5A6XA

Structure of the lecb lectin from pseudomonas aeruginosa strain pa14 in complex with alpha-methyl-fucoside
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
114
Chain Sequence
b'ATQGVFTLPANTQFGVTAFANSAGTQTVNVQVNNETVATFTGQSTNNAIIGSKVLNSGGGGKVQILVSVNGRSSDLVSAQVILANELNFALVGSEDSTDNDYNDAVVVINWPLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOSE-BINDING LECTIN PA-IIL
publication title The virulence factor LecB varies in clinical isolates: consequences for ligand binding and drug discovery.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 24
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 5a6xA00
4CE8A 3DCQA 2VUCA 2JDYA 2BOJA 5A6XA 2XR4A 2BP6A 1OUSA 2VNVA 5HCHA 2BOIA 1OVPA 2WR9A 2JDHA 5A3OA 5A70A 5A6YA 1GZTA 4AOCA 1OURA 4UT5A 1OUXA 1UQXA 3ZDVA 2JDMA 1UZVA 2BV4A 5A6ZA 1W8FA 1OXCA 1W8HA 1OVSA 5D2AA 2JDKA 2JDNA 2CHHA 2WRAA 2JDUA 5A6QA 2JDPA 2VUDA
chains in the Genus database with same CATH superfamily
2CTVA 4LPLA 1JYTA 2Z4FA 4UF0A 4RYDA 1AYM1 2QQOA 1V9U3 4Q4V1 2V73A 5EV7A 5JMOA 2Y0IA 2P6CA 4BISA 4W4ZA 4ZONA 4SLIA 4RS5B 4MUVA 1IG3A 3AZXA 4AFDA 4QQOA 4AOCA 2Y6FA 2QFEA 1W3VA 3HBKA 3GZUC 4PDWB 3VBOC 3ZXKA 4XJUA 2RR13 3RNSA 5C4WA 2KXLA 1QJY2 4Y3OA 1SBFA 2WFF2 5H9PA 4B7EA 3VBRC 3AZZA 1VBD2 1W99A 2G9GA 3KF3A 3LSEA 3ORJA 5T5OA 5JUVA 4QX7A 1H1MA 3VB9A 5LA2A 2XUMA 2Y34A 4FAHA 1FPN3 5LY1A 3M3OA 1JN2P 3JZVA 3IDEA 2AH2A 2Y38A 2DVBA 4NRQA 3M8LA 1C8NA 5KHHA 2J1TA 2IFRA 2VQUA 1TMF2 4DY5A 4BHPA 2I45A 2JENA 3KWVA 4MHRA 5IVBA 4S2DA 4I2OA 4LO6B 1REDA 5J98B 4AFAA 4QB2A 4P9GA 5L7OB 3V0AA 3TOJA 5F6KA 1BCXA 5CU1A 2JE8A 3AC0A 5DZEA 1GWLA 4WM7B 1X50A 1E57A 2ZEWA 1UYYA 1OLME 4YZ5A 5IK8A 5FMDA 2RS51 1ND2B 4CE8A 4PIYA 1COV3 4TN7A 4AVTA 4L99A 2E33A 2YU2A 2ZACA 1QNWA 1VBC1 4N7UA 1JZ2A 1I3HA 3PUIA 4GJYA 4HONA 5HCHA 1CJPA 4GMP0 3SHRA 4BIFA 2WR9A 4WVVA 3WUCA 2NQYA 2YC0A 4GB31 1BYHA 3POSA 4UF0B 2NN8A 3VBFB 3POWA 4FXKB 4XIKA 4MG2A 5FXZA 4N90A 5B4NA 4LBQD 1GQGA 1OHFA 2PN5A 2RMU3 2W3JA 5EIYB 2Q8DA 1HLCA 3O12A 4JV4A 3NJYA 4M3CA 1E5IA 4GH4C 4Q0QA 1W2UA 2P3YA 4IEZA 4PQ9A 4KU7A 1OKQA 2R1BA 4P9IA 5C4WB 5GM0A 5FY5A 4A3ZA 5KXDA 5FJKA 1PK6B 1QJU2 5FZBA 1W04A 1X8MA 4MXWB 5IK4A 5F3CA 4AF9A 4CP9A 2MNGA 2WFPA 3H8UA 5BNQA 3ZFFC 5GALA 4XJZA 4JRLA 1YC61 4C1XA 4ZZ5A 3P1IA 2XVLA 5FXWA 4PLMA 5LBFA 3H1YA 5F32A 5DXDA 4IEQA 3U4XA 4GA9A 5FZ3A 3J8F2 4NPMA 1BEV3 1FX5A 3ES4A 4H55A 4LR4A 4B3NA 2JE7A 2WWJA 3WX5A 1JZ4A 2JG8B 2ZZQA 4GALA 4NVPA 4CDQC 1V6NA 1Z7S1 1QOSA 4K1YA 3AM2A 3R0RA 4CDUA 1S4CA 3V0AB 2GMPA 1J1TA 2XJSA 4BQXA 1MQTC 4P9YA 4MXVA 1AR71 3BTZA 3UL2A 3LDKA 5FY0A 4BQ1A 3USUA 4HK9A 4W6YA 1ZA4A 2XWJB 2JG9B 3AFKA 4BLIA 5AC93 2VR4A 4NIDA 1D4VB 2QQPA 4FXGB 5IUQA 1TG7A 2QQWA 1AYM2 5E1RA 1MZFA 4Q4V2 3UKVA 4KWKA 3F2ZA 4YVWA 2WYFA 1MS9A 3EO6A 3A0KA 2HWD2 4MGIE 3ZKYA 4BA6A 5JXHA 1RUI3 1ONAA 4HZFA 4NOTA 2HWE1 4K1ZA 3UKTA 4HKOA 4XFHA 1D0GA 2EALA 1KXGA 5FZEA 4Q4Y1 1QXRA 1W6QA 1F9KA 4C90A 4LHNA 1MS8A 2EXIA 3KLSA 2DVGA 3UYJA 4LBOA 5LBBA 3ZSJA 3ZXLA 5DUVA 3KT4A 4YLZA 1RUG1 2VAUA 4DXRA 5ERLA 4C0HA 3UNPA 1R081 2PYTA 5GLTA 5GZFA 1JOBA 1WMFA 4LHKA 1NYWA 1NCQA 5H9SA 2IXHA 1B35A 4DZGA 3I3MA 1S0GA 3ZYFA 3J4UH 5FBJA 3O1UA 5C8WA 3T0DA 2XQXA 1H2MA 1HN1A 5CKNA 2FBEA 5E8AA 3SC7X 4LHLA 1OVSA 3A21A 4Q8LA 4IV3B 2B9UA 4QKNA 4NHXA 1RUD1 3I49A 1W8TA 5T54A 2FQPA 1GWMA 3OB8A 2EIDA 3LA2A 1ULFA 4LORA 3U1XA 3SEEA 1RINA 3VKMA 3M7AA 3WW3A 1ZRRA 2TBVA 1QQP1 5GZEA 2ETEA 1J3PA 3ZMOA 3O1TA 2EIGA 4E4SA 2PTMA 4CEWA 2RS52 1VRH3 3GJAA 1LOEA 3O1VA 4XJ9A 3IDCB 5FYMA 3TN91 4FOQA 1AR61 4XUQA 1VBC2 1HRI1 3K3OA 2L9LA 2OPKA 3PTRB 3RWNA 3H8RA 2D40A 2VTFA 1DQ6A 2D5HA 1EV12 3U4SA 5FZ4A 2E32A 4J6GA 4CRQA 1BLZA 3JB4C 3WLUA 1W6PB 5FYTA 3TEWA 1D7PM 1DGWA 1FMD2 3NJXA 1IGOA 5A80A 3WG2A 4Q0SA 1UL9A 5HCFA 4XUOA 2SBAA 2FMDA 4JKMA 3J9SA 1AX0A 5CAZA 3B9CA 1RJ8A 1AX1A 1V70A 2QQJA 4JQTA 5SV5A 3SEPA 2VGDA 2WN3A 2RS12 5A3PA 4XURA 4IEOA 5E89A 2MHFA 1DBNA 2VOTA 4FTEA 3ZFEA 3NKGA 4ATEA 4AL9A 1ASJ1 1OC1A 2C1FA 2WO7A 2XJTA 3H7JA 3IKWA 4HOOA 4KL1A 4Y33A 5SV8A 3HAGA 3KV9A 1S2EA 4OZXA 5FY1A 2ZHKA 3FUOA 1LESA 2RG4A 4I0BA 1G9BA 3QH6A 3K46A 3ZN6A 2XKPA 1I5PA 1YHFA 3POFA 4W65A 2A3XA 3M3IA 5GLWA 4I30A 4LO4B 2YYOA 1VBB3 5EFUA 4HBNA 2EF6A 4K9SA 1HX6A 1TQ5A 3IMMA 3ACFA 1TME3 4ZPIA 2ADDA 4Y20A 4AEKA 3LWCA 4DB5A 1POV3 1WLWA 3BB6A 4MGYE 4YZ4A 1RXGA 4N9IA 2J1RA 1ND3B 1Z7S2 1DQ5A 2G19A 4LQRA 4M3CF 2F4LA 2GNTA 3R6SA 5IVCA 2RJLA 4JHTA 3LIGA 4K6BA 5A3MA 1AR72 2W2IA 3WF2A 4D7TA 1J1LA 2BV4A 5KXCA 4TSVA 1N1SA 4CDWA 4LXLA 4BXFA 1IOAA 1YNAA 2JEMA 2P3IA 2O8OA 3T30A 3VBHB 3WDXA 3O0VA 3KF5A 2QZ2A 1RITA 3BALA 4QDSA 2GN3A 4UFJA 3BUCA 3THTA 2MPFA 3MLLA 1J3RA 2HWE2 5H9QA 5CNAA 5I93A 2WSUA 1AR91 1W06A 1XU2A 4LKEA 3LPFA 5JCTA 4I3PA 2WFF3 4FP2A 4WM8C 1AZDA 3I2HA 3WCRA 4AVCA 3ZYIB 1UYZA 2V4VA 1LTEA 2XLGA 4NPLA 3RWKX 3VBOA 4QKDA 2ZPXA 1GNHA 1Y9MA 5C3QA 4Q27A 1RUC1 5FY8A 3PTYA 4RS5C 2XBO1 3HD8B 2A6VA 3VBRA 3HT1A 3K48A 5GLVA 3C2UA 3GZAA 1MPXA 3ZFEB 3Q8BA 5A6QA 1CWPA 4XFAA 1TMF3 2QQNA 4DUXA 4PDWC 2DVFA 2DU1A 4JGZB 1N1VA 1V0AA 4LBQA 4ZU7A 1ZZ8A 4H2AA 4HLTA 4KU8A 4XJ8A 4LMFA 5ABJC 4FQ4A 3WDTA 3ZMNA 4FBFA 3GHMA 5IVJA 1BK0A 4H7MA 1PM4A 4XPVA 1RUD2 4QM9A 3VBUB 5EQUA 4DY3A 4ASKA 4JHZA 3I7DA 2DFBA 1UX7A 1JXNA 1J59A 2ARBA 2XONA 2WQ4A 1DF0A 2JDMA 4YW7A 3VKLA 2IVIB 3JBG1 1MS4A 2OW4A 4A44A 2W52A 4C0BA 1C8M2 1GZWB 1IPSA 3ZPOA 2QVSB 3J7LA 1ZZ7A 2VH9A 2VBPA 2WUHA 1Y43B 3QH7A 4IEYA 4P14A 1JUIA 2WA3A 3I2FA 2ZX3A 1QJX3 3MO4A 2VUDA 1EAH2 1AR62 1FNZA 3BYWA 1HRI2 1OF3A 4CDXC 5FPLA 4P9JA 1PHMA 4L2NA 3T08A 2YFZA 1VBE1 5FTTC 3VDCA 4I02A 4WVWA 4B4RA 3AMPA 3PIGA 5C33A 3WQ0A 1Y9GA 2C26A 5L9BA 3PDQA 4WM7C 5L73A 3A7QA 1PZ9A 1OT5A 1RUJ1 3L9JT 1ND2C 2R043 2OA2A 4WZCA 4C1WA 4CUAA 2FDKA 2HYKA 2ZX0A 3OGSA 1L7LA 4KWLA 3WY6A 1JZ6A 2QKDA 3Q8FA 3KQ4B 5J48A 2CY6A 1IPJA 1XE7A 4FCAA 5E88A 5L9RA 2J42A 3D0JA 1CX1A 4QM8A 1RC6A 3N9LA 1G7YA 2ARAA 3ZXEA 1QJU3 2RVAA 4GH4A 4MGZE 3VBFC 1WW6A 4A7ZA 1GQPA 3VHNA 5LA1A 5CG8A 3E5QA 2X09A 1IKPA 1Y9QA 1PO21 1YI9A 1W8NA 4GQ7A 3VBRB 3C7GA 1Q8PA 4JGYB 3U37A 3HR9A 2QQLA 3OJBA 2LTNA 3JQXA 4XFFA 4Y5SA 3ILNA 1V9U2 1WMDA 3B00A 4UFMA 1UIKA 3ZN5A 3J8F3 3ZFFA 4FI9A 3KMHA 4AI3A 2GC1A 2WO2A 1CAVB 1ENRA 1SPPA 3S0MA 1FT9A 5I8SA 2A5ZA 2DBIA 1YFUA 5FPVA 2R7EB 2D6LX 4R4XA 1QMJA 1PK6C 3EQEA 3DYMA 4LE4A 4Y1VA 3ZSLA 5JAXA 4M01A 2R0HA 1VMHA 1QWRA 5BNOC 3T2QA 4UAPA 4E2GA 3H1WA 4URTA 1AR81 4DMIA 3QBQA 5FZCA 1AYM3 1MQTA 2WZ8A 3OGVA 4Q4V3 4IERA 1IS6A 3GALA 5FZMA 2VBBA 4GZ9A 4Q0PA 3BI3A 2VQTA 4LT5A 1TVGA 4XAEA 1PZ8A 1MVEA 3JUUA 5FPBA 2JG8C 5LY2A 3FZ3A 1F4HA 3W59A 5F37A 3PLQA 4K8RB 1W8WA 3WCSA 4H14A 3BCWA 1MS1A 5K0UC 5A7OA 3AP5A 4ORFA 2HWF1 1JYCA 5CYYA 5E6HA 3SQOA 2NP0A 3H9AA 3KV6A 1F31A 2CDOA 4KNCA 4PCRA 2E7TA 4XBLA 2VBDA 1J58A 2IUWA 4QKBA 2JG9C 3C3VA 2OYZA 4YW4A 2PLV1 1LAJA 1YIPA 3RPQA 1WCQA 1OMIA 4XZUG 2VNVA 5FO9B 2XBO2 1TEIA 4LK6A 1H2LA 5F5QA 3TEYA 3TNPB 2ZX4A 2A71A 3ZYRA 4QAWA 3S6PA 3ZX7A 1CD3G 1ODNA 1COV2 3VD3A 2ZABA 3ZO0B 4IV1C 4XABA 1R091 3POJA 5GLUA 3FHAA 2MEV1 1XNTA 4MH0E 2XUEA 1CPMA 2ARXA 3AX4A 2JB8A 3OPZA 4XFCA 1KDMA 5BXXA 2AREA 3I2GA 5D8AB 1YIFA 1TNRA 1UD1A 2XWBB 2VXJA 2FDGA 4FOVA 1SPPB 2RMU2 2RS53 1ODMA 2JKBA 2OS2A 4YGEA 4A41A 1XU1A 2PHRA 1Q8OA 4LO5B 4H7LA 4D94A 1DU3D 1XJAA 2HJIA 1VBC3 4XBQA 3N7MA 2CSGA 2WT1A 5FQ0B 2WWSA 3MIBA 4OUSA 3WD5A 4IV3C 3PVNA 4EN9B 4ONUA 4CDQB 1K5JA 3CLPA 3MUY1 3WW4A 5KWRA 3NNGA 3DEMA 3PUHA 4GB33 2UYAA 4GXLA 3O14A 1VBE2 3GJBA 3IDBB 4LBJA 4RFT0 1HKDA 4K40A 2W0XA 1JYIA 1ZZ6A 5IFPA 3I2DA 1LOFC 1N47A 1UOGA 5FIXA 2XOMA 1DDLA 4BDVB 4CEYC 4LJHA 2A6ZA 1UF2C 3Q8EA 1VAVA 1RUJ2 1VBB1 4XQ4A 2WNVB 4I0AA 2VZOA 2X10A 2XVKA 1RUNA 1PGW1 2CYFA 3OTFA 4PJYA 1NZCA 1AJKA 2ET7A 2X5IB 1WKYA 4KQ7A 4PI0A 5DDJ1 1RTVA 2ORXA 2RHPA 5A3WA 4HK8A 4B4QA 4EN8B 1CONA 1PMHX 3N9QA 3ZDVA 1OOPB 4YRDA 3ZIXA 2Q5TA 3GF6A 3O0WA 3IPVA 1OH4A 2B45X 4LLFA 4EZ4A 5FOBB 1KFUL 2ZX2A 3AP6A 2V5YA 4NN0A 5D1IA 4NIIA 5A7PA 1MR5A 5AC92 4P9XA 5F1RA 3HWJA 1GOGA 2XJPA 1GZCA 3CU7A 2F4PA 2JECA 5D2AA 4ZS3A 1OF4A 2DCTA 5IT6A 4ZU4A 1UU6A 3ACIA 2VG9A 4YW3A 3VDBA 1CGPA 2LUWA 3OYWB 1O4TA 3I59A 4PI2A 3WNXA 4EZHA 1DGRN 1ALYA 4YFWA 5T3NA 1POQA 5I0TA 5LK7B 1Z7S3 1XBFA 3HBZA 3HN3A 3WF1A 4DXZA 1JMUB 1YWKA 5IVEA 3IM0A 3I8TA 1AR73 4NHLA 4JTOA 4QPIB 1GSLA 5IK7A 2R071 1STMA 4IE5A 4CCMA 1RUOA 3AZVA 2VOVA 1WW7A 1UZYA 2DVAA 3MIFA 4FPOB 4LIUA 2E6VA 3JD71 4NHKA 1AR82 3TEXA 4BZ4A 4HN1A 1HN0A 5AVPA 3K77A 4CXYA 4OHWA 3I2KA 2JDKA 1CESA 3WV6A 2BTVC 1B09A 3V64A 2HWE3 2VCMA 2VQ0A 3VBSB 1W3XA 3FLRA 3ZR5A 4BJ0A 3W5MA 1QNYA 3TB0A 4UYBA 4CCNA 1YI7A 1XC6A 2HWF2 1HRV1 1NCRA 4HVOA 1O91A 4Q4Y3 3W58A 3ZDSA 4DQAA 4QXHA 4G4FA 3B69A 1N3PA 1MZEA 2WQ8A 3AYCA 4RD7A 2Y26A 5BV6A 1A78A 4L9BA 2D6PA 2BNMA 4FPJA 2B4KA 2RS31 1NT0A 1PM7A 1RUG3 1UYPA 2ZS6B 4RN5A 5F5IA 2LRPA 5JIAA 3VBHC 1R083 2AEYA 4GAZA 4WM8A 2A75A 3QOPA 1HIXA 2HEYF 4ISQA 4KGQA 2ZEYA 3VGIA 3KSCA 2JDZA 3HQUA 1PNGA 2GP3A 3CHXA 5FZOB 3EHKA 4YSFA 1ENSA 2PQQA 2F6BA 5J09A 4RS5A 1R092 3I3BA 3OGGA 5IVFA 3ZXJA 2MEV2 1MEC1 2OZ6A 5DG2A 1ENQA 1RUD3 1MS3A 4PDWA 4LA3A 1PX4A 5FOJB 1YQ2A 4ISRA 4ZY9A 3OGRA 1O3QA 5ABJA 5F5AA 2VL4A 1LHUA 2VNGA 1QQP3 3MHZA 5I91A 3PVOA 3VD9A 3N7KA 1HV0A 4B1LA 4HANA 4JGZC 4OHXA 3TN93 1AR63 2TEPA 1CAWB 1HRI3 1POV0 2Q8EA 2VE1A 2VD7A 2BUKA 4LIVA 1S0CA 2JKXA 3GHNA 4YW1A 3FBMA 2ZGUA 2HBUA 5F3IA 1LHNA 3NW4A 5HCAA 5A6XA 3FHIB 4CDXA 1H8TB 5A3UA 3GBWA 3WG1A 1QH7A 3E5UA 2GH8A 5LRRA 5BUVA 4XZPA 4DPNA 1LNSA 1J3QA 5JOZA 1VBB2 3MW4A 5JXJA 2GP5A 1OBNA 4FPKA 1UWWA 3SKJE 3IMNA 4WM7A 1US3A 5C8CC 1JI6A 1PGW2 3U0ZA 1UY1A 4CVUA 2PHWA 1ND2A 5CIRA 3FFZA 1W8FA 1VLNA 2VECA 1ASJ3 1EPWA 3AMMA 3APBA 4Y5TA 1CVNA 2E7AA 5DDJ2 5FKBA 4K21A 5HV0A 4CP1A 4LEJA 2FHRA 3PVBB 3VL8A 1JHJA 2N7GA 2Y64A 2KA3A 3DL3A 4BQ2A 1OA4A 5FZ7A 4AW7A 4AEDB 2FCTA 4OI4A 3U07A 3VBFA 4ASMB 4ES8A 1LHVA 1K3IA 1W05A 2DCYA 2YBKA 3MFCA 4FP3A 1QXJA 2VCCA 3VKOA 1S0IA 5APAA 1L7RA 3S57A 3VZNA 1BVP1 1SLBA 5EJ1B 1J83A 1RUE1 2VMDA 4XJWA 3MV01 4BCUA 1EYBA 2V09A 5B4XA 1PO11 2VZRA 3RZLA 3ST7A 1FYUA 2OPWA 4RGKA 4YYOA 3ZFGB 2VZ3A 1UKRA 4FFGA 5ABJB 2ATFA 3PUSA 1JH5A 1SCSA 4JAAA 2R072 4P00B 4JGYC 1EP0A 4LNVA 3I2IA 1PK6A 1S2BA 4M0HA 1CIYA 3JD72 4KI5M 4MXWA 4XCBA 3INAA 3LIHA 1WW5A 3MIGA 5BNOA 5DQ0A 3UGFA 2D7FA 3VD7A 3O1SA 4MGSA 4CCKA 1RYYA 1SBDA 4YM2A 3B02A 3LDRA 4L92A 2DCZA 3CDZB 2UWBA 1X33A 3NJVA 1C5HA 3ES1A 4A7YA 2HH9A 4UFHA 4EE2A 2ZGMA 1AR93 3RG0A 1U12A 2XH6A 2DCKA 2NYYA 4KGGA 4DOUA 5ACA1 4YPJA 1T2XA 2JG8A 4CDXB 3OUJA 2DVDA 4CYDA 5A7SA 4RHV1 4GJZA 5K0UA 1D4M1 3AL6A 1NG0A 1VRBA 3RRDA 1DGLA 2HWC1 2RS32 1F35A 2VZPA 2XVGA 4ARYA 2AACA 4U36A 3E5XA 3T09A 4E9KA 1RUC3 4N53C 3H8XA 5F2SA 1TE1B 2XBO3 2JG9A 4NWWA 3S7EA 4Q0VA 3B9IA 5FZ6A 2A6XA 5JPNB 3KCXA 2VNOA 3LOIA 1JYXA 4QDQA 2DUOA 1QJX2 4CU9A 2G1MA 2IXJA 5A7NA 2OXBA 3POIA 3RS6A 4BH9A 3NSTA 2GMEA 1W9FA 1RVF1 5FZLA 3PIJA 3IIAA 4IV1A 1W0NA 4NIHA 4D6RA 1HB3A 2JX9A 3JBG3 3B01A 1ULOA 4RL7A 1QF3A 2EICA 3LDBA 2FDIA 5JOYA 2B8MA 2R042 2CDPA 3ZYBA 4I0WB 5FYUA 1ULCA 1G8WA 5C9AB 3AXDA 4NRMA 4FOWA 4GD4A 1DZQA 2O8QA 2J1EA 2OVUA 5JVVA 1WCUA 2V72A 5FP9A 1Z0HA 2GZWA 3UV9A 2GN7A 3WG4A 4FPFA 4XQWA 4CCEA 1YLLA 4FPEA 4Z1VA 3RZHA 1V6KA 1X82A 2PA7A 1VBE3 4PF5A 1NKGA 5D8AC 5BNOB 4AFMA 5FP8A 1HDKA 2GC0A 4IXLA 3RQ0A 4IV3A 4QQPA 2EXKA 3NO8A 4TLGA 4HN0A 3K4ZA 1RUJ3 4NIAA 3ILFA 3HNMA 4QHOA 4F83A 4BPZA 3HT2A 3MW3A 2P17A 1URXA 3ZXDA 2P34A 4QMAA 1PZ7A 3UK9A 1LOFA 3SITA 4XW3A 2PFWA 1YQCA 4CEYA 4Q5OA 2JDPA 2K9ZA 2GALA 1BHGA 1ZYBA 4FPCA 5K0UB 1UNBA 4NUBA 5HCBA 5LRSA 2XR4A 3JB8A 4AHYA 3N3HA 4KWUA 1BXHA 1NXMA 1WUVA 2ZAAA 1FNYA 1PO23 3OPTA 5A70A 1CZSA 1W6PA 5F3EA 4I3GA 5F2WA 1LRHA 1ULPA 2WNVC 2ZGNA 2H6CA 4JZRA 2XL7A 3AZWA 4DNYA 4A45A 3JCIA 2RV9A 1R1A1 2ZGTA 4LO7A 1UO9A 1V6JA 2BZDA 3KGZA 2BYVE 2IC1A 2X5IC 1W6NA 2YUEA 4DUWA 4XXAA 1F2NA 4AEMA 2W9XA 4A6OA 1LOBA 4IV1B 5CZKA 4AGGA 1ZRFA 5C3RA 1DGWX 3PL0A 2J7MA 3NMBA 1OOPC 2BVVA 3MV11 2KD7A 2YU1A 3DGTA 1BBT1 5LBEA 3GCWA 3PU8A 4JRAA 4COYA 3RJRA 3ZOIA 2BGPA 3VZOA 1AR83 4WZFA 4NRPA 5DUXA 3KD4A 1N3OA 4L11A 3EXUA 4XHBA 3SKVA 3BOPA 2ILMA 4BK4A 2B42B 5LEKA 4COVA 1ENXA 4Z2AA 4XFBA 4Y22B 4Z82A 3ACHA 2QBXA 4QQHA 4XAAA 1YQ6A 2RDRA 1UY2A 2A6YA 4AI2A 4V1PA 1FXZA 5F7UA 1PNFA 3KCYA 3MUZ1 2XDVA 3HVDA 1AX2A 2HWF3 1WBLA 2VMGA 4QHZA 4QPWA 2CHHA 4QPIC 3IWZA 2VZSA 4UFLA 4XACA 1ND3A 4AI8A 2BFUL 2K0GA 2QZ3A 4RHV2 1ZRCA 4QX2A 1UY4A 1GOFA 2PLV3 3ILRA 2BFUS 3OGJA 1JODA 1XQNA 2HWC2 4I09A 4LTAA 3T2PA 4Q1RA 5A1FA 4CEYB 1C3HA 1CX4A 2EXHA 5JZGB 2WT2A 3BN6A 1JZ5A 3O0XA 3VBSC 3DV8A 4HVRA 2ZXQA 3VBHA 4EQVA 2AENA 2PHTA 1R093 1SLCA 3MLJA 3T1LA 1IHMA 2GC2A 3AKRA 2MEV3 2UU8A 2WS91 3K2OA 4Q4W1 4R8HA 4BQWA 2P2KA 3T1MA 2QQMA 1CZVA 3WUDA 2HKXA 2B9VA 2ZGKA 2WNUB 2D97A 4LUKA 1RVF2 4GB32 4YG6A 5FLIA 2HWB1 4CU6A 1JZ8A 4Y26A 4OHZA 2BJSA 3NWKA 1BKZA 2H0BA 1XXNA 2RJKA 4S2HA 2VTXJ 3WNPA 1KQRA 2XKOA 4FVVA 1W6NB 4OULA 3E6DA 1GQHA 4CPBD 4D7SA 5J7MA 1H8VA 4XF1A 5FCCA 3RSJA 3PNAA 3D5OA 4J25A 2GU9A 3NV3A 3OUIA 1PGL2 4RGAA 2QTWB 4EN0A 2I74A 1IQDC 1V00A 1WGPA 2ZGSA 1K5MB 4R9AA 1W2NA 5G05L 1IKQA 4JGZA 5EYXA 1W03A 4HT1T 4W6XA 4LOSA 3E6CC 5F5CA 4E27A 1A8DA 2DFCA 2NMNA 4NHYA 3M1HA 2D98A 2AGSA 3VBUA 2ZA9A 3V65A 5A1LA 5I0SA 5BNPB 1KRIA 3WHTA 1OA3A 4MVTA 2BVBA 2TNFA 5FP3A 5HBAA 4XDPA 1WD3A 1WBFA 3N7LA 4TLFA 4ZZ8A 4OHYA 4XMAA 1RUH1 3IDAA 3ZXGA 5T50A 1UPSA 3B3QE 4YWAA 1GZWA 2WWUA 1LHWA 3FLPA 1O7FA 5KBFA 1QY4A 5DDJ3 4MX3A 3TRSB 1OSGA 1BK1A 4HKWA 3SISA 1A34A 4PT6A 3GZEA 4EN7B 3VDAA 5C8CA 1QXPA 5C3PA 3HQXA 1H8TC 2JICA 4EROA 3KZ4C 2IVJA 3G6JB 1FOD1 2Z79A 4CXXA 5JSOA 1WLCA 2WRAA 1DZTA 2V5DA 3C7OA 3O1MA 4BU2A 1NA1B 1NY71 5A3NA 5J36A 3U11A 1JUHA 3VKFC 5FZIA 4R9BA 5A33B 3IN9A 1R1A2 3BTAA 1QEXA 4UW3A 3ENRA 2X8KA 3WP3A 2VU9A 1T6BX 3IB3A 2W5FA 4AHZA 3NKTA 3POBA 5M0TA 1U5XA 4CXWA 4Q4Y2 1K42A 1D2SA 2UURA 2VMCA 1QIQA 1UQXA 2WNEA 2R073 4LLOA 1BBT2 2WYSA 4KWJA 4AEDC 2WL1A 2ENRA 3JD73 4N43C 1I1EA 1RUG2 1H2KA 5FYIA 1R082 3WOGA 1UX6A 1UZWA 3A23A 2A70A 4QX1A 5DMYA 2W92A 3WP4A 4M00A 1GKBA 4QPYA 2W1WA 4JGYA 2YY1A 4YNIA 5LATA 2X05A 3RFRA 1UZZA 4B29A 2VW0A 4SBVA 1PX3A 1OKOA 1HB2A 2GAUA 3DYOA 2CNAA 1RL3A 3MEPA 4Y1YA 1HRV3 2EAAA 2C6SA 3ZFGC 3ZSMA 5L9VA 3HOBA 2XB6C 3N7JA 1CAVA 2JXAA 1UMZA 3I2JA 4CCJA 4RR3B 2WO3A 1W8UA 4UW4A 3CL1A 2RS33 1GFF2 4MGQA 4AXOA 5IK5A 3GXUA 4CCDA 4COWA 4Q4X1 2AEZA 1GANA 5KC6A 3SNMA 2DWRA 2ZJCA 4L97A 2WLQA 4Q0UA 1QQP2 1ZBE3 1VP6A 1ZX5A 2I2SA 5CFCB 1IS5A 1GV9A 5ISLA 3RZKA 3PURA 4ZU5A 2IXLA 2WZEA 1ULGA 3WR0A 5C8CB 4N53A 1LGCA 3TN92 1XYNA 1LU1A 4IESA 2W1UA 1MEC3 2BBAA 3AYAA 4CCOA 1XE8A 2ES3A 1Y7BA 1WW4A 3WEZA 1UMHA 1ZNPA 3AKSA 3MIDA 2HWB2 1CIWA 1O8PA 1X7NA 1ZZ9A 1Q3EA 3WP6A 4IQPA 3OEAA 5JR7B 2VUAA 4WVMA 1C28A 1S0DA 3JXSA 3M4FA 4OCTA 3RZGA 4BMBA 1NXD1 2ZGPA 3HN1A 4W50A 5FXVA 4V2WA 3Q8AA 4CCCA 4P5YA 5BY5A 1QH6A 2WO1A 3VL9A 1PMJX 1CAXB 1O5LA 2E53A 3WT3A 1LJ7A 1RIRA 1ULEA 3EB7A 4BLJA 4MZUA 1WWYA 3U75A 2JIJA 2W91A 1OLRA 4PLNA 3VHOA 1ASJ2 1H4GA 1H1AA 5F8PA 1X9TA 3PJQA 4Q1PA 4LE3A 4AVAA 1C1LA 1APNA 3AB0A 5C5UA 4NHMA 5FMCA 1SG3A 2UWCA 1W6MB 3SLIA 4AGVA 1NLQA 4P08A 4RQPC 2XHNA 1AL21 4YZ3A 1NQDA 5C9AC 1UW8A 4XF0A 4O65A 5D8AA 5JXGA 1RXFA 4TYSA 3ZXFA 4AQ6A 4X8PA 1RUH2 5IVYA 2CWMA 2H0VA 4R4ZA 4XF4A 4OQ8A 1C57A 1W8HA 2B7YA 2Q30A 1S0JA 5FO8B 5I0RA 5JWPA 4CUBA 4JVAA 2ID4A 4XDQA 3KGLA 3RVHA 5FQ0A 1ZVFA 4CDQA 3OG2A 2YMZA 4AFBA 5G04L 4A42A 3ZYPA 3ASIA 1W9YA 4E4HA 1PVXA 2VC9A 3VN4A 2HEWF 2FCVA 4XUPA 4PIXA 1LGNA 2UYBA 4IEVA 1NY72 4N53B 5KHGA 5F6LB 1EUTA 3CO2A 4AAXA 4RFRB 1RUE3 2Q1ZB 3S5AA 1VMFA 2YPDA 2WNVA 2VVFA 4P9LA 4GIQA 1HB1A 3FLTA 4OYUA 5K4LA 4LBKA 1VPHA 1NOVA 1PO13 1UXZA 3CKHA 4X8NA 5T5PA 2RM21 1AR92 1IZ3A 2ZMLA 4YZ1A 3P6BA 2XLFA 4W8JA 2XLAA 4YG3A 2X5IA 2QUOA 1UYXA 1W39A 3CNAA 4WVMB 4LKSA 4DUVA 3DXUA 1UY0A 1JBCA 1BZWA 3MIEA 2P3JA 3MYXA 1KS4A 2ZHMA 4D8MA 1OOPA 3UGGA 5J37A 5HV4A 3LD8A 1RUC2 4IGQA 4XVHA 5CKMA 5EZWA 4XFGA 5CFDB 5DAXA 1SDDB 1AVBA 4GWNA 2VZTA 3BTXA 3V0BB 4XUTA 2EAKA 2VXRA 3GCXA 1DFQA 3WZ1A 3OYWA 2O1QA 3EJKA 2HYXA 2QQIA 4CPBA 5ACA3 5FYCA 4KG8A 1WCKA 3B93A 3VDDC 3O5SA 3BOWA 4OZOA 5FZKA 4RHV3 3UT0A 3VV1A 3IIIA 1D4M3 5IYYA 1HXS1 5FXXA 4DFSA 2HWC3 1QKQA 4QPIA 4R52A 4B4PA 1PIV1 2Q1MA 3SMHA 3BVCA 3CZJA 4Q4X2 4KG0A 1R64A 3JBG2 5IWFA 5FMOL 3FE5A 1OI6A 2AR6A 5IVVA 5FZ9A 2UY8A 2ZEXA 3NNFA 2HLEA 2D43A 4YM0A 1NAEA 4UBGA 3VBSA 4K3UA 2C9AA 1KGYA 1UN1A 2JDAA 1RVF3 1H1IA 3MFAA 1O4ZA 1LEDA 1OFSA 2R32A 2YPJA 3PJYA 4QGLA 3WHUA 2J22A 5T5LA 1W8ZA 2WNOA 3BU0A 5JZGC 1OA2A 2WSVA 4OUEA 5K9YA 5FFOC 2R061 4QB1A 3AXEA 4MGKE 4KH9A 1O8SA 4URAA 4LO8A 1H9PA 4AWDA 4ET7A 2ZTNA 1A8MA 5FZOA 5T52A 4AHWA 3ZYJB 4WV8A 3OBAA 4AK3A 3BKZA 3FUQA 4CCLA 1WZXA 2WNUC 1LULA 5FJHA 4HVQA 4RSUA 2Y60A 3ZIWA 1RUF1 4IEWA 1VALA 1OH3A 2ZZJA 3N9PA 5JLVA 1LR5A 1CAUB 1PO22 1SFPA 2TUNA 4GWJA 4CUCA 4D0QA 4XOGA 1AL22 1E5SA 3WSOA 2W1SA 2XHKA 4OFGA 2YBSA 4AVBA 1SLTA 3EMRA 4W6WA 1OPMA 4AQ2A 5LW9A 2H6BA 2HEVF 3EYPA 1VJ2A 4FO9A 5FKCA 2FZ2A 4HSLA 4NWVA 3UJQA 1K5MC 5C6CA 3DKQA 4DXTA 3H3LA 2CGNA 4WBBA 1S0FA 1U0AA 4KBBA 2DDUA 3E1F1 2E31A 3RMXA 1CAWA 3N9OA 5FY9A 2OQ6A 3S5QA 1OUXA 4PHZA 3MPBA 5BNPC 2G9ZA 4IGPA 3GM8A 4HKLA 3WNLA 4AGRA 4A3XA 3FFQA 1JOJA 2PHXA 4C91A 5FRAA 1LECA 3H7YA 2GNDA 4XILA 1DQ0A 1PVC1 1H8TA 4JCKA 2D3RA 1R1A3 2CU5A 1KJRA 2OKXA 4XJAA 5ANNA 4ASLA 1CZTA 2WZR1 5CEHA 5AFEA 3IZOA 3LEIA 2P6HA 1OLQA 4HMZA 1G9CA 2CGOA 1QJY1 2RM22 4E2QA 1L3JA 2Y6GA 2GSYA 1VBD1 2JDHA 2KM2A 1BBT3 1JU3A 3OBRA 2JIGA 4HXCA 4PLOA 4QGNA 5KHIA 1OURA 4JX0A 3USSA 1W2AX 2PLV2 2OT7A 4EJRA 4S2GA 2B39A 1NA1C 2Q8CA 3AKTA 5BNNC 3P3PA 4LITA 1O5UA 4QX3A 5GZGA 1ZBE1 4AEDA 5FZ8A 2B46X 4DRRA 4N43A 2ET1A 2R16A 1ZBA1 5HI0A 1RMU1 2D3SA 2R30A 2VY0A 4IL7A 4RGGA 2VOWA 1X9PA 3AYEA 2E9QA 2FD8A 4QB6A 1JHNA 1UZ0A 1YCIA 3NAPB 2ZMKA 2E7QA 2VPVA 2CL2A 1XSRA 4CEWC 3RZZA 1VB4A 3ZFGA 2DUPA 1ULDA 3SH5A 4OUMA 1GICA 4MADA 3TAYA 2Y6HA 2DUQA 2WDBA 2YC2A 4UT5A 4AE2A 3T0AA 4XQDA 3CEWA 2K2SA 4M0NA 4LULA 1M06G 1OD5A 4E4ZA 5J3UA 1UIJA 2J1UA 3AMQA 3KM5A 2PAMA 4XC9A 3LKJA 1Y4WA 2GMMA 4Q4W3 5HXVA 2WS93 2WIIB 3C7EA 4UWDA 1AXYA 1NE4A 2P4EA 2R49A 4RR3C 4ATFA 1W6OB 2WT0A 2Z69A 1XNCA 1QDOA 2ZGLA 3DCQA 2HWB3 4META 2Q1FA 3D8CA 1AYN1 3MI8A 2EVXA 2E51A 3KB5A 3OD0A 5FWEA 5FY4A 3OOXA 1RHI1 1YRZA 2R0FA 1MS5A 5CFCC 1SLAA 2GNMA 4IE0A 2ZKNA 3CJIB 2OQ7A 2R062 3B7MA 2A6WA 5FLHA 5FYSA 2W47A 1WD4A 4GMP1 4HPKA 3BU7A 3I3QA 1W9SA 1H9WA 3QLQA 5LWBA 1XE0A 3ZR6A 2AC1A 3ZYHA 1DGRA 1YFYA 3OD4A 1Z78A 4NO4A 4QGMA 2PHUA 1CN1A 2JJ6A 3AJZA 2D93A 4XHXA 3GYDA 3WXPA 4JDMA 1F4AA 1DCSA 2PELA 3AP4A 3GZTB 3IT8A 4N43B 5FV3A 5A7WB 3OCPA 5IFTA 4XIOA 4DXSA 2QDNA 2YROA 5FUNA 2ZHNA 4MLOA 1RUH3 1JOPA 2W95A 4EYUA 3FX3A 2C5DA 3WQ1A 1GZTA 4C8DA 3LPGA 4YGDA 1DLCA 5FYZA 5FPUA 2YG0A 3HEIA 5C9AA 4Q2FA 2BBVA 3UGHA 5JOXA 4UI9L 4M4RA 1O3TA 3FL7A 5LA0A 5IAXA 4YM1A 2XXZA 4IETA 5FBZA 4FSJA 3WW2A 1GWKA 1J84A 2P37A 3ZSKA 2WN2A 4BIOA 1FOD3 4DEQA 1ZA7A 1QOOA 4YVSC 3WNKA 2IXIA 3D0SA 4BQ3A 3GBGA 3SCFA 1PVC2 2HWD1 3K75B 4YG0A 2FZ1A 5F39A 3OUHA 3LA3A 1X8EA 2OZJA 2WZR2 3ATGA 5JI9A 1VBA1 2XJUA 1JU4A 4LBMA 5L36A 1YUDA 2IZWA 2NPIA 3O1OA 1HRV2 2XPJA 2WLPA 3LQCA 1VAKA 1SZBA 2LW8A 3OY8B 3T0BA 1W8OA 5DZFA 5K8SA 1OXCA 2LS6A 2ZX1A 2A1XA 4R9CA 5GJ6A 2CGPA 2YBPA 4GWIA 3AMNA 3T3YA 5DZGA 1HQLA 1Q56A 1O6UA 1XNDA 2JD9A 3MIHA 3IAPA 4DS0A 1F5FA 1GP6A 3NV2A 5FO7B 3LE0A 3DPRB 4HPKB 2VUCA 2Y6LA 1P8JA 1ZBE2 2BOJA 2VM9A 4IEPA 3LEMA 1ZBA2 1RMU2 2YHJA 4IGOA 4M3CE 3KVAA 1GMMA 1AHSA 4YW5A 5CG9A 3AP9A 3VLBB 4KMQA 1DZRA 2WZPP 1MEC2 2LM3A 3A22A 5JI7A 2QJVA 5B2GB 3X29B 4P02B 3BGAA 4NROA 4Q4X3 3AYDA 4IE6A 1JTZX 1E5HA 3VDDA 2QQKA 4OQ9A 1VIWB 4RQPB 1GYKA 5CFDC 3UESA 2JDUA 1A3KA 1MACA 1CPNA 2PQSA 1OQDA 4N8MA 2VMHA 3HNBM 5JDBA 1W9WA 1AUYA 4FFIA 3R05A 2YC4A 4Y22A 3FC0A 2BDRA 1EV11 3GDBA 3HPNA 4XTPA 2XJVA 5H9RA 4D69A 5JMCA 5F3GA 1FMD1 3K51A 1WLTA 1O59A 4LOTA 4Z2WA 3GGLA 1U5ZA 4FPGA 3THCA 2YXSA 4NR1A 2BERA 1AYN2 1H6XA 1OLMA 1UOBA 1W0OA 4OI0A 2VW1A 4NJ4A 5CBLA 3E6BA 3I2OA 1RHI2 1PGL1 3LFIA 1BVVA 5I0DA 4NIGA 2RS11 4PQQA 1XYOA 5FYHA 3OBZA 4CP0A 5JIUA 5JZGA 4AAPA 3T2OA 5T55A 4AI0A 2QQUA 4FFHA 1QGLA 1R1ZA 1HW5A 3ZVXA 3PMSA 3CMGA 4AYUA 1GOHA 2BGOA 1S0BA 3MDPA 5DAPA 3V56A 3BPZA 1N3QA 2D6OX 2DU0A 4WVZA 1YJKA 4NE9A 4CP2A 5C70A 2WNUA 1AL23 4J1XA 2RE9A 2BNNA 4G9SB 1GU3A 1TNFA 1W9TA 2ERFA 3FBYA 2WQZC 3AFGA 2VUJA 3RI8A 4NAOA 2BWCA 1DHKB 4XBNA 3RGBA 2VNRA 4QXBA 1RUE2 2ZGOA 5DAWA 4JC1A 3ZN4A 1MZ5A 2R6QA 2AYHA 5LB6A 4LKDA 2PHDA 5J1XA 2BW8A 1IQAA 3T4VA 2CAVA 1PO12 4D6QA 5JSPA 2XMLA 5A3TA 3UETA 3H3UA 2P1BA 4XMIA 2BP6A 4JKLA 1IS3A 2VQAA 4AVSA 1K5MA 3VDDB 4R9DA 3AP7A 3WG3A 1C1FA 1JS9A 4UFIA 1F5JA 1HV1A 4P5HA 1I6XA 3I3EA 4Y4RA 4QXKA 4BM8A 2WJSA 1XNKA 2XGXA 1HJGA 4PIZA 2PAKA 1GNZA 5BNPA 1QJFA 1KFXL 4FTBA 1IPKA 1OD3A 3SXWA 4CUGA 4YZ2A 3Q9OA 4Q8KA 3H1MA 1OQ1A 3POYA 1VBA2 1NE6A 5FZ1A 2RM23 4UW5A 5FAXA 2D6KA 1PMIA 5FPXA 5ACA2 3VUOA 2VCAA 1REFA 3C8XA 4QX0A 3B5LB 4EWDA 1W90A 3KT7A 1D4M2 1T6GC 4M3CB 2DF7A 3ZLIA 4F3JA 1LOGA 5A3OA 3OPWA 1GLHA 1GP5A 2VMEA 1H30A 1QDCA 5C5TA 5IW0A 4L0PA 1EPZA 4QX5A 2VO5A 2BQPA 1N1YA 4FPHA 5F9TA 1I5ZA 1LGBA 5AVAA 1NA1A 3JU9A 4JDNA 5GZDA 1BQPA 5IJRA 5BNNA 1SEFA 5JXIA 4TZDA 2E26A 4CP9B 5A33A 3S7IA 4H3WA 2XG3A 3ZYGA 3WQ7A 3KS7A 1KJLA 3TBDA 1Q8VA 3L2YA 1HXS3 4Q26A 1G86A 3PVEA 1PIV3 1OUSA 4XF3A 1C8M1 3NV1A 4Z8BA 2CAUA 2BOIA 3H42B 1V6LA 3LB9A 4QX8A 3LAGA 3UKNA 3PUQA 4FFFA 3VD4A 1UPIA 1XSQA 3D3AA 4D7YA 1UU5A 4CDUB 1SHWB 1KDKA 3WF4A 3VZKA 5FDBA 1EAH1 2DYCA 3K4DA 3N36A 1BMV1 1LCLA 3USUB 3NAPC 3H8OA 1DP0A 3IBMA 2VMIA 2X53S 1I9RA 3NRUA 4HG6B 2CWSA 1A6CA 3OEBA 2Z5WA 3HNYM 3VHPA 3NNMA 4XCAA 1H2NA 4IE7A 1YJLA 5AFBA 4BQ4A 4YVWB 4RR3A 2D3PA 4G3YC 1LB2A 4DIQA 3PMEA 4XXPA 2DURA 2PHLA 1IS4A 3FWEA 2W1QA 4IEXA 2BGCA 2YDEA 2W87A 2R063 3B94A 4LBNA 4X6RB 3D6EA 3TEZA 2LROA 1C5IA 2UY9A 5KXBA 1W0PA 1W6QB 1UOFA 2JWPA 3J7MA 5C3OA 4GKYA 1AF9A 5A3LA 1SLIA 4XUNA 3W20A 1VMJA 5CFCA 4HETA 2EIEA 4FT8A 1UXXX 4IDZA 2OIIA 3AK0A 3A4UA 2Q4SA 1RUF3 4AQSA 5IATA 1NCQB 1JYVA 2Z42A 1B35B 2VZUA 2G4IA 4OHVA 4PBOA 1NQJA 5DPNA 5FLJA 1Q43A 1V9U1 2NM1A 4CZSA 1QU0A 1JYWA 3CJIC 4E4DX 5BNNB 1AXKA 4Y1ZA 2YGMA 3VD5A 1UOJA 4QPGC 1JZ7A 2XJRA 4Q29A 4ARXA 4B7KA 2R1DA 4LKFA 3THDA 3ETQA 1CAXA 2W46A 1V6OA 2OUJA 1SFYA 1XB9A 3ME2A 1OPOA 1ZM1A 2RR11 2XJQA 3KV5A 4DINB 1LEMA 4AG4A 3I97A 5BPXA 5FPZA 5DG1A 1REEA 2PHFA 3RYPA 4Y4YA 4Y1XA 5LA9A 1SDWA 1S0EA 1UU4A 4U2AA 5FZDA 3BTYA 1QJEA 4IEUA 4CEWB 2FDFA 5C71A 4FPYA 3FN9A 3H50A 1WMEA 3AKPA 5EJZB 3BIEA 1FPN1 1NCRC 1PVC3 3RJ2X 3RZMA 5FMBA 1FATA 3KV4A 1W6MA 2VJXA 5KXEA 2VOXA 4M4PA 3C7HA 1OFNA 3W9AA 2GH2A 2VZQA 2WZR3 4BOWA 4YVSA 4FQZA 5EWSA 5J96B 3NVCA 4Y24A 1DQ2A 5JPMB 5I0UA 1QJY3 3JQWA 4FAGA 4XE9A 4AR2A 1VBD3 4RA0A 3AVRA 3M70A 1YXWA 2JB4A 3KT1A 4CTEA 3CBNA 1F15A 4TXWA 4XEZA 1JYNA 4AQTA 2DV9A 4O9EA 1WA6X 4YW2A 1XRUA 2JDNA 4TWTA 1SACA 3Q8CA 4ZS2A 5FZHA 4ZXKA 1COV1 1ZBA3 5C3SA 1RMU3 2EA7A 4EWEA 3N4MA 3LFMA 2ZCWA 3M3CA 3QACA 5LCWL 3WNMA 2EXJA 1UMIA 5HPOA 2J1SA 4PBPA 5DUUA 2ZGQA 3OBTA 3VZMA 4Q4W2 4HSJA 2WC2A 1NLRA 2WS92 4O7XA 1HQNA 3KVBA 4O61A 3ZN6B 2BU9A 1V6IA 5FK8A 4A7KA 3ACGA 4QD2A 4XFIA 4A2UA 3FHQA 1Q5OA 2NZ9A 3DYPA 2C0ZA 5DN2A 1XNAA 2RDQA 2WBKA 2UWAA 5EP9A 4BK5A 5KR7A 5LZ6A 4NAMA 5A32A 2OX0A 5L19A 3D4KA 1K45A 2YGLA 3DPRC 1HB4A 2RMU1 1FV2A 3FJSA 2P5BA 1DYOA 1M4WA 4Y20B 3W21A 5GZCA 1EUUA 3CJXA 1Q8QA 3RYKA 1DG6A 3K4AA 4S2FA 3PU3A 3C7FA 3ALQA 1YEWA 3ZM8A 5LASA 2PAEA 5CFDA 3NQHA 3RMYA 3O1RA 3IAQA 1BMV2 4CDWB 1WLDA 2FDJA 3ELNA 4J1WA 2K46A 3BIWE 5L7OC 3V0BA 5D21A 4YFZA 4QDRA 5IAVA 5FZGA 3MLKA 1O3RA 1AYN3 1JW6A 3LSDA 4GKXA 1K12A 1QHDA 2RDNA 3POGA 3HJRA 1HQWA 5A6YA 5GLZA 1RHI3 2YV8A 2A3YA 3HMYA 5GKAC 4MV2A 5EPAA 2YB7A 5LK5A 1BEV1 4YVSB 3AKQA 1YFXA 5A6ZA 3VZLA 1S2KA 4GMP3 4COUA 1WA4A 2LALA 5HXMA 1U5IA 4QWNA 1PGSA 1LENA 2VMFA 2XQRA 3CF6E 3VBOB 3GNEA 2WAOA 1N1TA 1W2OA 5ANQA 1XNBA 3J7HA 1UAIA 5EXOA 4BQYA 2Z2SB 1KS5A 2FCUA 4QU1A 4OMCA 5AC91 4I01A 3LCPA 4D6SA 4ZKTB 1FOD2 3U78A 4NPRA 1QOTA 2O14A 4A4AA 3I3DA 3O1PA 4MGTA 4AHXA 1DYKA 1UCXA 1ZZCA 1KD7A 1SMVA 3VZJA 3MF9A 4LBQB 4LA2A 3CZUA 1MZ6A 1WMXA 1CR7A 5C4WC 1UZVA 1RUI1 1D2QA 4FOYA 4NMIA 3WW1A 2VVEA 4ZHNA 1NUKA 4E2SA 2RR12 2VOKA 5A32B 2XL9A 2WINB 4OMDA 2AUYA 4IW3A 3NJZA 3PHMA 4OVEA 3SH3A 3WQBA 1S55A 1O3SA 1ZRIA 3W5NA 3U10A 3H3ZA 4EWAA 4K20A 2C9KA 1CAUA 2Y6KA 1FPN2 4QQ2A 2HWD3 4DEVA 4E8CA 4P9WA 3WP5A 2W68A 4BMEA 2P3KA 1NX9A 3AMHA 5EYYA 4LUMA 1G9FA 3AVSA 1VBA3 4AI9A 3J7NA 4AVVA 2OUHA 2X29A 2Y6JA 1DYPA 5CB7A 1YQ5A 5JR2A 3WDYA 3KQRA 3NNLA 2ZKLA 3ZSEA 4X6QB 4CU8A 3WDWA 1OQEA 3N9MA 3WNNA 5BYNA 4OLLA 1JZ3A 1GR3A 1UKGA 1V6MA 5E16A 4AEJA 3MBWA 3LOBA 1Q8SA 1G9DA 1W2TA 4MHUA 5DUWA 1YFWA 1VRH1 5FMOS 1ZRDA 1LU2A 4GH4B 4UW6A 2D5FA 2IXCA 5FZFA 2I07B 4XTMA 3RI9A 2DTYA 3DECA 1G6NA 4UBHA 3WDVA 3ZXAC 4XF9A 2ARCA 2W39A 1YO8A 4K7JA 2ZBJA 4Y1UA 4K8FA 2ZOEB 5FR3A 3URFA 2IFWA 3ZFFB 4Y5Z0 2ZGRA 1VE0A 1LKNA 2NMOA 3OSDA 4N9HA 4D3WA 1GZ9A 2CV6A 2A7AA 3ABZA 1C4RA 1FI2A 1SQ4A 2C4XA 5JOWA 2FMYA 2JDYA 3R4DB 3GBFA 2Q8OA 2ORZA 3H0OA 1OVPA 1TZOA 2ZHLA 2DBNA 3TYJA 5LBCA 3EBRA 5I8YA 2IWGB 4Z92B 4B8EA 3M2MA 1EV13 3T4HB 2A3WA 5CADA 3F95A 5TSWA 2G9FA 1FMD3 1MQTB 2VVDA 1KEXA 1VB2A 2BNOA 1LOAA 2ZMNA 3MICA 3NAPA 4IE4A 5EHDA 3SCGA 4YARA 2ZEZA 3VKNA 5LEJA 4JDOA 3D82A 5FYYA 3WINE 3LEGA 2Y8KA 5CKQA 1LOCA 4CDUC 1O4YA 4F7ZA 2VW2A 2D6MA 4JTNA 4JKKA 2RS13 1W28A 2BRTA 1BEV2 2A73B 2F17A 4Z07A 1TME1 5FK7A 2NLRA 1DLLA 4LBLA 3I4IA 4AI1A 1U5YA 3PUAA 1POV1 2W94A 3POEA 3NNJA 3TWIA 4OI2A 1RB8G 2BEOA 4DRVA 4ZXEA 5IHRA 5FP4A 1QJZA 4YGBA 3WF3A 5KHKA 3A0NA 1DQ1A 4BE3A 1UY3A 3LGRA 2VTXA 3LF7A 5DAQA 4YVWC 3R4SA 5A7QA 3WNOA 3WVJA 4N7IA 1W6OA 2DTWA 3K3NA 5CA6A 2Y0OA 3N9NA 1S1AA 1G9AA 3G7DA 1FAYA 2B5HA 4QT6A 1WCDJ 5FPAA 4BXSV 3AL5A 1RUI2 4V2VA 2KR2A 3SCHA 3CJIA 2VZ1A 1LHOA 4YM3A 1ST8A 2VZVA 4BB3A 2PXJA 3U14A 2WFF1 4QPGA 1SLLA 2D6NA 1NCQC 1B35C 4OI1A 4QXCA 5T5JA 4B1MA 5DABA 3ETPA 1FV3A 2QCSB 2DCJA 2JE9A 5DAVA 4AZZA 5A1AA 3MF6A 4INDA 3CQOA 3RDIA 1E5RA 1VR3A 3DUIA 2EIBA 1US2A 4QU2A 4EV0A 2ADEA 4DO0A 3M3EA 5FREA 4YW6A 2RJ2A 2YZ4A 5CVRA 5FP7A 3THPA 1KITA 5A7WA 3OF1A 1TMF1 2D44A 1ND3C 3BODA 5FY7A 3L2HA 4ITCA 4GWMA 1VAMA 3P3NA 1XYPA 2HBTA 3DN7A 4L8QA 4FPLA 4FTSA 1DQ4A 4LK7A 3BPSA 4MOAA 3RYRA 4LHSA 2QNKA 3HQRA 5FUPA 3T2TA 4BYYA 2WA4A 2JD4A 4F8AA 4UOJA 1IG0A 2QE3A 4UFKA 1HXS2 4JQRA 4HFSA 1BJQA 3ITQA 4IUGA 4XYXA 1WCSA 3MW2A 1PIV2 3KCCA 4QQLA 2J1VA 2RDSA 1F8VA 3FMGA 3ZKUA 5KC5A 1RGSA 4BWOA 3O7OA 2FDHA 2J1AA 1RJ7A 2E63A 3ROUA 1VRH2 3DF0A 1ZREA 3J26N 1HJFA 1QJX1 2WKKA 2AZ5A 2WAAA 1AXZA 3IPVB 4GULA 1LODA 4XETA 4CSWA 3S30A 5I8TA 3TNQA 2V4AA 4COZA 1NZIA 4ES9A 5CISA 3NL1A 5FYBA 3HIFA 1SFNA 3N35A 4E8DA 3E97A 5K7PA 4AFCA 2QQVA 3QD6A 4BQ5A 3OY8A 4HL0A 1C8M3 3I54A 3I59B 4CA9A 2R041 3ZFEC 1SCRA 1AL0G 3LEKA 2GNBA 4O9GA 2QDRA 1GBGA 2W08A 5FWJA 1Y3TA 4QHBA 1D0HA 3ACLA 1ACCA 1DIWA 1EAH3 2WABA 2Q0AA 4QPGB 4YGCA 3DPRA 2Y33A 3M3QA 2BPA2 2C24A 1QJU1 2BWAA 2O0OA 1ZZBA 3VBUC 4TTGA 1L7QA 3R4UA 1H0BA 3MGUA 5FZAA 3MZHA 2GC3A 3LA7A 1NLSA 3VHRA 1GUIA 2VULA 3KHBA 1GNYA 3MPPG 1RUF2 3AJYA 4A6SA 1H6YA 3RZJA 4KBZA 1YQ8A 1SBEA 3QCWA 1AJOA 2ZAHA 5L7OA 2SLIA 1YYNA 2GDFA 2YFUA 1MVQA 1X36A 3KHCA 3J8F1 3DKWA 5FUIA 5EJ3A 5C7GA 1NCRB 3LZZA 1XPWA 1CQ9A 4MYEA 4XDOA 3WDUA 1TME2 2VCBA 4RQPA 4CU7A 1H4HA 2IXKA 4EN6B 3UJOA 1XOYA 4CDWC 4MSVA 2PMWB 5FZ0A 4UXAA 1GP4A 5FYVA 4QKFA 1EY2A 3ON7A 3SH4A 3NV4A 4PF1A 5JSRA 3AZYA 3DXTA 4MO3M 3P5BA 4WM8B 1MS0A 3CIHA 3WF0A 3ECQA 3ZPYA 5KHJA 1CJDA
chains in the Genus database with same CATH topology
4CE8A 3DCQA 2VUCA 2JDYA 2BOJA 5A6XA 2XR4A 2BP6A 1OUSA 2VNVA 5HCHA 2BOIA 1OVPA 2WR9A 2JDHA 5A3OA 5A70A 5A6YA 1GZTA 4AOCA 1OURA 4UT5A 1OUXA 1UQXA 3ZDVA 2JDMA 1UZVA 2BV4A 5A6ZA 1W8FA 1OXCA 1W8HA 1OVSA 5D2AA 2JDKA 2JDNA 2CHHA 2WRAA 2JDUA 5A6QA 2JDPA 2VUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CE8 A;  3DCQ A;  2VUC A;  2JDY A;  2BOJ A;  5A6X A;  2XR4 A;  2BP6 A;  1OUS A;  2VNV A;  5HCH A;  2BOI A;  1OVP A;  2WR9 A;  2JDH A;  5A3O A;  5A70 A;  5A6Y A;  1GZT A;  4AOC A;  1OUR A;  4UT5 A;  1OUX A;  1UQX A;  3ZDV A;  2JDM A;  1UZV A;  2BV4 A;  5A6Z A;  1W8F A;  1OXC A;  1W8H A;  1OVS A;  5D2A A;  2JDK A;  2JDN A;  2CHH A;  2WRA A;  2JDU A;  5A6Q A;  2JDP A;  2VUD A; 
#chains in the Genus database with same CATH topology
 2CTV A;  4LPL A;  1JYT A;  2Z4F A;  4UF0 A;  4RYD A;  1AYM 1;  2QQO A;  1V9U 3;  4Q4V 1;  2V73 A;  5EV7 A;  5JMO A;  2Y0I A;  2P6C A;  4BIS A;  4W4Z A;  4ZON A;  4SLI A;  4RS5 B;  4MUV A;  1IG3 A;  3AZX A;  4AFD A;  4QQO A;  4AOC A;  2Y6F A;  2QFE A;  1W3V A;  3HBK A;  3GZU C;  4PDW B;  3VBO C;  3ZXK A;  4XJU A;  2RR1 3;  3RNS A;  5C4W A;  2KXL A;  1QJY 2;  4Y3O A;  1SBF A;  2WFF 2;  5H9P A;  4B7E A;  3VBR C;  3AZZ A;  1VBD 2;  1W99 A;  2G9G A;  3KF3 A;  3LSE A;  3ORJ A;  5T5O A;  5JUV A;  4QX7 A;  1H1M A;  3VB9 A;  5LA2 A;  2XUM A;  2Y34 A;  4FAH A;  1FPN 3;  5LY1 A;  3M3O A;  1JN2 P;  3JZV A;  3IDE A;  2AH2 A;  2Y38 A;  2DVB A;  4NRQ A;  3M8L A;  1C8N A;  5KHH A;  2J1T A;  2IFR A;  2VQU A;  1TMF 2;  4DY5 A;  4BHP A;  2I45 A;  2JEN A;  3KWV A;  4MHR A;  5IVB A;  4S2D A;  4I2O A;  4LO6 B;  1RED A;  5J98 B;  4AFA A;  4QB2 A;  4P9G A;  5L7O B;  3V0A A;  3TOJ A;  5F6K A;  1BCX A;  5CU1 A;  2JE8 A;  3AC0 A;  5DZE A;  1GWL A;  4WM7 B;  1X50 A;  1E57 A;  2ZEW A;  1UYY A;  1OLM E;  4YZ5 A;  5IK8 A;  5FMD A;  2RS5 1;  1ND2 B;  4CE8 A;  4PIY A;  1COV 3;  4TN7 A;  4AVT A;  4L99 A;  2E33 A;  2YU2 A;  2ZAC A;  1QNW A;  1VBC 1;  4N7U A;  1JZ2 A;  1I3H A;  3PUI A;  4GJY A;  4HON A;  5HCH A;  1CJP A;  4GMP 0;  3SHR A;  4BIF A;  2WR9 A;  4WVV A;  3WUC A;  2NQY A;  2YC0 A;  4GB3 1;  1BYH A;  3POS A;  4UF0 B;  2NN8 A;  3VBF B;  3POW A;  4FXK B;  4XIK A;  4MG2 A;  5FXZ A;  4N90 A;  5B4N A;  4LBQ D;  1GQG A;  1OHF A;  2PN5 A;  2RMU 3;  2W3J A;  5EIY B;  2Q8D A;  1HLC A;  3O12 A;  4JV4 A;  3NJY A;  4M3C A;  1E5I A;  4GH4 C;  4Q0Q A;  1W2U A;  2P3Y A;  4IEZ A;  4PQ9 A;  4KU7 A;  1OKQ A;  2R1B A;  4P9I A;  5C4W B;  5GM0 A;  5FY5 A;  4A3Z A;  5KXD A;  5FJK A;  1PK6 B;  1QJU 2;  5FZB A;  1W04 A;  1X8M A;  4MXW B;  5IK4 A;  5F3C A;  4AF9 A;  4CP9 A;  2MNG A;  2WFP A;  3H8U A;  5BNQ A;  3ZFF C;  5GAL A;  4XJZ A;  4JRL A;  1YC6 1;  4C1X A;  4ZZ5 A;  3P1I A;  2XVL A;  5FXW A;  4PLM A;  5LBF A;  3H1Y A;  5F32 A;  5DXD A;  4IEQ A;  3U4X A;  4GA9 A;  5FZ3 A;  3J8F 2;  4NPM A;  1BEV 3;  1FX5 A;  3ES4 A;  4H55 A;  4LR4 A;  4B3N A;  2JE7 A;  2WWJ A;  3WX5 A;  1JZ4 A;  2JG8 B;  2ZZQ A;  4GAL A;  4NVP A;  4CDQ C;  1V6N A;  1Z7S 1;  1QOS A;  4K1Y A;  3AM2 A;  3R0R A;  4CDU A;  1S4C A;  3V0A B;  2GMP A;  1J1T A;  2XJS A;  4BQX A;  1MQT C;  4P9Y A;  4MXV A;  1AR7 1;  3BTZ A;  3UL2 A;  3LDK A;  5FY0 A;  4BQ1 A;  3USU A;  4HK9 A;  4W6Y A;  1ZA4 A;  2XWJ B;  2JG9 B;  3AFK A;  4BLI A;  5AC9 3;  2VR4 A;  4NID A;  1D4V B;  2QQP A;  4FXG B;  5IUQ A;  1TG7 A;  2QQW A;  1AYM 2;  5E1R A;  1MZF A;  4Q4V 2;  3UKV A;  4KWK A;  3F2Z A;  4YVW A;  2WYF A;  1MS9 A;  3EO6 A;  3A0K A;  2HWD 2;  4MGI E;  3ZKY A;  4BA6 A;  5JXH A;  1RUI 3;  1ONA A;  4HZF A;  4NOT A;  2HWE 1;  4K1Z A;  3UKT A;  4HKO A;  4XFH A;  1D0G A;  2EAL A;  1KXG A;  5FZE A;  4Q4Y 1;  1QXR A;  1W6Q A;  1F9K A;  4C90 A;  4LHN A;  1MS8 A;  2EXI A;  3KLS A;  2DVG A;  3UYJ A;  4LBO A;  5LBB A;  3ZSJ A;  3ZXL A;  5DUV A;  3KT4 A;  4YLZ A;  1RUG 1;  2VAU A;  4DXR A;  5ERL A;  4C0H A;  3UNP A;  1R08 1;  2PYT A;  5GLT A;  5GZF A;  1JOB A;  1WMF A;  4LHK A;  1NYW A;  1NCQ A;  5H9S A;  2IXH A;  1B35 A;  4DZG A;  3I3M A;  1S0G A;  3ZYF A;  3J4U H;  5FBJ A;  3O1U A;  5C8W A;  3T0D A;  2XQX A;  1H2M A;  1HN1 A;  5CKN A;  2FBE A;  5E8A A;  3SC7 X;  4LHL A;  1OVS A;  3A21 A;  4Q8L A;  4IV3 B;  2B9U A;  4QKN A;  4NHX A;  1RUD 1;  3I49 A;  1W8T A;  5T54 A;  2FQP A;  1GWM A;  3OB8 A;  2EID A;  3LA2 A;  1ULF A;  4LOR A;  3U1X A;  3SEE A;  1RIN A;  3VKM A;  3M7A A;  3WW3 A;  1ZRR A;  2TBV A;  1QQP 1;  5GZE A;  2ETE A;  1J3P A;  3ZMO A;  3O1T A;  2EIG A;  4E4S A;  2PTM A;  4CEW A;  2RS5 2;  1VRH 3;  3GJA A;  1LOE A;  3O1V A;  4XJ9 A;  3IDC B;  5FYM A;  3TN9 1;  4FOQ A;  1AR6 1;  4XUQ A;  1VBC 2;  1HRI 1;  3K3O A;  2L9L A;  2OPK A;  3PTR B;  3RWN A;  3H8R A;  2D40 A;  2VTF A;  1DQ6 A;  2D5H A;  1EV1 2;  3U4S A;  5FZ4 A;  2E32 A;  4J6G A;  4CRQ A;  1BLZ A;  3JB4 C;  3WLU A;  1W6P B;  5FYT A;  3TEW A;  1D7P M;  1DGW A;  1FMD 2;  3NJX A;  1IGO A;  5A80 A;  3WG2 A;  4Q0S A;  1UL9 A;  5HCF A;  4XUO A;  2SBA A;  2FMD A;  4JKM A;  3J9S A;  1AX0 A;  5CAZ A;  3B9C A;  1RJ8 A;  1AX1 A;  1V70 A;  2QQJ A;  4JQT A;  5SV5 A;  3SEP A;  2VGD A;  2WN3 A;  2RS1 2;  5A3P A;  4XUR A;  4IEO A;  5E89 A;  2MHF A;  1DBN A;  2VOT A;  4FTE A;  3ZFE A;  3NKG A;  4ATE A;  4AL9 A;  1ASJ 1;  1OC1 A;  2C1F A;  2WO7 A;  2XJT A;  3H7J A;  3IKW A;  4HOO A;  4KL1 A;  4Y33 A;  5SV8 A;  3HAG A;  3KV9 A;  1S2E A;  4OZX A;  5FY1 A;  2ZHK A;  3FUO A;  1LES A;  2RG4 A;  4I0B A;  1G9B A;  3QH6 A;  3K46 A;  3ZN6 A;  2XKP A;  1I5P A;  1YHF A;  3POF A;  4W65 A;  2A3X A;  3M3I A;  5GLW A;  4I30 A;  4LO4 B;  2YYO A;  1VBB 3;  5EFU A;  4HBN A;  2EF6 A;  4K9S A;  1HX6 A;  1TQ5 A;  3IMM A;  3ACF A;  1TME 3;  4ZPI A;  2ADD A;  4Y20 A;  4AEK A;  3LWC A;  4DB5 A;  1POV 3;  1WLW A;  3BB6 A;  4MGY E;  4YZ4 A;  1RXG A;  4N9I A;  2J1R A;  1ND3 B;  1Z7S 2;  1DQ5 A;  2G19 A;  4LQR A;  4M3C F;  2F4L A;  2GNT A;  3R6S A;  5IVC A;  2RJL A;  4JHT A;  3LIG A;  4K6B A;  5A3M A;  1AR7 2;  2W2I A;  3WF2 A;  4D7T A;  1J1L A;  2BV4 A;  5KXC A;  4TSV A;  1N1S A;  4CDW A;  4LXL A;  4BXF A;  1IOA A;  1YNA A;  2JEM A;  2P3I A;  2O8O A;  3T30 A;  3VBH B;  3WDX A;  3O0V A;  3KF5 A;  2QZ2 A;  1RIT A;  3BAL A;  4QDS A;  2GN3 A;  4UFJ A;  3BUC A;  3THT A;  2MPF A;  3MLL A;  1J3R A;  2HWE 2;  5H9Q A;  5CNA A;  5I93 A;  2WSU A;  1AR9 1;  1W06 A;  1XU2 A;  4LKE A;  3LPF A;  5JCT A;  4I3P A;  2WFF 3;  4FP2 A;  4WM8 C;  1AZD A;  3I2H A;  3WCR A;  4AVC A;  3ZYI B;  1UYZ A;  2V4V A;  1LTE A;  2XLG A;  4NPL A;  3RWK X;  3VBO A;  4QKD A;  2ZPX A;  1GNH A;  1Y9M A;  5C3Q A;  4Q27 A;  1RUC 1;  5FY8 A;  3PTY A;  4RS5 C;  2XBO 1;  3HD8 B;  2A6V A;  3VBR A;  3HT1 A;  3K48 A;  5GLV A;  3C2U A;  3GZA A;  1MPX A;  3ZFE B;  3Q8B A;  5A6Q A;  1CWP A;  4XFA A;  1TMF 3;  2QQN A;  4DUX A;  4PDW C;  2DVF A;  2DU1 A;  4JGZ B;  1N1V A;  1V0A A;  4LBQ A;  4ZU7 A;  1ZZ8 A;  4H2A A;  4HLT A;  4KU8 A;  4XJ8 A;  4LMF A;  5ABJ C;  4FQ4 A;  3WDT A;  3ZMN A;  4FBF A;  3GHM A;  5IVJ A;  1BK0 A;  4H7M A;  1PM4 A;  4XPV A;  1RUD 2;  4QM9 A;  3VBU B;  5EQU A;  4DY3 A;  4ASK A;  4JHZ A;  3I7D A;  2DFB A;  1UX7 A;  1JXN A;  1J59 A;  2ARB A;  2XON A;  2WQ4 A;  1DF0 A;  2JDM A;  4YW7 A;  3VKL A;  2IVI B;  3JBG 1;  1MS4 A;  2OW4 A;  4A44 A;  2W52 A;  4C0B A;  1C8M 2;  1GZW B;  1IPS A;  3ZPO A;  2QVS B;  3J7L A;  1ZZ7 A;  2VH9 A;  2VBP A;  2WUH A;  1Y43 B;  3QH7 A;  4IEY A;  4P14 A;  1JUI A;  2WA3 A;  3I2F A;  2ZX3 A;  1QJX 3;  3MO4 A;  2VUD A;  1EAH 2;  1AR6 2;  1FNZ A;  3BYW A;  1HRI 2;  1OF3 A;  4CDX C;  5FPL A;  4P9J A;  1PHM A;  4L2N A;  3T08 A;  2YFZ A;  1VBE 1;  5FTT C;  3VDC A;  4I02 A;  4WVW A;  4B4R A;  3AMP A;  3PIG A;  5C33 A;  3WQ0 A;  1Y9G A;  2C26 A;  5L9B A;  3PDQ A;  4WM7 C;  5L73 A;  3A7Q A;  1PZ9 A;  1OT5 A;  1RUJ 1;  3L9J T;  1ND2 C;  2R04 3;  2OA2 A;  4WZC A;  4C1W A;  4CUA A;  2FDK A;  2HYK A;  2ZX0 A;  3OGS A;  1L7L A;  4KWL A;  3WY6 A;  1JZ6 A;  2QKD A;  3Q8F A;  3KQ4 B;  5J48 A;  2CY6 A;  1IPJ A;  1XE7 A;  4FCA A;  5E88 A;  5L9R A;  2J42 A;  3D0J A;  1CX1 A;  4QM8 A;  1RC6 A;  3N9L A;  1G7Y A;  2ARA A;  3ZXE A;  1QJU 3;  2RVA A;  4GH4 A;  4MGZ E;  3VBF C;  1WW6 A;  4A7Z A;  1GQP A;  3VHN A;  5LA1 A;  5CG8 A;  3E5Q A;  2X09 A;  1IKP A;  1Y9Q A;  1PO2 1;  1YI9 A;  1W8N A;  4GQ7 A;  3VBR B;  3C7G A;  1Q8P A;  4JGY B;  3U37 A;  3HR9 A;  2QQL A;  3OJB A;  2LTN A;  3JQX A;  4XFF A;  4Y5S A;  3ILN A;  1V9U 2;  1WMD A;  3B00 A;  4UFM A;  1UIK A;  3ZN5 A;  3J8F 3;  3ZFF A;  4FI9 A;  3KMH A;  4AI3 A;  2GC1 A;  2WO2 A;  1CAV B;  1ENR A;  1SPP A;  3S0M A;  1FT9 A;  5I8S A;  2A5Z A;  2DBI A;  1YFU A;  5FPV A;  2R7E B;  2D6L X;  4R4X A;  1QMJ A;  1PK6 C;  3EQE A;  3DYM A;  4LE4 A;  4Y1V A;  3ZSL A;  5JAX A;  4M01 A;  2R0H A;  1VMH A;  1QWR A;  5BNO C;  3T2Q A;  4UAP A;  4E2G A;  3H1W A;  4URT A;  1AR8 1;  4DMI A;  3QBQ A;  5FZC A;  1AYM 3;  1MQT A;  2WZ8 A;  3OGV A;  4Q4V 3;  4IER A;  1IS6 A;  3GAL A;  5FZM A;  2VBB A;  4GZ9 A;  4Q0P A;  3BI3 A;  2VQT A;  4LT5 A;  1TVG A;  4XAE A;  1PZ8 A;  1MVE A;  3JUU A;  5FPB A;  2JG8 C;  5LY2 A;  3FZ3 A;  1F4H A;  3W59 A;  5F37 A;  3PLQ A;  4K8R B;  1W8W A;  3WCS A;  4H14 A;  3BCW A;  1MS1 A;  5K0U C;  5A7O A;  3AP5 A;  4ORF A;  2HWF 1;  1JYC A;  5CYY A;  5E6H A;  3SQO A;  2NP0 A;  3H9A A;  3KV6 A;  1F31 A;  2CDO A;  4KNC A;  4PCR A;  2E7T A;  4XBL A;  2VBD A;  1J58 A;  2IUW A;  4QKB A;  2JG9 C;  3C3V A;  2OYZ A;  4YW4 A;  2PLV 1;  1LAJ A;  1YIP A;  3RPQ A;  1WCQ A;  1OMI A;  4XZU G;  2VNV A;  5FO9 B;  2XBO 2;  1TEI A;  4LK6 A;  1H2L A;  5F5Q A;  3TEY A;  3TNP B;  2ZX4 A;  2A71 A;  3ZYR A;  4QAW A;  3S6P A;  3ZX7 A;  1CD3 G;  1ODN A;  1COV 2;  3VD3 A;  2ZAB A;  3ZO0 B;  4IV1 C;  4XAB A;  1R09 1;  3POJ A;  5GLU A;  3FHA A;  2MEV 1;  1XNT A;  4MH0 E;  2XUE A;  1CPM A;  2ARX A;  3AX4 A;  2JB8 A;  3OPZ A;  4XFC A;  1KDM A;  5BXX A;  2ARE A;  3I2G A;  5D8A B;  1YIF A;  1TNR A;  1UD1 A;  2XWB B;  2VXJ A;  2FDG A;  4FOV A;  1SPP B;  2RMU 2;  2RS5 3;  1ODM A;  2JKB A;  2OS2 A;  4YGE A;  4A41 A;  1XU1 A;  2PHR A;  1Q8O A;  4LO5 B;  4H7L A;  4D94 A;  1DU3 D;  1XJA A;  2HJI A;  1VBC 3;  4XBQ A;  3N7M A;  2CSG A;  2WT1 A;  5FQ0 B;  2WWS A;  3MIB A;  4OUS A;  3WD5 A;  4IV3 C;  3PVN A;  4EN9 B;  4ONU A;  4CDQ B;  1K5J A;  3CLP A;  3MUY 1;  3WW4 A;  5KWR A;  3NNG A;  3DEM A;  3PUH A;  4GB3 3;  2UYA A;  4GXL A;  3O14 A;  1VBE 2;  3GJB A;  3IDB B;  4LBJ A;  4RFT 0;  1HKD A;  4K40 A;  2W0X A;  1JYI A;  1ZZ6 A;  5IFP A;  3I2D A;  1LOF C;  1N47 A;  1UOG A;  5FIX A;  2XOM A;  1DDL A;  4BDV B;  4CEY C;  4LJH A;  2A6Z A;  1UF2 C;  3Q8E A;  1VAV A;  1RUJ 2;  1VBB 1;  4XQ4 A;  2WNV B;  4I0A A;  2VZO A;  2X10 A;  2XVK A;  1RUN A;  1PGW 1;  2CYF A;  3OTF A;  4PJY A;  1NZC A;  1AJK A;  2ET7 A;  2X5I B;  1WKY A;  4KQ7 A;  4PI0 A;  5DDJ 1;  1RTV A;  2ORX A;  2RHP A;  5A3W A;  4HK8 A;  4B4Q A;  4EN8 B;  1CON A;  1PMH X;  3N9Q A;  3ZDV A;  1OOP B;  4YRD A;  3ZIX A;  2Q5T A;  3GF6 A;  3O0W A;  3IPV A;  1OH4 A;  2B45 X;  4LLF A;  4EZ4 A;  5FOB B;  1KFU L;  2ZX2 A;  3AP6 A;  2V5Y A;  4NN0 A;  5D1I A;  4NII A;  5A7P A;  1MR5 A;  5AC9 2;  4P9X A;  5F1R A;  3HWJ A;  1GOG A;  2XJP A;  1GZC A;  3CU7 A;  2F4P A;  2JEC A;  5D2A A;  4ZS3 A;  1OF4 A;  2DCT A;  5IT6 A;  4ZU4 A;  1UU6 A;  3ACI A;  2VG9 A;  4YW3 A;  3VDB A;  1CGP A;  2LUW A;  3OYW B;  1O4T A;  3I59 A;  4PI2 A;  3WNX A;  4EZH A;  1DGR N;  1ALY A;  4YFW A;  5T3N A;  1POQ A;  5I0T A;  5LK7 B;  1Z7S 3;  1XBF A;  3HBZ A;  3HN3 A;  3WF1 A;  4DXZ A;  1JMU B;  1YWK A;  5IVE A;  3IM0 A;  3I8T A;  1AR7 3;  4NHL A;  4JTO A;  4QPI B;  1GSL A;  5IK7 A;  2R07 1;  1STM A;  4IE5 A;  4CCM A;  1RUO A;  3AZV A;  2VOV A;  1WW7 A;  1UZY A;  2DVA A;  3MIF A;  4FPO B;  4LIU A;  2E6V A;  3JD7 1;  4NHK A;  1AR8 2;  3TEX A;  4BZ4 A;  4HN1 A;  1HN0 A;  5AVP A;  3K77 A;  4CXY A;  4OHW A;  3I2K A;  2JDK A;  1CES A;  3WV6 A;  2BTV C;  1B09 A;  3V64 A;  2HWE 3;  2VCM A;  2VQ0 A;  3VBS B;  1W3X A;  3FLR A;  3ZR5 A;  4BJ0 A;  3W5M A;  1QNY A;  3TB0 A;  4UYB A;  4CCN A;  1YI7 A;  1XC6 A;  2HWF 2;  1HRV 1;  1NCR A;  4HVO A;  1O91 A;  4Q4Y 3;  3W58 A;  3ZDS A;  4DQA A;  4QXH A;  4G4F A;  3B69 A;  1N3P A;  1MZE A;  2WQ8 A;  3AYC A;  4RD7 A;  2Y26 A;  5BV6 A;  1A78 A;  4L9B A;  2D6P A;  2BNM A;  4FPJ A;  2B4K A;  2RS3 1;  1NT0 A;  1PM7 A;  1RUG 3;  1UYP A;  2ZS6 B;  4RN5 A;  5F5I A;  2LRP A;  5JIA A;  3VBH C;  1R08 3;  2AEY A;  4GAZ A;  4WM8 A;  2A75 A;  3QOP A;  1HIX A;  2HEY F;  4ISQ A;  4KGQ A;  2ZEY A;  3VGI A;  3KSC A;  2JDZ A;  3HQU A;  1PNG A;  2GP3 A;  3CHX A;  5FZO B;  3EHK A;  4YSF A;  1ENS A;  2PQQ A;  2F6B A;  5J09 A;  4RS5 A;  1R09 2;  3I3B A;  3OGG A;  5IVF A;  3ZXJ A;  2MEV 2;  1MEC 1;  2OZ6 A;  5DG2 A;  1ENQ A;  1RUD 3;  1MS3 A;  4PDW A;  4LA3 A;  1PX4 A;  5FOJ B;  1YQ2 A;  4ISR A;  4ZY9 A;  3OGR A;  1O3Q A;  5ABJ A;  5F5A A;  2VL4 A;  1LHU A;  2VNG A;  1QQP 3;  3MHZ A;  5I91 A;  3PVO A;  3VD9 A;  3N7K A;  1HV0 A;  4B1L A;  4HAN A;  4JGZ C;  4OHX A;  3TN9 3;  1AR6 3;  2TEP A;  1CAW B;  1HRI 3;  1POV 0;  2Q8E A;  2VE1 A;  2VD7 A;  2BUK A;  4LIV A;  1S0C A;  2JKX A;  3GHN A;  4YW1 A;  3FBM A;  2ZGU A;  2HBU A;  5F3I A;  1LHN A;  3NW4 A;  5HCA A;  5A6X A;  3FHI B;  4CDX A;  1H8T B;  5A3U A;  3GBW A;  3WG1 A;  1QH7 A;  3E5U A;  2GH8 A;  5LRR A;  5BUV A;  4XZP A;  4DPN A;  1LNS A;  1J3Q A;  5JOZ A;  1VBB 2;  3MW4 A;  5JXJ A;  2GP5 A;  1OBN A;  4FPK A;  1UWW A;  3SKJ E;  3IMN A;  4WM7 A;  1US3 A;  5C8C C;  1JI6 A;  1PGW 2;  3U0Z A;  1UY1 A;  4CVU A;  2PHW A;  1ND2 A;  5CIR A;  3FFZ A;  1W8F A;  1VLN A;  2VEC A;  1ASJ 3;  1EPW A;  3AMM A;  3APB A;  4Y5T A;  1CVN A;  2E7A A;  5DDJ 2;  5FKB A;  4K21 A;  5HV0 A;  4CP1 A;  4LEJ A;  2FHR A;  3PVB B;  3VL8 A;  1JHJ A;  2N7G A;  2Y64 A;  2KA3 A;  3DL3 A;  4BQ2 A;  1OA4 A;  5FZ7 A;  4AW7 A;  4AED B;  2FCT A;  4OI4 A;  3U07 A;  3VBF A;  4ASM B;  4ES8 A;  1LHV A;  1K3I A;  1W05 A;  2DCY A;  2YBK A;  3MFC A;  4FP3 A;  1QXJ A;  2VCC A;  3VKO A;  1S0I A;  5APA A;  1L7R A;  3S57 A;  3VZN A;  1BVP 1;  1SLB A;  5EJ1 B;  1J83 A;  1RUE 1;  2VMD A;  4XJW A;  3MV0 1;  4BCU A;  1EYB A;  2V09 A;  5B4X A;  1PO1 1;  2VZR A;  3RZL A;  3ST7 A;  1FYU A;  2OPW A;  4RGK A;  4YYO A;  3ZFG B;  2VZ3 A;  1UKR A;  4FFG A;  5ABJ B;  2ATF A;  3PUS A;  1JH5 A;  1SCS A;  4JAA A;  2R07 2;  4P00 B;  4JGY C;  1EP0 A;  4LNV A;  3I2I A;  1PK6 A;  1S2B A;  4M0H A;  1CIY A;  3JD7 2;  4KI5 M;  4MXW A;  4XCB A;  3INA A;  3LIH A;  1WW5 A;  3MIG A;  5BNO A;  5DQ0 A;  3UGF A;  2D7F A;  3VD7 A;  3O1S A;  4MGS A;  4CCK A;  1RYY A;  1SBD A;  4YM2 A;  3B02 A;  3LDR A;  4L92 A;  2DCZ A;  3CDZ B;  2UWB A;  1X33 A;  3NJV A;  1C5H A;  3ES1 A;  4A7Y A;  2HH9 A;  4UFH A;  4EE2 A;  2ZGM A;  1AR9 3;  3RG0 A;  1U12 A;  2XH6 A;  2DCK A;  2NYY A;  4KGG A;  4DOU A;  5ACA 1;  4YPJ A;  1T2X A;  2JG8 A;  4CDX B;  3OUJ A;  2DVD A;  4CYD A;  5A7S A;  4RHV 1;  4GJZ A;  5K0U A;  1D4M 1;  3AL6 A;  1NG0 A;  1VRB A;  3RRD A;  1DGL A;  2HWC 1;  2RS3 2;  1F35 A;  2VZP A;  2XVG A;  4ARY A;  2AAC A;  4U36 A;  3E5X A;  3T09 A;  4E9K A;  1RUC 3;  4N53 C;  3H8X A;  5F2S A;  1TE1 B;  2XBO 3;  2JG9 A;  4NWW A;  3S7E A;  4Q0V A;  3B9I A;  5FZ6 A;  2A6X A;  5JPN B;  3KCX A;  2VNO A;  3LOI A;  1JYX A;  4QDQ A;  2DUO A;  1QJX 2;  4CU9 A;  2G1M A;  2IXJ A;  5A7N A;  2OXB A;  3POI A;  3RS6 A;  4BH9 A;  3NST A;  2GME A;  1W9F A;  1RVF 1;  5FZL A;  3PIJ A;  3IIA A;  4IV1 A;  1W0N A;  4NIH A;  4D6R A;  1HB3 A;  2JX9 A;  3JBG 3;  3B01 A;  1ULO A;  4RL7 A;  1QF3 A;  2EIC A;  3LDB A;  2FDI A;  5JOY A;  2B8M A;  2R04 2;  2CDP A;  3ZYB A;  4I0W B;  5FYU A;  1ULC A;  1G8W A;  5C9A B;  3AXD A;  4NRM A;  4FOW A;  4GD4 A;  1DZQ A;  2O8Q A;  2J1E A;  2OVU A;  5JVV A;  1WCU A;  2V72 A;  5FP9 A;  1Z0H A;  2GZW A;  3UV9 A;  2GN7 A;  3WG4 A;  4FPF A;  4XQW A;  4CCE A;  1YLL A;  4FPE A;  4Z1V A;  3RZH A;  1V6K A;  1X82 A;  2PA7 A;  1VBE 3;  4PF5 A;  1NKG A;  5D8A C;  5BNO B;  4AFM A;  5FP8 A;  1HDK A;  2GC0 A;  4IXL A;  3RQ0 A;  4IV3 A;  4QQP A;  2EXK A;  3NO8 A;  4TLG A;  4HN0 A;  3K4Z A;  1RUJ 3;  4NIA A;  3ILF A;  3HNM A;  4QHO A;  4F83 A;  4BPZ A;  3HT2 A;  3MW3 A;  2P17 A;  1URX A;  3ZXD A;  2P34 A;  4QMA A;  1PZ7 A;  3UK9 A;  1LOF A;  3SIT A;  4XW3 A;  2PFW A;  1YQC A;  4CEY A;  4Q5O A;  2JDP A;  2K9Z A;  2GAL A;  1BHG A;  1ZYB A;  4FPC A;  5K0U B;  1UNB A;  4NUB A;  5HCB A;  5LRS A;  2XR4 A;  3JB8 A;  4AHY A;  3N3H A;  4KWU A;  1BXH A;  1NXM A;  1WUV A;  2ZAA A;  1FNY A;  1PO2 3;  3OPT A;  5A70 A;  1CZS A;  1W6P A;  5F3E A;  4I3G A;  5F2W A;  1LRH A;  1ULP A;  2WNV C;  2ZGN A;  2H6C A;  4JZR A;  2XL7 A;  3AZW A;  4DNY A;  4A45 A;  3JCI A;  2RV9 A;  1R1A 1;  2ZGT A;  4LO7 A;  1UO9 A;  1V6J A;  2BZD A;  3KGZ A;  2BYV E;  2IC1 A;  2X5I C;  1W6N A;  2YUE A;  4DUW A;  4XXA A;  1F2N A;  4AEM A;  2W9X A;  4A6O A;  1LOB A;  4IV1 B;  5CZK A;  4AGG A;  1ZRF A;  5C3R A;  1DGW X;  3PL0 A;  2J7M A;  3NMB A;  1OOP C;  2BVV A;  3MV1 1;  2KD7 A;  2YU1 A;  3DGT A;  1BBT 1;  5LBE A;  3GCW A;  3PU8 A;  4JRA A;  4COY A;  3RJR A;  3ZOI A;  2BGP A;  3VZO A;  1AR8 3;  4WZF A;  4NRP A;  5DUX A;  3KD4 A;  1N3O A;  4L11 A;  3EXU A;  4XHB A;  3SKV A;  3BOP A;  2ILM A;  4BK4 A;  2B42 B;  5LEK A;  4COV A;  1ENX A;  4Z2A A;  4XFB A;  4Y22 B;  4Z82 A;  3ACH A;  2QBX A;  4QQH A;  4XAA A;  1YQ6 A;  2RDR A;  1UY2 A;  2A6Y A;  4AI2 A;  4V1P A;  1FXZ A;  5F7U A;  1PNF A;  3KCY A;  3MUZ 1;  2XDV A;  3HVD A;  1AX2 A;  2HWF 3;  1WBL A;  2VMG A;  4QHZ A;  4QPW A;  2CHH A;  4QPI C;  3IWZ A;  2VZS A;  4UFL A;  4XAC A;  1ND3 A;  4AI8 A;  2BFU L;  2K0G A;  2QZ3 A;  4RHV 2;  1ZRC A;  4QX2 A;  1UY4 A;  1GOF A;  2PLV 3;  3ILR A;  2BFU S;  3OGJ A;  1JOD A;  1XQN A;  2HWC 2;  4I09 A;  4LTA A;  3T2P A;  4Q1R A;  5A1F A;  4CEY B;  1C3H A;  1CX4 A;  2EXH A;  5JZG B;  2WT2 A;  3BN6 A;  1JZ5 A;  3O0X A;  3VBS C;  3DV8 A;  4HVR A;  2ZXQ A;  3VBH A;  4EQV A;  2AEN A;  2PHT A;  1R09 3;  1SLC A;  3MLJ A;  3T1L A;  1IHM A;  2GC2 A;  3AKR A;  2MEV 3;  2UU8 A;  2WS9 1;  3K2O A;  4Q4W 1;  4R8H A;  4BQW A;  2P2K A;  3T1M A;  2QQM A;  1CZV A;  3WUD A;  2HKX A;  2B9V A;  2ZGK A;  2WNU B;  2D97 A;  4LUK A;  1RVF 2;  4GB3 2;  4YG6 A;  5FLI A;  2HWB 1;  4CU6 A;  1JZ8 A;  4Y26 A;  4OHZ A;  2BJS A;  3NWK A;  1BKZ A;  2H0B A;  1XXN A;  2RJK A;  4S2H A;  2VTX J;  3WNP A;  1KQR A;  2XKO A;  4FVV A;  1W6N B;  4OUL A;  3E6D A;  1GQH A;  4CPB D;  4D7S A;  5J7M A;  1H8V A;  4XF1 A;  5FCC A;  3RSJ A;  3PNA A;  3D5O A;  4J25 A;  2GU9 A;  3NV3 A;  3OUI A;  1PGL 2;  4RGA A;  2QTW B;  4EN0 A;  2I74 A;  1IQD C;  1V00 A;  1WGP A;  2ZGS A;  1K5M B;  4R9A A;  1W2N A;  5G05 L;  1IKQ A;  4JGZ A;  5EYX A;  1W03 A;  4HT1 T;  4W6X A;  4LOS A;  3E6C C;  5F5C A;  4E27 A;  1A8D A;  2DFC A;  2NMN A;  4NHY A;  3M1H A;  2D98 A;  2AGS A;  3VBU A;  2ZA9 A;  3V65 A;  5A1L A;  5I0S A;  5BNP B;  1KRI A;  3WHT A;  1OA3 A;  4MVT A;  2BVB A;  2TNF A;  5FP3 A;  5HBA A;  4XDP A;  1WD3 A;  1WBF A;  3N7L A;  4TLF A;  4ZZ8 A;  4OHY A;  4XMA A;  1RUH 1;  3IDA A;  3ZXG A;  5T50 A;  1UPS A;  3B3Q E;  4YWA A;  1GZW A;  2WWU A;  1LHW A;  3FLP A;  1O7F A;  5KBF A;  1QY4 A;  5DDJ 3;  4MX3 A;  3TRS B;  1OSG A;  1BK1 A;  4HKW A;  3SIS A;  1A34 A;  4PT6 A;  3GZE A;  4EN7 B;  3VDA A;  5C8C A;  1QXP A;  5C3P A;  3HQX A;  1H8T C;  2JIC A;  4ERO A;  3KZ4 C;  2IVJ A;  3G6J B;  1FOD 1;  2Z79 A;  4CXX A;  5JSO A;  1WLC A;  2WRA A;  1DZT A;  2V5D A;  3C7O A;  3O1M A;  4BU2 A;  1NA1 B;  1NY7 1;  5A3N A;  5J36 A;  3U11 A;  1JUH A;  3VKF C;  5FZI A;  4R9B A;  5A33 B;  3IN9 A;  1R1A 2;  3BTA A;  1QEX A;  4UW3 A;  3ENR A;  2X8K A;  3WP3 A;  2VU9 A;  1T6B X;  3IB3 A;  2W5F A;  4AHZ A;  3NKT A;  3POB A;  5M0T A;  1U5X A;  4CXW A;  4Q4Y 2;  1K42 A;  1D2S A;  2UUR A;  2VMC A;  1QIQ A;  1UQX A;  2WNE A;  2R07 3;  4LLO A;  1BBT 2;  2WYS A;  4KWJ A;  4AED C;  2WL1 A;  2ENR A;  3JD7 3;  4N43 C;  1I1E A;  1RUG 2;  1H2K A;  5FYI A;  1R08 2;  3WOG A;  1UX6 A;  1UZW A;  3A23 A;  2A70 A;  4QX1 A;  5DMY A;  2W92 A;  3WP4 A;  4M00 A;  1GKB A;  4QPY A;  2W1W A;  4JGY A;  2YY1 A;  4YNI A;  5LAT A;  2X05 A;  3RFR A;  1UZZ A;  4B29 A;  2VW0 A;  4SBV A;  1PX3 A;  1OKO A;  1HB2 A;  2GAU A;  3DYO A;  2CNA A;  1RL3 A;  3MEP A;  4Y1Y A;  1HRV 3;  2EAA A;  2C6S A;  3ZFG C;  3ZSM A;  5L9V A;  3HOB A;  2XB6 C;  3N7J A;  1CAV A;  2JXA A;  1UMZ A;  3I2J A;  4CCJ A;  4RR3 B;  2WO3 A;  1W8U A;  4UW4 A;  3CL1 A;  2RS3 3;  1GFF 2;  4MGQ A;  4AXO A;  5IK5 A;  3GXU A;  4CCD A;  4COW A;  4Q4X 1;  2AEZ A;  1GAN A;  5KC6 A;  3SNM A;  2DWR A;  2ZJC A;  4L97 A;  2WLQ A;  4Q0U A;  1QQP 2;  1ZBE 3;  1VP6 A;  1ZX5 A;  2I2S A;  5CFC B;  1IS5 A;  1GV9 A;  5ISL A;  3RZK A;  3PUR A;  4ZU5 A;  2IXL A;  2WZE A;  1ULG A;  3WR0 A;  5C8C B;  4N53 A;  1LGC A;  3TN9 2;  1XYN A;  1LU1 A;  4IES A;  2W1U A;  1MEC 3;  2BBA A;  3AYA A;  4CCO A;  1XE8 A;  2ES3 A;  1Y7B A;  1WW4 A;  3WEZ A;  1UMH A;  1ZNP A;  3AKS A;  3MID A;  2HWB 2;  1CIW A;  1O8P A;  1X7N A;  1ZZ9 A;  1Q3E A;  3WP6 A;  4IQP A;  3OEA A;  5JR7 B;  2VUA A;  4WVM A;  1C28 A;  1S0D A;  3JXS A;  3M4F A;  4OCT A;  3RZG A;  4BMB A;  1NXD 1;  2ZGP A;  3HN1 A;  4W50 A;  5FXV A;  4V2W A;  3Q8A A;  4CCC A;  4P5Y A;  5BY5 A;  1QH6 A;  2WO1 A;  3VL9 A;  1PMJ X;  1CAX B;  1O5L A;  2E53 A;  3WT3 A;  1LJ7 A;  1RIR A;  1ULE A;  3EB7 A;  4BLJ A;  4MZU A;  1WWY A;  3U75 A;  2JIJ A;  2W91 A;  1OLR A;  4PLN A;  3VHO A;  1ASJ 2;  1H4G A;  1H1A A;  5F8P A;  1X9T A;  3PJQ A;  4Q1P A;  4LE3 A;  4AVA A;  1C1L A;  1APN A;  3AB0 A;  5C5U A;  4NHM A;  5FMC A;  1SG3 A;  2UWC A;  1W6M B;  3SLI A;  4AGV A;  1NLQ A;  4P08 A;  4RQP C;  2XHN A;  1AL2 1;  4YZ3 A;  1NQD A;  5C9A C;  1UW8 A;  4XF0 A;  4O65 A;  5D8A A;  5JXG A;  1RXF A;  4TYS A;  3ZXF A;  4AQ6 A;  4X8P A;  1RUH 2;  5IVY A;  2CWM A;  2H0V A;  4R4Z A;  4XF4 A;  4OQ8 A;  1C57 A;  1W8H A;  2B7Y A;  2Q30 A;  1S0J A;  5FO8 B;  5I0R A;  5JWP A;  4CUB A;  4JVA A;  2ID4 A;  4XDQ A;  3KGL A;  3RVH A;  5FQ0 A;  1ZVF A;  4CDQ A;  3OG2 A;  2YMZ A;  4AFB A;  5G04 L;  4A42 A;  3ZYP A;  3ASI A;  1W9Y A;  4E4H A;  1PVX A;  2VC9 A;  3VN4 A;  2HEW F;  2FCV A;  4XUP A;  4PIX A;  1LGN A;  2UYB A;  4IEV A;  1NY7 2;  4N53 B;  5KHG A;  5F6L B;  1EUT A;  3CO2 A;  4AAX A;  4RFR B;  1RUE 3;  2Q1Z B;  3S5A A;  1VMF A;  2YPD A;  2WNV A;  2VVF A;  4P9L A;  4GIQ A;  1HB1 A;  3FLT A;  4OYU A;  5K4L A;  4LBK A;  1VPH A;  1NOV A;  1PO1 3;  1UXZ A;  3CKH A;  4X8N A;  5T5P A;  2RM2 1;  1AR9 2;  1IZ3 A;  2ZML A;  4YZ1 A;  3P6B A;  2XLF A;  4W8J A;  2XLA A;  4YG3 A;  2X5I A;  2QUO A;  1UYX A;  1W39 A;  3CNA A;  4WVM B;  4LKS A;  4DUV A;  3DXU A;  1UY0 A;  1JBC A;  1BZW A;  3MIE A;  2P3J A;  3MYX A;  1KS4 A;  2ZHM A;  4D8M A;  1OOP A;  3UGG A;  5J37 A;  5HV4 A;  3LD8 A;  1RUC 2;  4IGQ A;  4XVH A;  5CKM A;  5EZW A;  4XFG A;  5CFD B;  5DAX A;  1SDD B;  1AVB A;  4GWN A;  2VZT A;  3BTX A;  3V0B B;  4XUT A;  2EAK A;  2VXR A;  3GCX A;  1DFQ A;  3WZ1 A;  3OYW A;  2O1Q A;  3EJK A;  2HYX A;  2QQI A;  4CPB A;  5ACA 3;  5FYC A;  4KG8 A;  1WCK A;  3B93 A;  3VDD C;  3O5S A;  3BOW A;  4OZO A;  5FZK A;  4RHV 3;  3UT0 A;  3VV1 A;  3III A;  1D4M 3;  5IYY A;  1HXS 1;  5FXX A;  4DFS A;  2HWC 3;  1QKQ A;  4QPI A;  4R52 A;  4B4P A;  1PIV 1;  2Q1M A;  3SMH A;  3BVC A;  3CZJ A;  4Q4X 2;  4KG0 A;  1R64 A;  3JBG 2;  5IWF A;  5FMO L;  3FE5 A;  1OI6 A;  2AR6 A;  5IVV A;  5FZ9 A;  2UY8 A;  2ZEX A;  3NNF A;  2HLE A;  2D43 A;  4YM0 A;  1NAE A;  4UBG A;  3VBS A;  4K3U A;  2C9A A;  1KGY A;  1UN1 A;  2JDA A;  1RVF 3;  1H1I A;  3MFA A;  1O4Z A;  1LED A;  1OFS A;  2R32 A;  2YPJ A;  3PJY A;  4QGL A;  3WHU A;  2J22 A;  5T5L A;  1W8Z A;  2WNO A;  3BU0 A;  5JZG C;  1OA2 A;  2WSV A;  4OUE A;  5K9Y A;  5FFO C;  2R06 1;  4QB1 A;  3AXE A;  4MGK E;  4KH9 A;  1O8S A;  4URA A;  4LO8 A;  1H9P A;  4AWD A;  4ET7 A;  2ZTN A;  1A8M A;  5FZO A;  5T52 A;  4AHW A;  3ZYJ B;  4WV8 A;  3OBA A;  4AK3 A;  3BKZ A;  3FUQ A;  4CCL A;  1WZX A;  2WNU C;  1LUL A;  5FJH A;  4HVQ A;  4RSU A;  2Y60 A;  3ZIW A;  1RUF 1;  4IEW A;  1VAL A;  1OH3 A;  2ZZJ A;  3N9P A;  5JLV A;  1LR5 A;  1CAU B;  1PO2 2;  1SFP A;  2TUN A;  4GWJ A;  4CUC A;  4D0Q A;  4XOG A;  1AL2 2;  1E5S A;  3WSO A;  2W1S A;  2XHK A;  4OFG A;  2YBS A;  4AVB A;  1SLT A;  3EMR A;  4W6W A;  1OPM A;  4AQ2 A;  5LW9 A;  2H6B A;  2HEV F;  3EYP A;  1VJ2 A;  4FO9 A;  5FKC A;  2FZ2 A;  4HSL A;  4NWV A;  3UJQ A;  1K5M C;  5C6C A;  3DKQ A;  4DXT A;  3H3L A;  2CGN A;  4WBB A;  1S0F A;  1U0A A;  4KBB A;  2DDU A;  3E1F 1;  2E31 A;  3RMX A;  1CAW A;  3N9O A;  5FY9 A;  2OQ6 A;  3S5Q A;  1OUX A;  4PHZ A;  3MPB A;  5BNP C;  2G9Z A;  4IGP A;  3GM8 A;  4HKL A;  3WNL A;  4AGR A;  4A3X A;  3FFQ A;  1JOJ A;  2PHX A;  4C91 A;  5FRA A;  1LEC A;  3H7Y A;  2GND A;  4XIL A;  1DQ0 A;  1PVC 1;  1H8T A;  4JCK A;  2D3R A;  1R1A 3;  2CU5 A;  1KJR A;  2OKX A;  4XJA A;  5ANN A;  4ASL A;  1CZT A;  2WZR 1;  5CEH A;  5AFE A;  3IZO A;  3LEI A;  2P6H A;  1OLQ A;  4HMZ A;  1G9C A;  2CGO A;  1QJY 1;  2RM2 2;  4E2Q A;  1L3J A;  2Y6G A;  2GSY A;  1VBD 1;  2JDH A;  2KM2 A;  1BBT 3;  1JU3 A;  3OBR A;  2JIG A;  4HXC A;  4PLO A;  4QGN A;  5KHI A;  1OUR A;  4JX0 A;  3USS A;  1W2A X;  2PLV 2;  2OT7 A;  4EJR A;  4S2G A;  2B39 A;  1NA1 C;  2Q8C A;  3AKT A;  5BNN C;  3P3P A;  4LIT A;  1O5U A;  4QX3 A;  5GZG A;  1ZBE 1;  4AED A;  5FZ8 A;  2B46 X;  4DRR A;  4N43 A;  2ET1 A;  2R16 A;  1ZBA 1;  5HI0 A;  1RMU 1;  2D3S A;  2R30 A;  2VY0 A;  4IL7 A;  4RGG A;  2VOW A;  1X9P A;  3AYE A;  2E9Q A;  2FD8 A;  4QB6 A;  1JHN A;  1UZ0 A;  1YCI A;  3NAP B;  2ZMK A;  2E7Q A;  2VPV A;  2CL2 A;  1XSR A;  4CEW C;  3RZZ A;  1VB4 A;  3ZFG A;  2DUP A;  1ULD A;  3SH5 A;  4OUM A;  1GIC A;  4MAD A;  3TAY A;  2Y6H A;  2DUQ A;  2WDB A;  2YC2 A;  4UT5 A;  4AE2 A;  3T0A A;  4XQD A;  3CEW A;  2K2S A;  4M0N A;  4LUL A;  1M06 G;  1OD5 A;  4E4Z A;  5J3U A;  1UIJ A;  2J1U A;  3AMQ A;  3KM5 A;  2PAM A;  4XC9 A;  3LKJ A;  1Y4W A;  2GMM A;  4Q4W 3;  5HXV A;  2WS9 3;  2WII B;  3C7E A;  4UWD A;  1AXY A;  1NE4 A;  2P4E A;  2R49 A;  4RR3 C;  4ATF A;  1W6O B;  2WT0 A;  2Z69 A;  1XNC A;  1QDO A;  2ZGL A;  3DCQ A;  2HWB 3;  4MET A;  2Q1F A;  3D8C A;  1AYN 1;  3MI8 A;  2EVX A;  2E51 A;  3KB5 A;  3OD0 A;  5FWE A;  5FY4 A;  3OOX A;  1RHI 1;  1YRZ A;  2R0F A;  1MS5 A;  5CFC C;  1SLA A;  2GNM A;  4IE0 A;  2ZKN A;  3CJI B;  2OQ7 A;  2R06 2;  3B7M A;  2A6W A;  5FLH A;  5FYS A;  2W47 A;  1WD4 A;  4GMP 1;  4HPK A;  3BU7 A;  3I3Q A;  1W9S A;  1H9W A;  3QLQ A;  5LWB A;  1XE0 A;  3ZR6 A;  2AC1 A;  3ZYH A;  1DGR A;  1YFY A;  3OD4 A;  1Z78 A;  4NO4 A;  4QGM A;  2PHU A;  1CN1 A;  2JJ6 A;  3AJZ A;  2D93 A;  4XHX A;  3GYD A;  3WXP A;  4JDM A;  1F4A A;  1DCS A;  2PEL A;  3AP4 A;  3GZT B;  3IT8 A;  4N43 B;  5FV3 A;  5A7W B;  3OCP A;  5IFT A;  4XIO A;  4DXS A;  2QDN A;  2YRO A;  5FUN A;  2ZHN A;  4MLO A;  1RUH 3;  1JOP A;  2W95 A;  4EYU A;  3FX3 A;  2C5D A;  3WQ1 A;  1GZT A;  4C8D A;  3LPG A;  4YGD A;  1DLC A;  5FYZ A;  5FPU A;  2YG0 A;  3HEI A;  5C9A A;  4Q2F A;  2BBV A;  3UGH A;  5JOX A;  4UI9 L;  4M4R A;  1O3T A;  3FL7 A;  5LA0 A;  5IAX A;  4YM1 A;  2XXZ A;  4IET A;  5FBZ A;  4FSJ A;  3WW2 A;  1GWK A;  1J84 A;  2P37 A;  3ZSK A;  2WN2 A;  4BIO A;  1FOD 3;  4DEQ A;  1ZA7 A;  1QOO A;  4YVS C;  3WNK A;  2IXI A;  3D0S A;  4BQ3 A;  3GBG A;  3SCF A;  1PVC 2;  2HWD 1;  3K75 B;  4YG0 A;  2FZ1 A;  5F39 A;  3OUH A;  3LA3 A;  1X8E A;  2OZJ A;  2WZR 2;  3ATG A;  5JI9 A;  1VBA 1;  2XJU A;  1JU4 A;  4LBM A;  5L36 A;  1YUD A;  2IZW A;  2NPI A;  3O1O A;  1HRV 2;  2XPJ A;  2WLP A;  3LQC A;  1VAK A;  1SZB A;  2LW8 A;  3OY8 B;  3T0B A;  1W8O A;  5DZF A;  5K8S A;  1OXC A;  2LS6 A;  2ZX1 A;  2A1X A;  4R9C A;  5GJ6 A;  2CGP A;  2YBP A;  4GWI A;  3AMN A;  3T3Y A;  5DZG A;  1HQL A;  1Q56 A;  1O6U A;  1XND A;  2JD9 A;  3MIH A;  3IAP A;  4DS0 A;  1F5F A;  1GP6 A;  3NV2 A;  5FO7 B;  3LE0 A;  3DPR B;  4HPK B;  2VUC A;  2Y6L A;  1P8J A;  1ZBE 2;  2BOJ A;  2VM9 A;  4IEP A;  3LEM A;  1ZBA 2;  1RMU 2;  2YHJ A;  4IGO A;  4M3C E;  3KVA A;  1GMM A;  1AHS A;  4YW5 A;  5CG9 A;  3AP9 A;  3VLB B;  4KMQ A;  1DZR A;  2WZP P;  1MEC 2;  2LM3 A;  3A22 A;  5JI7 A;  2QJV A;  5B2G B;  3X29 B;  4P02 B;  3BGA A;  4NRO A;  4Q4X 3;  3AYD A;  4IE6 A;  1JTZ X;  1E5H A;  3VDD A;  2QQK A;  4OQ9 A;  1VIW B;  4RQP B;  1GYK A;  5CFD C;  3UES A;  2JDU A;  1A3K A;  1MAC A;  1CPN A;  2PQS A;  1OQD A;  4N8M A;  2VMH A;  3HNB M;  5JDB A;  1W9W A;  1AUY A;  4FFI A;  3R05 A;  2YC4 A;  4Y22 A;  3FC0 A;  2BDR A;  1EV1 1;  3GDB A;  3HPN A;  4XTP A;  2XJV A;  5H9R A;  4D69 A;  5JMC A;  5F3G A;  1FMD 1;  3K51 A;  1WLT A;  1O59 A;  4LOT A;  4Z2W A;  3GGL A;  1U5Z A;  4FPG A;  3THC A;  2YXS A;  4NR1 A;  2BER A;  1AYN 2;  1H6X A;  1OLM A;  1UOB A;  1W0O A;  4OI0 A;  2VW1 A;  4NJ4 A;  5CBL A;  3E6B A;  3I2O A;  1RHI 2;  1PGL 1;  3LFI A;  1BVV A;  5I0D A;  4NIG A;  2RS1 1;  4PQQ A;  1XYO A;  5FYH A;  3OBZ A;  4CP0 A;  5JIU A;  5JZG A;  4AAP A;  3T2O A;  5T55 A;  4AI0 A;  2QQU A;  4FFH A;  1QGL A;  1R1Z A;  1HW5 A;  3ZVX A;  3PMS A;  3CMG A;  4AYU A;  1GOH A;  2BGO A;  1S0B A;  3MDP A;  5DAP A;  3V56 A;  3BPZ A;  1N3Q A;  2D6O X;  2DU0 A;  4WVZ A;  1YJK A;  4NE9 A;  4CP2 A;  5C70 A;  2WNU A;  1AL2 3;  4J1X A;  2RE9 A;  2BNN A;  4G9S B;  1GU3 A;  1TNF A;  1W9T A;  2ERF A;  3FBY A;  2WQZ C;  3AFG A;  2VUJ A;  3RI8 A;  4NAO A;  2BWC A;  1DHK B;  4XBN A;  3RGB A;  2VNR A;  4QXB A;  1RUE 2;  2ZGO A;  5DAW A;  4JC1 A;  3ZN4 A;  1MZ5 A;  2R6Q A;  2AYH A;  5LB6 A;  4LKD A;  2PHD A;  5J1X A;  2BW8 A;  1IQA A;  3T4V A;  2CAV A;  1PO1 2;  4D6Q A;  5JSP A;  2XML A;  5A3T A;  3UET A;  3H3U A;  2P1B A;  4XMI A;  2BP6 A;  4JKL A;  1IS3 A;  2VQA A;  4AVS A;  1K5M A;  3VDD B;  4R9D A;  3AP7 A;  3WG3 A;  1C1F A;  1JS9 A;  4UFI A;  1F5J A;  1HV1 A;  4P5H A;  1I6X A;  3I3E A;  4Y4R A;  4QXK A;  4BM8 A;  2WJS A;  1XNK A;  2XGX A;  1HJG A;  4PIZ A;  2PAK A;  1GNZ A;  5BNP A;  1QJF A;  1KFX L;  4FTB A;  1IPK A;  1OD3 A;  3SXW A;  4CUG A;  4YZ2 A;  3Q9O A;  4Q8K A;  3H1M A;  1OQ1 A;  3POY A;  1VBA 2;  1NE6 A;  5FZ1 A;  2RM2 3;  4UW5 A;  5FAX A;  2D6K A;  1PMI A;  5FPX A;  5ACA 2;  3VUO A;  2VCA A;  1REF A;  3C8X A;  4QX0 A;  3B5L B;  4EWD A;  1W90 A;  3KT7 A;  1D4M 2;  1T6G C;  4M3C B;  2DF7 A;  3ZLI A;  4F3J A;  1LOG A;  5A3O A;  3OPW A;  1GLH A;  1GP5 A;  2VME A;  1H30 A;  1QDC A;  5C5T A;  5IW0 A;  4L0P A;  1EPZ A;  4QX5 A;  2VO5 A;  2BQP A;  1N1Y A;  4FPH A;  5F9T A;  1I5Z A;  1LGB A;  5AVA A;  1NA1 A;  3JU9 A;  4JDN A;  5GZD A;  1BQP A;  5IJR A;  5BNN A;  1SEF A;  5JXI A;  4TZD A;  2E26 A;  4CP9 B;  5A33 A;  3S7I A;  4H3W A;  2XG3 A;  3ZYG A;  3WQ7 A;  3KS7 A;  1KJL A;  3TBD A;  1Q8V A;  3L2Y A;  1HXS 3;  4Q26 A;  1G86 A;  3PVE A;  1PIV 3;  1OUS A;  4XF3 A;  1C8M 1;  3NV1 A;  4Z8B A;  2CAU A;  2BOI A;  3H42 B;  1V6L A;  3LB9 A;  4QX8 A;  3LAG A;  3UKN A;  3PUQ A;  4FFF A;  3VD4 A;  1UPI A;  1XSQ A;  3D3A A;  4D7Y A;  1UU5 A;  4CDU B;  1SHW B;  1KDK A;  3WF4 A;  3VZK A;  5FDB A;  1EAH 1;  2DYC A;  3K4D A;  3N36 A;  1BMV 1;  1LCL A;  3USU B;  3NAP C;  3H8O A;  1DP0 A;  3IBM A;  2VMI A;  2X53 S;  1I9R A;  3NRU A;  4HG6 B;  2CWS A;  1A6C A;  3OEB A;  2Z5W A;  3HNY M;  3VHP A;  3NNM A;  4XCA A;  1H2N A;  4IE7 A;  1YJL A;  5AFB A;  4BQ4 A;  4YVW B;  4RR3 A;  2D3P A;  4G3Y C;  1LB2 A;  4DIQ A;  3PME A;  4XXP A;  2DUR A;  2PHL A;  1IS4 A;  3FWE A;  2W1Q A;  4IEX A;  2BGC A;  2YDE A;  2W87 A;  2R06 3;  3B94 A;  4LBN A;  4X6R B;  3D6E A;  3TEZ A;  2LRO A;  1C5I A;  2UY9 A;  5KXB A;  1W0P A;  1W6Q B;  1UOF A;  2JWP A;  3J7M A;  5C3O A;  4GKY A;  1AF9 A;  5A3L A;  1SLI A;  4XUN A;  3W20 A;  1VMJ A;  5CFC A;  4HET A;  2EIE A;  4FT8 A;  1UXX X;  4IDZ A;  2OII A;  3AK0 A;  3A4U A;  2Q4S A;  1RUF 3;  4AQS A;  5IAT A;  1NCQ B;  1JYV A;  2Z42 A;  1B35 B;  2VZU A;  2G4I A;  4OHV A;  4PBO A;  1NQJ A;  5DPN A;  5FLJ A;  1Q43 A;  1V9U 1;  2NM1 A;  4CZS A;  1QU0 A;  1JYW A;  3CJI C;  4E4D X;  5BNN B;  1AXK A;  4Y1Z A;  2YGM A;  3VD5 A;  1UOJ A;  4QPG C;  1JZ7 A;  2XJR A;  4Q29 A;  4ARX A;  4B7K A;  2R1D A;  4LKF A;  3THD A;  3ETQ A;  1CAX A;  2W46 A;  1V6O A;  2OUJ A;  1SFY A;  1XB9 A;  3ME2 A;  1OPO A;  1ZM1 A;  2RR1 1;  2XJQ A;  3KV5 A;  4DIN B;  1LEM A;  4AG4 A;  3I97 A;  5BPX A;  5FPZ A;  5DG1 A;  1REE A;  2PHF A;  3RYP A;  4Y4Y A;  4Y1X A;  5LA9 A;  1SDW A;  1S0E A;  1UU4 A;  4U2A A;  5FZD A;  3BTY A;  1QJE A;  4IEU A;  4CEW B;  2FDF A;  5C71 A;  4FPY A;  3FN9 A;  3H50 A;  1WME A;  3AKP A;  5EJZ B;  3BIE A;  1FPN 1;  1NCR C;  1PVC 3;  3RJ2 X;  3RZM A;  5FMB A;  1FAT A;  3KV4 A;  1W6M A;  2VJX A;  5KXE A;  2VOX A;  4M4P A;  3C7H A;  1OFN A;  3W9A A;  2GH2 A;  2VZQ A;  2WZR 3;  4BOW A;  4YVS A;  4FQZ A;  5EWS A;  5J96 B;  3NVC A;  4Y24 A;  1DQ2 A;  5JPM B;  5I0U A;  1QJY 3;  3JQW A;  4FAG A;  4XE9 A;  4AR2 A;  1VBD 3;  4RA0 A;  3AVR A;  3M70 A;  1YXW A;  2JB4 A;  3KT1 A;  4CTE A;  3CBN A;  1F15 A;  4TXW A;  4XEZ A;  1JYN A;  4AQT A;  2DV9 A;  4O9E A;  1WA6 X;  4YW2 A;  1XRU A;  2JDN A;  4TWT A;  1SAC A;  3Q8C A;  4ZS2 A;  5FZH A;  4ZXK A;  1COV 1;  1ZBA 3;  5C3S A;  1RMU 3;  2EA7 A;  4EWE A;  3N4M A;  3LFM A;  2ZCW A;  3M3C A;  3QAC A;  5LCW L;  3WNM A;  2EXJ A;  1UMI A;  5HPO A;  2J1S A;  4PBP A;  5DUU A;  2ZGQ A;  3OBT A;  3VZM A;  4Q4W 2;  4HSJ A;  2WC2 A;  1NLR A;  2WS9 2;  4O7X A;  1HQN A;  3KVB A;  4O61 A;  3ZN6 B;  2BU9 A;  1V6I A;  5FK8 A;  4A7K A;  3ACG A;  4QD2 A;  4XFI A;  4A2U A;  3FHQ A;  1Q5O A;  2NZ9 A;  3DYP A;  2C0Z A;  5DN2 A;  1XNA A;  2RDQ A;  2WBK A;  2UWA A;  5EP9 A;  4BK5 A;  5KR7 A;  5LZ6 A;  4NAM A;  5A32 A;  2OX0 A;  5L19 A;  3D4K A;  1K45 A;  2YGL A;  3DPR C;  1HB4 A;  2RMU 1;  1FV2 A;  3FJS A;  2P5B A;  1DYO A;  1M4W A;  4Y20 B;  3W21 A;  5GZC A;  1EUU A;  3CJX A;  1Q8Q A;  3RYK A;  1DG6 A;  3K4A A;  4S2F A;  3PU3 A;  3C7F A;  3ALQ A;  1YEW A;  3ZM8 A;  5LAS A;  2PAE A;  5CFD A;  3NQH A;  3RMY A;  3O1R A;  3IAQ A;  1BMV 2;  4CDW B;  1WLD A;  2FDJ A;  3ELN A;  4J1W A;  2K46 A;  3BIW E;  5L7O C;  3V0B A;  5D21 A;  4YFZ A;  4QDR A;  5IAV A;  5FZG A;  3MLK A;  1O3R A;  1AYN 3;  1JW6 A;  3LSD A;  4GKX A;  1K12 A;  1QHD A;  2RDN A;  3POG A;  3HJR A;  1HQW A;  5A6Y A;  5GLZ A;  1RHI 3;  2YV8 A;  2A3Y A;  3HMY A;  5GKA C;  4MV2 A;  5EPA A;  2YB7 A;  5LK5 A;  1BEV 1;  4YVS B;  3AKQ A;  1YFX A;  5A6Z A;  3VZL A;  1S2K A;  4GMP 3;  4COU A;  1WA4 A;  2LAL A;  5HXM A;  1U5I A;  4QWN A;  1PGS A;  1LEN A;  2VMF A;  2XQR A;  3CF6 E;  3VBO B;  3GNE A;  2WAO A;  1N1T A;  1W2O A;  5ANQ A;  1XNB A;  3J7H A;  1UAI A;  5EXO A;  4BQY A;  2Z2S B;  1KS5 A;  2FCU A;  4QU1 A;  4OMC A;  5AC9 1;  4I01 A;  3LCP A;  4D6S A;  4ZKT B;  1FOD 2;  3U78 A;  4NPR A;  1QOT A;  2O14 A;  4A4A A;  3I3D A;  3O1P A;  4MGT A;  4AHX A;  1DYK A;  1UCX A;  1ZZC A;  1KD7 A;  1SMV A;  3VZJ A;  3MF9 A;  4LBQ B;  4LA2 A;  3CZU A;  1MZ6 A;  1WMX A;  1CR7 A;  5C4W C;  1UZV A;  1RUI 1;  1D2Q A;  4FOY A;  4NMI A;  3WW1 A;  2VVE A;  4ZHN A;  1NUK A;  4E2S A;  2RR1 2;  2VOK A;  5A32 B;  2XL9 A;  2WIN B;  4OMD A;  2AUY A;  4IW3 A;  3NJZ A;  3PHM A;  4OVE A;  3SH3 A;  3WQB A;  1S55 A;  1O3S A;  1ZRI A;  3W5N A;  3U10 A;  3H3Z A;  4EWA A;  4K20 A;  2C9K A;  1CAU A;  2Y6K A;  1FPN 2;  4QQ2 A;  2HWD 3;  4DEV A;  4E8C A;  4P9W A;  3WP5 A;  2W68 A;  4BME A;  2P3K A;  1NX9 A;  3AMH A;  5EYY A;  4LUM A;  1G9F A;  3AVS A;  1VBA 3;  4AI9 A;  3J7N A;  4AVV A;  2OUH A;  2X29 A;  2Y6J A;  1DYP A;  5CB7 A;  1YQ5 A;  5JR2 A;  3WDY A;  3KQR A;  3NNL A;  2ZKL A;  3ZSE A;  4X6Q B;  4CU8 A;  3WDW A;  1OQE A;  3N9M A;  3WNN A;  5BYN A;  4OLL A;  1JZ3 A;  1GR3 A;  1UKG A;  1V6M A;  5E16 A;  4AEJ A;  3MBW A;  3LOB A;  1Q8S A;  1G9D A;  1W2T A;  4MHU A;  5DUW A;  1YFW A;  1VRH 1;  5FMO S;  1ZRD A;  1LU2 A;  4GH4 B;  4UW6 A;  2D5F A;  2IXC A;  5FZF A;  2I07 B;  4XTM A;  3RI9 A;  2DTY A;  3DEC A;  1G6N A;  4UBH A;  3WDV A;  3ZXA C;  4XF9 A;  2ARC A;  2W39 A;  1YO8 A;  4K7J A;  2ZBJ A;  4Y1U A;  4K8F A;  2ZOE B;  5FR3 A;  3URF A;  2IFW A;  3ZFF B;  4Y5Z 0;  2ZGR A;  1VE0 A;  1LKN A;  2NMO A;  3OSD A;  4N9H A;  4D3W A;  1GZ9 A;  2CV6 A;  2A7A A;  3ABZ A;  1C4R A;  1FI2 A;  1SQ4 A;  2C4X A;  5JOW A;  2FMY A;  2JDY A;  3R4D B;  3GBF A;  2Q8O A;  2ORZ A;  3H0O A;  1OVP A;  1TZO A;  2ZHL A;  2DBN A;  3TYJ A;  5LBC A;  3EBR A;  5I8Y A;  2IWG B;  4Z92 B;  4B8E A;  3M2M A;  1EV1 3;  3T4H B;  2A3W A;  5CAD A;  3F95 A;  5TSW A;  2G9F A;  1FMD 3;  1MQT B;  2VVD A;  1KEX A;  1VB2 A;  2BNO A;  1LOA A;  2ZMN A;  3MIC A;  3NAP A;  4IE4 A;  5EHD A;  3SCG A;  4YAR A;  2ZEZ A;  3VKN A;  5LEJ A;  4JDO A;  3D82 A;  5FYY A;  3WIN E;  3LEG A;  2Y8K A;  5CKQ A;  1LOC A;  4CDU C;  1O4Y A;  4F7Z A;  2VW2 A;  2D6M A;  4JTN A;  4JKK A;  2RS1 3;  1W28 A;  2BRT A;  1BEV 2;  2A73 B;  2F17 A;  4Z07 A;  1TME 1;  5FK7 A;  2NLR A;  1DLL A;  4LBL A;  3I4I A;  4AI1 A;  1U5Y A;  3PUA A;  1POV 1;  2W94 A;  3POE A;  3NNJ A;  3TWI A;  4OI2 A;  1RB8 G;  2BEO A;  4DRV A;  4ZXE A;  5IHR A;  5FP4 A;  1QJZ A;  4YGB A;  3WF3 A;  5KHK A;  3A0N A;  1DQ1 A;  4BE3 A;  1UY3 A;  3LGR A;  2VTX A;  3LF7 A;  5DAQ A;  4YVW C;  3R4S A;  5A7Q A;  3WNO A;  3WVJ A;  4N7I A;  1W6O A;  2DTW A;  3K3N A;  5CA6 A;  2Y0O A;  3N9N A;  1S1A A;  1G9A A;  3G7D A;  1FAY A;  2B5H A;  4QT6 A;  1WCD J;  5FPA A;  4BXS V;  3AL5 A;  1RUI 2;  4V2V A;  2KR2 A;  3SCH A;  3CJI A;  2VZ1 A;  1LHO A;  4YM3 A;  1ST8 A;  2VZV A;  4BB3 A;  2PXJ A;  3U14 A;  2WFF 1;  4QPG A;  1SLL A;  2D6N A;  1NCQ C;  1B35 C;  4OI1 A;  4QXC A;  5T5J A;  4B1M A;  5DAB A;  3ETP A;  1FV3 A;  2QCS B;  2DCJ A;  2JE9 A;  5DAV A;  4AZZ A;  5A1A A;  3MF6 A;  4IND A;  3CQO A;  3RDI A;  1E5R A;  1VR3 A;  3DUI A;  2EIB A;  1US2 A;  4QU2 A;  4EV0 A;  2ADE A;  4DO0 A;  3M3E A;  5FRE A;  4YW6 A;  2RJ2 A;  2YZ4 A;  5CVR A;  5FP7 A;  3THP A;  1KIT A;  5A7W A;  3OF1 A;  1TMF 1;  2D44 A;  1ND3 C;  3BOD A;  5FY7 A;  3L2H A;  4ITC A;  4GWM A;  1VAM A;  3P3N A;  1XYP A;  2HBT A;  3DN7 A;  4L8Q A;  4FPL A;  4FTS A;  1DQ4 A;  4LK7 A;  3BPS A;  4MOA A;  3RYR A;  4LHS A;  2QNK A;  3HQR A;  5FUP A;  3T2T A;  4BYY A;  2WA4 A;  2JD4 A;  4F8A A;  4UOJ A;  1IG0 A;  2QE3 A;  4UFK A;  1HXS 2;  4JQR A;  4HFS A;  1BJQ A;  3ITQ A;  4IUG A;  4XYX A;  1WCS A;  3MW2 A;  1PIV 2;  3KCC A;  4QQL A;  2J1V A;  2RDS A;  1F8V A;  3FMG A;  3ZKU A;  5KC5 A;  1RGS A;  4BWO A;  3O7O A;  2FDH A;  2J1A A;  1RJ7 A;  2E63 A;  3ROU A;  1VRH 2;  3DF0 A;  1ZRE A;  3J26 N;  1HJF A;  1QJX 1;  2WKK A;  2AZ5 A;  2WAA A;  1AXZ A;  3IPV B;  4GUL A;  1LOD A;  4XET A;  4CSW A;  3S30 A;  5I8T A;  3TNQ A;  2V4A A;  4COZ A;  1NZI A;  4ES9 A;  5CIS A;  3NL1 A;  5FYB A;  3HIF A;  1SFN A;  3N35 A;  4E8D A;  3E97 A;  5K7P A;  4AFC A;  2QQV A;  3QD6 A;  4BQ5 A;  3OY8 A;  4HL0 A;  1C8M 3;  3I54 A;  3I59 B;  4CA9 A;  2R04 1;  3ZFE C;  1SCR A;  1AL0 G;  3LEK A;  2GNB A;  4O9G A;  2QDR A;  1GBG A;  2W08 A;  5FWJ A;  1Y3T A;  4QHB A;  1D0H A;  3ACL A;  1ACC A;  1DIW A;  1EAH 3;  2WAB A;  2Q0A A;  4QPG B;  4YGC A;  3DPR A;  2Y33 A;  3M3Q A;  2BPA 2;  2C24 A;  1QJU 1;  2BWA A;  2O0O A;  1ZZB A;  3VBU C;  4TTG A;  1L7Q A;  3R4U A;  1H0B A;  3MGU A;  5FZA A;  3MZH A;  2GC3 A;  3LA7 A;  1NLS A;  3VHR A;  1GUI A;  2VUL A;  3KHB A;  1GNY A;  3MPP G;  1RUF 2;  3AJY A;  4A6S A;  1H6Y A;  3RZJ A;  4KBZ A;  1YQ8 A;  1SBE A;  3QCW A;  1AJO A;  2ZAH A;  5L7O A;  2SLI A;  1YYN A;  2GDF A;  2YFU A;  1MVQ A;  1X36 A;  3KHC A;  3J8F 1;  3DKW A;  5FUI A;  5EJ3 A;  5C7G A;  1NCR B;  3LZZ A;  1XPW A;  1CQ9 A;  4MYE A;  4XDO A;  3WDU A;  1TME 2;  2VCB A;  4RQP A;  4CU7 A;  1H4H A;  2IXK A;  4EN6 B;  3UJO A;  1XOY A;  4CDW C;  4MSV A;  2PMW B;  5FZ0 A;  4UXA A;  1GP4 A;  5FYV A;  4QKF A;  1EY2 A;  3ON7 A;  3SH4 A;  3NV4 A;  4PF1 A;  5JSR A;  3AZY A;  3DXT A;  4MO3 M;  3P5B A;  4WM8 B;  1MS0 A;  3CIH A;  3WF0 A;  3ECQ A;  3ZPY A;  5KHJ A;  1CJD A; 
#chains in the Genus database with same CATH homology
 4CE8 A;  3DCQ A;  2VUC A;  2JDY A;  2BOJ A;  5A6X A;  2XR4 A;  2BP6 A;  1OUS A;  2VNV A;  5HCH A;  2BOI A;  1OVP A;  2WR9 A;  2JDH A;  5A3O A;  5A70 A;  5A6Y A;  1GZT A;  4AOC A;  1OUR A;  4UT5 A;  1OUX A;  1UQX A;  3ZDV A;  2JDM A;  1UZV A;  2BV4 A;  5A6Z A;  1W8F A;  1OXC A;  1W8H A;  1OVS A;  5D2A A;  2JDK A;  2JDN A;  2CHH A;  2WRA A;  2JDU A;  5A6Q A;  2JDP A;  2VUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...