5A6ZA

Structure of the lecb lectin from pseudomonas aeruginosa strain pa14 in complex with lewis a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTQFGVTAFANSAGTQTVNVQVNNETVATFTGQSTNNAIIGSKVLNSGGGGKVQILVSVNGRSSDLVSAQVILANELNFALVGSEDSTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LECB
publication title The virulence factor LecB varies in clinical isolates: consequences for ligand binding and drug discovery.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 23
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 5a6zA00
1UZVA 4AOCA 1OXCA 2JDUA 2WR9A 3DCQA 1OURA 2BP6A 2BV4A 1OUSA 5A70A 2CHHA 2JDHA 1W8FA 1OUXA 5A6QA 2VUDA 2JDKA 2JDNA 5A6YA 4UT5A 2XR4A 2JDYA 3ZDVA 5A3OA 5A6XA 5HCHA 2JDMA 2JDPA 2VUCA 1GZTA 1UQXA 1OVPA 2BOIA 1W8HA 1OVSA 2VNVA 5A6ZA 4CE8A 2BOJA 2WRAA 5D2AA
chains in the Genus database with same CATH superfamily
2CWSA 1ASJ2 2PLV1 1V9U3 4HK8A 4QKBA 2XPJA 3F2ZA 5HV0A 2ET7A 3CQOA 1GOFA 3U0ZA 5DAXA 3ZSKA 3AL6A 4IGPA 1W0PA 4CDQB 1W8FA 1GU3A 1HLCA 4O7XA 4ARYA 4AHXA 4LORA 1CJPA 4NIDA 3RZHA 2F17A 2FDJA 4YM1A 1Q43A 3WNOA 4XTPA 1XNDA 2WZR2 5D8AC 2KR2A 4CCCA 3CL1A 4RHV1 3RI9A 3WNMA 4A45A 4AR2A 3S5AA 4OCTA 1PIV1 5FP8A 1W90A 2OPKA 3P3PA 4MGIE 4YW3A 3ACGA 5GLTA 3ENRA 2IXLA 5ABJC 4P9XA 4MVTA 2BEOA 2C5DA 2V4AA 2ZKLA 4BJ0A 2GSYA 2WO1A 3EXUA 5FY5A 1OD3A 2D97A 4MLOA 1F8VA 3OYWB 5IT6A 3OUJA 2D3PA 3HMYA 4LQRA 1W8ZA 4IGQA 1BHGA 3POWA 4HXCA 3H8XA 4OUMA 4JKMA 1DQ6A 3RJ2X 1YQ8A 4XIKA 2ORXA 3ILRA 1XQNA 2WAOA 5FMOL 5FWEA 5FZMA 4M4PA 1HXS3 4A4AA 3PJYA 1CZSA 1UQXA 3J7NA 2R072 1UOFA 3KT1A 5AC92 2VCCA 1NCQB 1SFYA 1AL23 1FV3A 2QDNA 1H8TB 4GULA 1SLCA 4L2NA 4FXKB 3SHRA 2XJUA 3KF5A 5FPVA 3T09A 4UBGA 2XLFA 4CP9B 3EO6A 5C9AB 3MIEA 1G9FA 5A7OA 1YO8A 3OD4A 4CDXA 3WT3A 1DFQA 1I5PA 2W3JA 4UF0A 1TME2 3EJKA 1SLTA 4YG3A 4GWIA 3DYMA 2K0GA 4CCOA 3LFMA 1A6CA 4Q4X3 3VBHC 2F4LA 3O0VA 1ONAA 4F7ZA 1SMVA 1HRI3 3GJAA 4AQ2A 2O8QA 2VVEA 1J3QA 1LRHA 3R4UA 5A80A 4R9CA 4ORFA 5JOZA 5LATA 4CP1A 4LO6B 5IK8A 1UIJA 2B42B 2EXJA 2VNVA 3BPSA 4HKLA 3VD5A 1CAWB 3GGLA 1OLME 2G19A 1RJ7A 2VOTA 2G4IA 3E5XA 3GCWA 3ETPA 4YW5A 4AI3A 4N53A 3SMHA 3T2PA 5IFTA 1UZ0A 3ACLA 1HB1A 4JX0A 5IVVA 4F3JA 5DAWA 4EROA 3ON7A 4XQDA 2F6BA 4KGQA 3URFA 2X5IC 4C1XA 2D5FA 2BNOA 2CYFA 5FYMA 1GP5A 1OQEA 3RMYA 5I0RA 1PO22 3KHCA 4LLOA 4Q0SA 4AHYA 1PGL2 2A75A 4TXWA 3HEIA 2B46X 1LOFC 1VBA2 2HKXA 4PBOA 3J9SA 3KT4A 2QQVA 3MIHA 3HVDA 3GZEA 1VBB1 3ETQA 1ULDA 1IKQA 1KITA 3I2OA 5FLJA 2QQWA 2FD8A 2ZPXA 2HWB3 3SQOA 2ZGOA 4QQHA 1PGSA 3DKWA 4LA2A 2Z79A 4FPCA 1QXJA 1WGPA 2YC0A 2ZGUA 2R0FA 1CZVA 3GF6A 3Q8CA 4OLLA 5FZOB 3ZO0B 2P1BA 5CYYA 5FPZA 2EICA 5I8SA 3CIHA 1LHWA 1QQP3 1W9TA 3ACHA 4PHZA 5F2SA 3MO4A 5IAVA 5AVAA 3NV4A 1YEWA 4FXGB 2WFPA 3NSTA 5F3CA 1SLIA 3PVBB 1YIFA 3IIIA 4HMZA 4BLIA 4BMEA 4C0HA 1GQPA 3N9OA 4FI9A 1AR71 3PL0A 3VDDC 5F2WA 2PQQA 5FYHA 3VBOA 1JYNA 5KHHA 4NOTA 3OGJA 1LECA 4PT6A 1FATA 1C5HA 1TEIA 4JDMA 3BOWA 4OYUA 4YW1A 3SH5A 4BE3A 1YFWA 4BZ4A 4XXPA 4COVA 2XJPA 3E6DA 1QXRA 3VV1A 1OBNA 3D3AA 3JBG3 3NAPA 3LF7A 1ND3C 4RSUA 3ZX7A 2LM3A 3E6CC 2W1UA 4H3WA 1O4ZA 1O3SA 5FQ0B 1ASJ3 4QGLA 1RMU1 2DVGA 5GM0A 5A70A 1AYN3 1MVQA 1W04A 2QDRA 4Y22B 3R4DB 4M00A 1PHMA 2WDBA 3WVJA 2D44A 2GC3A 2RS31 3TEYA 1S4CA 5A3LA 5KBFA 1W6NA 2JG8A 2VH9A 1WW7A 5A7NA 4S2HA 3R6SA 2VNOA 4AGRA 4YZ5A 2VMGA 3LEIA 4GD4A 4YZ2A 4XFAA 1PVC2 3JUUA 1SLAA 1Q8VA 1STMA 4NR1A 1KS4A 3C2UA 4NE9A 2FCVA 3SCGA 4B4RA 4IEPA 1IHMA 1XSRA 2OQ6A 3FX3A 1LU2A 5F1RA 3C7OA 1VJ2A 2E63A 5EQUA 1VAMA 4AFMA 4AVTA 1XOYA 2W9XA 2ADEA 2D3SA 3VL8A 4I0AA 4L92A 1CWPA 2ZGKA 4Z2AA 2DYCA 1YWKA 3ZXAC 2VULA 3RJRA 1WCDJ 4PQ9A 3VGIA 4ZXKA 3RZMA 4EWAA 1QJX1 1QJY2 3B9IA 1O5UA 4LKEA 3QLQA 3PMEA 5FLIA 2BGCA 4XJ9A 3V65A 5F6KA 5FZIA 1O6UA 2WZPP 4NIAA 2X8KA 4COUA 1LB2A 1DZTA 4M0HA 4IE7A 3KS7A 1SPPA 3ELNA 1N1VA 5K4LA 5C9AA 4TYSA 2CY6A 3VDDB 4DEVA 1YI7A 4H2AA 5KXBA 2O0OA 4HSJA 3VD4A 2W47A 4B7KA 1QNWA 4YYOA 2YC4A 2C24A 3IBMA 3THCA 5A7PA 3VKFC 4CDWB 5JI7A 4QGNA 5CNAA 2WL1A 1H1AA 3PUHA 2CTVA 1I3HA 1V6JA 4IESA 3FLRA 3S7IA 1ND3B 2VOXA 1LOBA 5ACA1 3NKGA 4XDPA 4FCAA 3NKTA 2VQTA 2OVUA 4CCKA 3WP3A 1O5LA 4XXAA 1PIV2 3FLPA 2ZGLA 4SLIA 1DZQA 4DB5A 4EJRA 3VZMA 5C4WC 3FZ3A 2XJTA 5FJHA 1UXXX 3ZFFC 1FXZA 4D6RA 2FCTA 3RRDA 2XBO1 5C5UA 2MEV1 2YC2A 1SLBA 4CEYA 5IFPA 4AI9A 3MHZA 1OOPA 1GKBA 3WNNA 3VHNA 4AI8A 5A1AA 3OTFA 3RI8A 1I9RA 5JXHA 1E5SA 3V56A 5F8PA 5B4XA 4AI1A 2XJRA 3C8XA 2JB8A 2D6NA 5DPNA 1UNBA 4LEJA 5A3OA 4AFDA 4RGGA 1PO23 4K7JA 1PM4A 1OH3A 3OGRA 3ZDSA 1VBA3 3K51A 4AVAA 4CSWA 2BDRA 2EAAA 4D94A 2A7AA 4YVWA 5KXEA 4XF1A 4V1PA 4MHRA 4XUPA 4FOQA 1AR61 2IFRA 3UGGA 3IPVB 4MZUA 5JZGA 4Q4W1 4R52A 2HYKA 2R043 3WF1A 1S0JA 2I2SA 3SCHA 4LBOA 1E5RA 5JMCA 1ULGA 1EPZA 1MEC1 1QU0A 2VU9A 3M2MA 4UXAA 2JDKA 2QUOA 2Z42A 2DUQA 1QJU2 1Y43B 2WNVA 4GMP0 1K5MA 5LA2A 4YSFA 2YXSA 5T5PA 2XONA 1D0HA 3MEPA 5CFCB 3C7GA 1NAEA 4Y20B 2VR4A 1TQ5A 4Z8BA 5FXXA 4RS5A 1EAH3 3VBRC 1D4M2 1YLLA 4AEDB 4AXOA 4XHXA 5F3GA 2WS93 4IEYA 3LZZA 2E31A 2ZX2A 5BNNB 5EXOA 3N9MA 1R1A2 4CDUB 4QPGC 3DPRC 1O3QA 2VW0A 5CEHA 3U07A 3U75A 4BQ4A 3KVBA 2JD4A 3PUIA 3ITQA 3NW4A 4RR3A 2ERFA 3ACFA 1PO11 1BZWA 2K46A 2DUOA 3WR0A 1IKPA 3S0MA 2QVSB 4UI9L 2VTXA 2W52A 1QGLA 2Y0IA 2FDHA 4DOUA 4L97A 2VBPA 3VDCA 1M4WA 4J1WA 4GB33 5AVPA 2C6SA 1S2KA 4GXLA 5FYBA 2RR12 3T0BA 4W50A 1YJLA 3TWIA 2DF7A 4E9KA 4EWDA 2AACA 4AF9A 2XKOA 2YG0A 1AXKA 4ES9A 1H2LA 2GMEA 2YBSA 5FOBB 3WG2A 3MFAA 4E2GA 1VE0A 2IXIA 4LBKA 5BNPA 4WZFA 2IXJA 3H1WA 4QQOA 1ZZBA 1XNAA 2HWE2 3UNPA 4OULA 5BNOC 2GC0A 1IOAA 4RN5A 4Q4V1 4X8PA 4XOGA 1WW5A 4N9HA 5IHRA 5FZEA 1FMD2 4DY5A 1EV11 1RUC1 3OEAA 4XF0A 1GANA 2F4PA 3P3NA 1QXPA 3FN9A 3UJQA 1C8M3 4NRPA 4Y1YA 5CISA 3IT8A 4GALA 1MS5A 4IV1C 1YQ2A 3ZFEC 4HVQA 1VALA 5BUVA 1AR72 1V6IA 4JC1A 4EN0A 1JI6A 1MVEA 4Q29A 3AKTA 3D8CA 5IVCA 2EIEA 3POIA 1LENA 1NOVA 1YYNA 3RWNA 3PTRB 3ST7A 2PN5A 4EN9B 2DCTA 4QKDA 3WEZA 1W9FA 2V73A 3VBRB 1VMFA 2E6VA 2Q30A 4G3YC 2AREA 4Y5TA 5FXZA 3ZSEA 4B1MA 2C4XA 4WM8C 3WDXA 3ZYJB 2D7FA 2PLV3 4N43B 4Z1VA 1FNZA 1ZA4A 2ETEA 5I93A 3NRUA 1QJEA 3R4SA 3KCXA 4W6WA 1O8PA 3PJQA 5HPOA 1W3VA 1YI9A 2BUKA 3EHKA 3WNLA 3GHMA 5CKQA 5FZ1A 5L19A 2RS32 2QBXA 1ENQA 2DVFA 2QZ2A 2NLRA 3LSDA 4IEZA 4JHZA 5HCBA 4AWDA 2E51A 3VZJA 3ZKYA 2JG9C 2WWJA 4RHV3 4CEWC 3N9LA 1N3QA 5C6CA 4IQPA 1LGBA 1OVPA 1PIV3 3AZZA 3PVNA 5C8CC 4PIXA 4UFMA 4EN6B 1S0CA 4QKFA 4CP0A 1LR5A 3MV11 3ROUA 3PUQA 1BCXA 1S0DA 1FNYA 3ZPYA 4HN1A 2BERA 3SH3A 3WINE 2JIGA 4Y5Z0 1KFUL 2W39A 5FCCA 3RZKA 4NJ4A 1TMF1 3POSA 3UESA 3VHOA 1AR81 5BNOB 3D5OA 1RUG1 1UYZA 4OVEA 5L7OA 2X05A 5CFDC 1QJX2 1UU4A 3PVEA 5C70A 1MPXA 3I2JA 3SEPA 4AL9A 4C90A 3ZFGA 5LY1A 2JDMA 3WDWA 4DUWA 2WQ8A 1BVP1 2HLEA 1U5XA 3UKNA 3DYPA 3OY8B 2WNUA 5FYVA 2XLAA 3AYDA 4IV1B 3ZFEB 4YM3A 3AKQA 4YGCA 3Q8BA 1JYVA 4A7KA 3AYEA 3MI8A 1HRV2 2QJVA 3GHNA 4JGYB 1CX1A 1RUE3 2VMCA 1H1IA 2XLGA 3KV9A 1C8NA 1W0OA 3DKQA 4L9BA 5ACA2 5C3QA 2VUDA 1G9BA 4LO7A 4QQPA 5FBJA 5A32B 1SCSA 5T50A 3LGRA 4FBFA 1QY4A 1WWYA 4DS0A 1BBT1 2P2KA 2HWF3 2VNRA 2WZR1 4O65A 4L0PA 3MPPG 2Y6HA 1LEDA 3H3LA 1KD7A 4E4SA 2JG9B 4YFWA 1PVXA 2XBO2 1CQ9A 5E1RA 1W6PA 1XNTA 2LRPA 3M3OA 1B35A 2PXJA 1J3PA 2QQOA 3LDRA 4HPKB 4FFFA 4MOAA 5FY7A 3FE5A 1PX4A 2VQUA 2HWC3 5ERLA 4IEWA 4PI0A 2PYTA 4XUNA 1X9PA 1DGWX 2R061 3PUSA 4QWNA 4UFJA 2QCSB 5C8WA 4FP3A 1N47A 5GLVA 5BXXA 4ZS3A 1RUH2 1GWMA 2GH8A 2JDAA 2P6CA 2JDPA 1PX3A 2VUJA 2XJSA 3HT1A 3MLKA 4I30A 1JBCA 3ZYIB 1RUJ2 2R071 2UY8A 4XJ8A 3WY6A 5AC91 2VD7A 5J96B 1G9DA 1VBB3 2DDUA 3ALQA 4Q4W2 3MBWA 4ASKA 4TLFA 3OUIA 3V0BB 1OURA 1S0GA 5FZGA 2FCUA 1VBE2 1QDCA 1TME1 2CNAA 2YPJA 3USUB 5JXIA 2B7YA 3T4HB 1LHOA 1AX1A 3RMXA 3WQ0A 1PMIA 5ANQA 1DQ1A 1E57A 4WVMA 4XFCA 5T54A 5LZ6A 3VZOA 5FO8B 2ID4A 1AR73 4P9JA 5DZEA 3DV8A 3JU9A 4MGSA 1V6MA 1OPMA 3B5LB 4QPIA 3GZAA 4AAXA 4CDXC 4CP2A 2IVJA 5DZFA 5JDBA 1VBC2 1NLRA 4N43A 1QWRA 1AJKA 2OZJA 1LJ7A 2XH6A 4JDNA 5D2AA 1TNRA 2DBIA 4XURA 5CAZA 4OHYA 5LB6A 4ZU7A 1PO12 3HD8B 4LHKA 2VW2A 5FXVA 1O7FA 1RVF1 2EAKA 3P5BA 1H8VA 1RMU3 4BB3A 4UT5A 3OBTA 4P9LA 4B4PA 5C5TA 4XC9A 1NT0A 2NM1A 4GH4A 1HV1A 2E7QA 2RS33 3CKHA 3NV2A 1A8DA 2Q1ZB 4AEMA 4UYBA 4E27A 4NHXA 5A3PA 3AMQA 2WFF1 2PTMA 3W5MA 3ME2A 2HEVF 4QX8A 1JYWA 2VAUA 1H30A 3OUHA 4FPOB 4N53C 5FLHA 3ECQA 4CZSA 4MG2A 2RS13 4LJHA 4YW4A 2IXKA 2H0BA 2VOKA 4GWJA 2ZX0A 3W58A 4I2OA 3FLTA 1RUC2 4YM2A 1N1YA 1RJ8A 4PF5A 3MIGA 4E8CA 3HQXA 3MDPA 1MZFA 2RDSA 4M3CB 2D6MA 2ES3A 1XU2A 3FL7A 4NHLA 4PIZA 5A7SA 4MGYE 5EIYB 2OUHA 4IDZA 5FZ0A 1QHDA 4PI2A 4RGAA 3V0AA 1QJX3 4XDQA 1BEV1 3DN7A 5FV3A 3CJXA 1VBD1 2E7AA 1BJQA 5J3UA 1IS6A 2KA3A 1GZTA 3TN91 3KT7A 1BK0A 3KZ4C 4NMIA 5DMYA 1S2EA 5A33A 3AX4A 1W3XA 2FBEA 1ZNPA 2B9VA 4S2DA 1JOPA 3LKJA 2ZGTA 2X09A 1W9YA 4FTEA 1NYWA 3LD8A 1PK6A 4QDQA 2VM9A 3N35A 5LRRA 1UZVA 2RM22 3L9JT 4E4HA 5FZLA 4ES8A 3HWJA 5LASA 2HH9A 3BOPA 4BK4A 3GBFA 1ND2B 1ZBA2 4FOWA 4RGKA 2L9LA 4XZPA 1ZZ6A 2XB6C 1WCSA 4IEOA 1UO9A 3KV4A 4FFGA 4XFFA 2VVDA 5ACA3 3L2YA 1IGOA 2E26A 4OHWA 2HWD2 4BYYA 1KJLA 3VBOC 3WDUA 4FPEA 4XF3A 4DUVA 1KGYA 4XBLA 5K0UA 4CUBA 5BYNA 3FBYA 3N9PA 1D2SA 3MUZ1 4QKNA 4OI1A 1XE7A 3AFKA 5JOXA 5FYZA 1RUF1 2JD9A 4HPKA 5LCWL 3PUAA 1FOD1 1PVC1 4IV3A 1W2AX 2QQJA 4BQ3A 4TLGA 3U10A 1OKQA 2XBO3 5IVEA 2W94A 4QHBA 1FT9A 4BISA 1AR82 1HB2A 1PZ9A 2MEV3 3H3UA 1FV2A 1C3HA 3V64A 3QACA 5KC5A 1HJFA 1DQ0A 4JGZB 2SLIA 3OGVA 4GZ9A 5GJ6A 1J1LA 1KEXA 4FAHA 4AVVA 3AKSA 3PIJA 2XUMA 4M4RA 1CAUB 1Q8PA 3VB9A 2V4VA 3VD3A 2Y6GA 1QJY1 2ZACA 1UCXA 3SKJE 5A3MA 1NA1C 4PJYA 2VPVA 2MNGA 1UYYA 2LTNA 2Y38A 1QIQA 4XCBA 3THDA 4P9IA 1Y9QA 3QCWA 4UW6A 2OX0A 4A7YA 2ZX3A 1XYNA 2Y6LA 2AENA 1AR63 4ARXA 3CU7A 3IDEA 1T2XA 1MS4A 4Q4W3 3D4KA 3J7HA 1AYM1 4BQ1A 1C1LA 1SQ4A 3CO2A 1MEC3 2W95A 2Y6JA 3LA3A 5FPXA 1F9KA 1JS9A 3VD9A 5IK5A 1CAXB 3MZHA 2UWAA 1MS0A 1S1AA 2VZ3A 1V6LA 3H1MA 5EPAA 5GKAC 1BBT2 1OFSA 3AMNA 2QE3A 2ZJCA 4IE0A 1M06G 3LQCA 3N36A 2A3XA 5I0SA 2C9AA 4GJYA 5FRAA 1OFNA 1UOJA 2O1QA 1RTVA 5FWJA 2ARAA 1T6GC 4A41A 1RL3A 3Q8AA 3G7DA 2NYYA 4HOOA 4W8JA 5JIAA 4CE8A 5J37A 1UYXA 1SFNA 5F5IA 3VBSB 2D6LX 2GP3A 3GBWA 5IK7A 1K12A 2PELA 1OPOA 2R062 2AUYA 3C7EA 1C5IA 1YNAA 3AP6A 4Y4YA 1PO13 4ZONA 1OA2A 1K42A 3I3MA 2CDPA 2BFUL 2JB4A 1UAIA 2CU5A 2ATFA 1U5ZA 2GN7A 1AXYA 2DCJA 2ZAAA 3J26N 2EF6A 1GWLA 2W1WA 3KM5A 5SV8A 5T5OA 3WP6A 4BXFA 3NVCA 2HJIA 1R081 2VZSA 4NPLA 4M3CE 3HQUA 1GNHA 4QDSA 2VZUA 3KGLA 1DGRN 5F7UA 1BYHA 1DF0A 3U4SA 5FR3A 4PLNA 3POJA 1NA1B 4YW6A 4CEYC 2XHKA 2BOJA 1OOPC 3OF1A 1HX6A 4Q4V3 1DU3D 4LBQA 2FHRA 1CVNA 2Q0AA 5JPNB 1EV13 1RUC3 1U5YA 3N3HA 3NJYA 3VKOA 1AL0G 4UBHA 5J1XA 3HNBM 5EJ1B 5I8TA 5LBFA 2A6YA 1EYBA 2W68A 1UD1A 4AGGA 4DY3A 3NJZA 2I74A 3LIGA 4GMP1 1QJU1 4UW5A 3WOGA 3HN3A 4K9SA 4YVWC 1KXGA 2X53S 2BOIA 3AC0A 3LFIA 2VZ1A 5D8AB 3A22A 4ZY9A 1JH5A 1D4M1 3CZUA 2N7GA 4ISRA 4AEJA 4CPBA 5JZGC 2VL4A 3VZNA 4AQ6A 3BALA 3JD72 4DRVA 1JZ8A 1OI6A 1ND2A 1R1A1 1RC6A 1KS5A 1VAKA 1W6OA 1W99A 2A71A 2OA2A 3R05A 4URTA 3UT0A 5ABJB 1G8WA 1RVF2 3JB8A 3QH6A 2WNVC 4FPLA 4LUKA 4FFIA 1K5MC 2AYHA 3LE0A 2XGXA 3H8UA 4QXCA 2DTWA 3FFZA 3IM0A 1SBFA 4QX2A 4XAAA 2ZHKA 4HFSA 1I1EA 2Z4FA 1ENSA 4OMCA 1IQAA 1OA4A 3M3IA 1EUUA 4RS5C 1OLMA 3ZN4A 1GOGA 1PZ7A 4YRDA 5FAXA 1S0IA 2QQIA 3K3OA 4OHXA 4AE2A 3ZVXA 2Z5WA 2WFF2 3DF0A 3ZM8A 1FPN2 4DXSA 1ZBE1 2VJXA 4U36A 1SACA 3SH4A 1A34A 2RR11 5I8YA 1XE8A 3AB0A 5FREA 3OEBA 5IK4A 1G9CA 3VD7A 2Y64A 3INAA 4BQYA 3AMMA 4PDWA 1CAVB 2DFCA 2VMHA 4ZU4A 1D7PM 2HWE1 5DZGA 3J8F2 1V6KA 1OKOA 1S0EA 4JGZA 1YQ6A 3A0NA 5HCFA 5FYYA 1TMF3 2Y34A 1OUSA 2AC1A 4LBMA 1AR83 2JX9A 4WM7A 5FZAA 1RUG3 4U2AA 1FMD1 1X33A 3TEXA 4DXZA 5KXCA 5BPXA 1WCUA 3WW4A 5ISLA 1F2NA 2XR4A 3WZ1A 1BEV2 4H55A 5GZFA 4H7MA 1VBD2 4RQPA 2FDKA 1RHI2 3TN92 1XYPA 3VBHB 3GZTB 2DFBA 3OJBA 1GNYA 1OT5A 3ZN6B 1KRIA 2WSVA 1BKZA 3M70A 1MQTC 5JOYA 4FPHA 1UKGA 3WG3A 3KGZA 3RZLA 3FMGA 2C1FA 5DUUA 4LIUA 2VOWA 3B94A 4QMAA 4V2VA 2WRAA 4XJUA 4D0QA 3O1OA 2KXLA 1SEFA 1HDKA 4MXWB 4CDQA 1LU1A 4LR4A 2GMPA 1HW5A 4L8QA 2VO5A 4I3PA 1W8WA 1ALYA 4HKOA 5IWFA 1IQDC 2EA7A 3TRSB 5FIXA 2Y60A 3T1LA 1ULPA 3CLPA 3IN9A 2DVBA 2O14A 2X5IB 3N7LA 2YY1A 1Q3EA 2WN2A 1BBT3 2H0VA 2WZR3 4JHTA 4QDRA 4YVSC 4FT8A 1BMV2 1RUF2 5C3RA 1JODA 3PMSA 1DIWA 1FOD2 2XVLA 5IVJA 3GNEA 5T52A 2BBVA 1CIYA 5C71A 1DYOA 1VAVA 3VZLA 3OYWA 1SDWA 1ZREA 3MLJA 1AVBA 1CPNA 4DFSA 2WC2A 3VBFC 3A23A 3LSEA 1ULFA 3NO8A 1GP6A 2VECA 3OSDA 4BXSV 2QQKA 3TB0A 4EN8B 4ZS2A 1POQA 2PA7A 5L9BA 5E8AA 3VHRA 5K7PA 1JTZX 3B00A 3E1F1 3MW3A 2J42A 3N9QA 2D6PA 2R063 2WYFA 4UOJA 4COYA 2FDGA 1IPSA 2PHDA 1NLQA 1WMFA 3VBUC 3PVOA 1DQ5A 1NCQA 1H8TA 4CP9A 2ZMLA 4Q26A 4LOTA 4I01A 4CCDA 3F95A 1O91A 5A3UA 3LPFA 2R073 5AC93 4W4ZA 3HOBA 3FHIB 4A3ZA 1AYM2 5CU1A 4BIOA 1DQ4A 1GMMA 1HRV1 1GLHA 3B93A 3WF2A 5JCTA 2DWRA 5F3IA 2PAMA 1ZRRA 3DGTA 3AXEA 4PLMA 1H4HA 2W1QA 1TME3 5FZBA 5JXGA 2WYSA 1US2A 2V72A 5FZ7A 4K21A 2YFZA 3K4ZA 3WG4A 2WNUC 4MGQA 3UJOA 4KMQA 3MICA 4HN0A 2R1DA 4LA3A 4QGMA 3SISA 2FZ2A 4BH9A 4NUBA 3HBKA 1QNYA 1BQPA 1CAWA 1W8HA 5DDJ1 1VB4A 5JOWA 1QDOA 2OXBA 4YVSB 1ENXA 1TZOA 5IATA 2VCAA 4R9BA 4TTGA 1W8UA 2R32A 1CESA 2WSUA 1F15A 1UU5A 3VBFB 1RVF3 4AHWA 4BDVB 3WP4A 4GQ7A 4S2GA 4UFKA 4Y3OA 4XYXA 4EZ4A 4G9SB 3POBA 4XAEA 1W39A 3NNFA 4QHZA 1QEXA 5IJRA 5LK7B 1VRH1 4XF9A 1HN0A 4IEVA 4AK3A 4HG6B 1R082 2GN3A 3IMMA 4XE9A 5C3SA 1RUD2 1CPMA 1RUH1 2VMDA 3AK0A 2G9FA 1XSQA 1B35C 3VBUB 1JYIA 4IUGA 3NNMA 1ZVFA 1HB4A 1RUJ1 5E88A 2R7EB 5F3EA 3O1RA 2RS52 1UU6A 3ZR6A 2WNOA 5FZOA 3ZXJA 3MYXA 2VNGA 1GP4A 1J59A 2QNKA 2W08A 4HANA 3K3NA 3AZYA 5T3NA 5A3TA 2W0XA 1UX6A 2W91A 1VBE1 3KWVA 2RV9A 5FP9A 2VTFA 3HR9A 4CU9A 2VMFA 1C1FA 1BEV3 2VTXJ 5FUNA 5JR7B 1VBD3 3ZPOA 3ZMNA 2GNTA 3TN93 1CZTA 4MUVA 3QBQA 1W6MB 5A7WB 3JCIA 2B4KA 4DXRA 4AFAA 1RUOA 4MGTA 3BODA 2CGPA 3GZUC 1F5JA 1KDMA 2W87A 4XPVA 5FQ0A 4LTAA 1RINA 1UY1A 1VBC1 5C4WB 5F5QA 2I45A 3ZFFB 1DGWA 5A1FA 3UKTA 4Y22A 2BV4A 5DQ0A 2WLQA 3FJSA 5KXDA 5L9RA 2JE7A 4DIQA 5JWPA 2WA3A 4Y4RA 2A3WA 4KWUA 1GZCA 1W9WA 4CCJA 5DAVA 1NCRC 4LK6A 4XHBA 4WZCA 1ZBE2 4IERA 5BNQA 1RITA 3LPGA 3WSOA 2ZABA 1H9PA 1Q8SA 4NN0A 1LOFA 1QMJA 3I97A 1ACCA 4CXXA 2J1RA 3RGBA 4EQVA 4YGEA 1X8EA 4Z92B 1RUF3 2ZEWA 3B69A 5DXDA 1FOD3 1PVC3 4LNVA 4IEXA 2ZHLA 2GMMA 5C3OA 4PQQA 3NWKA 4FFHA 3D6EA 3U4XA 1DQ2A 3VDBA 3RYKA 2VXRA 1J83A 4S2FA 4XEZA 4Q5OA 1GZWB 4GH4C 2YPDA 4BPZA 5B2GB 1X8MA 2BRTA 2ZGQA 4NWVA 4P14A 3UGHA 5FO9B 2Y0OA 3MF6A 3WP5A 1N1SA 2R0HA 1WLDA 4OQ8A 1W6QB 2QQUA 3BPZA 1QJY3 3BU0A 1LOEA 2G1MA 3M3CA 3ORJA 3VDDA 1VIWB 3SCFA 1POV0 2XWBB 4E4DX 4EZHA 2D6KA 4MADA 5DUXA 4CDWA 1QH6A 1YQ5A 2VVFA 3MPBA 4LKFA 2FQPA 1W06A 2ZGRA 4QPGB 3DPRB 1ND3A 2EXKA 2RM21 3W9AA 3ZYGA 1AYM3 4TSVA 5EJZB 1REDA 2JDHA 4MYEA 4XJAA 1ZBA1 5FPBA 2Q8OA 3KCCA 1UL9A 4IW3A 1LHUA 2D5HA 2VBDA 5D21A 1UW8A 5GLZA 4LHNA 1UY2A 4D7TA 1WBFA 3NJVA 3Q9OA 2HWD1 2B45X 1SFPA 1RIRA 2ARCA 1UZYA 3O0WA 4QX3A 2J1UA 1NY71 2OIIA 4NHMA 1P8JA 1NCRB 4X8NA 3LA7A 4JDOA 2B8MA 3ZSMA 5L36A 4KU7A 2IC1A 3ZXLA 3ZR5A 3KCYA 4YFZA 3ZYBA 4C0BA 4D3WA 2K2SA 3GBGA 1L7LA 2AZ5A 4COWA 4RA0A 3G6JB 5GLUA 4XVHA 3TNPB 4E2SA 4HL0A 4W65A 3U14A 3HBZA 2ZKNA 4Y33A 3I2FA 4XFGA 2AGSA 2R1BA 4W6YA 5JAXA 2P17A 1AXZA 5K0UC 1VR3A 1HB3A 4RFRB 3RVHA 4TZDA 3ES1A 1J1TA 2Q8EA 1SCRA 1US3A 2BTVC 2JEMA 4C8DA 4A3XA 1OVSA 4OMDA 3M1HA 3WQBA 4MX3A 5CIRA 4HK9A 3IPVA 1LKNA 3I59B 3IB3A 4LO4B 5CVRA 1JMUB 2JENA 3ABZA 1HQLA 5FMOS 1CONA 1YQCA 1URXA 1VLNA 1LGNA 3H9AA 2CHHA 2ZOEB 4WM8B 1NZIA 3AFGA 1EUTA 1N3PA 3CJIC 4LXLA 2LW8A 4R9AA 5KHKA 3WW3A 1QOOA 3DECA 3ZOIA 3ZXDA 5DUWA 1PGW2 4Y20A 5CFCA 4XUTA 4I09A 4R9DA 4AEDA 2E32A 4OHZA 4INDA 4GMP3 1QJU3 2TUNA 4BMBA 2DCKA 4LMFA 4CU8A 5BNNA 2G9GA 1EPWA 2BPA2 4MXVA 2WWSA 5DDJ2 4CDUA 4CPBD 5EFUA 2GC2A 3T2QA 1D4M3 2XVGA 4LIVA 3KV5A 4OI4A 4CEWB 1LAJA 1Q56A 1MACA 4D7YA 1SG3A 4KH9A 3TOJA 3ZFFA 5LA0A 1R1A3 1OXCA 5C8CB 1O59A 3H7JA 3TEZA 4QM8A 3K75B 1UKRA 5C7GA 4YNIA 4Q0PA 2PHTA 5F39A 4FOYA 3ACIA 4YZ1A 3M8LA 5H9SA 4NIGA 2BZDA 4K3UA 1UXZA 5C3PA 1VRH2 1GYKA 1V6NA 1QOTA 4AEKA 2P3IA 3IDBB 4XABA 4CA9A 1ULCA 4X6QB 3LA2A 3VL9A 5CFDB 3TYJA 2WABA 1GWKA 4QXHA 5CBLA 1ZBE3 3PDQA 5IVBA 2RR13 1JZ5A 5GZGA 2ZA9A 5E6HA 5HXMA 4CRQA 5D1IA 1O4TA 1O8SA 2V5YA 5FPAA 2R30A 2RDQA 2YROA 4J1XA 1J3RA 3S7EA 5FZHA 1GZWA 1VRBA 3O7OA 1K45A 1G6NA 2HWE3 4HT1T 5LY2A 2UYBA 4CU6A 1WW4A 1H2MA 3POEA 4EWEA 1Y4WA 1QJZA 4W6XA 4XFIA 1JXNA 1JN2P 1UOGA 1H1MA 3ZXKA 1FMD3 2MPFA 4JRLA 4EN7B 5A1LA 5J48A 3T4VA 1XC6A 4K40A 4IEUA 4JTOA 2VCBA 4KBZA 3KMHA 4FPYA 5A7QA 2O8OA 5FYIA 3ZYHA 4CCNA 2P3KA 4A7ZA 3CJIB 2ZEYA 1VB2A 1NX9A 3WUDA 4ZZ8A 4Y1UA 1XNBA 1JHNA 3WF3A 5C33A 5FOJB 1VMJA 3VBRA 4OQ9A 2GAUA 4JTNA 4K8RB 3WF4A 1H9WA 2YBPA 1O3RA 4TN7A 3WDYA 4AHZA 2J1AA 2GDFA 1ZRIA 4BA6A 1T6BX 4DINB 1F35A 3JD71 2Y6FA 2ENRA 2OUJA 3D0SA 2BVBA 2WT1A 3RYPA 4KWLA 3TAYA 3QD6A 4XMAA 3DUIA 1IZ3A 5FYSA 4DXTA 3KV6A 2CGNA 3LEKA 4Q27A 2HBTA 3WV6A 4XZUG 3ZIXA 5I0UA 2VZOA 4Q0QA 5HXVA 1NQDA 3BCWA 3RQ0A 2P37A 3WQ1A 4D6QA 3OD0A 4R8HA 1V6OA 2GU9A 3C7HA 1IS4A 1FPN1 4PBPA 5I0DA 3AP9A 2SBAA 4NHYA 1HQNA 1MS8A 4LKSA 3IMNA 3OCPA 3PU3A 4AOCA 2J1SA 3VZKA 5BNOA 2HYXA 2HEYF 1WKYA 2XXZA 3L2HA 2YU2A 3J8F1 5F5CA 1C57A 4BLJA 3WXPA 5L9VA 2QZ3A 2AEYA 3RWKX 4E8DA 3LIHA 3CF6E 3OY8A 4QQLA 4NWWA 4P9GA 1QOSA 4IV1A 3W59A 1Y9GA 3ZFEA 4FPJA 2XQXA 4FSJA 4NROA 2JDZA 4K1ZA 2VZVA 4QB1A 1RHI1 3DL3A 5E89A 3U11A 4LPLA 4P5HA 3I59A 2OKXA 4PDWC 4IEQA 3D82A 4QT6A 4N8MA 5A6ZA 5AFEA 4D6SA 4XILA 5CKMA 4K8FA 1ZZ7A 4JGYA 4WM7C 4OHVA 2CSGA 1VMHA 2VG9A 4Q4X2 1IG0A 2WNEA 4AFBA 4CDXB 4CVUA 4FTSA 3PNAA 2A6XA 1RXGA 3D0JA 4UF0B 1HRV3 4D69A 1MS3A 4D8MA 5A32A 3PHMA 4XDOA 4AVCA 2VZPA 1Z0HA 5FZDA 5IAXA 3S5QA 3BTAA 3THPA 2ZEZA 5LWBA 4NHKA 3U37A 3MIFA 1NY72 3O1UA 2JE8A 2JG9A 3PTYA 4AG4A 4Z2WA 3AZXA 4R4ZA 1UY3A 1GR3A 4O9EA 4Y1XA 3MIBA 1SDDB 3NAPC 3T1MA 1BMV1 1XXNA 4CDQC 4CXYA 3AZVA 2OT7A 2HEWF 1HQWA 3PURA 4E2QA 4BQ5A 4XUOA 3POFA 3IIAA 5LBEA 4N53B 2EIGA 1X50A 3AJZA 4IE4A 4XACA 2RMU1 4CCLA 4I0WB 2J7MA 3DYOA 2VZQA 2A70A 3KB5A 4ITCA 2XOMA 5EWSA 3KLSA 4BQWA 1LNSA 5HI0A 1ZRFA 4NPMA 2JG8C 2VBBA 2VXJA 2A6ZA 3J7LA 1VRH3 1UPSA 2W92A 2D3RA 2XHNA 1YJKA 3LAGA 1RGSA 3NJXA 1UZZA 4IE6A 2DVAA 4Y24A 1UWWA 3I54A 3RZGA 1RUH3 2ZX1A 4LHLA 4ET7A 5DG1A 4LLFA 2QQNA 1L7RA 1JOJA 3K4AA 3EBRA 3NMBA 3WLUA 1W2NA 4HETA 1RUJ3 4NAMA 5JMOA 3V0BA 1L7QA 4SBVA 1QQP2 3M3QA 2BYVE 4Q4Y1 5FP7A 2ZEXA 4Q1RA 2BP6A 5FYTA 2WAAA 3K4DA 2ZGSA 1AF9A 3USUA 1FAYA 5A6YA 3RS6A 5K9YA 1N3OA 3LEMA 3TEWA 4MGKE 1NCQC 4IGOA 1VBE3 2P3YA 5FXWA 3T2TA 1CX4A 2VC9A 2XJVA 2W5FA 4P9WA 3T3YA 1GOHA 4WVWA 1A78A 2WUHA 3AKRA 3HPNA 4KG8A 4P5YA 5FFOC 5IUQA 1K5JA 3ES4A 2XUEA 2YDEA 1JOBA 3LEGA 3Q8FA 4UFLA 4LO8A 5C9AC 1UMHA 4CXWA 4JZRA 5M0TA 3O12A 2ARBA 4ISQA 3VBOB 3WHUA 1BXHA 1JZ7A 1APNA 1PM7A 4Z82A 2PAEA 3RDIA 4CTEA 3O1PA 1DLCA 3W5NA 4LHSA 1MS9A 3NV3A 3IAPA 3SLIA 1AYN2 1W0NA 1JHJA 2YGMA 3BIWE 3KHBA 3KQRA 1VBC3 3MFCA 3NAPB 4JKKA 2EXHA 3M7AA 3GM8A 4IL7A 1CJDA 4N90A 1O3TA 2J22A 3HNMA 1PZ8A 3WNKA 4O9GA 2BW8A 4KG0A 4YM0A 3N4MA 3RZZA 4AFCA 3S30A 2YHJA 4QX7A 4UAPA 1W8NA 2I07B 1W6NB 2JG8B 2WO3A 4XTMA 5F32A 1MZ5A 1JYTA 1RUD1 3IWZA 4CCMA 5IYYA 1COV1 5LBCA 1WLWA 1TG7A 3GYDA 3I3DA 3BGAA 3P1IA 3I2DA 1QKQA 4DMIA 1ENRA 2LUWA 1R1ZA 5FJKA 3DCQA 3KVAA 2IZWA 4NPRA 3OB8A 2RS51 4M3CA 2WN3A 1IS5A 1V00A 4H7LA 3MV01 4MSVA 5BV6A 4Y1VA 3E5QA 3O0XA 2ZGNA 4K1YA 2NPIA 1E5IA 2BNNA 3O1TA 3N9NA 4M3CF 2XJQA 1LOAA 1YC61 1W9SA 1WLCA 3FFQA 1AR91 3AZWA 5TSWA 5HCAA 1YFUA 1J84A 1SPPB 4LOSA 3POGA 5J09A 5LEJA 3T2OA 1RUE1 4A2UA 3LOIA 2GP5A 4LT5A 4V2WA 2A73B 2OW4A 3OGGA 1X82A 2PAKA 2YGLA 4DO0A 1C4RA 4LO5B 2ZXQA 2RM23 2VQAA 2X29A 2B5HA 4J25A 4ASLA 1ZBA3 3SKVA 1SLLA 4ZPIA 2Q1MA 2HWF1 3I49A 4FOVA 2Q8CA 4B8EA 4Q2FA 3K46A 4JAAA 4Q0UA 2HWD3 2OS2A 1U5IA 4IE5A 2IXCA 1D4VB 1ZYBA 2KM2A 2XDVA 2IXHA 2RDNA 4IXLA 3BB6A 1D0GA 3B02A 3FC0A 5LEKA 5T5JA 5GZDA 1ZRDA 4RR3C 2JDUA 2HWC1 1WBLA 2WBKA 2ZZQA 5L73A 3BUCA 1WD4A 2GZWA 4CEYB 4YG0A 4GJZA 1DG6A 4IETA 1OOPB 1CAUA 4MGZE 5IVYA 2VOVA 3B01A 1S0FA 4XW3A 1JUHA 2PHXA 4DUXA 2Y26A 3H1YA 4L11A 5FZCA 4YG6A 5FKCA 3U1XA 5BNPC 3FHAA 4WVVA 3UK9A 5F37A 1XYOA 2YZ4A 1DGLA 3UGFA 2D43A 2RVAA 4XMIA 2RE9A 4Y5SA 2R16A 1W03A 2R042 2RJ2A 4YVWB 1Z7S1 1POV1 1JU4A 2QQMA 2OQ7A 4FTBA 3MW4A 3SXWA 3BN6A 3UETA 5JZGB 1CAXA 3QH7A 4JQTA 5J36A 1RUI1 2GALA 3JQXA 4XJZA 1YIPA 2UWBA 2Z2SB 3EYPA 3IDCB 1AHSA 1EAH2 3KSCA 3AYAA 4DRRA 4HSLA 4LBLA 2WNVB 2WS92 1U0AA 2Y6KA 1K5MB 3J4UH 4BU2A 1YXWA 1WMXA 2JXAA 2WA4A 3NNGA 1OHFA 1WD3A 1WW6A 2BJSA 4YGDA 5E16A 4YW2A 5FYCA 3UYJA 3VKMA 3IAQA 4RS5B 5A3WA 4KNCA 4CDWC 1YCIA 4YARA 1AJOA 4LE3A 4RYDA 1RYYA 2W46A 1J58A 1OA3A 1QJFA 2ZAHA 3VBSA 2A5ZA 3BTZA 3FHQA 1G86A 1R091 4K6BA 2PHFA 3BTYA 2YMZA 2Y8KA 4HVOA 4Q8KA 2RMU2 5HV4A 5H9QA 5FY8A 2IVIB 2WT2A 1SHWB 1ODMA 1XE0A 3LWCA 4H14A 4URAA 2BQPA 3SEEA 4RR3B 4BWOA 2P5BA 5GZEA 4GB32 2VCMA 4L99A 2DCYA 3GXUA 1WUVA 2CAUA 3ASIA 5CZKA 5EP9A 1D2QA 5CG9A 4QD2A 5GZCA 4KGGA 1DYKA 4CYDA 4ZHNA 4XBNA 2ZHMA 1NG0A 1A8MA 1H4GA 3IKWA 2P3JA 3SC7X 1FYUA 1NA1A 2P6HA 2A1XA 4QPYA 1C28A 5JXJA 2BU9A 2RS11 5I91A 4XBQA 5BNPB 3M4FA 1HV0A 4RL7A 5IVFA 2TEPA 3E97A 4Q4Y2 1WMEA 1MQTB 3OBZA 5EV7A 2WR9A 2JJ6A 3C3VA 1C8M2 1Y3TA 3P6BA 4ONUA 4YLZA 2GH2A 4AAPA 4OI0A 3I3EA 3JZVA 4WV8A 2NMNA 1LOCA 1REEA 3ZFGC 1G9AA 1UY0A 1WMDA 5T55A 1BLZA 1IG3A 3I4IA 2PQSA 2WLPA 5HCHA 2E53A 3OGSA 3OPZA 2B9UA 1NQJA 1PGW1 1MR5A 5BY5A 1H2NA 5D8AA 2VMEA 4FQ4A 5FY4A 2J1VA 1Y9MA 1OD5A 4EE2A 5I0TA 3X29B 2WZ8A 3ZSLA 2HBUA 1W8TA 4B7EA 2ZGPA 1UZWA 3B9CA 5FO7B 1H2KA 2PLV2 4FPFA 4GIQA 2CV6A 5ABJA 3ZXGA 3ZYPA 3H8OA 5CA6A 5JIUA 4UW3A 2LS6A 5FMBA 4CUCA 3JD73 1NUKA 4ZKTB 1WCKA 5CFCC 3LOBA 3AMPA 2ZGMA 3GDBA 2FDIA 3VUOA 2H6BA 5FPLA 3CZJA 4AEDC 4RHV2 3ZLIA 4CUAA 2VUAA 3KF3A 1WLTA 3GJBA 5BNNC 4PCRA 3DXUA 3M3EA 4YPJA 1SBDA 4CDUC 4AW7A 1F4AA 2DBNA 3OBRA 3AP5A 3NV1A 1HIXA 4R4XA 4NIIA 1VPHA 1X7NA 3LCPA 2ZZJA 3WG1A 4YGBA 1JZ3A 2E33A 1GBGA 1DHKB 1COV2 2WFF3 2P4EA 1FPN3 3CMGA 4KQ7A 1CAVA 1S55A 5FZ3A 1Q8OA 3W20A 1UIKA 2ZMNA 1BVVA 2E7TA 4LKDA 3RPQA 3OPWA 3WNPA 2YU1A 1U12A 5KWRA 2DV9A 4QX1A 2UURA 1UYPA 3BIEA 5EHDA 4ASMB 2VW1A 1AZDA 1V0AA 3J8F3 4GA9A 4YZ4A 1YFXA 4OI2A 4YWAA 5FZFA 3HT2A 4AI2A 4KBBA 5L7OB 1GQHA 3ZDVA 1VP6A 4N7UA 4BM8A 3CNAA 1W28A 3VBHA 1LESA 3ZN6A 1OSGA 2BBAA 3PIGA 5EYXA 3ZFGB 3VDAA 1AR92 3USSA 4HBNA 2JKBA 3HNYM 1RHI3 2QQLA 2WNUB 1HN1A 1NKGA 3Q8EA 3A4UA 1X36A 2B39A 1RUE2 4O61A 1LCLA 1Y7BA 4QXBA 5DUVA 3B3QE 4OUSA 1V9U1 1OQ1A 4MXWA 2UWCA 4HKWA 2IWGB 4PIYA 2JECA 3RSJA 5FMCA 3I7DA 2VY0A 3WW1A 1RB8G 3MW2A 4LE4A 3RG0A 2XL7A 4BHPA 4QHOA 4KWKA 2WKKA 1ZZCA 2ZHNA 1GNZA 1XNKA 2HWF2 2JWPA 2X5IA 3MGUA 4QB6A 2UY9A 1IPJA 2WINB 3QOPA 4XQ4A 1MZEA 5JUVA 2FMDA 4OZXA 5LW9A 5FY9A 4AI0A 4RFT0 4QPIC 2R6QA 1XJAA 5EYYA 2DVDA 3NQHA 4N43C 1W8OA 1OF3A 2BWCA 2AR6A 3N7JA 4M0NA 4YW7A 2HWC2 4RD7A 4A44A 4B1LA 1DZRA 1G7YA 1UN1A 1W6PB 4XCAA 1B35B 2VQ0A 3WCSA 4Q0VA 3S57A 3MUY1 5JR2A 2XL9A 5FKBA 1KFXL 1OLRA 3I8TA 2RMU3 2JDNA 4LUMA 4OUEA 2PHUA 3POYA 5FK8A 1PMJX 4DZGA 3AXDA 3I3QA 4QQ2A 1OQDA 1ODNA 2R49A 2V5DA 5LBBA 4KL1A 1HXS1 1MS1A 4M01A 1DDLA 1LOGA 1AL21 1VBB2 3T0AA 2EALA 4G4FA 3C7FA 3OOXA 4QB2A 4YZ3A 1GFF2 4BOWA 4FAGA 1Z7S2 4K20A 3UV9A 4F83A 1MQTA 3FUOA 4AVSA 4TWTA 2CL2A 2PFWA 3K77A 5LA9A 5A3NA 1QH7A 4XJWA 5LA1A 5F9TA 2ZS6B 3H8RA 2Q8DA 1BK1A 2ET1A 3DXTA 4Q4Y3 1RUI2 2AH2A 5JPMB 2JE9A 4Q4X1 1ZA7A 1NE6A 2MHFA 2NN8A 1WCQA 4E4ZA 3I2KA 2KD7A 1HRI1 3H0OA 4AYUA 2QTWB 1F5FA 2OYZA 2CWMA 3WUCA 4WVMB 1A3KA 2D6OX 2NP0A 5H9PA 4HZFA 3ZXEA 2VE1A 1PK6C 3PU8A 4JGYC 5G04L 4EV0A 4YVSA 4LITA 1GV9A 4NVPA 1R092 2DURA 4QPIB 3GALA 4QAWA 1DGRA 4UWDA 1PNGA 1EP0A 1RMU2 1JW6A 4P08A 2PHLA 3VBFA 1UY4A 3A21A 2XMLA 1WZXA 5FZ6A 3MLLA 2WWUA 4PF1A 3VKNA 3LDBA 2D40A 4XQWA 1UPIA 4A6OA 5FY0A 1L3JA 4AZZA 4BQ2A 4D7SA 4LBNA 4QU1A 2LALA 4ZXEA 1Q5OA 3ZXFA 3LDKA 4OFGA 5KHIA 4BQXA 2A6VA 2EIBA 4GH4B 3ZIWA 5FY1A 2A6WA 1H6XA 5JI9A 1NLSA 3VBUA 4Z07A 1R083 5AFBA 2RS12 3MF9A 4MH0E 3UL2A 4IV3C 3WNXA 3ZSJA 1RUD3 2BFUS 1ULEA 4XFHA 1YFYA 5F5AA 3S6PA 3T08A 1COV3 4UFHA 5DAPA 2HWB1 3N7MA 1NE4A 2WT0A 3BVCA 5JVVA 2XG3A 1GICA 4LBQD 4X6RB 5FUPA 1I6XA 1NXMA 3MIDA 3AP4A 5H9RA 5SV5A 5KR7A 1W2UA 1S0BA 1QQP1 2RS53 3FBMA 5EJ3A 1HJGA 2FZ1A 4B4QA 4CUGA 1DCSA 4JRAA 4NRMA 3ZN5A 1DBNA 3O5SA 1MZ6A 2J1EA 3RZJA 1YUDA 4QPWA 5IW0A 2WO2A 3V0AB 4BK5A 2OZ6A 2VUCA 1TNFA 4LK7A 3I2GA 1W6MA 5A7WA 4JVAA 1FX5A 4KI5M 3H50A 2XWJB 2DCZA 3VKLA 1AR93 2CAVA 4HLTA 3WQ7A 1K3IA 5A33B 5GALA 1H0BA 3AKPA 3JBG1 1F31A 5C4WA 4C1WA 2K9ZA 3FUQA 5L7OC 1PK6B 4XFBA 1AX2A 3T30A 3B7MA 1ASJ1 5ANNA 1KQRA 2JIJA 2NZ9A 5J7MA 3HAGA 3JXSA 1AYN1 1YRZA 3GCXA 2GNBA 5FZKA 3EMRA 1I5ZA 2YUEA 4FQZA 4WBBA 3CBNA 5JLVA 1O4YA 5LRSA 1LEMA 4DPNA 3W21A 1EY2A 3UKVA 1XU1A 1XRUA 4GAZA 1CIWA 2ZCWA 5FTTC 2DTYA 2E9QA 2XKPA 5DABA 3E6BA 3U78A 3WCRA 3WDVA 4AQTA 5HBAA 3I3BA 5K0UB 3BYWA 2PHRA 1PMHX 3AVSA 2MEV2 3AM2A 5DAQA 3CDZB 2ZMKA 1CN1A 1JYXA 3WHTA 1OH4A 3I2HA 4IV3B 4AGVA 2ZX4A 3WDTA 3ZMOA 1ZX5A 2GC1A 4I02A 4MO3M 1JZ4A 5JSPA 3O14A 2VZRA 2QQPA 1N1TA 5CADA 4Q8LA 3THTA 1AX0A 1TVGA 1PNFA 2ILMA 2X10A 2EIDA 3WF0A 3ZYFA 3ZYRA 3H3ZA 3R0RA 4ATEA 3ILNA 1LULA 1XBFA 1W6QA 2W2IA 3AP7A 4DQAA 5A6XA 1ZZ9A 5FZ4A 5FUIA 3TNQA 4EYUA 1CR7A 1H6YA 1W2OA 3WW2A 1QF3A 1RUNA 2DU0A 5T5LA 1AR62 2NQYA 1V9U2 4BIFA 3A7QA 4JCKA 1Z7S3 1POV3 4LBJA 2QFEA 1Q8QA 1HKDA 1MEC2 3A0KA 3DPRA 4QPGA 4B3NA 5JSRA 4P00B 2BWAA 4QX0A 3O1MA 1UOBA 1DLLA 4FPGA 1RUI3 4N9IA 1OC1A 4KU8A 2V09A 3OPTA 2QKDA 4DNYA 4GWNA 2VZTA 1UF2C 4GWMA 3EB7A 4A42A 1RXFA 5KHGA 4AVBA 1NCRA 1W05A 2A3YA 2YV8A 3APBA 1S2BA 3N7KA 5FYUA 1ND2C 2PMWB 3NNJA 2Q4SA 1LTEA 2DU1A 1IPKA 3KQ4B 2ZBJA 5FK7A 4OZOA 5KHJA 2ADDA 1KJRA 1LHNA 1XNCA 1R093 2GNMA 3ATGA 3FWEA 3K2OA 3K48A 4NAOA 1NXD1 2TBVA 5LK5A 3H7YA 1DP0A 2IFWA 2WIIB 2YFUA 3JQWA 2WQZC 4Y26A 4ZZ5A 2UU8A 3AYCA 5CG8A 1OUXA 2LROA 4NIHA 2GNDA 2WJSA 4GKXA 3DEMA 5EZWA 4ZU5A 3RNSA 4META 1HXS2 1LODA 1PO21 4KWJA 3VLBB 4P9YA 3RYRA 1SBEA 1SZBA 1PGL1 4UW4A 1AL22 1ULOA 2JKXA 3SITA 4Y1ZA 4QM9A 1VBA1 4DEQA 1ST8A 1JYCA 2D93A 2RDRA 2WO7A 1F4HA 4LULA 1UMZA 1X9TA 4HONA 3HQRA 2ORZA 3PLQA 4Q4V2 1OLQA 2C9KA 5F6LB 5B4NA 1ZZ8A 1ZM1A 2J1TA 3O1VA 1REFA 4JGZC 4PLOA 1EV12 1DYPA 2R041 1AUYA 1JU3A 4A6SA 5FDBA 1GZ9A 2XQRA 2VMIA 4WM8A 1GQGA 5FMDA 4LBQB 4XF4A 5G05L 5FZ8A 5GLWA 1FI2A 1HRI2 4RQPC 2P34A 5K8SA 4N7IA 3HJRA 3VHPA 5KC6A 3T0DA 2RJLA 4B29A 1EAH1 1Z78A 3VN4A 4COZA 1W2TA 1JUIA 1XB9A 2Y33A 2RJKA 3AL5A 2NMOA 2WS91 3NNLA 2CGOA 3BKZA 3BTXA 2FDFA 5FPUA 2YYOA 3ILFA 2TNFA 2ARXA 1B09A 4CU7A 2BNMA 1CGPA 4CEWA 4QXKA 4F8AA 3BU7A 5JSOA 1ZRCA 2D98A 3TBDA 1OF4A 2YB7A 2YBKA 5DDJ3 3ZKUA 5C8CA 2BGPA 3HN1A 2IUWA 3J7MA 1V70A 3AVRA 5DG2A 3WD5A 3SNMA 4BCUA 2Z69A 4J6GA 1JZ2A 2DUPA 1W6OB 4QX5A 5FZ9A 2JICA 1TE1B 2OPWA 5FP4A 5CB7A 2AEZA 3OBAA 1UX7A 2C26A 2C0ZA 2JDYA 3BI3A 3CHXA 3EQEA 4GB31 5CFDA 1KDKA 3CEWA 4JKLA 4FPKA 4MV2A 1LGCA 4QU2A 1R64A 1OMIA 4JQRA 4FVVA 4NRQA 3RFRA 4FP2A 3E5UA 4UFIA 2WZEA 3JB4C 2RHPA 4NO4A 3VBSC 2UYAA 4XIOA 1XPWA 4I0BA 4ATFA 2G9ZA 1GSLA 4XUQA 4WVZA 2EXIA 1LHVA 2HWB2 4I3GA 2Q5TA 2XVKA 2VGDA 3IZOA 1JZ6A 4C91A 4XETA 1TMF2 2FMYA 4MHUA 3H42B 4Q1PA 1RUG2 3OG2A 4HVRA 4PDWB 3NL1A 2EVXA 4JV4A 3LB9A 5DN2A 4FO9A 4GKYA 5A6QA 1C8M1 4WM7B 5FP3A 5CKNA 1CD3G 2PHWA 2WQ4A 1IS3A 3CJIA 2CDOA 5FBZA 2RG4A 1H8TC 3WX5A 1UMIA 2BVVA 2BGOA 3O1SA 4RQPB 5APAA 4AQSA 2ZTNA 3HIFA 3I2IA 4P02B 5J98B 1WA6X 3KD4A 1NZCA 1GUIA 3JBG2 2Q1FA 3AJYA 3AMHA 1E5HA 1WA4A 4CCEA 1YHFA 3IDAA 2H6CA 2W1SA
chains in the Genus database with same CATH topology
1UZVA 4AOCA 1OXCA 2JDUA 2WR9A 3DCQA 1OURA 2BP6A 2BV4A 1OUSA 5A70A 2CHHA 2JDHA 1W8FA 1OUXA 5A6QA 2VUDA 2JDKA 2JDNA 5A6YA 4UT5A 2XR4A 2JDYA 3ZDVA 5A3OA 5A6XA 5HCHA 2JDMA 2JDPA 2VUCA 1GZTA 1UQXA 1OVPA 2BOIA 1W8HA 1OVSA 2VNVA 5A6ZA 4CE8A 2BOJA 2WRAA 5D2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UZV A;  4AOC A;  1OXC A;  2JDU A;  2WR9 A;  3DCQ A;  1OUR A;  2BP6 A;  2BV4 A;  1OUS A;  5A70 A;  2CHH A;  2JDH A;  1W8F A;  1OUX A;  5A6Q A;  2VUD A;  2JDK A;  2JDN A;  5A6Y A;  4UT5 A;  2XR4 A;  2JDY A;  3ZDV A;  5A3O A;  5A6X A;  5HCH A;  2JDM A;  2JDP A;  2VUC A;  1GZT A;  1UQX A;  1OVP A;  2BOI A;  1W8H A;  1OVS A;  2VNV A;  5A6Z A;  4CE8 A;  2BOJ A;  2WRA A;  5D2A A; 
#chains in the Genus database with same CATH topology
 2CWS A;  1ASJ 2;  2PLV 1;  1V9U 3;  4HK8 A;  4QKB A;  2XPJ A;  3F2Z A;  5HV0 A;  2ET7 A;  3CQO A;  1GOF A;  3U0Z A;  5DAX A;  3ZSK A;  3AL6 A;  4IGP A;  1W0P A;  4CDQ B;  1W8F A;  1GU3 A;  1HLC A;  4O7X A;  4ARY A;  4AHX A;  4LOR A;  1CJP A;  4NID A;  3RZH A;  2F17 A;  2FDJ A;  4YM1 A;  1Q43 A;  3WNO A;  4XTP A;  1XND A;  2WZR 2;  5D8A C;  2KR2 A;  4CCC A;  3CL1 A;  4RHV 1;  3RI9 A;  3WNM A;  4A45 A;  4AR2 A;  3S5A A;  4OCT A;  1PIV 1;  5FP8 A;  1W90 A;  2OPK A;  3P3P A;  4MGI E;  4YW3 A;  3ACG A;  5GLT A;  3ENR A;  2IXL A;  5ABJ C;  4P9X A;  4MVT A;  2BEO A;  2C5D A;  2V4A A;  2ZKL A;  4BJ0 A;  2GSY A;  2WO1 A;  3EXU A;  5FY5 A;  1OD3 A;  2D97 A;  4MLO A;  1F8V A;  3OYW B;  5IT6 A;  3OUJ A;  2D3P A;  3HMY A;  4LQR A;  1W8Z A;  4IGQ A;  1BHG A;  3POW A;  4HXC A;  3H8X A;  4OUM A;  4JKM A;  1DQ6 A;  3RJ2 X;  1YQ8 A;  4XIK A;  2ORX A;  3ILR A;  1XQN A;  2WAO A;  5FMO L;  5FWE A;  5FZM A;  4M4P A;  1HXS 3;  4A4A A;  3PJY A;  1CZS A;  1UQX A;  3J7N A;  2R07 2;  1UOF A;  3KT1 A;  5AC9 2;  2VCC A;  1NCQ B;  1SFY A;  1AL2 3;  1FV3 A;  2QDN A;  1H8T B;  4GUL A;  1SLC A;  4L2N A;  4FXK B;  3SHR A;  2XJU A;  3KF5 A;  5FPV A;  3T09 A;  4UBG A;  2XLF A;  4CP9 B;  3EO6 A;  5C9A B;  3MIE A;  1G9F A;  5A7O A;  1YO8 A;  3OD4 A;  4CDX A;  3WT3 A;  1DFQ A;  1I5P A;  2W3J A;  4UF0 A;  1TME 2;  3EJK A;  1SLT A;  4YG3 A;  4GWI A;  3DYM A;  2K0G A;  4CCO A;  3LFM A;  1A6C A;  4Q4X 3;  3VBH C;  2F4L A;  3O0V A;  1ONA A;  4F7Z A;  1SMV A;  1HRI 3;  3GJA A;  4AQ2 A;  2O8Q A;  2VVE A;  1J3Q A;  1LRH A;  3R4U A;  5A80 A;  4R9C A;  4ORF A;  5JOZ A;  5LAT A;  4CP1 A;  4LO6 B;  5IK8 A;  1UIJ A;  2B42 B;  2EXJ A;  2VNV A;  3BPS A;  4HKL A;  3VD5 A;  1CAW B;  3GGL A;  1OLM E;  2G19 A;  1RJ7 A;  2VOT A;  2G4I A;  3E5X A;  3GCW A;  3ETP A;  4YW5 A;  4AI3 A;  4N53 A;  3SMH A;  3T2P A;  5IFT A;  1UZ0 A;  3ACL A;  1HB1 A;  4JX0 A;  5IVV A;  4F3J A;  5DAW A;  4ERO A;  3ON7 A;  4XQD A;  2F6B A;  4KGQ A;  3URF A;  2X5I C;  4C1X A;  2D5F A;  2BNO A;  2CYF A;  5FYM A;  1GP5 A;  1OQE A;  3RMY A;  5I0R A;  1PO2 2;  3KHC A;  4LLO A;  4Q0S A;  4AHY A;  1PGL 2;  2A75 A;  4TXW A;  3HEI A;  2B46 X;  1LOF C;  1VBA 2;  2HKX A;  4PBO A;  3J9S A;  3KT4 A;  2QQV A;  3MIH A;  3HVD A;  3GZE A;  1VBB 1;  3ETQ A;  1ULD A;  1IKQ A;  1KIT A;  3I2O A;  5FLJ A;  2QQW A;  2FD8 A;  2ZPX A;  2HWB 3;  3SQO A;  2ZGO A;  4QQH A;  1PGS A;  3DKW A;  4LA2 A;  2Z79 A;  4FPC A;  1QXJ A;  1WGP A;  2YC0 A;  2ZGU A;  2R0F A;  1CZV A;  3GF6 A;  3Q8C A;  4OLL A;  5FZO B;  3ZO0 B;  2P1B A;  5CYY A;  5FPZ A;  2EIC A;  5I8S A;  3CIH A;  1LHW A;  1QQP 3;  1W9T A;  3ACH A;  4PHZ A;  5F2S A;  3MO4 A;  5IAV A;  5AVA A;  3NV4 A;  1YEW A;  4FXG B;  2WFP A;  3NST A;  5F3C A;  1SLI A;  3PVB B;  1YIF A;  3III A;  4HMZ A;  4BLI A;  4BME A;  4C0H A;  1GQP A;  3N9O A;  4FI9 A;  1AR7 1;  3PL0 A;  3VDD C;  5F2W A;  2PQQ A;  5FYH A;  3VBO A;  1JYN A;  5KHH A;  4NOT A;  3OGJ A;  1LEC A;  4PT6 A;  1FAT A;  1C5H A;  1TEI A;  4JDM A;  3BOW A;  4OYU A;  4YW1 A;  3SH5 A;  4BE3 A;  1YFW A;  4BZ4 A;  4XXP A;  4COV A;  2XJP A;  3E6D A;  1QXR A;  3VV1 A;  1OBN A;  3D3A A;  3JBG 3;  3NAP A;  3LF7 A;  1ND3 C;  4RSU A;  3ZX7 A;  2LM3 A;  3E6C C;  2W1U A;  4H3W A;  1O4Z A;  1O3S A;  5FQ0 B;  1ASJ 3;  4QGL A;  1RMU 1;  2DVG A;  5GM0 A;  5A70 A;  1AYN 3;  1MVQ A;  1W04 A;  2QDR A;  4Y22 B;  3R4D B;  4M00 A;  1PHM A;  2WDB A;  3WVJ A;  2D44 A;  2GC3 A;  2RS3 1;  3TEY A;  1S4C A;  5A3L A;  5KBF A;  1W6N A;  2JG8 A;  2VH9 A;  1WW7 A;  5A7N A;  4S2H A;  3R6S A;  2VNO A;  4AGR A;  4YZ5 A;  2VMG A;  3LEI A;  4GD4 A;  4YZ2 A;  4XFA A;  1PVC 2;  3JUU A;  1SLA A;  1Q8V A;  1STM A;  4NR1 A;  1KS4 A;  3C2U A;  4NE9 A;  2FCV A;  3SCG A;  4B4R A;  4IEP A;  1IHM A;  1XSR A;  2OQ6 A;  3FX3 A;  1LU2 A;  5F1R A;  3C7O A;  1VJ2 A;  2E63 A;  5EQU A;  1VAM A;  4AFM A;  4AVT A;  1XOY A;  2W9X A;  2ADE A;  2D3S A;  3VL8 A;  4I0A A;  4L92 A;  1CWP A;  2ZGK A;  4Z2A A;  2DYC A;  1YWK A;  3ZXA C;  2VUL A;  3RJR A;  1WCD J;  4PQ9 A;  3VGI A;  4ZXK A;  3RZM A;  4EWA A;  1QJX 1;  1QJY 2;  3B9I A;  1O5U A;  4LKE A;  3QLQ A;  3PME A;  5FLI A;  2BGC A;  4XJ9 A;  3V65 A;  5F6K A;  5FZI A;  1O6U A;  2WZP P;  4NIA A;  2X8K A;  4COU A;  1LB2 A;  1DZT A;  4M0H A;  4IE7 A;  3KS7 A;  1SPP A;  3ELN A;  1N1V A;  5K4L A;  5C9A A;  4TYS A;  2CY6 A;  3VDD B;  4DEV A;  1YI7 A;  4H2A A;  5KXB A;  2O0O A;  4HSJ A;  3VD4 A;  2W47 A;  4B7K A;  1QNW A;  4YYO A;  2YC4 A;  2C24 A;  3IBM A;  3THC A;  5A7P A;  3VKF C;  4CDW B;  5JI7 A;  4QGN A;  5CNA A;  2WL1 A;  1H1A A;  3PUH A;  2CTV A;  1I3H A;  1V6J A;  4IES A;  3FLR A;  3S7I A;  1ND3 B;  2VOX A;  1LOB A;  5ACA 1;  3NKG A;  4XDP A;  4FCA A;  3NKT A;  2VQT A;  2OVU A;  4CCK A;  3WP3 A;  1O5L A;  4XXA A;  1PIV 2;  3FLP A;  2ZGL A;  4SLI A;  1DZQ A;  4DB5 A;  4EJR A;  3VZM A;  5C4W C;  3FZ3 A;  2XJT A;  5FJH A;  1UXX X;  3ZFF C;  1FXZ A;  4D6R A;  2FCT A;  3RRD A;  2XBO 1;  5C5U A;  2MEV 1;  2YC2 A;  1SLB A;  4CEY A;  5IFP A;  4AI9 A;  3MHZ A;  1OOP A;  1GKB A;  3WNN A;  3VHN A;  4AI8 A;  5A1A A;  3OTF A;  3RI8 A;  1I9R A;  5JXH A;  1E5S A;  3V56 A;  5F8P A;  5B4X A;  4AI1 A;  2XJR A;  3C8X A;  2JB8 A;  2D6N A;  5DPN A;  1UNB A;  4LEJ A;  5A3O A;  4AFD A;  4RGG A;  1PO2 3;  4K7J A;  1PM4 A;  1OH3 A;  3OGR A;  3ZDS A;  1VBA 3;  3K51 A;  4AVA A;  4CSW A;  2BDR A;  2EAA A;  4D94 A;  2A7A A;  4YVW A;  5KXE A;  4XF1 A;  4V1P A;  4MHR A;  4XUP A;  4FOQ A;  1AR6 1;  2IFR A;  3UGG A;  3IPV B;  4MZU A;  5JZG A;  4Q4W 1;  4R52 A;  2HYK A;  2R04 3;  3WF1 A;  1S0J A;  2I2S A;  3SCH A;  4LBO A;  1E5R A;  5JMC A;  1ULG A;  1EPZ A;  1MEC 1;  1QU0 A;  2VU9 A;  3M2M A;  4UXA A;  2JDK A;  2QUO A;  2Z42 A;  2DUQ A;  1QJU 2;  1Y43 B;  2WNV A;  4GMP 0;  1K5M A;  5LA2 A;  4YSF A;  2YXS A;  5T5P A;  2XON A;  1D0H A;  3MEP A;  5CFC B;  3C7G A;  1NAE A;  4Y20 B;  2VR4 A;  1TQ5 A;  4Z8B A;  5FXX A;  4RS5 A;  1EAH 3;  3VBR C;  1D4M 2;  1YLL A;  4AED B;  4AXO A;  4XHX A;  5F3G A;  2WS9 3;  4IEY A;  3LZZ A;  2E31 A;  2ZX2 A;  5BNN B;  5EXO A;  3N9M A;  1R1A 2;  4CDU B;  4QPG C;  3DPR C;  1O3Q A;  2VW0 A;  5CEH A;  3U07 A;  3U75 A;  4BQ4 A;  3KVB A;  2JD4 A;  3PUI A;  3ITQ A;  3NW4 A;  4RR3 A;  2ERF A;  3ACF A;  1PO1 1;  1BZW A;  2K46 A;  2DUO A;  3WR0 A;  1IKP A;  3S0M A;  2QVS B;  4UI9 L;  2VTX A;  2W52 A;  1QGL A;  2Y0I A;  2FDH A;  4DOU A;  4L97 A;  2VBP A;  3VDC A;  1M4W A;  4J1W A;  4GB3 3;  5AVP A;  2C6S A;  1S2K A;  4GXL A;  5FYB A;  2RR1 2;  3T0B A;  4W50 A;  1YJL A;  3TWI A;  2DF7 A;  4E9K A;  4EWD A;  2AAC A;  4AF9 A;  2XKO A;  2YG0 A;  1AXK A;  4ES9 A;  1H2L A;  2GME A;  2YBS A;  5FOB B;  3WG2 A;  3MFA A;  4E2G A;  1VE0 A;  2IXI A;  4LBK A;  5BNP A;  4WZF A;  2IXJ A;  3H1W A;  4QQO A;  1ZZB A;  1XNA A;  2HWE 2;  3UNP A;  4OUL A;  5BNO C;  2GC0 A;  1IOA A;  4RN5 A;  4Q4V 1;  4X8P A;  4XOG A;  1WW5 A;  4N9H A;  5IHR A;  5FZE A;  1FMD 2;  4DY5 A;  1EV1 1;  1RUC 1;  3OEA A;  4XF0 A;  1GAN A;  2F4P A;  3P3N A;  1QXP A;  3FN9 A;  3UJQ A;  1C8M 3;  4NRP A;  4Y1Y A;  5CIS A;  3IT8 A;  4GAL A;  1MS5 A;  4IV1 C;  1YQ2 A;  3ZFE C;  4HVQ A;  1VAL A;  5BUV A;  1AR7 2;  1V6I A;  4JC1 A;  4EN0 A;  1JI6 A;  1MVE A;  4Q29 A;  3AKT A;  3D8C A;  5IVC A;  2EIE A;  3POI A;  1LEN A;  1NOV A;  1YYN A;  3RWN A;  3PTR B;  3ST7 A;  2PN5 A;  4EN9 B;  2DCT A;  4QKD A;  3WEZ A;  1W9F A;  2V73 A;  3VBR B;  1VMF A;  2E6V A;  2Q30 A;  4G3Y C;  2ARE A;  4Y5T A;  5FXZ A;  3ZSE A;  4B1M A;  2C4X A;  4WM8 C;  3WDX A;  3ZYJ B;  2D7F A;  2PLV 3;  4N43 B;  4Z1V A;  1FNZ A;  1ZA4 A;  2ETE A;  5I93 A;  3NRU A;  1QJE A;  3R4S A;  3KCX A;  4W6W A;  1O8P A;  3PJQ A;  5HPO A;  1W3V A;  1YI9 A;  2BUK A;  3EHK A;  3WNL A;  3GHM A;  5CKQ A;  5FZ1 A;  5L19 A;  2RS3 2;  2QBX A;  1ENQ A;  2DVF A;  2QZ2 A;  2NLR A;  3LSD A;  4IEZ A;  4JHZ A;  5HCB A;  4AWD A;  2E51 A;  3VZJ A;  3ZKY A;  2JG9 C;  2WWJ A;  4RHV 3;  4CEW C;  3N9L A;  1N3Q A;  5C6C A;  4IQP A;  1LGB A;  1OVP A;  1PIV 3;  3AZZ A;  3PVN A;  5C8C C;  4PIX A;  4UFM A;  4EN6 B;  1S0C A;  4QKF A;  4CP0 A;  1LR5 A;  3MV1 1;  3ROU A;  3PUQ A;  1BCX A;  1S0D A;  1FNY A;  3ZPY A;  4HN1 A;  2BER A;  3SH3 A;  3WIN E;  2JIG A;  4Y5Z 0;  1KFU L;  2W39 A;  5FCC A;  3RZK A;  4NJ4 A;  1TMF 1;  3POS A;  3UES A;  3VHO A;  1AR8 1;  5BNO B;  3D5O A;  1RUG 1;  1UYZ A;  4OVE A;  5L7O A;  2X05 A;  5CFD C;  1QJX 2;  1UU4 A;  3PVE A;  5C70 A;  1MPX A;  3I2J A;  3SEP A;  4AL9 A;  4C90 A;  3ZFG A;  5LY1 A;  2JDM A;  3WDW A;  4DUW A;  2WQ8 A;  1BVP 1;  2HLE A;  1U5X A;  3UKN A;  3DYP A;  3OY8 B;  2WNU A;  5FYV A;  2XLA A;  3AYD A;  4IV1 B;  3ZFE B;  4YM3 A;  3AKQ A;  4YGC A;  3Q8B A;  1JYV A;  4A7K A;  3AYE A;  3MI8 A;  1HRV 2;  2QJV A;  3GHN A;  4JGY B;  1CX1 A;  1RUE 3;  2VMC A;  1H1I A;  2XLG A;  3KV9 A;  1C8N A;  1W0O A;  3DKQ A;  4L9B A;  5ACA 2;  5C3Q A;  2VUD A;  1G9B A;  4LO7 A;  4QQP A;  5FBJ A;  5A32 B;  1SCS A;  5T50 A;  3LGR A;  4FBF A;  1QY4 A;  1WWY A;  4DS0 A;  1BBT 1;  2P2K A;  2HWF 3;  2VNR A;  2WZR 1;  4O65 A;  4L0P A;  3MPP G;  2Y6H A;  1LED A;  3H3L A;  1KD7 A;  4E4S A;  2JG9 B;  4YFW A;  1PVX A;  2XBO 2;  1CQ9 A;  5E1R A;  1W6P A;  1XNT A;  2LRP A;  3M3O A;  1B35 A;  2PXJ A;  1J3P A;  2QQO A;  3LDR A;  4HPK B;  4FFF A;  4MOA A;  5FY7 A;  3FE5 A;  1PX4 A;  2VQU A;  2HWC 3;  5ERL A;  4IEW A;  4PI0 A;  2PYT A;  4XUN A;  1X9P A;  1DGW X;  2R06 1;  3PUS A;  4QWN A;  4UFJ A;  2QCS B;  5C8W A;  4FP3 A;  1N47 A;  5GLV A;  5BXX A;  4ZS3 A;  1RUH 2;  1GWM A;  2GH8 A;  2JDA A;  2P6C A;  2JDP A;  1PX3 A;  2VUJ A;  2XJS A;  3HT1 A;  3MLK A;  4I30 A;  1JBC A;  3ZYI B;  1RUJ 2;  2R07 1;  2UY8 A;  4XJ8 A;  3WY6 A;  5AC9 1;  2VD7 A;  5J96 B;  1G9D A;  1VBB 3;  2DDU A;  3ALQ A;  4Q4W 2;  3MBW A;  4ASK A;  4TLF A;  3OUI A;  3V0B B;  1OUR A;  1S0G A;  5FZG A;  2FCU A;  1VBE 2;  1QDC A;  1TME 1;  2CNA A;  2YPJ A;  3USU B;  5JXI A;  2B7Y A;  3T4H B;  1LHO A;  1AX1 A;  3RMX A;  3WQ0 A;  1PMI A;  5ANQ A;  1DQ1 A;  1E57 A;  4WVM A;  4XFC A;  5T54 A;  5LZ6 A;  3VZO A;  5FO8 B;  2ID4 A;  1AR7 3;  4P9J A;  5DZE A;  3DV8 A;  3JU9 A;  4MGS A;  1V6M A;  1OPM A;  3B5L B;  4QPI A;  3GZA A;  4AAX A;  4CDX C;  4CP2 A;  2IVJ A;  5DZF A;  5JDB A;  1VBC 2;  1NLR A;  4N43 A;  1QWR A;  1AJK A;  2OZJ A;  1LJ7 A;  2XH6 A;  4JDN A;  5D2A A;  1TNR A;  2DBI A;  4XUR A;  5CAZ A;  4OHY A;  5LB6 A;  4ZU7 A;  1PO1 2;  3HD8 B;  4LHK A;  2VW2 A;  5FXV A;  1O7F A;  1RVF 1;  2EAK A;  3P5B A;  1H8V A;  1RMU 3;  4BB3 A;  4UT5 A;  3OBT A;  4P9L A;  4B4P A;  5C5T A;  4XC9 A;  1NT0 A;  2NM1 A;  4GH4 A;  1HV1 A;  2E7Q A;  2RS3 3;  3CKH A;  3NV2 A;  1A8D A;  2Q1Z B;  4AEM A;  4UYB A;  4E27 A;  4NHX A;  5A3P A;  3AMQ A;  2WFF 1;  2PTM A;  3W5M A;  3ME2 A;  2HEV F;  4QX8 A;  1JYW A;  2VAU A;  1H30 A;  3OUH A;  4FPO B;  4N53 C;  5FLH A;  3ECQ A;  4CZS A;  4MG2 A;  2RS1 3;  4LJH A;  4YW4 A;  2IXK A;  2H0B A;  2VOK A;  4GWJ A;  2ZX0 A;  3W58 A;  4I2O A;  3FLT A;  1RUC 2;  4YM2 A;  1N1Y A;  1RJ8 A;  4PF5 A;  3MIG A;  4E8C A;  3HQX A;  3MDP A;  1MZF A;  2RDS A;  4M3C B;  2D6M A;  2ES3 A;  1XU2 A;  3FL7 A;  4NHL A;  4PIZ A;  5A7S A;  4MGY E;  5EIY B;  2OUH A;  4IDZ A;  5FZ0 A;  1QHD A;  4PI2 A;  4RGA A;  3V0A A;  1QJX 3;  4XDQ A;  1BEV 1;  3DN7 A;  5FV3 A;  3CJX A;  1VBD 1;  2E7A A;  1BJQ A;  5J3U A;  1IS6 A;  2KA3 A;  1GZT A;  3TN9 1;  3KT7 A;  1BK0 A;  3KZ4 C;  4NMI A;  5DMY A;  1S2E A;  5A33 A;  3AX4 A;  1W3X A;  2FBE A;  1ZNP A;  2B9V A;  4S2D A;  1JOP A;  3LKJ A;  2ZGT A;  2X09 A;  1W9Y A;  4FTE A;  1NYW A;  3LD8 A;  1PK6 A;  4QDQ A;  2VM9 A;  3N35 A;  5LRR A;  1UZV A;  2RM2 2;  3L9J T;  4E4H A;  5FZL A;  4ES8 A;  3HWJ A;  5LAS A;  2HH9 A;  3BOP A;  4BK4 A;  3GBF A;  1ND2 B;  1ZBA 2;  4FOW A;  4RGK A;  2L9L A;  4XZP A;  1ZZ6 A;  2XB6 C;  1WCS A;  4IEO A;  1UO9 A;  3KV4 A;  4FFG A;  4XFF A;  2VVD A;  5ACA 3;  3L2Y A;  1IGO A;  2E26 A;  4OHW A;  2HWD 2;  4BYY A;  1KJL A;  3VBO C;  3WDU A;  4FPE A;  4XF3 A;  4DUV A;  1KGY A;  4XBL A;  5K0U A;  4CUB A;  5BYN A;  3FBY A;  3N9P A;  1D2S A;  3MUZ 1;  4QKN A;  4OI1 A;  1XE7 A;  3AFK A;  5JOX A;  5FYZ A;  1RUF 1;  2JD9 A;  4HPK A;  5LCW L;  3PUA A;  1FOD 1;  1PVC 1;  4IV3 A;  1W2A X;  2QQJ A;  4BQ3 A;  4TLG A;  3U10 A;  1OKQ A;  2XBO 3;  5IVE A;  2W94 A;  4QHB A;  1FT9 A;  4BIS A;  1AR8 2;  1HB2 A;  1PZ9 A;  2MEV 3;  3H3U A;  1FV2 A;  1C3H A;  3V64 A;  3QAC A;  5KC5 A;  1HJF A;  1DQ0 A;  4JGZ B;  2SLI A;  3OGV A;  4GZ9 A;  5GJ6 A;  1J1L A;  1KEX A;  4FAH A;  4AVV A;  3AKS A;  3PIJ A;  2XUM A;  4M4R A;  1CAU B;  1Q8P A;  3VB9 A;  2V4V A;  3VD3 A;  2Y6G A;  1QJY 1;  2ZAC A;  1UCX A;  3SKJ E;  5A3M A;  1NA1 C;  4PJY A;  2VPV A;  2MNG A;  1UYY A;  2LTN A;  2Y38 A;  1QIQ A;  4XCB A;  3THD A;  4P9I A;  1Y9Q A;  3QCW A;  4UW6 A;  2OX0 A;  4A7Y A;  2ZX3 A;  1XYN A;  2Y6L A;  2AEN A;  1AR6 3;  4ARX A;  3CU7 A;  3IDE A;  1T2X A;  1MS4 A;  4Q4W 3;  3D4K A;  3J7H A;  1AYM 1;  4BQ1 A;  1C1L A;  1SQ4 A;  3CO2 A;  1MEC 3;  2W95 A;  2Y6J A;  3LA3 A;  5FPX A;  1F9K A;  1JS9 A;  3VD9 A;  5IK5 A;  1CAX B;  3MZH A;  2UWA A;  1MS0 A;  1S1A A;  2VZ3 A;  1V6L A;  3H1M A;  5EPA A;  5GKA C;  1BBT 2;  1OFS A;  3AMN A;  2QE3 A;  2ZJC A;  4IE0 A;  1M06 G;  3LQC A;  3N36 A;  2A3X A;  5I0S A;  2C9A A;  4GJY A;  5FRA A;  1OFN A;  1UOJ A;  2O1Q A;  1RTV A;  5FWJ A;  2ARA A;  1T6G C;  4A41 A;  1RL3 A;  3Q8A A;  3G7D A;  2NYY A;  4HOO A;  4W8J A;  5JIA A;  4CE8 A;  5J37 A;  1UYX A;  1SFN A;  5F5I A;  3VBS B;  2D6L X;  2GP3 A;  3GBW A;  5IK7 A;  1K12 A;  2PEL A;  1OPO A;  2R06 2;  2AUY A;  3C7E A;  1C5I A;  1YNA A;  3AP6 A;  4Y4Y A;  1PO1 3;  4ZON A;  1OA2 A;  1K42 A;  3I3M A;  2CDP A;  2BFU L;  2JB4 A;  1UAI A;  2CU5 A;  2ATF A;  1U5Z A;  2GN7 A;  1AXY A;  2DCJ A;  2ZAA A;  3J26 N;  2EF6 A;  1GWL A;  2W1W A;  3KM5 A;  5SV8 A;  5T5O A;  3WP6 A;  4BXF A;  3NVC A;  2HJI A;  1R08 1;  2VZS A;  4NPL A;  4M3C E;  3HQU A;  1GNH A;  4QDS A;  2VZU A;  3KGL A;  1DGR N;  5F7U A;  1BYH A;  1DF0 A;  3U4S A;  5FR3 A;  4PLN A;  3POJ A;  1NA1 B;  4YW6 A;  4CEY C;  2XHK A;  2BOJ A;  1OOP C;  3OF1 A;  1HX6 A;  4Q4V 3;  1DU3 D;  4LBQ A;  2FHR A;  1CVN A;  2Q0A A;  5JPN B;  1EV1 3;  1RUC 3;  1U5Y A;  3N3H A;  3NJY A;  3VKO A;  1AL0 G;  4UBH A;  5J1X A;  3HNB M;  5EJ1 B;  5I8T A;  5LBF A;  2A6Y A;  1EYB A;  2W68 A;  1UD1 A;  4AGG A;  4DY3 A;  3NJZ A;  2I74 A;  3LIG A;  4GMP 1;  1QJU 1;  4UW5 A;  3WOG A;  3HN3 A;  4K9S A;  4YVW C;  1KXG A;  2X53 S;  2BOI A;  3AC0 A;  3LFI A;  2VZ1 A;  5D8A B;  3A22 A;  4ZY9 A;  1JH5 A;  1D4M 1;  3CZU A;  2N7G A;  4ISR A;  4AEJ A;  4CPB A;  5JZG C;  2VL4 A;  3VZN A;  4AQ6 A;  3BAL A;  3JD7 2;  4DRV A;  1JZ8 A;  1OI6 A;  1ND2 A;  1R1A 1;  1RC6 A;  1KS5 A;  1VAK A;  1W6O A;  1W99 A;  2A71 A;  2OA2 A;  3R05 A;  4URT A;  3UT0 A;  5ABJ B;  1G8W A;  1RVF 2;  3JB8 A;  3QH6 A;  2WNV C;  4FPL A;  4LUK A;  4FFI A;  1K5M C;  2AYH A;  3LE0 A;  2XGX A;  3H8U A;  4QXC A;  2DTW A;  3FFZ A;  3IM0 A;  1SBF A;  4QX2 A;  4XAA A;  2ZHK A;  4HFS A;  1I1E A;  2Z4F A;  1ENS A;  4OMC A;  1IQA A;  1OA4 A;  3M3I A;  1EUU A;  4RS5 C;  1OLM A;  3ZN4 A;  1GOG A;  1PZ7 A;  4YRD A;  5FAX A;  1S0I A;  2QQI A;  3K3O A;  4OHX A;  4AE2 A;  3ZVX A;  2Z5W A;  2WFF 2;  3DF0 A;  3ZM8 A;  1FPN 2;  4DXS A;  1ZBE 1;  2VJX A;  4U36 A;  1SAC A;  3SH4 A;  1A34 A;  2RR1 1;  5I8Y A;  1XE8 A;  3AB0 A;  5FRE A;  3OEB A;  5IK4 A;  1G9C A;  3VD7 A;  2Y64 A;  3INA A;  4BQY A;  3AMM A;  4PDW A;  1CAV B;  2DFC A;  2VMH A;  4ZU4 A;  1D7P M;  2HWE 1;  5DZG A;  3J8F 2;  1V6K A;  1OKO A;  1S0E A;  4JGZ A;  1YQ6 A;  3A0N A;  5HCF A;  5FYY A;  1TMF 3;  2Y34 A;  1OUS A;  2AC1 A;  4LBM A;  1AR8 3;  2JX9 A;  4WM7 A;  5FZA A;  1RUG 3;  4U2A A;  1FMD 1;  1X33 A;  3TEX A;  4DXZ A;  5KXC A;  5BPX A;  1WCU A;  3WW4 A;  5ISL A;  1F2N A;  2XR4 A;  3WZ1 A;  1BEV 2;  4H55 A;  5GZF A;  4H7M A;  1VBD 2;  4RQP A;  2FDK A;  1RHI 2;  3TN9 2;  1XYP A;  3VBH B;  3GZT B;  2DFB A;  3OJB A;  1GNY A;  1OT5 A;  3ZN6 B;  1KRI A;  2WSV A;  1BKZ A;  3M70 A;  1MQT C;  5JOY A;  4FPH A;  1UKG A;  3WG3 A;  3KGZ A;  3RZL A;  3FMG A;  2C1F A;  5DUU A;  4LIU A;  2VOW A;  3B94 A;  4QMA A;  4V2V A;  2WRA A;  4XJU A;  4D0Q A;  3O1O A;  2KXL A;  1SEF A;  1HDK A;  4MXW B;  4CDQ A;  1LU1 A;  4LR4 A;  2GMP A;  1HW5 A;  4L8Q A;  2VO5 A;  4I3P A;  1W8W A;  1ALY A;  4HKO A;  5IWF A;  1IQD C;  2EA7 A;  3TRS B;  5FIX A;  2Y60 A;  3T1L A;  1ULP A;  3CLP A;  3IN9 A;  2DVB A;  2O14 A;  2X5I B;  3N7L A;  2YY1 A;  1Q3E A;  2WN2 A;  1BBT 3;  2H0V A;  2WZR 3;  4JHT A;  4QDR A;  4YVS C;  4FT8 A;  1BMV 2;  1RUF 2;  5C3R A;  1JOD A;  3PMS A;  1DIW A;  1FOD 2;  2XVL A;  5IVJ A;  3GNE A;  5T52 A;  2BBV A;  1CIY A;  5C71 A;  1DYO A;  1VAV A;  3VZL A;  3OYW A;  1SDW A;  1ZRE A;  3MLJ A;  1AVB A;  1CPN A;  4DFS A;  2WC2 A;  3VBF C;  3A23 A;  3LSE A;  1ULF A;  3NO8 A;  1GP6 A;  2VEC A;  3OSD A;  4BXS V;  2QQK A;  3TB0 A;  4EN8 B;  4ZS2 A;  1POQ A;  2PA7 A;  5L9B A;  5E8A A;  3VHR A;  5K7P A;  1JTZ X;  3B00 A;  3E1F 1;  3MW3 A;  2J42 A;  3N9Q A;  2D6P A;  2R06 3;  2WYF A;  4UOJ A;  4COY A;  2FDG A;  1IPS A;  2PHD A;  1NLQ A;  1WMF A;  3VBU C;  3PVO A;  1DQ5 A;  1NCQ A;  1H8T A;  4CP9 A;  2ZML A;  4Q26 A;  4LOT A;  4I01 A;  4CCD A;  3F95 A;  1O91 A;  5A3U A;  3LPF A;  2R07 3;  5AC9 3;  4W4Z A;  3HOB A;  3FHI B;  4A3Z A;  1AYM 2;  5CU1 A;  4BIO A;  1DQ4 A;  1GMM A;  1HRV 1;  1GLH A;  3B93 A;  3WF2 A;  5JCT A;  2DWR A;  5F3I A;  2PAM A;  1ZRR A;  3DGT A;  3AXE A;  4PLM A;  1H4H A;  2W1Q A;  1TME 3;  5FZB A;  5JXG A;  2WYS A;  1US2 A;  2V72 A;  5FZ7 A;  4K21 A;  2YFZ A;  3K4Z A;  3WG4 A;  2WNU C;  4MGQ A;  3UJO A;  4KMQ A;  3MIC A;  4HN0 A;  2R1D A;  4LA3 A;  4QGM A;  3SIS A;  2FZ2 A;  4BH9 A;  4NUB A;  3HBK A;  1QNY A;  1BQP A;  1CAW A;  1W8H A;  5DDJ 1;  1VB4 A;  5JOW A;  1QDO A;  2OXB A;  4YVS B;  1ENX A;  1TZO A;  5IAT A;  2VCA A;  4R9B A;  4TTG A;  1W8U A;  2R32 A;  1CES A;  2WSU A;  1F15 A;  1UU5 A;  3VBF B;  1RVF 3;  4AHW A;  4BDV B;  3WP4 A;  4GQ7 A;  4S2G A;  4UFK A;  4Y3O A;  4XYX A;  4EZ4 A;  4G9S B;  3POB A;  4XAE A;  1W39 A;  3NNF A;  4QHZ A;  1QEX A;  5IJR A;  5LK7 B;  1VRH 1;  4XF9 A;  1HN0 A;  4IEV A;  4AK3 A;  4HG6 B;  1R08 2;  2GN3 A;  3IMM A;  4XE9 A;  5C3S A;  1RUD 2;  1CPM A;  1RUH 1;  2VMD A;  3AK0 A;  2G9F A;  1XSQ A;  1B35 C;  3VBU B;  1JYI A;  4IUG A;  3NNM A;  1ZVF A;  1HB4 A;  1RUJ 1;  5E88 A;  2R7E B;  5F3E A;  3O1R A;  2RS5 2;  1UU6 A;  3ZR6 A;  2WNO A;  5FZO A;  3ZXJ A;  3MYX A;  2VNG A;  1GP4 A;  1J59 A;  2QNK A;  2W08 A;  4HAN A;  3K3N A;  3AZY A;  5T3N A;  5A3T A;  2W0X A;  1UX6 A;  2W91 A;  1VBE 1;  3KWV A;  2RV9 A;  5FP9 A;  2VTF A;  3HR9 A;  4CU9 A;  2VMF A;  1C1F A;  1BEV 3;  2VTX J;  5FUN A;  5JR7 B;  1VBD 3;  3ZPO A;  3ZMN A;  2GNT A;  3TN9 3;  1CZT A;  4MUV A;  3QBQ A;  1W6M B;  5A7W B;  3JCI A;  2B4K A;  4DXR A;  4AFA A;  1RUO A;  4MGT A;  3BOD A;  2CGP A;  3GZU C;  1F5J A;  1KDM A;  2W87 A;  4XPV A;  5FQ0 A;  4LTA A;  1RIN A;  1UY1 A;  1VBC 1;  5C4W B;  5F5Q A;  2I45 A;  3ZFF B;  1DGW A;  5A1F A;  3UKT A;  4Y22 A;  2BV4 A;  5DQ0 A;  2WLQ A;  3FJS A;  5KXD A;  5L9R A;  2JE7 A;  4DIQ A;  5JWP A;  2WA3 A;  4Y4R A;  2A3W A;  4KWU A;  1GZC A;  1W9W A;  4CCJ A;  5DAV A;  1NCR C;  4LK6 A;  4XHB A;  4WZC A;  1ZBE 2;  4IER A;  5BNQ A;  1RIT A;  3LPG A;  3WSO A;  2ZAB A;  1H9P A;  1Q8S A;  4NN0 A;  1LOF A;  1QMJ A;  3I97 A;  1ACC A;  4CXX A;  2J1R A;  3RGB A;  4EQV A;  4YGE A;  1X8E A;  4Z92 B;  1RUF 3;  2ZEW A;  3B69 A;  5DXD A;  1FOD 3;  1PVC 3;  4LNV A;  4IEX A;  2ZHL A;  2GMM A;  5C3O A;  4PQQ A;  3NWK A;  4FFH A;  3D6E A;  3U4X A;  1DQ2 A;  3VDB A;  3RYK A;  2VXR A;  1J83 A;  4S2F A;  4XEZ A;  4Q5O A;  1GZW B;  4GH4 C;  2YPD A;  4BPZ A;  5B2G B;  1X8M A;  2BRT A;  2ZGQ A;  4NWV A;  4P14 A;  3UGH A;  5FO9 B;  2Y0O A;  3MF6 A;  3WP5 A;  1N1S A;  2R0H A;  1WLD A;  4OQ8 A;  1W6Q B;  2QQU A;  3BPZ A;  1QJY 3;  3BU0 A;  1LOE A;  2G1M A;  3M3C A;  3ORJ A;  3VDD A;  1VIW B;  3SCF A;  1POV 0;  2XWB B;  4E4D X;  4EZH A;  2D6K A;  4MAD A;  5DUX A;  4CDW A;  1QH6 A;  1YQ5 A;  2VVF A;  3MPB A;  4LKF A;  2FQP A;  1W06 A;  2ZGR A;  4QPG B;  3DPR B;  1ND3 A;  2EXK A;  2RM2 1;  3W9A A;  3ZYG A;  1AYM 3;  4TSV A;  5EJZ B;  1RED A;  2JDH A;  4MYE A;  4XJA A;  1ZBA 1;  5FPB A;  2Q8O A;  3KCC A;  1UL9 A;  4IW3 A;  1LHU A;  2D5H A;  2VBD A;  5D21 A;  1UW8 A;  5GLZ A;  4LHN A;  1UY2 A;  4D7T A;  1WBF A;  3NJV A;  3Q9O A;  2HWD 1;  2B45 X;  1SFP A;  1RIR A;  2ARC A;  1UZY A;  3O0W A;  4QX3 A;  2J1U A;  1NY7 1;  2OII A;  4NHM A;  1P8J A;  1NCR B;  4X8N A;  3LA7 A;  4JDO A;  2B8M A;  3ZSM A;  5L36 A;  4KU7 A;  2IC1 A;  3ZXL A;  3ZR5 A;  3KCY A;  4YFZ A;  3ZYB A;  4C0B A;  4D3W A;  2K2S A;  3GBG A;  1L7L A;  2AZ5 A;  4COW A;  4RA0 A;  3G6J B;  5GLU A;  4XVH A;  3TNP B;  4E2S A;  4HL0 A;  4W65 A;  3U14 A;  3HBZ A;  2ZKN A;  4Y33 A;  3I2F A;  4XFG A;  2AGS A;  2R1B A;  4W6Y A;  5JAX A;  2P17 A;  1AXZ A;  5K0U C;  1VR3 A;  1HB3 A;  4RFR B;  3RVH A;  4TZD A;  3ES1 A;  1J1T A;  2Q8E A;  1SCR A;  1US3 A;  2BTV C;  2JEM A;  4C8D A;  4A3X A;  1OVS A;  4OMD A;  3M1H A;  3WQB A;  4MX3 A;  5CIR A;  4HK9 A;  3IPV A;  1LKN A;  3I59 B;  3IB3 A;  4LO4 B;  5CVR A;  1JMU B;  2JEN A;  3ABZ A;  1HQL A;  5FMO S;  1CON A;  1YQC A;  1URX A;  1VLN A;  1LGN A;  3H9A A;  2CHH A;  2ZOE B;  4WM8 B;  1NZI A;  3AFG A;  1EUT A;  1N3P A;  3CJI C;  4LXL A;  2LW8 A;  4R9A A;  5KHK A;  3WW3 A;  1QOO A;  3DEC A;  3ZOI A;  3ZXD A;  5DUW A;  1PGW 2;  4Y20 A;  5CFC A;  4XUT A;  4I09 A;  4R9D A;  4AED A;  2E32 A;  4OHZ A;  4IND A;  4GMP 3;  1QJU 3;  2TUN A;  4BMB A;  2DCK A;  4LMF A;  4CU8 A;  5BNN A;  2G9G A;  1EPW A;  2BPA 2;  4MXV A;  2WWS A;  5DDJ 2;  4CDU A;  4CPB D;  5EFU A;  2GC2 A;  3T2Q A;  1D4M 3;  2XVG A;  4LIV A;  3KV5 A;  4OI4 A;  4CEW B;  1LAJ A;  1Q56 A;  1MAC A;  4D7Y A;  1SG3 A;  4KH9 A;  3TOJ A;  3ZFF A;  5LA0 A;  1R1A 3;  1OXC A;  5C8C B;  1O59 A;  3H7J A;  3TEZ A;  4QM8 A;  3K75 B;  1UKR A;  5C7G A;  4YNI A;  4Q0P A;  2PHT A;  5F39 A;  4FOY A;  3ACI A;  4YZ1 A;  3M8L A;  5H9S A;  4NIG A;  2BZD A;  4K3U A;  1UXZ A;  5C3P A;  1VRH 2;  1GYK A;  1V6N A;  1QOT A;  4AEK A;  2P3I A;  3IDB B;  4XAB A;  4CA9 A;  1ULC A;  4X6Q B;  3LA2 A;  3VL9 A;  5CFD B;  3TYJ A;  2WAB A;  1GWK A;  4QXH A;  5CBL A;  1ZBE 3;  3PDQ A;  5IVB A;  2RR1 3;  1JZ5 A;  5GZG A;  2ZA9 A;  5E6H A;  5HXM A;  4CRQ A;  5D1I A;  1O4T A;  1O8S A;  2V5Y A;  5FPA A;  2R30 A;  2RDQ A;  2YRO A;  4J1X A;  1J3R A;  3S7E A;  5FZH A;  1GZW A;  1VRB A;  3O7O A;  1K45 A;  1G6N A;  2HWE 3;  4HT1 T;  5LY2 A;  2UYB A;  4CU6 A;  1WW4 A;  1H2M A;  3POE A;  4EWE A;  1Y4W A;  1QJZ A;  4W6X A;  4XFI A;  1JXN A;  1JN2 P;  1UOG A;  1H1M A;  3ZXK A;  1FMD 3;  2MPF A;  4JRL A;  4EN7 B;  5A1L A;  5J48 A;  3T4V A;  1XC6 A;  4K40 A;  4IEU A;  4JTO A;  2VCB A;  4KBZ A;  3KMH A;  4FPY A;  5A7Q A;  2O8O A;  5FYI A;  3ZYH A;  4CCN A;  2P3K A;  4A7Z A;  3CJI B;  2ZEY A;  1VB2 A;  1NX9 A;  3WUD A;  4ZZ8 A;  4Y1U A;  1XNB A;  1JHN A;  3WF3 A;  5C33 A;  5FOJ B;  1VMJ A;  3VBR A;  4OQ9 A;  2GAU A;  4JTN A;  4K8R B;  3WF4 A;  1H9W A;  2YBP A;  1O3R A;  4TN7 A;  3WDY A;  4AHZ A;  2J1A A;  2GDF A;  1ZRI A;  4BA6 A;  1T6B X;  4DIN B;  1F35 A;  3JD7 1;  2Y6F A;  2ENR A;  2OUJ A;  3D0S A;  2BVB A;  2WT1 A;  3RYP A;  4KWL A;  3TAY A;  3QD6 A;  4XMA A;  3DUI A;  1IZ3 A;  5FYS A;  4DXT A;  3KV6 A;  2CGN A;  3LEK A;  4Q27 A;  2HBT A;  3WV6 A;  4XZU G;  3ZIX A;  5I0U A;  2VZO A;  4Q0Q A;  5HXV A;  1NQD A;  3BCW A;  3RQ0 A;  2P37 A;  3WQ1 A;  4D6Q A;  3OD0 A;  4R8H A;  1V6O A;  2GU9 A;  3C7H A;  1IS4 A;  1FPN 1;  4PBP A;  5I0D A;  3AP9 A;  2SBA A;  4NHY A;  1HQN A;  1MS8 A;  4LKS A;  3IMN A;  3OCP A;  3PU3 A;  4AOC A;  2J1S A;  3VZK A;  5BNO A;  2HYX A;  2HEY F;  1WKY A;  2XXZ A;  3L2H A;  2YU2 A;  3J8F 1;  5F5C A;  1C57 A;  4BLJ A;  3WXP A;  5L9V A;  2QZ3 A;  2AEY A;  3RWK X;  4E8D A;  3LIH A;  3CF6 E;  3OY8 A;  4QQL A;  4NWW A;  4P9G A;  1QOS A;  4IV1 A;  3W59 A;  1Y9G A;  3ZFE A;  4FPJ A;  2XQX A;  4FSJ A;  4NRO A;  2JDZ A;  4K1Z A;  2VZV A;  4QB1 A;  1RHI 1;  3DL3 A;  5E89 A;  3U11 A;  4LPL A;  4P5H A;  3I59 A;  2OKX A;  4PDW C;  4IEQ A;  3D82 A;  4QT6 A;  4N8M A;  5A6Z A;  5AFE A;  4D6S A;  4XIL A;  5CKM A;  4K8F A;  1ZZ7 A;  4JGY A;  4WM7 C;  4OHV A;  2CSG A;  1VMH A;  2VG9 A;  4Q4X 2;  1IG0 A;  2WNE A;  4AFB A;  4CDX B;  4CVU A;  4FTS A;  3PNA A;  2A6X A;  1RXG A;  3D0J A;  4UF0 B;  1HRV 3;  4D69 A;  1MS3 A;  4D8M A;  5A32 A;  3PHM A;  4XDO A;  4AVC A;  2VZP A;  1Z0H A;  5FZD A;  5IAX A;  3S5Q A;  3BTA A;  3THP A;  2ZEZ A;  5LWB A;  4NHK A;  3U37 A;  3MIF A;  1NY7 2;  3O1U A;  2JE8 A;  2JG9 A;  3PTY A;  4AG4 A;  4Z2W A;  3AZX A;  4R4Z A;  1UY3 A;  1GR3 A;  4O9E A;  4Y1X A;  3MIB A;  1SDD B;  3NAP C;  3T1M A;  1BMV 1;  1XXN A;  4CDQ C;  4CXY A;  3AZV A;  2OT7 A;  2HEW F;  1HQW A;  3PUR A;  4E2Q A;  4BQ5 A;  4XUO A;  3POF A;  3IIA A;  5LBE A;  4N53 B;  2EIG A;  1X50 A;  3AJZ A;  4IE4 A;  4XAC A;  2RMU 1;  4CCL A;  4I0W B;  2J7M A;  3DYO A;  2VZQ A;  2A70 A;  3KB5 A;  4ITC A;  2XOM A;  5EWS A;  3KLS A;  4BQW A;  1LNS A;  5HI0 A;  1ZRF A;  4NPM A;  2JG8 C;  2VBB A;  2VXJ A;  2A6Z A;  3J7L A;  1VRH 3;  1UPS A;  2W92 A;  2D3R A;  2XHN A;  1YJK A;  3LAG A;  1RGS A;  3NJX A;  1UZZ A;  4IE6 A;  2DVA A;  4Y24 A;  1UWW A;  3I54 A;  3RZG A;  1RUH 3;  2ZX1 A;  4LHL A;  4ET7 A;  5DG1 A;  4LLF A;  2QQN A;  1L7R A;  1JOJ A;  3K4A A;  3EBR A;  3NMB A;  3WLU A;  1W2N A;  4HET A;  1RUJ 3;  4NAM A;  5JMO A;  3V0B A;  1L7Q A;  4SBV A;  1QQP 2;  3M3Q A;  2BYV E;  4Q4Y 1;  5FP7 A;  2ZEX A;  4Q1R A;  2BP6 A;  5FYT A;  2WAA A;  3K4D A;  2ZGS A;  1AF9 A;  3USU A;  1FAY A;  5A6Y A;  3RS6 A;  5K9Y A;  1N3O A;  3LEM A;  3TEW A;  4MGK E;  1NCQ C;  4IGO A;  1VBE 3;  2P3Y A;  5FXW A;  3T2T A;  1CX4 A;  2VC9 A;  2XJV A;  2W5F A;  4P9W A;  3T3Y A;  1GOH A;  4WVW A;  1A78 A;  2WUH A;  3AKR A;  3HPN A;  4KG8 A;  4P5Y A;  5FFO C;  5IUQ A;  1K5J A;  3ES4 A;  2XUE A;  2YDE A;  1JOB A;  3LEG A;  3Q8F A;  4UFL A;  4LO8 A;  5C9A C;  1UMH A;  4CXW A;  4JZR A;  5M0T A;  3O12 A;  2ARB A;  4ISQ A;  3VBO B;  3WHU A;  1BXH A;  1JZ7 A;  1APN A;  1PM7 A;  4Z82 A;  2PAE A;  3RDI A;  4CTE A;  3O1P A;  1DLC A;  3W5N A;  4LHS A;  1MS9 A;  3NV3 A;  3IAP A;  3SLI A;  1AYN 2;  1W0N A;  1JHJ A;  2YGM A;  3BIW E;  3KHB A;  3KQR A;  1VBC 3;  3MFC A;  3NAP B;  4JKK A;  2EXH A;  3M7A A;  3GM8 A;  4IL7 A;  1CJD A;  4N90 A;  1O3T A;  2J22 A;  3HNM A;  1PZ8 A;  3WNK A;  4O9G A;  2BW8 A;  4KG0 A;  4YM0 A;  3N4M A;  3RZZ A;  4AFC A;  3S30 A;  2YHJ A;  4QX7 A;  4UAP A;  1W8N A;  2I07 B;  1W6N B;  2JG8 B;  2WO3 A;  4XTM A;  5F32 A;  1MZ5 A;  1JYT A;  1RUD 1;  3IWZ A;  4CCM A;  5IYY A;  1COV 1;  5LBC A;  1WLW A;  1TG7 A;  3GYD A;  3I3D A;  3BGA A;  3P1I A;  3I2D A;  1QKQ A;  4DMI A;  1ENR A;  2LUW A;  1R1Z A;  5FJK A;  3DCQ A;  3KVA A;  2IZW A;  4NPR A;  3OB8 A;  2RS5 1;  4M3C A;  2WN3 A;  1IS5 A;  1V00 A;  4H7L A;  3MV0 1;  4MSV A;  5BV6 A;  4Y1V A;  3E5Q A;  3O0X A;  2ZGN A;  4K1Y A;  2NPI A;  1E5I A;  2BNN A;  3O1T A;  3N9N A;  4M3C F;  2XJQ A;  1LOA A;  1YC6 1;  1W9S A;  1WLC A;  3FFQ A;  1AR9 1;  3AZW A;  5TSW A;  5HCA A;  1YFU A;  1J84 A;  1SPP B;  4LOS A;  3POG A;  5J09 A;  5LEJ A;  3T2O A;  1RUE 1;  4A2U A;  3LOI A;  2GP5 A;  4LT5 A;  4V2W A;  2A73 B;  2OW4 A;  3OGG A;  1X82 A;  2PAK A;  2YGL A;  4DO0 A;  1C4R A;  4LO5 B;  2ZXQ A;  2RM2 3;  2VQA A;  2X29 A;  2B5H A;  4J25 A;  4ASL A;  1ZBA 3;  3SKV A;  1SLL A;  4ZPI A;  2Q1M A;  2HWF 1;  3I49 A;  4FOV A;  2Q8C A;  4B8E A;  4Q2F A;  3K46 A;  4JAA A;  4Q0U A;  2HWD 3;  2OS2 A;  1U5I A;  4IE5 A;  2IXC A;  1D4V B;  1ZYB A;  2KM2 A;  2XDV A;  2IXH A;  2RDN A;  4IXL A;  3BB6 A;  1D0G A;  3B02 A;  3FC0 A;  5LEK A;  5T5J A;  5GZD A;  1ZRD A;  4RR3 C;  2JDU A;  2HWC 1;  1WBL A;  2WBK A;  2ZZQ A;  5L73 A;  3BUC A;  1WD4 A;  2GZW A;  4CEY B;  4YG0 A;  4GJZ A;  1DG6 A;  4IET A;  1OOP B;  1CAU A;  4MGZ E;  5IVY A;  2VOV A;  3B01 A;  1S0F A;  4XW3 A;  1JUH A;  2PHX A;  4DUX A;  2Y26 A;  3H1Y A;  4L11 A;  5FZC A;  4YG6 A;  5FKC A;  3U1X A;  5BNP C;  3FHA A;  4WVV A;  3UK9 A;  5F37 A;  1XYO A;  2YZ4 A;  1DGL A;  3UGF A;  2D43 A;  2RVA A;  4XMI A;  2RE9 A;  4Y5S A;  2R16 A;  1W03 A;  2R04 2;  2RJ2 A;  4YVW B;  1Z7S 1;  1POV 1;  1JU4 A;  2QQM A;  2OQ7 A;  4FTB A;  3MW4 A;  3SXW A;  3BN6 A;  3UET A;  5JZG B;  1CAX A;  3QH7 A;  4JQT A;  5J36 A;  1RUI 1;  2GAL A;  3JQX A;  4XJZ A;  1YIP A;  2UWB A;  2Z2S B;  3EYP A;  3IDC B;  1AHS A;  1EAH 2;  3KSC A;  3AYA A;  4DRR A;  4HSL A;  4LBL A;  2WNV B;  2WS9 2;  1U0A A;  2Y6K A;  1K5M B;  3J4U H;  4BU2 A;  1YXW A;  1WMX A;  2JXA A;  2WA4 A;  3NNG A;  1OHF A;  1WD3 A;  1WW6 A;  2BJS A;  4YGD A;  5E16 A;  4YW2 A;  5FYC A;  3UYJ A;  3VKM A;  3IAQ A;  4RS5 B;  5A3W A;  4KNC A;  4CDW C;  1YCI A;  4YAR A;  1AJO A;  4LE3 A;  4RYD A;  1RYY A;  2W46 A;  1J58 A;  1OA3 A;  1QJF A;  2ZAH A;  3VBS A;  2A5Z A;  3BTZ A;  3FHQ A;  1G86 A;  1R09 1;  4K6B A;  2PHF A;  3BTY A;  2YMZ A;  2Y8K A;  4HVO A;  4Q8K A;  2RMU 2;  5HV4 A;  5H9Q A;  5FY8 A;  2IVI B;  2WT2 A;  1SHW B;  1ODM A;  1XE0 A;  3LWC A;  4H14 A;  4URA A;  2BQP A;  3SEE A;  4RR3 B;  4BWO A;  2P5B A;  5GZE A;  4GB3 2;  2VCM A;  4L99 A;  2DCY A;  3GXU A;  1WUV A;  2CAU A;  3ASI A;  5CZK A;  5EP9 A;  1D2Q A;  5CG9 A;  4QD2 A;  5GZC A;  4KGG A;  1DYK A;  4CYD A;  4ZHN A;  4XBN A;  2ZHM A;  1NG0 A;  1A8M A;  1H4G A;  3IKW A;  2P3J A;  3SC7 X;  1FYU A;  1NA1 A;  2P6H A;  2A1X A;  4QPY A;  1C28 A;  5JXJ A;  2BU9 A;  2RS1 1;  5I91 A;  4XBQ A;  5BNP B;  3M4F A;  1HV0 A;  4RL7 A;  5IVF A;  2TEP A;  3E97 A;  4Q4Y 2;  1WME A;  1MQT B;  3OBZ A;  5EV7 A;  2WR9 A;  2JJ6 A;  3C3V A;  1C8M 2;  1Y3T A;  3P6B A;  4ONU A;  4YLZ A;  2GH2 A;  4AAP A;  4OI0 A;  3I3E A;  3JZV A;  4WV8 A;  2NMN A;  1LOC A;  1REE A;  3ZFG C;  1G9A A;  1UY0 A;  1WMD A;  5T55 A;  1BLZ A;  1IG3 A;  3I4I A;  2PQS A;  2WLP A;  5HCH A;  2E53 A;  3OGS A;  3OPZ A;  2B9U A;  1NQJ A;  1PGW 1;  1MR5 A;  5BY5 A;  1H2N A;  5D8A A;  2VME A;  4FQ4 A;  5FY4 A;  2J1V A;  1Y9M A;  1OD5 A;  4EE2 A;  5I0T A;  3X29 B;  2WZ8 A;  3ZSL A;  2HBU A;  1W8T A;  4B7E A;  2ZGP A;  1UZW A;  3B9C A;  5FO7 B;  1H2K A;  2PLV 2;  4FPF A;  4GIQ A;  2CV6 A;  5ABJ A;  3ZXG A;  3ZYP A;  3H8O A;  5CA6 A;  5JIU A;  4UW3 A;  2LS6 A;  5FMB A;  4CUC A;  3JD7 3;  1NUK A;  4ZKT B;  1WCK A;  5CFC C;  3LOB A;  3AMP A;  2ZGM A;  3GDB A;  2FDI A;  3VUO A;  2H6B A;  5FPL A;  3CZJ A;  4AED C;  4RHV 2;  3ZLI A;  4CUA A;  2VUA A;  3KF3 A;  1WLT A;  3GJB A;  5BNN C;  4PCR A;  3DXU A;  3M3E A;  4YPJ A;  1SBD A;  4CDU C;  4AW7 A;  1F4A A;  2DBN A;  3OBR A;  3AP5 A;  3NV1 A;  1HIX A;  4R4X A;  4NII A;  1VPH A;  1X7N A;  3LCP A;  2ZZJ A;  3WG1 A;  4YGB A;  1JZ3 A;  2E33 A;  1GBG A;  1DHK B;  1COV 2;  2WFF 3;  2P4E A;  1FPN 3;  3CMG A;  4KQ7 A;  1CAV A;  1S55 A;  5FZ3 A;  1Q8O A;  3W20 A;  1UIK A;  2ZMN A;  1BVV A;  2E7T A;  4LKD A;  3RPQ A;  3OPW A;  3WNP A;  2YU1 A;  1U12 A;  5KWR A;  2DV9 A;  4QX1 A;  2UUR A;  1UYP A;  3BIE A;  5EHD A;  4ASM B;  2VW1 A;  1AZD A;  1V0A A;  3J8F 3;  4GA9 A;  4YZ4 A;  1YFX A;  4OI2 A;  4YWA A;  5FZF A;  3HT2 A;  4AI2 A;  4KBB A;  5L7O B;  1GQH A;  3ZDV A;  1VP6 A;  4N7U A;  4BM8 A;  3CNA A;  1W28 A;  3VBH A;  1LES A;  3ZN6 A;  1OSG A;  2BBA A;  3PIG A;  5EYX A;  3ZFG B;  3VDA A;  1AR9 2;  3USS A;  4HBN A;  2JKB A;  3HNY M;  1RHI 3;  2QQL A;  2WNU B;  1HN1 A;  1NKG A;  3Q8E A;  3A4U A;  1X36 A;  2B39 A;  1RUE 2;  4O61 A;  1LCL A;  1Y7B A;  4QXB A;  5DUV A;  3B3Q E;  4OUS A;  1V9U 1;  1OQ1 A;  4MXW A;  2UWC A;  4HKW A;  2IWG B;  4PIY A;  2JEC A;  3RSJ A;  5FMC A;  3I7D A;  2VY0 A;  3WW1 A;  1RB8 G;  3MW2 A;  4LE4 A;  3RG0 A;  2XL7 A;  4BHP A;  4QHO A;  4KWK A;  2WKK A;  1ZZC A;  2ZHN A;  1GNZ A;  1XNK A;  2HWF 2;  2JWP A;  2X5I A;  3MGU A;  4QB6 A;  2UY9 A;  1IPJ A;  2WIN B;  3QOP A;  4XQ4 A;  1MZE A;  5JUV A;  2FMD A;  4OZX A;  5LW9 A;  5FY9 A;  4AI0 A;  4RFT 0;  4QPI C;  2R6Q A;  1XJA A;  5EYY A;  2DVD A;  3NQH A;  4N43 C;  1W8O A;  1OF3 A;  2BWC A;  2AR6 A;  3N7J A;  4M0N A;  4YW7 A;  2HWC 2;  4RD7 A;  4A44 A;  4B1L A;  1DZR A;  1G7Y A;  1UN1 A;  1W6P B;  4XCA A;  1B35 B;  2VQ0 A;  3WCS A;  4Q0V A;  3S57 A;  3MUY 1;  5JR2 A;  2XL9 A;  5FKB A;  1KFX L;  1OLR A;  3I8T A;  2RMU 3;  2JDN A;  4LUM A;  4OUE A;  2PHU A;  3POY A;  5FK8 A;  1PMJ X;  4DZG A;  3AXD A;  3I3Q A;  4QQ2 A;  1OQD A;  1ODN A;  2R49 A;  2V5D A;  5LBB A;  4KL1 A;  1HXS 1;  1MS1 A;  4M01 A;  1DDL A;  1LOG A;  1AL2 1;  1VBB 2;  3T0A A;  2EAL A;  4G4F A;  3C7F A;  3OOX A;  4QB2 A;  4YZ3 A;  1GFF 2;  4BOW A;  4FAG A;  1Z7S 2;  4K20 A;  3UV9 A;  4F83 A;  1MQT A;  3FUO A;  4AVS A;  4TWT A;  2CL2 A;  2PFW A;  3K77 A;  5LA9 A;  5A3N A;  1QH7 A;  4XJW A;  5LA1 A;  5F9T A;  2ZS6 B;  3H8R A;  2Q8D A;  1BK1 A;  2ET1 A;  3DXT A;  4Q4Y 3;  1RUI 2;  2AH2 A;  5JPM B;  2JE9 A;  4Q4X 1;  1ZA7 A;  1NE6 A;  2MHF A;  2NN8 A;  1WCQ A;  4E4Z A;  3I2K A;  2KD7 A;  1HRI 1;  3H0O A;  4AYU A;  2QTW B;  1F5F A;  2OYZ A;  2CWM A;  3WUC A;  4WVM B;  1A3K A;  2D6O X;  2NP0 A;  5H9P A;  4HZF A;  3ZXE A;  2VE1 A;  1PK6 C;  3PU8 A;  4JGY C;  5G04 L;  4EV0 A;  4YVS A;  4LIT A;  1GV9 A;  4NVP A;  1R09 2;  2DUR A;  4QPI B;  3GAL A;  4QAW A;  1DGR A;  4UWD A;  1PNG A;  1EP0 A;  1RMU 2;  1JW6 A;  4P08 A;  2PHL A;  3VBF A;  1UY4 A;  3A21 A;  2XML A;  1WZX A;  5FZ6 A;  3MLL A;  2WWU A;  4PF1 A;  3VKN A;  3LDB A;  2D40 A;  4XQW A;  1UPI A;  4A6O A;  5FY0 A;  1L3J A;  4AZZ A;  4BQ2 A;  4D7S A;  4LBN A;  4QU1 A;  2LAL A;  4ZXE A;  1Q5O A;  3ZXF A;  3LDK A;  4OFG A;  5KHI A;  4BQX A;  2A6V A;  2EIB A;  4GH4 B;  3ZIW A;  5FY1 A;  2A6W A;  1H6X A;  5JI9 A;  1NLS A;  3VBU A;  4Z07 A;  1R08 3;  5AFB A;  2RS1 2;  3MF9 A;  4MH0 E;  3UL2 A;  4IV3 C;  3WNX A;  3ZSJ A;  1RUD 3;  2BFU S;  1ULE A;  4XFH A;  1YFY A;  5F5A A;  3S6P A;  3T08 A;  1COV 3;  4UFH A;  5DAP A;  2HWB 1;  3N7M A;  1NE4 A;  2WT0 A;  3BVC A;  5JVV A;  2XG3 A;  1GIC A;  4LBQ D;  4X6R B;  5FUP A;  1I6X A;  1NXM A;  3MID A;  3AP4 A;  5H9R A;  5SV5 A;  5KR7 A;  1W2U A;  1S0B A;  1QQP 1;  2RS5 3;  3FBM A;  5EJ3 A;  1HJG A;  2FZ1 A;  4B4Q A;  4CUG A;  1DCS A;  4JRA A;  4NRM A;  3ZN5 A;  1DBN A;  3O5S A;  1MZ6 A;  2J1E A;  3RZJ A;  1YUD A;  4QPW A;  5IW0 A;  2WO2 A;  3V0A B;  4BK5 A;  2OZ6 A;  2VUC A;  1TNF A;  4LK7 A;  3I2G A;  1W6M A;  5A7W A;  4JVA A;  1FX5 A;  4KI5 M;  3H50 A;  2XWJ B;  2DCZ A;  3VKL A;  1AR9 3;  2CAV A;  4HLT A;  3WQ7 A;  1K3I A;  5A33 B;  5GAL A;  1H0B A;  3AKP A;  3JBG 1;  1F31 A;  5C4W A;  4C1W A;  2K9Z A;  3FUQ A;  5L7O C;  1PK6 B;  4XFB A;  1AX2 A;  3T30 A;  3B7M A;  1ASJ 1;  5ANN A;  1KQR A;  2JIJ A;  2NZ9 A;  5J7M A;  3HAG A;  3JXS A;  1AYN 1;  1YRZ A;  3GCX A;  2GNB A;  5FZK A;  3EMR A;  1I5Z A;  2YUE A;  4FQZ A;  4WBB A;  3CBN A;  5JLV A;  1O4Y A;  5LRS A;  1LEM A;  4DPN A;  3W21 A;  1EY2 A;  3UKV A;  1XU1 A;  1XRU A;  4GAZ A;  1CIW A;  2ZCW A;  5FTT C;  2DTY A;  2E9Q A;  2XKP A;  5DAB A;  3E6B A;  3U78 A;  3WCR A;  3WDV A;  4AQT A;  5HBA A;  3I3B A;  5K0U B;  3BYW A;  2PHR A;  1PMH X;  3AVS A;  2MEV 2;  3AM2 A;  5DAQ A;  3CDZ B;  2ZMK A;  1CN1 A;  1JYX A;  3WHT A;  1OH4 A;  3I2H A;  4IV3 B;  4AGV A;  2ZX4 A;  3WDT A;  3ZMO A;  1ZX5 A;  2GC1 A;  4I02 A;  4MO3 M;  1JZ4 A;  5JSP A;  3O14 A;  2VZR A;  2QQP A;  1N1T A;  5CAD A;  4Q8L A;  3THT A;  1AX0 A;  1TVG A;  1PNF A;  2ILM A;  2X10 A;  2EID A;  3WF0 A;  3ZYF A;  3ZYR A;  3H3Z A;  3R0R A;  4ATE A;  3ILN A;  1LUL A;  1XBF A;  1W6Q A;  2W2I A;  3AP7 A;  4DQA A;  5A6X A;  1ZZ9 A;  5FZ4 A;  5FUI A;  3TNQ A;  4EYU A;  1CR7 A;  1H6Y A;  1W2O A;  3WW2 A;  1QF3 A;  1RUN A;  2DU0 A;  5T5L A;  1AR6 2;  2NQY A;  1V9U 2;  4BIF A;  3A7Q A;  4JCK A;  1Z7S 3;  1POV 3;  4LBJ A;  2QFE A;  1Q8Q A;  1HKD A;  1MEC 2;  3A0K A;  3DPR A;  4QPG A;  4B3N A;  5JSR A;  4P00 B;  2BWA A;  4QX0 A;  3O1M A;  1UOB A;  1DLL A;  4FPG A;  1RUI 3;  4N9I A;  1OC1 A;  4KU8 A;  2V09 A;  3OPT A;  2QKD A;  4DNY A;  4GWN A;  2VZT A;  1UF2 C;  4GWM A;  3EB7 A;  4A42 A;  1RXF A;  5KHG A;  4AVB A;  1NCR A;  1W05 A;  2A3Y A;  2YV8 A;  3APB A;  1S2B A;  3N7K A;  5FYU A;  1ND2 C;  2PMW B;  3NNJ A;  2Q4S A;  1LTE A;  2DU1 A;  1IPK A;  3KQ4 B;  2ZBJ A;  5FK7 A;  4OZO A;  5KHJ A;  2ADD A;  1KJR A;  1LHN A;  1XNC A;  1R09 3;  2GNM A;  3ATG A;  3FWE A;  3K2O A;  3K48 A;  4NAO A;  1NXD 1;  2TBV A;  5LK5 A;  3H7Y A;  1DP0 A;  2IFW A;  2WII B;  2YFU A;  3JQW A;  2WQZ C;  4Y26 A;  4ZZ5 A;  2UU8 A;  3AYC A;  5CG8 A;  1OUX A;  2LRO A;  4NIH A;  2GND A;  2WJS A;  4GKX A;  3DEM A;  5EZW A;  4ZU5 A;  3RNS A;  4MET A;  1HXS 2;  1LOD A;  1PO2 1;  4KWJ A;  3VLB B;  4P9Y A;  3RYR A;  1SBE A;  1SZB A;  1PGL 1;  4UW4 A;  1AL2 2;  1ULO A;  2JKX A;  3SIT A;  4Y1Z A;  4QM9 A;  1VBA 1;  4DEQ A;  1ST8 A;  1JYC A;  2D93 A;  2RDR A;  2WO7 A;  1F4H A;  4LUL A;  1UMZ A;  1X9T A;  4HON A;  3HQR A;  2ORZ A;  3PLQ A;  4Q4V 2;  1OLQ A;  2C9K A;  5F6L B;  5B4N A;  1ZZ8 A;  1ZM1 A;  2J1T A;  3O1V A;  1REF A;  4JGZ C;  4PLO A;  1EV1 2;  1DYP A;  2R04 1;  1AUY A;  1JU3 A;  4A6S A;  5FDB A;  1GZ9 A;  2XQR A;  2VMI A;  4WM8 A;  1GQG A;  5FMD A;  4LBQ B;  4XF4 A;  5G05 L;  5FZ8 A;  5GLW A;  1FI2 A;  1HRI 2;  4RQP C;  2P34 A;  5K8S A;  4N7I A;  3HJR A;  3VHP A;  5KC6 A;  3T0D A;  2RJL A;  4B29 A;  1EAH 1;  1Z78 A;  3VN4 A;  4COZ A;  1W2T A;  1JUI A;  1XB9 A;  2Y33 A;  2RJK A;  3AL5 A;  2NMO A;  2WS9 1;  3NNL A;  2CGO A;  3BKZ A;  3BTX A;  2FDF A;  5FPU A;  2YYO A;  3ILF A;  2TNF A;  2ARX A;  1B09 A;  4CU7 A;  2BNM A;  1CGP A;  4CEW A;  4QXK A;  4F8A A;  3BU7 A;  5JSO A;  1ZRC A;  2D98 A;  3TBD A;  1OF4 A;  2YB7 A;  2YBK A;  5DDJ 3;  3ZKU A;  5C8C A;  2BGP A;  3HN1 A;  2IUW A;  3J7M A;  1V70 A;  3AVR A;  5DG2 A;  3WD5 A;  3SNM A;  4BCU A;  2Z69 A;  4J6G A;  1JZ2 A;  2DUP A;  1W6O B;  4QX5 A;  5FZ9 A;  2JIC A;  1TE1 B;  2OPW A;  5FP4 A;  5CB7 A;  2AEZ A;  3OBA A;  1UX7 A;  2C26 A;  2C0Z A;  2JDY A;  3BI3 A;  3CHX A;  3EQE A;  4GB3 1;  5CFD A;  1KDK A;  3CEW A;  4JKL A;  4FPK A;  4MV2 A;  1LGC A;  4QU2 A;  1R64 A;  1OMI A;  4JQR A;  4FVV A;  4NRQ A;  3RFR A;  4FP2 A;  3E5U A;  4UFI A;  2WZE A;  3JB4 C;  2RHP A;  4NO4 A;  3VBS C;  2UYA A;  4XIO A;  1XPW A;  4I0B A;  4ATF A;  2G9Z A;  1GSL A;  4XUQ A;  4WVZ A;  2EXI A;  1LHV A;  2HWB 2;  4I3G A;  2Q5T A;  2XVK A;  2VGD A;  3IZO A;  1JZ6 A;  4C91 A;  4XET A;  1TMF 2;  2FMY A;  4MHU A;  3H42 B;  4Q1P A;  1RUG 2;  3OG2 A;  4HVR A;  4PDW B;  3NL1 A;  2EVX A;  4JV4 A;  3LB9 A;  5DN2 A;  4FO9 A;  4GKY A;  5A6Q A;  1C8M 1;  4WM7 B;  5FP3 A;  5CKN A;  1CD3 G;  2PHW A;  2WQ4 A;  1IS3 A;  3CJI A;  2CDO A;  5FBZ A;  2RG4 A;  1H8T C;  3WX5 A;  1UMI A;  2BVV A;  2BGO A;  3O1S A;  4RQP B;  5APA A;  4AQS A;  2ZTN A;  3HIF A;  3I2I A;  4P02 B;  5J98 B;  1WA6 X;  3KD4 A;  1NZC A;  1GUI A;  3JBG 2;  2Q1F A;  3AJY A;  3AMH A;  1E5H A;  1WA4 A;  4CCE A;  1YHF A;  3IDA A;  2H6C A;  2W1S A; 
#chains in the Genus database with same CATH homology
 1UZV A;  4AOC A;  1OXC A;  2JDU A;  2WR9 A;  3DCQ A;  1OUR A;  2BP6 A;  2BV4 A;  1OUS A;  5A70 A;  2CHH A;  2JDH A;  1W8F A;  1OUX A;  5A6Q A;  2VUD A;  2JDK A;  2JDN A;  5A6Y A;  4UT5 A;  2XR4 A;  2JDY A;  3ZDV A;  5A3O A;  5A6X A;  5HCH A;  2JDM A;  2JDP A;  2VUC A;  1GZT A;  1UQX A;  1OVP A;  2BOI A;  1W8H A;  1OVS A;  2VNV A;  5A6Z A;  4CE8 A;  2BOJ A;  2WRA A;  5D2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...