2DVA A;  1D4M 1;  2G9G A;  4BLJ A;  4YVW A;  3UL2 A;  1MS3 A;  4AFC A;  1WWY A;  2JDU A;  3MV0 1;  3KSC A;  4DNY A;  4M0H A;  3TYJ A;  4UYB A;  5FPA A;  4A3X A;  1PO1 1;  1FV3 A;  3FUQ A;  3ILF A;  4XMI A;  4A6S A;  4AHX A;  4CDW A;  1Q3E A;  2BP6 A;  1N1S A;  3LF7 A;  1W9F A;  4IEY A;  1RUI 1;  2E7A A;  4LEJ A;  2ORX A;  4QWN A;  1FMD 2;  5BXX A;  4Y1X A;  1ZRE A;  2A6X A;  4Q4V 3;  4FPF A;  3WF3 A;  2WZR 1;  1OD3 A;  3ZXG A;  1RUJ 1;  1CWP A;  1WUV A;  3WF1 A;  4L8Q A;  5K0U C;  1PZ7 A;  4RHV 1;  3KS7 A;  3HWJ A;  4YZ4 A;  2E31 A;  4OQ9 A;  1AR6 1;  3WCR A;  2DBN A;  1DBN A;  3ZOI A;  1XBF A;  2HWC 2;  3TBD A;  4XJ9 A;  4CDX A;  2CL2 A;  3ILR A;  5K7P A;  5K8S A;  3IWZ A;  2VCM A;  1RHI 3;  3LGR A;  5DDJ 1;  2EXJ A;  2VZR A;  5A70 A;  2DUQ A;  5FYV A;  2EA7 A;  4NRQ A;  1LHO A;  2VOW A;  3SH5 A;  1ND3 B;  5FKB A;  1NX9 A;  4A41 A;  1IKP A;  4AVC A;  1BYH A;  3K46 A;  4QU1 A;  1ASJ 2;  4JHZ A;  3VBH C;  3P6B A;  4AVS A;  1W9W A;  3J7L A;  4QB2 A;  5GZD A;  2XJS A;  2VUC A;  5JSR A;  2MPF A;  1WD3 A;  2JE7 A;  3VDD B;  4BQY A;  3V0A A;  3OBR A;  3A23 A;  3ZN5 A;  2D6L X;  1HRV 2;  1OFS A;  1QJX 2;  2JDA A;  5FCC A;  4NAO A;  3WD5 A;  1GR3 A;  1CGP A;  1DLC A;  2JDP A;  2YC2 A;  3H8U A;  3MO4 A;  5FY8 A;  1UZY A;  4AHY A;  2E33 A;  1V70 A;  4OMC A;  3VBF C;  4YM1 A;  2D98 A;  2XBO 2;  4DB5 A;  1FX5 A;  5CFD B;  4YZ3 A;  2RM2 1;  3CDZ B;  2WO3 A;  1MQT A;  1W6Q B;  4GKX A;  1NAE A;  3HQR A;  5FZD A;  4PLN A;  3SH4 A;  3WQ0 A;  4ONU A;  3RZK A;  2JG9 B;  1WBF A;  2BYV E;  4QDR A;  4QX0 A;  4AE2 A;  2UYB A;  1V6M A;  1RUF 2;  5C8W A;  2P3K A;  1CAX B;  3K4D A;  3L2H A;  4XJZ A;  2OA2 A;  4AOC A;  1RJ8 A;  5IYY A;  1B35 A;  4ES8 A;  4IUG A;  5FV3 A;  2YBK A;  2ZMN A;  3HQU A;  1GNH A;  1X8M A;  2ZGU A;  4CZS A;  4YZ1 A;  2ZBJ A;  1K3I A;  2YBP A;  3V56 A;  5FZO B;  2J1E A;  4NHY A;  1ND2 A;  5IVC A;  3POY A;  3AFK A;  4YVW C;  2RMU 2;  3GZE A;  1GOH A;  2A6Y A;  4FSJ A;  3AP5 A;  4P5H A;  1AYM 3;  4IGO A;  4NRO A;  3RDI A;  1O4Z A;  4MO3 M;  1CAU B;  4CDW C;  4KWK A;  5CB7 A;  4CRQ A;  1POV 0;  5I0T A;  4BCU A;  4XTM A;  1F35 A;  1QJY 2;  3J8F 1;  1UN1 A;  4DRR A;  3WHT A;  2P3J A;  1LGC A;  3USU B;  5IUQ A;  3I3B A;  3MYX A;  4NO4 A;  4DEQ A;  3PJY A;  4FFH A;  1U5X A;  4X6Q B;  2BFU L;  4CDX C;  1IPJ A;  2J1R A;  5CG9 A;  2DCT A;  4H3W A;  4BXS V;  2VOT A;  2E51 A;  4AI3 A;  3I59 A;  5E8A A;  4NN0 A;  3U4X A;  1NQD A;  1T6B X;  2EAA A;  1LUL A;  4YW6 A;  1H30 A;  1POV 3;  5T5L A;  4YG0 A;  3AMP A;  5F37 A;  2C5D A;  5T5P A;  3G7D A;  1OKO A;  3AKR A;  4XW3 A;  1O7F A;  2JDK A;  4Q5O A;  4CP1 A;  3S6P A;  2Y60 A;  3KGZ A;  4B4P A;  4D94 A;  1UZW A;  3A0K A;  3WF0 A;  2GN7 A;  4YSF A;  5JR2 A;  1ZRC A;  1KIT A;  2BW8 A;  4CDQ A;  1BCX A;  5JDB A;  1CD3 G;  1VBC 1;  4AI1 A;  2O1Q A;  1H8T A;  1G86 A;  3CJX A;  1LOF A;  1R08 2;  1Y7B A;  3WQ7 A;  4AK3 A;  3EXU A;  2RDQ A;  4L0P A;  4QDQ A;  4ZS3 A;  1Q8O A;  2VQU A;  2IXC A;  1BBT 3;  4I0W B;  5H9P A;  5FY9 A;  1JYX A;  5L73 A;  4OZX A;  1MQT C;  5A6Y A;  2CGN A;  1QIQ A;  1HXS 2;  1R09 1;  3OY8 A;  5LBF A;  3MGU A;  4XUR A;  3EQE A;  4BB3 A;  4B29 A;  1KFU L;  4LKS A;  3W58 A;  5FY1 A;  2LRP A;  2ZEY A;  2ZZJ A;  3BCW A;  1VPH A;  1YLL A;  1RMU 3;  4FOV A;  5JOY A;  1EV1 3;  2WAA A;  5C71 A;  5CZK A;  2HBU A;  4AAP A;  4C1W A;  3M3E A;  4HN1 A;  4LBK A;  1PZ9 A;  4NIG A;  1SFP A;  1UPS A;  3KD4 A;  5F3I A;  3B3Q E;  3ZO0 B;  1W8H A;  1V00 A;  1UKG A;  4XJW A;  3PTR B;  1ND2 C;  1UYP A;  4I2O A;  2CAU A;  3JD7 1;  1YC6 1;  3E97 A;  1G9B A;  1ND3 A;  4XAE A;  3M3O A;  3AB0 A;  1MZE A;  3PHM A;  5IVF A;  1MZF A;  1HB1 A;  2QFE A;  1UOF A;  3I97 A;  2VUA A;  3MIH A;  2ADE A;  2VXR A;  4IEU A;  3M7A A;  3ECQ A;  1XU2 A;  3GHM A;  2HWB 3;  2ZX0 A;  1VBD 2;  5FMO L;  4FQ4 A;  3ZR5 A;  2BPA 2;  5IAX A;  3VDD A;  1RUN A;  2Y34 A;  3FL7 A;  5IK5 A;  1ZNP A;  5HPO A;  1ST8 A;  2Y0O A;  1NA1 A;  3UES A;  4ARY A;  4PHZ A;  4H2A A;  1SLL A;  5LK5 A;  1SEF A;  4MH0 E;  1O3Q A;  1CAW B;  2Y64 A;  4EWD A;  2RV9 A;  4CXX A;  3OPW A;  2XL7 A;  4M3C A;  1UY4 A;  2I45 A;  3WLU A;  1O4Y A;  2YUE A;  3KHB A;  4YFW A;  5CFD A;  3IDC B;  4CYD A;  1NYW A;  1Q43 A;  1AVB A;  1ZBA 1;  4BHP A;  3RS6 A;  3D0S A;  4GMP 0;  2V73 A;  4QKB A;  5FYM A;  4BQ4 A;  2JG9 A;  4AQ2 A;  4XFB A;  4AHW A;  2HJI A;  5FKC A;  2PTM A;  4I0B A;  4LBQ A;  3FMG A;  4HOO A;  1CAX A;  2JJ6 A;  4BWO A;  1VBB 3;  4IV1 B;  2NPI A;  4CDQ C;  1BQP A;  3PMS A;  3GJA A;  4GAL A;  5FYC A;  4RD7 A;  2ATF A;  3OB8 A;  5A7Q A;  3VHO A;  2HWF 3;  4FP3 A;  1YCI A;  1AL0 G;  1LOF C;  2L9L A;  5FZO A;  4DRV A;  5IAT A;  3TNP B;  4XC9 A;  2WO2 A;  3RYR A;  3GXU A;  4NHM A;  1FOD 3;  3TAY A;  2PLV 3;  4GMP 3;  2EVX A;  1FPN 2;  2WLP A;  4Q4Y 1;  1H9P A;  5DZG A;  4ZY9 A;  3E6C C;  1VB2 A;  2X29 A;  5HV0 A;  1GZC A;  3IDE A;  2NZ9 A;  2G9Z A;  1AR9 3;  2UWB A;  3NV2 A;  4S2F A;  1UZZ A;  4UW3 A;  3A22 A;  5T55 A;  3GCW A;  3RJ2 X;  3ZXE A;  4LA2 A;  4CPB A;  1VRH 1;  4NIA A;  1O5U A;  4TSV A;  3SKJ E;  2P1B A;  3N9Q A;  3USU A;  5JXH A;  1AXZ A;  4QKN A;  1OA3 A;  5FMD A;  3ON7 A;  1DYK A;  5FYU A;  4AED B;  1QU0 A;  3WQ1 A;  3T0B A;  1R1A 2;  3RGB A;  2OVU A;  1FMD 3;  2JIJ A;  2QNK A;  4FPO B;  5C3Q A;  3JCI A;  3N7K A;  3RZL A;  4G9S B;  4UWD A;  4Y33 A;  5FBJ A;  3NW4 A;  4M01 A;  1ND3 C;  2RS3 2;  3ZSE A;  2Y6H A;  3PJQ A;  1W6M B;  1KS4 A;  3JB8 A;  4L99 A;  2HWC 3;  4OYU A;  3LFM A;  3T1M A;  2WN2 A;  5FK8 A;  1N1V A;  4LUK A;  2R06 1;  1DLL A;  3KF5 A;  2RS5 1;  5LW9 A;  3KCX A;  2VZS A;  3S5A A;  3URF A;  3VDD C;  3ZIW A;  3LAG A;  3U37 A;  4Q0U A;  2P6H A;  1ASJ 3;  2ZX1 A;  1BLZ A;  1NA1 C;  1JHJ A;  2Q8E A;  1GNZ A;  3KLS A;  1SLB A;  1XYP A;  2PHD A;  2BRT A;  3VKN A;  2P17 A;  1ULD A;  4RS5 A;  3IBM A;  1JZ5 A;  1V9U 1;  4FO9 A;  1GLH A;  3VDC A;  3O5S A;  5DZE A;  3N9N A;  5A80 A;  5CFD C;  3VD4 A;  1HRV 3;  3F95 A;  3UYJ A;  1O91 A;  1QJX 3;  3T2O A;  4LMF A;  4XDQ A;  1AYN 1;  2VZ1 A;  5FUI A;  2VPV A;  4XMA A;  2XR4 A;  3FFZ A;  2JG9 C;  4XXP A;  5GZC A;  1JZ4 A;  1NCR A;  4W8J A;  2XBO 3;  4LPL A;  3FBM A;  4P02 B;  3TNQ A;  1LTE A;  4B8E A;  2F4P A;  3AJY A;  3MFC A;  5FO7 B;  1RUH 1;  2A3W A;  4ZU5 A;  1RIT A;  3PUQ A;  4HFS A;  3VBO A;  4AI8 A;  5FZM A;  4MV2 A;  3I3E A;  3P1I A;  4HG6 B;  1KS5 A;  4PF1 A;  1RUF 3;  3MLL A;  4PT6 A;  2C9A A;  4XHB A;  4ZKT B;  1PHM A;  4N7I A;  4E9K A;  3LKJ A;  1Z7S 1;  4YWA A;  1AZD A;  3NO8 A;  1DIW A;  2Z5W A;  4Y22 B;  1DQ1 A;  2E7Q A;  4GUL A;  4BDV B;  2PMW B;  1A3K A;  3WDV A;  3Q8C A;  2B4K A;  5KHH A;  4ISR A;  4AHZ A;  4ET7 A;  1YFY A;  3WNK A;  3TWI A;  3BU7 A;  1GYK A;  1X9P A;  3UGH A;  4QGN A;  2QJV A;  3DEM A;  4UAP A;  5JLV A;  3AKQ A;  2X09 A;  5FZK A;  1ZRR A;  5FY7 A;  1QQP 2;  2W39 A;  4CP0 A;  4DXZ A;  1QJY 3;  3UV9 A;  1RVF 1;  5DAP A;  5L19 A;  4Q29 A;  5FZE A;  1GZW B;  3NKT A;  4NOT A;  4GB3 2;  2HEW F;  2Q5T A;  4LT5 A;  2J42 A;  2YY1 A;  4BZ4 A;  1MR5 A;  1FAT A;  2ZGN A;  3SH3 A;  1W06 A;  4KU8 A;  1G9C A;  4GQ7 A;  1V6J A;  1U5Z A;  5GZG A;  5JOW A;  3IM0 A;  2AAC A;  1X7N A;  4LBQ D;  4RYD A;  4YW1 A;  3A21 A;  3NL1 A;  1UAI A;  2VME A;  4YYO A;  1PMH X;  3PVO A;  4TXW A;  5EHD A;  4EN0 A;  2IUW A;  2ZGR A;  4EZ4 A;  4IE6 A;  4IV1 A;  5JXG A;  3ZYR A;  4Y5Z 0;  1C1L A;  2RE9 A;  4GWI A;  2O14 A;  5FY5 A;  2TBV A;  1YNA A;  2GNM A;  1TVG A;  3EBR A;  3PIG A;  3GDB A;  4RS5 C;  1OQ1 A;  3KT1 A;  4LE4 A;  4NE9 A;  1K5M B;  2ET7 A;  2WA3 A;  3DPR A;  3HNY M;  5L9B A;  1RUG 2;  1YIF A;  5KHI A;  3NST A;  3J26 N;  5L36 A;  1YFW A;  4AL9 A;  4JDM A;  2VW1 A;  3LEG A;  3NAP B;  1JYW A;  2HWE 2;  5FY4 A;  1R08 3;  4CPB D;  2VZO A;  1NCR C;  1VMH A;  5AVA A;  1JW6 A;  2RR1 2;  2PFW A;  1K45 A;  2HBT A;  3BN6 A;  2X05 A;  4G3Y C;  3OOX A;  4XQ4 A;  3WSO A;  1E5I A;  3B94 A;  1HXS 3;  3VBO C;  1YO8 A;  2ZA9 A;  3B01 A;  4JX0 A;  4OCT A;  4AED A;  4R4X A;  1UX7 A;  4XF3 A;  5FYY A;  1W8T A;  3OYW B;  5B2G B;  1HQL A;  3CNA A;  3T2Q A;  1OHF A;  1BK0 A;  1KXG A;  4XIK A;  3T2T A;  4C1X A;  3O1M A;  3DYP A;  3H8R A;  4DUX A;  1RUD 2;  4COW A;  2XPJ A;  3PVB B;  1RED A;  4H55 A;  2VCB A;  2WJS A;  1RUC 1;  2VNV A;  3LA3 A;  5FAX A;  2WO1 A;  3SXW A;  1W6M A;  4MGY E;  3ZN6 B;  2WAB A;  4CDU A;  4D8M A;  5K0U B;  1FNZ A;  2XJQ A;  4CE8 A;  1GOG A;  4QQL A;  1LHU A;  5LEK A;  1YUD A;  3BOP A;  3JXS A;  3S57 A;  2BBA A;  2ZGS A;  1ENS A;  1WKY A;  4AG4 A;  4C0B A;  2YZ4 A;  4F83 A;  1VBA 2;  4QKF A;  1PGW 1;  5A1A A;  1BEV 2;  5FUP A;  5EXO A;  1SCS A;  4QMA A;  4LOS A;  2QQP A;  1GZT A;  3B69 A;  4YM3 A;  3MI8 A;  4I3P A;  4AYU A;  4IW3 A;  1VBD 3;  4FPG A;  3GZU C;  4HVR A;  5LRR A;  4M3C F;  4N43 B;  4HSJ A;  2D43 A;  4YVS B;  4YW5 A;  4YNI A;  1NZI A;  2OYZ A;  1RIN A;  4LBM A;  4QPG B;  4AFA A;  3L2Y A;  1ZZ6 A;  2BJS A;  3ZXD A;  5ANQ A;  3IIA A;  2Q8O A;  5CAD A;  4QPI B;  3AK0 A;  3H8X A;  1UZ0 A;  1R64 A;  1PNF A;  1J84 A;  3FLR A;  4AVV A;  5IVB A;  1WCU A;  2BWC A;  1UYZ A;  4IV1 C;  1NLQ A;  3RG0 A;  1D4M 2;  2ZGT A;  3UGG A;  4NID A;  4XFA A;  2XHK A;  4XUO A;  4NVP A;  1XJA A;  3KV6 A;  1HLC A;  2JKX A;  4DXT A;  3S5Q A;  3T30 A;  4PCR A;  4PLM A;  4XAA A;  5JCT A;  4Y1V A;  1PO1 2;  2VD7 A;  1VAM A;  2JWP A;  2PQS A;  3BIE A;  4ORF A;  1RUI 2;  1DFQ A;  1ONA A;  3POW A;  3VL8 A;  4IEP A;  2CYF A;  4LHS A;  3O14 A;  4QPW A;  5G05 L;  1AX2 A;  3HR9 A;  3PUA A;  2CU5 A;  1ZBE 2;  2WZR 2;  4R9A A;  4L11 A;  1RUJ 2;  2ZEW A;  4Y22 A;  4CP2 A;  1CZT A;  1QMJ A;  2YBS A;  1JOB A;  4RHV 2;  5FZ9 A;  3HT1 A;  4Q4W 2;  3ZYG A;  4BH9 A;  5C7G A;  1AR6 2;  1Y43 B;  1FPN 3;  1J58 A;  3Q8B A;  3WR0 A;  4JKK A;  3A0N A;  1QY4 A;  1EAH 2;  2DF7 A;  2FBE A;  3DYO A;  3VD5 A;  3ACG A;  5DDJ 2;  1C5I A;  3CIH A;  4AED C;  4E2Q A;  1OUX A;  3EMR A;  1J3P A;  5LCW L;  1UYY A;  2XHN A;  3CBN A;  1SBE A;  3NNG A;  2GMP A;  4AVT A;  4S2G A;  4ASL A;  2C24 A;  4KWJ A;  4E8D A;  1XSQ A;  2MEV 1;  3ZYP A;  5CKM A;  2ZXQ A;  4AW7 A;  2YV8 A;  2Q1F A;  1COV 1;  2DV9 A;  3HOB A;  4R52 A;  3POI A;  1EUT A;  1R1A 3;  4LBN A;  2VTX J;  2WNE A;  4LO8 A;  4YW4 A;  4CU9 A;  4Z8B A;  2XWB B;  4XF9 A;  5LAT A;  1JZ6 A;  2FMY A;  3L9J T;  2QQO A;  3RQ0 A;  4UT5 A;  1SBF A;  5T54 A;  5KXB A;  2RS3 3;  4FTS A;  1O6U A;  2UY9 A;  1Q8Q A;  4XDO A;  5IVY A;  1YJK A;  3UNP A;  4C90 A;  1ZA7 A;  5FMB A;  1W05 A;  2QTW B;  2OQ6 A;  2XJV A;  5FZ1 A;  1PK6 B;  1Y9M A;  4HPK B;  3VD3 A;  2RM2 2;  5GLZ A;  2A6V A;  1D2Q A;  4Q27 A;  3ZXF A;  5EZW A;  2R32 A;  2WLQ A;  1BHG A;  1T6G C;  5CVR A;  3UT0 A;  1UU6 A;  4QX3 A;  1HJG A;  3S7I A;  3IN9 A;  3NJX A;  4JV4 A;  2ZAH A;  4JZR A;  4BPZ A;  4IES A;  2VXJ A;  4DPN A;  3V0A B;  1SLC A;  2AYH A;  3E5X A;  3NAP A;  4MHR A;  3MZH A;  2ZGQ A;  2IXI A;  3M8L A;  4M4R A;  4LIT A;  1V6K A;  5IT6 A;  2FDI A;  1K42 A;  1OI6 A;  3R05 A;  4UW5 A;  2FZ1 A;  3CU7 A;  4K1Y A;  4KQ7 A;  3PIJ A;  1WCS A;  3VHR A;  2CY6 A;  3ZXA C;  1U12 A;  4MET A;  5C3P A;  2VZT A;  1HRI 1;  2UU8 A;  3OYW A;  1HDK A;  2C0Z A;  3M1H A;  5HXM A;  2XKP A;  2BBV A;  2ETE A;  2QKD A;  2WYF A;  3TEY A;  4D0Q A;  3AX4 A;  4DIQ A;  2VOX A;  3AFG A;  4Y20 B;  4RGK A;  4CCD A;  4EJR A;  3JBG 1;  4ARX A;  3J8F 2;  3I2I A;  4HN0 A;  1ENQ A;  3ORJ A;  1LEC A;  4MGT A;  3MID A;  2PQQ A;  2GZW A;  2WSU A;  1B35 B;  4XHX A;  3TEZ A;  3B93 A;  4ASM B;  5DMY A;  4RN5 A;  1JYC A;  3AVR A;  1QJU 1;  2WYS A;  3VD7 A;  4HK8 A;  4BYY A;  1VE0 A;  3EJK A;  3LFI A;  4HON A;  3FUO A;  3CF6 E;  4P9G A;  1NQJ A;  2I2S A;  3N9P A;  2OW4 A;  1MS5 A;  4Z92 B;  1GUI A;  3FWE A;  3J7N A;  1SZB A;  3N3H A;  3WP4 A;  1HN0 A;  3C7H A;  1X9T A;  4EQV A;  5C4W B;  1GZ9 A;  1LOC A;  2Q30 A;  1QXP A;  2Y6L A;  3IB3 A;  2VVF A;  3I7D A;  3KVB A;  5I0U A;  5ACA 1;  4OZO A;  2ZKL A;  4H14 A;  4V2V A;  2LM3 A;  4AEJ A;  1U5Y A;  2WS9 1;  2Y33 A;  4COV A;  1W3V A;  2XLA A;  3S7E A;  2ZMK A;  4WM8 B;  1QQP 3;  4IE5 A;  2BWA A;  4L92 A;  5J98 B;  3WG2 A;  5IW0 A;  2C1F A;  1QHD A;  4GB3 3;  3TN9 1;  1S55 A;  2IXH A;  4GH4 B;  1VBC 2;  4QX5 A;  2B39 A;  2Z2S B;  4MGS A;  5KHG A;  5FP7 A;  1XOY A;  2RVA A;  4IGQ A;  5JI7 A;  2JEM A;  4FPY A;  5FZG A;  1QJE A;  2QVS B;  5C3O A;  1DQ2 A;  1OC1 A;  4OLL A;  3CLP A;  3NNL A;  1ZA4 A;  2VZU A;  3LZZ A;  2ZGK A;  2YGL A;  3QH7 A;  4AQS A;  3LIG A;  2B5H A;  1RHI 1;  2WBK A;  1ZRD A;  1K5M C;  4LBJ A;  2DFB A;  4QGM A;  4B1L A;  3X29 B;  1J1T A;  5BNP B;  3WQB A;  4CA9 A;  3GJB A;  4DY3 A;  4KL1 A;  3NAP C;  4NPR A;  3W9A A;  4A4A A;  4HLT A;  2YU1 A;  2W47 A;  1H8T B;  5JAX A;  1RUG 3;  2JX9 A;  3MUZ 1;  4K7J A;  4XFH A;  5JIU A;  1KDM A;  4GD4 A;  4FFI A;  1S2K A;  5FXW A;  5FOJ B;  2W92 A;  2HWE 3;  1HJF A;  4CCM A;  3ZFF B;  2GN3 A;  3RZH A;  3ZSM A;  1GKB A;  1WW7 A;  1AL2 1;  5B4X A;  2VBP A;  2RR1 3;  1DQ0 A;  3OY8 B;  2DUP A;  1QH7 A;  5FYI A;  3NNJ A;  1L7R A;  3NV3 A;  2DU1 A;  3OUJ A;  1KEX A;  1QWR A;  1TEI A;  5FP4 A;  1XNC A;  3K4A A;  4DO0 A;  1MS8 A;  5TSW A;  4Q1R A;  4P9J A;  2A70 A;  4DIN B;  3RVH A;  4H7L A;  5JOX A;  5I8T A;  1RUD 3;  2YFZ A;  3I2G A;  2VW0 A;  3ZFG B;  2H0B A;  3O1T A;  2IWG B;  3ZYJ B;  3K2O A;  2JB8 A;  4FPC A;  1QNY A;  5DAX A;  2YYO A;  4Q4X 1;  1LAJ A;  2A71 A;  1ZRI A;  3U0Z A;  2XUE A;  4YRD A;  3ME2 A;  1LOD A;  4ZHN A;  4GJZ A;  5GM0 A;  1PK6 A;  3VZK A;  4HPK A;  4AZZ A;  4NIH A;  2B9U A;  5T5J A;  1ZBA 2;  1YQ2 A;  1DQ5 A;  2DWR A;  5A3N A;  5JI9 A;  4CCL A;  3KCY A;  1DZT A;  3VKO A;  1ZZB A;  4XZP A;  3DGT A;  2AZ5 A;  2VEC A;  4P9I A;  1VBA 3;  4N9I A;  4QX8 A;  3RPQ A;  4N43 C;  3RFR A;  1BEV 3;  1W9S A;  4CTE A;  5FPU A;  3OUH A;  3JQW A;  4YVS C;  2XVG A;  4J6G A;  3UKV A;  3ZDS A;  3W21 A;  5FOB B;  5GLT A;  1QDO A;  1W3X A;  4QPG C;  3LQC A;  2B8M A;  1NA1 B;  2DFC A;  2RDN A;  2XGX A;  3ABZ A;  4AWD A;  5LWB A;  3AKS A;  4QPI C;  1W8F A;  4I02 A;  4W65 A;  1QF3 A;  4KG0 A;  2W87 A;  3C7G A;  2ID4 A;  1C8M 2;  5F3C A;  2PHL A;  1OA2 A;  1VAL A;  1TNR A;  1WCQ A;  4M3C B;  1ULO A;  4UF0 B;  2VZ3 A;  3POS A;  3ZMN A;  4RFR B;  4Q4Y 2;  5J3U A;  4LBO A;  5CIR A;  3OEA A;  3MLJ A;  1ACC A;  5FJH A;  1QEX A;  2XON A;  4LBQ B;  4Y20 A;  1D4M 3;  5FZ0 A;  1POV 1;  3ZM8 A;  4AI0 A;  1ZM1 A;  1DYO A;  1ULC A;  1US2 A;  1VRH 2;  2OUH A;  3TOJ A;  1W8U A;  1PO1 3;  2WL1 A;  3NKG A;  5BNN B;  1IKQ A;  1W2O A;  1LHN A;  5IWF A;  5A7P A;  4FBF A;  2A3X A;  1AXY A;  3WP3 A;  1BVV A;  1NG0 A;  1UNB A;  2WZR 3;  1F4H A;  1ZBE 3;  2W08 A;  1RUJ 3;  1MAC A;  1PVC 1;  3KT7 A;  2V72 A;  5C4W A;  4RHV 3;  2GSY A;  4EN9 B;  4Q4W 3;  1AR6 3;  1M4W A;  1F31 A;  1SQ4 A;  3AP7 A;  5I8Y A;  1NE4 A;  2JD9 A;  2YMZ A;  3DKW A;  1SLT A;  5HXV A;  1RUE 1;  2FHR A;  2HH9 A;  4LBL A;  5M0T A;  2GMM A;  1EAH 3;  1GP6 A;  1PO2 1;  2R06 2;  5EJ1 B;  1Y3T A;  5DDJ 3;  4WM8 A;  2RS5 2;  1REF A;  2EIC A;  2VUJ A;  2XQR A;  5DG1 A;  2VMG A;  3I3Q A;  1ENR A;  5FQ0 A;  1MS0 A;  3BGA A;  4GH4 A;  3KZ4 C;  3MF9 A;  4P5Y A;  3BOD A;  4I0A A;  3B00 A;  5F3G A;  1PMI A;  1YJL A;  2ZKN A;  4LR4 A;  1RMU 1;  1IPK A;  5JWP A;  4NUB A;  3ZFE B;  4OI0 A;  1PGL 1;  4XUT A;  1ZZ9 A;  2X5I B;  2YDE A;  3GHN A;  3H3U A;  4QM9 A;  4HZF A;  5H9S A;  1H4G A;  3MIG A;  5E89 A;  1PK6 C;  4FPH A;  4TLG A;  1LOB A;  3PU3 A;  3WVJ A;  2SBA A;  5F5Q A;  1AYN 2;  1UMZ A;  1W8W A;  1SMV A;  3H3L A;  5DAQ A;  2OII A;  3LA2 A;  1GIC A;  5FPL A;  4FPL A;  1UY2 A;  1LR5 A;  3PLQ A;  5BNP A;  2LAL A;  5FWJ A;  4UFI A;  4WZF A;  3FE5 A;  1GFF 2;  1NE6 A;  5FPV A;  1OT5 A;  1RUH 2;  5C9A A;  3SHR A;  1SG3 A;  5CIS A;  4QAW A;  4QXH A;  5FZL A;  4AXO A;  2HWB 1;  1O8P A;  4RS5 B;  4KG8 A;  5APA A;  2VZP A;  3DV8 A;  1URX A;  3J9S A;  5FRA A;  4ISQ A;  2BV4 A;  5LK7 B;  1W2N A;  4XBL A;  3BOW A;  3ZFF A;  1PM4 A;  1DHK B;  5E6H A;  4BK4 A;  3WF2 A;  2QCS B;  1Z7S 2;  2OKX A;  2A5Z A;  3K77 A;  4YZ2 A;  4MUV A;  4AGG A;  4A44 A;  1GQG A;  5DUU A;  5K9Y A;  1NCR B;  2VMF A;  5IK8 A;  4JDN A;  1PZ8 A;  1S0B A;  2VL4 A;  4AGV A;  3THD A;  1C3H A;  5ABJ B;  1LEM A;  3GCX A;  3VBO B;  1B35 C;  3ST7 A;  3N4M A;  3LD8 A;  4IER A;  1US3 A;  1F4A A;  2ZGL A;  3T3Y A;  5C8C B;  1APN A;  1O5L A;  1PIV 2;  3J8F 3;  3ZFG A;  1V6N A;  4BLI A;  5T50 A;  5LEJ A;  3IDB B;  5C4W C;  3OBA A;  1UZV A;  4HMZ A;  4FXK B;  4H7M A;  3M3I A;  1PNG A;  3ASI A;  2HWF 1;  2GH8 A;  4FFG A;  4A7Y A;  1G8W A;  5H9R A;  3S0M A;  1HQW A;  3HT2 A;  1TMF 1;  2P37 A;  3O0W A;  2WFF 2;  1FOD 1;  2HEY F;  5FYB A;  1WW5 A;  1CPN A;  1H1A A;  4K8R B;  4WM8 C;  2R30 A;  3E5U A;  4L9B A;  2Y6J A;  2XVL A;  4PIY A;  1O3T A;  1VBE 3;  2QBX A;  2XML A;  1RIR A; 
#chains in the Genus database with same CATH homology
 2JDN A;  2JDY A;  2WRA A;  5HCH A;  2VUD A;  1W8H A;  2JDM A;  1OUS A;  2CHH A;  2VNV A;  1W8F A;  2JDP A;  1OXC A;  5A3O A;  4CE8 A;  4UT5 A;  5A6X A;  1OVS A;  2BV4 A;  5A70 A;  1UZV A;  2XR4 A;  5A6Y A;  2JDU A;  5A6Q A;  1OUR A;  1UQX A;  2BOI A;  2JDK A;  3ZDV A;  2BP6 A;  1OUX A;  1GZT A;  2BOJ A;  3DCQ A;  2WR9 A;  2JDH A;  2VUC A;  1OVP A;  5D2A A;  4AOC A;  5A6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...