5A7NA

Crystal structure of human jmjd2a in complex with compound 43
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
351
structure length
351
Chain Sequence
ESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title Docking and Linking of Fragments to Discover Jumonji Histone Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 110
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a7nA01
5FY0A 3N9QA 3PUAA 5FP7A 3PUQA 5FWJA 3U4SA 4TN7A 5K4LA 5FZ4A 5FYVA 3N9PA 5IVEA 2OT7A 5F3CA 5FZBA 5FYUA 4XDOA 2Q8EA 2OS2A 4QXBA 5FYMA 4IGPA 5FZCA 5A3TA 5CEHA 5FZDA 5IVFA 5F5CA 4XDPA 4CUGA 5FJHA 4GD4A 4QWNA 5FZGA 5A3WA 4D6QA 5LY1A 3OPTA 4CCNA 5FXVA 4GJYA 4D6RA 3AVSA 5LWBA 3AVRA 4AAPA 5FPUA 5A7NA 5IVCA 3ZLIA 5FUNA 5LW9A 2OQ6A 2GP5A 5FZ7A 5FYBA 5F5IA 3KV6A 2P5BA 2Q8DA 3PTRB 5FPAA 4V2WA 5A7SA 3LDBA 2W2IA 3NJYA 4IGQA 5FPVA 3K2OA 2YBSA 4AI9A 5A7WB 5A7PA 5FYYA 5FUPA 2OX0A 4E4HA 5A7QA 5A3NA 4CCMA 4D6SA 5FZOA 4CSWA 3K3OA 5FYIA 3KV5A 5A7OA 5FY5A 3PU8A 4UF0A 3RVHA 5F3IA 4EYUA 5FPLA 4QX8A 4LITA 5A1LA 4GJZA 5FXWA 4EZHA 5F37A 3KVBA 5FZKA 5FZ6A 2Q8CA 5FP9A 4QXHA 4NUBA 5FZFA 5F39A 4QX7A 5FZ8A 5FWEA 3N9OA 2GP3A 2YBKA 2XMLA 4C8DA 4BXFA 3AL5A 4GAZA 5FZIA 5FYHA 5FZHA 2WWJA 2YPDA 5FXZA 5FY4A 3DXTA 5FY8A 5F2SA 5FZEA 2YU2A 5FY7A 5IVVA 2WWUA 4V2VA 3PURA 5FZ1A 3ZPOA 2XUEA 3PUSA 2OQ7A 5F3EA 4Y4RA 5F3GA 3K3NA 5FYTA 5FBJA 5F2WA 3N9NA 4HOOA 4LXLA 5IVBA 5F32A 4ASKA 5A1FA 5IVYA 5FY9A 5FZ3A 4IGOA 5FYCA 5FP4A 5FP3A 5FXXA 5LY2A 5FY1A 4HONA 5FZ9A 3UYJA 4EZ4A 5KR7A 5IW0A 5FZOB 5FZMA 5ISLA 5IVJA 2PXJA 4QXCA 5FPBA 4UF0B 3U78A 1VRBA 2YBPA 4Y33A 2XXZA 5A80A 5FJKA 4BU2A 4CCKA 3KV4A 5FZAA 3OPWA 3PU3A 5ANQA 5E6HA 3PDQA 3AL6A 3LD8A 2YU1A 4CCOA 5F5AA 3KV9A 4LIUA 5FZ0A 4CCLA 5FV3A 3N9MA 5A7WA 4CCJA 4BISA 5FYSA 4URAA 5A3PA 4QU1A 4LIVA 5FZLA 4DIQA 2VD7A 3N9LA 4DO0A 2XDVA 3KVAA 4Y3OA 5FYZA 5FP8A 3DXUA 5IWFA
chains in the Genus database with same CATH superfamily
2UU8A 3PUQA 1LOGA 4FFHA 5FWJA 3VZMA 1OD5A 5A1AA 3CJIC 1J3RA 4B4RA 4D69A 4YFWA 4QU2A 2GH2A 2YY1A 2V5DA 1NE4A 4K3UA 4YGCA 5FYUA 2Q8EA 5FYMA 4QXBA 1L7RA 2LS6A 2D98A 4FFFA 1P8JA 4NHLA 4FXGB 1RUF2 5A3OA 5F5CA 5H9QA 3RSJA 3C7GA 4QPWA 1O6UA 4MHUA 5K8SA 2P2KA 4Q26A 5IHRA 1CAWB 3O1UA 4U2AA 1FOD1 2HEYF 3KSCA 5C9AA 1MS1A 1VRH3 3HPNA 4GJYA 2GH8A 5I0SA 1US2A 1REDA 4CEWA 4FOVA 4M3CF 2WC2A 4EJRA 1W3VA 2VUCA 1R092 3J7LA 4KWUA 4CDQA 3K51A 2WYFA 1QKQA 4YVWA 1EP0A 5FPVA 1CJDA 3UL2A 5K0UA 1O3SA 3KS7A 3PTYA 3HIFA 2VVEA 1T6GC 1MQTC 2WO2A 1I5PA 4U36A 1O8SA 4XAAA 5HBAA 1QQP2 3ZN6B 4NIHA 1QOTA 4FVVA 4L2NA 3N4MA 4LBQA 2ZGPA 3WX5A 3J7NA 3QH7A 4JGYA 4R9DA 3ZFEC 5DAWA 2CGOA 4NO4A 1OFSA 1DYPA 1PGW1 1SQ4A 3VHOA 4HVQA 2W47A 1IG3A 2ZX4A 1UX7A 1XE7A 5DG1A 2RS53 3URFA 4NRPA 2RJLA 4IEXA 2IWGB 3M8LA 1JOBA 4YW7A 5LA0A 2BPA2 3RJ2X 2BBVA 3KT4A 4QKBA 2GC3A 1S0EA 4HSJA 3NWKA 4P9WA 3UKVA 5CFDA 4DXZA 1JS9A 4XF1A 5JAXA 1Y4WA 3CZJA 2E7TA 5KHHA 5LRRA 3O5SA 3PIJA 2J22A 5IVVA 1DP0A 2W92A 5CKNA 4XF9A 4ZU7A 1OI6A 2D5HA 2VBBA 5BNNB 2GNMA 3AMMA 5EPAA 1DFQA 1GBGA 2DVBA 1ASJ1 2DF7A 1ULEA 2OIIA 2RE9A 4YM1A 3BOPA 3ZXGA 2IXJA 4EZ4A 1OOPB 3I3DA 1Q56A 3MBWA 1XNAA 3FZ3A 5KHJA 1XQNA 5IVJA 4HKLA 4C90A 5JR2A 3ZYGA 2GN7A 4RS5A 5FMOS 3BVCA 2QZ3A 2ZHMA 5H9PA 4ZHNA 4Q4W2 2R7EB 4LO7A 2CWMA 2WT2A 5FUIA 4AFCA 4OZXA 2H0BA 2XJVA 3UK9A 5A3LA 3J4UH 2W1SA 2GMEA 2JDNA 3MW2A 3U1XA 1W2NA 4IE4A 4J1WA 4BHPA 5AC93 1ZZ9A 5HCAA 4CZSA 4HT1T 4YNIA 3SMHA 5I91A 1O59A 4E4SA 5FYSA 1Q3EA 1IHMA 3RWNA 4HMZA 3ROUA 4FPHA 1GWLA 1AZDA 1WLCA 4CTEA 2JX9A 2DDUA 2NN8A 2X29A 1KRIA 2R32A 2A3XA 1XYOA 5IWFA 2C9KA 5C70A 1H8VA 1PZ9A 2RS33 3PUAA 4W6XA 2XG3A 3HAGA 3LWCA 1UOFA 4QKDA 3I49A 4LBLA 4YVSB 1UKGA 3LAGA 4XFAA 4TLGA 3HNMA 2W87A 1LOCA 2XVGA 4IGPA 1QMJA 2P4EA 2ZKLA 4PF5A 5CEHA 2R16A 3WG3A 1W3XA 1IG0A 3MI8A 4NHYA 1GKBA 4RGGA 3VZOA 5IJRA 1KITA 1UY0A 2QQIA 2W1WA 3LA2A 4F83A 4H2AA 4Q4Y1 3N35A 4OI2A 1D2QA 5FMOL 3AVRA 4B4PA 2ZHNA 1YQCA 4N7IA 1A8MA 3UJOA 5HV0A 5LK7B 5EJ1B 1POV0 5J37A 4OQ8A 5BNNC 1K45A 4ARYA 5K7PA 3I2OA 1O5LA 3CZUA 1D7PM 5DMYA 3O0VA 1WBLA 3LB9A 1V6IA 4XUQA 3THDA 2WA3A 4M3CA 2Z79A 1OOPC 3BPSA 1URXA 5GZFA 1A34A 2QDNA 2F6BA 3QCWA 4Q8LA 3JD73 4LLOA 3UGHA 4H3WA 4YPJA 1UU6A 4RR3A 2ZABA 2KXLA 3MIHA 1LB2A 2VG9A 2ZGLA 3HNYM 1JZ4A 3FE5A 2WNUB 5F3IA 5T5LA 5FOBB 5LATA 4GH4A 2BRTA 5CZKA 5K9YA 1LHVA 2LUWA 2BFUS 1TNRA 3KQRA 4DINB 2TEPA 3LPFA 5F39A 4HLTA 4CDUC 4Q29A 2VUJA 2WS93 3N9OA 4AYUA 1QOOA 3SISA 4CU7A 3CDZB 3CEWA 3LFIA 3WSOA 1NUKA 3OCPA 4DMIA 1X50A 5I0DA 3DXTA 5FY8A 5AC91 5LA9A 3O1RA 4SLIA 1RUI3 3NV3A 4V2VA 1UU5A 3PURA 4FO9A 4IEWA 4YVSC 2CGNA 2BBAA 4DRVA 4XE9A 3U4XA 5F2WA 1V6NA 2VOVA 5JOYA 2CY6A 2X53S 2IXKA 4XILA 1BQPA 5T5PA 5BYNA 2RS31 1UPSA 3JBG1 4UFMA 3ILFA 1EUTA 1OA4A 3HQRA 4HONA 5LA1A 4AEDB 4FT8A 1IS6A 4Y24A 2WABA 3W5NA 3Q8AA 3W58A 1WW4A 1YIFA 5FZOB 4AI8A 1WMFA 1JODA 1HJFA 5BXXA 3N36A 2WO1A 3POSA 2QQPA 5FJKA 4DEQA 5FLJA 5C8CA 3FL7A 1ALYA 2AZ5A 5EJZB 1JOPA 2XBO2 3K4AA 3ZSLA 5C9AB 2BFUL 3DCQA 2ZEYA 5FRAA 4ATFA 1NYWA 2PLV2 3HN1A 2JD9A 4ZONA 1ZVFA 4CDQB 4EN7B 2QVSB 4NMIA 4K20A 1AX2A 2EAAA 3RGBA 5K0UB 1DU3D 1XNCA 3SCGA 1CN1A 3DPRA 3WNOA 2QQOA 2CDPA 3EBRA 2WNUC 3NAPA 4WVWA 4Y3OA 3NW4A 3WR0A 4EE2A 1QXJA 1DQ0A 3DECA 3MGUA 4FCAA 3POJA 3VZNA 4NIIA 1VE0A 1V6JA 3U4SA 3JD71 1HRV3 5C3OA 3FBMA 1CAVB 1ZRDA 1LENA 4LHNA 2FD8A 4K6BA 1D4VB 4LBQB 2F17A 3PMEA 4FFIA 3WW4A 4BQ3A 5FOJB 4PIZA 5JMCA 1QNWA 3RI9A 5B2GB 3SCFA 3MF9A 3VHPA 1O4TA 5HCHA 3EYPA 2TNFA 5F6KA 2DBIA 5GZCA 4INDA 3H42B 1OFNA 2FZ1A 5LWBA 2VQ0A 3WF1A 2WJSA 3LIHA 5C6CA 1UYYA 4A45A 2R49A 5FUNA 3VD3A 2DUQA 4XTMA 3RRDA 3WDXA 5CFDB 3F95A 1JYIA 4PBOA 1KGYA 2QFEA 5A7SA 1X33A 1VAKA 4P14A 2AR6A 4E9KA 2X10A 3OD0A 5FO9B 5I8TA 4BOWA 1RUI1 3AKPA 4N53A 2MPFA 1GUIA 1UZVA 2ZAAA 3EO6A 3OGJA 3RYPA 4R4ZA 4DUVA 5IK7A 4AEDC 5LA2A 4RSUA 2HWB2 2VCMA 2ZA9A 2Q4SA 2JIGA 2KM2A 5A7QA 3WHUA 2RDNA 2RJKA 4BB3A 4UI9L 1WA6X 1Y43B 3I3QA 4QMAA 1BCXA 2B4KA 4GIQA 3H8OA 2YB7A 1Z7S1 2OW4A 3ALQA 4IETA 4Q27A 1FI2A 4UW3A 4XUNA 3USSA 3ZIXA 4Z1VA 4W6YA 1FPN2 3RZGA 2XJUA 1AJKA 1F5JA 1U5IA 4P5YA 5BNPB 3ZKUA 1YQ6A 4FOYA 2Y64A 1CIWA 3GALA 4UBHA 5T5OA 2PHLA 4NIGA 3VZLA 2Y6LA 3MYXA 3MICA 1W6OB 1LULA 1L3JA 1JOJA 3TNQA 4XW3A 4J25A 2PHXA 2PQQA 4ES9A 1MS5A 3ZM8A 1PK6B 3SKVA 1UKRA 3ZPOA 1V00A 3PUSA 4M0NA 4DY3A 1XC6A 1UO9A 4QPIA 5JXGA 5FBJA 3B3QE 4HOOA 3O14A 5A32B 1QY4A 1GSLA 1ULOA 2QJVA 3POEA 5G04L 4DXSA 1DG6A 5FZ3A 2UWAA 1HRV1 2WDBA 4H7LA 5FZ9A 1GNZA 1AR82 3S5AA 3CO2A 2C4XA 4CP1A 1YFWA 1EAH3 4IV1C 3ZVXA 2BZDA 4BE3A 4I2OA 2XJPA 4KG0A 1XNBA 2EXKA 2RVAA 2ZAHA 2GNBA 3AL6A 4JQRA 3ZYRA 1ZA4A 1XRUA 3NO8A 4M4RA 1UZYA 3H3ZA 3MIGA 4W50A 1R1A2 3T0DA 1L7LA 3LEMA 1UIJA 1K5MB 5FDBA 5HXVA 1F15A 5GLWA 3VL8A 2WUHA 3WP5A 1UMZA 4MG2A 3CLPA 3N7JA 3P3PA 4M3CB 1COV1 1LU2A 1ODNA 2CAVA 1HN1A 2DTWA 2WQZC 2RR13 2X5IA 2JG9A 1JZ6A 1NKGA 4UBGA 4COZA 4ITCA 4RR3B 1CGPA 4K21A 5FY0A 5FP7A 1RUOA 3N3HA 4FPJA 2A6XA 2QQUA 3P1IA 3FUOA 4TWTA 5CKMA 5FZ4A 1W6NA 4QDQA 5BNPC 1PMIA 4ONUA 4AVVA 1ZZCA 1ULFA 4J6GA 1PNGA 3CJIA 2VMGA 2UY8A 1OPOA 4FP3A 4O9EA 4CDWB 4DQAA 5DDJ2 4EV0A 5ABJB 3SXWA 2P3JA 4QGLA 4AZZA 3KM5A 1KS5A 3RI8A 4DXTA 1H6XA 3VDCA 1W04A 4QWNA 1RUH2 1OKOA 2WZR3 5FIXA 2J1RA 2YG0A 3I54A 4NHKA 4AGGA 4TTGA 4ES8A 1PK6C 1GP5A 4A6OA 1EUUA 3VBFB 2XB6C 3GBWA 2CAUA 3OB8A 4FXKB 1UOBA 2AACA 1A78A 4XC9A 5A7NA 1S2EA 1V70A 3ENRA 3LEKA 4X6RB 2PHFA 5LW9A 2WT0A 1W9TA 2P5BA 2Q8DA 3VBOB 3JCIA 1H1AA 1LJ7A 1YLLA 1B35B 1WGPA 2YBSA 3B7MA 1BEV3 2YPJA 4OCTA 3MIFA 4JCKA 3J9SA 3L2YA 1AYM3 2R062 1LAJA 5ACA3 5A3MA 5CB7A 5GJ6A 4AG4A 1MQTA 3EJKA 4AI2A 5EQUA 1PO21 5FCCA 2Z42A 3NSTA 3R4UA 4HVOA 4CCDA 2G9ZA 2P6HA 5A1LA 2VVDA 1HB1A 5FZKA 4GWMA 3TEWA 1EAH1 1K5MC 1NQDA 1QJX1 2FQPA 1UIKA 3ZFEA 4AEKA 1GOFA 2OA2A 2KR2A 4AQ2A 4CP9B 3NNJA 3TN93 4Y1VA 3KWVA 3VKFC 4LEJA 1VBA1 1MEC2 4UAPA 2CSGA 4OUMA 1I9RA 4YFZA 1SLTA 1DQ2A 1RYYA 3D82A 3ZFGB 2FCTA 5FY7A 4DS0A 1G9BA 1JYWA 1U5ZA 5AVPA 5G05L 1K12A 3DPRB 4RFRB 1RUC2 3GZUC 4LKDA 4QKNA 1LKNA 1RUE2 1T2XA 3A0NA 3LFMA 5AFEA 2XVLA 1NY71 1SEFA 5ABJC 4CDWC 1AR73 2RR11 3GF6A 4A4AA 3I3MA 5F32A 3WW2A 4FOWA 4HG6B 3KCCA 2A6VA 4QQ2A 2D6KA 5CYYA 1HRI1 1XJAA 4IE0A 4ORFA 1C8M3 3H7JA 3U10A 3VBFC 4QX0A 1CAWA 3LDKA 4AR2A 2K2SA 1O4YA 1BK1A 3SEEA 2DVFA 2JDUA 5T52A 1IS5A 1FMD3 4QQHA 3VBOC 3WW3A 4O65A 5FBZA 2VCBA 2YU1A 4KGQA 4L9BA 2WZR1 5DXDA 3ZXKA 3T4HB 1B35C 2VL4A 2Y6FA 1SDDB 3AZVA 1S2BA 2QQVA 3J8F2 3RZLA 1MS3A 5E16A 3BTZA 3THPA 5FV3A 1RHI3 3M3OA 4OI1A 2BOJA 1H0BA 4XCAA 2JE9A 2NMNA 2HWC3 4K40A 1OT5A 1WW5A 2HWD3 1UOGA 2WAAA 2R072 3DYMA 2SLIA 3R4DB 1BEV1 4JVAA 1RVF2 2VY0A 3EXUA 3POYA 4AAXA 5FZEA 4C91A 5KXEA 2VCCA 1AYM1 1ZYBA 2HWE2 3H1YA 3I3BA 2ZHKA 4XFGA 1CESA 1RXGA 4FPEA 2ZHLA 5FYVA 5ACA1 4R9BA 1ZBA3 5IVEA 1JI6A 4DY5A 1X7NA 2E63A 4Q4V2 2ZGQA 2Z4FA 4P08A 2JDMA 4XYXA 1W28A 1SDWA 1JZ8A 3WG1A 1OVSA 1AYN3 1M06G 2RM22 2UURA 2WIIB 2YV8A 4QQOA 2V4VA 5CISA 3PHMA 3ZFGC 2YGMA 1UL9A 1KFXL 3OPTA 2ARBA 5JUVA 5DABA 5A6ZA 1J59A 1O5UA 2ILMA 3AP6A 3AVSA 4FPFA 1N1YA 1U5XA 2RDRA 2ZJCA 4D6RA 3RZMA 2GC2A 1XSRA 2FDIA 3TN91 2BERA 2GAUA 1NCRC 3R4SA 5FYBA 1YFXA 4X8NA 4YARA 1PGL2 1RMU2 2JB8A 2VOWA 2GN3A 2ZMNA 4QX3A 2AH2A 4IV3C 4XBNA 3ZSJA 2ARXA 5BNNA 2E33A 3K75B 1A6CA 4QPIB 2D44A 1LEDA 3NL1A 2WZ8A 1BLZA 1ZRIA 2OKXA 1OOPA 2CU5A 1AR71 4D6SA 4AI0A 3TRSB 3VLBB 1AHSA 1GMMA 2JDZA 2HBTA 2Q1FA 4Q4X3 3RVHA 4W8JA 5IFTA 3AMQA 1N1VA 1JZ2A 4F8AA 4XJ9A 4MHRA 1C8M1 5LBCA 3AP9A 1ZA7A 4Q1RA 5FZ6A 4PI2A 3S0MA 1GU3A 5APAA 3S30A 2RDQA 4PLMA 3WG4A 5HPOA 2JWPA 1IQDC 2ZMLA 1V6OA 1OHFA 4GKYA 3SLIA 3GHNA 3HOBA 1PIV3 4GB33 5DUVA 1NCQB 4RD7A 4C0HA 4BXFA 4CRQA 4CDUA 2XWJB 1ZREA 1OQDA 2VUAA 3MO4A 1F2NA 1STMA 5FQ0B 4DOUA 3KT7A 1UOJA 3DGTA 4MGZE 1GZCA 3HR9A 5T54A 2ORXA 3ZX7A 4QX1A 3M3EA 1RL3A 3T0BA 2X5IB 2HWC1 4AGRA 5BNOB 2HWD1 1W39A 3BI3A 1JYNA 3T1MA 4YVSA 4AFDA 1PMJX 1DYOA 1NZCA 4XF3A 1UMIA 3I2IA 1DZQA 1OQEA 3CJIB 4KL1A 2Q5TA 4MGIE 3UYJA 4CXWA 1ND3C 2WZEA 4AQTA 4EN0A 1SLCA 4ATEA 1N1SA 3D5OA 3OUHA 3TB0A 2XXZA 3T09A 4JKLA 4OMDA 1WBFA 1AUYA 3OUIA 4XJUA 3ZSEA 3ST7A 2E32A 3ILNA 4QDSA 3LD8A 3ZO0B 1S4CA 4D7YA 2JEMA 1SZBA 1NA1B 2V73A 1VBD2 3DKQA 3NRUA 4Y1ZA 4FTBA 3HMYA 4LHKA 5H9SA 1VBC3 4OHZA 1JU4A 2ZKNA 4Q0PA 1AXYA 3VBUC 4KMQA 4A3XA 3CJXA 1K5JA 2PFWA 3IBMA 5GLTA 1WCQA 1IS3A 1H6YA 1WD4A 5LRSA 4PBPA 5FP8A 4GWNA 1SLBA 4NPLA 5JOWA 2YC0A 4QAWA 1WLTA 2IZWA 2WNUA 4BK4A 1H1IA 2EXJA 3J26N 2OT7A 3U75A 1CAXA 4Q4X1 3FMGA 4NWVA 1NCQC 3LSDA 2VW2A 1XNTA 1XXNA 5FKBA 3J7HA 5FZCA 5IVFA 5CFCB 1DZRA 2C9AA 3ZFEB 1UMHA 4WVZA 4KWLA 2FHRA 3ME2A 3VGIA 2VMDA 3R05A 4EQVA 4NIAA 1X9TA 1Y3TA 2VU9A 1KEXA 5DZEA 4GB31 3HT2A 1PIV1 3TNPB 3WOGA 4BXSV 5FPZA 5FPUA 5BNOC 3H8XA 2WFF2 1ZRCA 5L36A 1BVVA 4CU8A 3O1MA 2CV6A 1FNYA 1ASJ3 1PGSA 1SFNA 2HKXA 4W6WA 5FO7B 4FP2A 1ODMA 3W59A 3K2OA 4N7UA 1C8NA 5EYXA 3P6BA 4K9SA 3CHXA 3HNBM 3I2JA 4EN6B 2AGSA 1AX1A 4QGNA 4UYBA 2ID4A 2JENA 4AEDA 3WT3A 5FZOA 2A1XA 1LODA 1S0FA 1TME3 2B45X 2IFRA 1U5YA 2ZX3A 3QACA 3LSEA 4M4PA 4BMEA 1GANA 1VRH2 4UFIA 2LROA 4HPKB 3GJBA 1PM4A 1OVPA 2WA4A 4GJZA 1YNAA 2PTMA 3VDDB 1I5ZA 4BWOA 5F37A 1KFUL 1NA1C 4P9YA 2C6SA 5JXHA 1G9AA 1WMEA 4NUBA 4CUAA 3QBQA 3I2KA 1FX5A 4QX7A 4OLLA 1D4M3 1S2KA 3M3QA 4QB6A 2I74A 1SMVA 3DV8A 1G9DA 5JOZA 2PHTA 2J1VA 5CG8A 4CPBA 2Q0AA 2AC1A 3JXSA 5FY4A 3FLTA 2CHHA 4CU9A 1PZ7A 1VBC1 5A6QA 3WCRA 2DUPA 1LECA 5J48A 1U12A 1C5IA 5F8PA 3I8TA 5LB6A 4AL9A 1C3HA 3IAPA 1W8NA 4OFGA 2DU0A 3EB7A 1CAVA 1X82A 4LA2A 5M0TA 4EWAA 3BTYA 2HYKA 2K0GA 1TNFA 5CFCC 1MR5A 4NN0A 1QJU3 1D0GA 4I3PA 2VW1A 4M0HA 3AYCA 4ZKTB 3OBTA 2RS52 1R093 4Q4Y3 4UFKA 1OLQA 1GWMA 3WHTA 4I0WB 2JKBA 1HQWA 4QXCA 4P9IA 4DEVA 1R64A 4XXPA 3H9AA 4AFBA 4RL7A 1BHGA 2QNKA 2XHNA 4BU2A 3QD6A 4FBFA 2QQKA 4I02A 4IV1A 2W1UA 2VUDA 2DCJA 4JDMA 4P00B 2YFZA 1LOAA 1XOYA 1AR62 2HWF1 5FTTC 3IN9A 5EZWA 4EN9B 1W0PA 2VZQA 5DAVA 3BIWE 5FKCA 4KGGA 1Z78A 4JX0A 1IQAA 1ENXA 1S0IA 2IVJA 2P3YA 1ZBE1 3ZOIA 5C8WA 3V0AB 1UN1A 1UY4A 1QOSA 2WT1A 3PJYA 4DIQA 4I09A 1H30A 3LDRA 4OULA 1VAMA 5HCFA 4ZY9A 2D3PA 4XJZA 2FMDA 3BOWA 3V64A 3C8XA 3VDDC 1BJQA 1BBT2 1REFA 1WW6A 2C24A 3AXEA 1ND2B 2QUOA 4JZRA 4COUA 4OHYA 3PIGA 3WNLA 5C4WB 1LHWA 3EMRA 4GALA 5JMOA 1TME1 2UYAA 3ON7A 4XDOA 3WD5A 1CQ9A 2V72A 4QHBA 4XJWA 5A3TA 5BNPA 5FZDA 4DUWA 3DN7A 3M70A 5EV7A 5CBLA 2JDKA 3H8UA 4G3YC 4BQ2A 5KWRA 4QM8A 4OHVA 4XBLA 3IIIA 1W06A 2RS12 2XL7A 4XFFA 1F4HA 4MXVA 4AFAA 4CDUB 1W6OA 1D4M1 1QNYA 1SLAA 4UOJA 2A71A 1JHJA 1UW8A 3NJXA 1GFF2 1AR92 1PK6A 5JXIA 3IB3A 5FZ7A 1LESA 3VHNA 4TLFA 4AVAA 3MHZA 3B93A 3ZMOA 1FATA 4B1MA 1QJY2 2MEV3 3JBG3 5A32A 4BQXA 3FFZA 1OMIA 2J1AA 3JZVA 5A7PA 4BQ4A 1LRHA 1RUF1 4Q4W3 2XLAA 5GZGA 2OX0A 5B4XA 4COYA 1NZIA 3AB0A 5KC5A 5L7OB 3FHAA 3PU8A 4BJ0A 1QJU1 4NWWA 5JPMB 2LRPA 1H4GA 4PLOA 4Y20B 4LITA 3H3LA 3MZHA 4LBNA 1R091 4X8PA 3KVBA 1W2OA 4AI1A 3KHCA 4J1XA 1APNA 2ZGTA 2E9QA 2AEYA 1TEIA 3C7HA 1MZEA 1QEXA 1GICA 1K5MA 4JTOA 5BUVA 2ATFA 2AREA 4AXOA 3AL5A 2Y0IA 3ZXLA 5C3RA 2WWJA 2P6CA 4BQWA 1QQP1 5LK5A 3JD72 1BMV2 1C1LA 5GKAC 4RN5A 1UPIA 4ISQA 4BM8A 2WNVB 3AXDA 2XPJA 3WF4A 1ND2C 3A23A 1YFUA 4URTA 5C4WC 4S2HA 3BKZA 5F3EA 1XNDA 2IXLA 4Y5Z0 4UW6A 1TE1B 2XUMA 2VTXJ 2VULA 2JE7A 2WN2A 2X09A 2XJRA 3E6BA 3ZSKA 3NKTA 2DU1A 2MNGA 2ZXQA 4CDWA 5LBEA 5ABJA 3BIEA 5E1RA 5LY2A 5AVAA 1CAXB 4BK5A 3NV4A 1GZWB 2WS92 1OA3A 1W8FA 5FMBA 2BEOA 5KR7A 5IW0A 3ZMNA 2IFWA 2JD4A 5FLHA 3MIBA 3O1PA 1VRBA 2Y6JA 3LA7A 4NRMA 4OI0A 2GNTA 3OPWA 3VBFA 4LUMA 3AJZA 1HB4A 1KD7A 2WBKA 2WSVA 1XE8A 2PHWA 1DQ1A 4WM8B 5F5AA 3VBOA 4PDWC 2D93A 1ZZ7A 1B35A 4Q5OA 4BISA 3T08A 2A7AA 4H7MA 1QH7A 1CONA 2O1QA 4HKWA 5T5JA 4Q0VA 2G4IA 5L7OC 4ZS3A 4R52A 2VOTA 2MEV1 1Z7S3 2B42B 1TQ5A 3ACFA 2XLGA 2BJSA 1V9U2 3ES4A 4XABA 3BTXA 4YRDA 4L8QA 3N9QA 3DEMA 4Q4W1 1O91A 4Q8KA 1I6XA 2RMU2 3SH3A 1RITA 2BP6A 3B00A 4QHZA 5K4LA 4MUVA 4FPKA 3SEPA 3WCSA 2ZOEB 4AVSA 2WO3A 5I8SA 3U14A 2ZGOA 3ECQA 4GZ9A 4ZU5A 3AKQA 3PJQA 3A0KA 3JB8A 4DZGA 2Z5WA 4OQ9A 3AKRA 5A3WA 4CP9A 4LO5B 5JZGB 1W8UA 2WNVC 1UF2C 1GQPA 1OC1A 1BZWA 1DZTA 3O0XA 3VV1A 3DYOA 2IVIB 3ZFGA 3AMPA 1ZNPA 5F5IA 1JTZX 1RTVA 2OVUA 1NG0A 2Y6HA 2YC4A 3RFRA 4V2WA 1ZRRA 2W2IA 3KHBA 3WP6A 4A3ZA 1UZZA 3ETPA 1NCRA 3BB6A 3WQ7A 3E5XA 2YMZA 4FTSA 5A7WB 4IV3A 3VZKA 5E6HA 4JV4A 5A6XA 4PQQA 2F4LA 1DYKA 4D0QA 2JB4A 3POIA 2XR4A 2XKOA 3OUJA 5LZ6A 3IDBB 2J1TA 3K77A 2XOMA 5CKQA 2Y0OA 1XU1A 2EIGA 1HIXA 4WM8C 2JDHA 3IZOA 4IEPA 3T2OA 1LOEA 2I2SA 2ORZA 3MIEA 1AL22 4IV1B 1W6MA 4P9GA 2VMIA 4BQYA 2ZEWA 1OBNA 4WZFA 3WLUA 3VBSC 4KBZA 4H55A 3DF0A 1COV3 4YW1A 3V65A 4XETA 1BKZA 1DCSA 3C2UA 1VBE2 4CU6A 4MSVA 4XQWA 4LOSA 3L2HA 3N7LA 3FUQA 5DPNA 1GWKA 2D6NA 3OGRA 3VBRC 3POBA 2VGDA 1RC6A 3I2DA 3B69A 1VPHA 4Q1PA 5FZ1A 4AQSA 5GM0A 4AEJA 5LEKA 2NP0A 1F35A 1F5FA 1UAIA 3K3NA 3KGLA 4HVRA 3OGVA 1ULGA 1TVGA 4LBJA 4BLJA 2PAKA 5D8AB 3VHRA 2WAOA 1VBB2 4ZPIA 4DB5A 4IGOA 5FXXA 4NR1A 2C1FA 2P37A 4I3GA 1CIYA 4PIXA 2PHRA 5JZGC 1R082 4LKFA 3VL9A 1MS0A 1CR7A 1CJPA 3KQ4B 3ZN5A 1N3OA 1W0NA 3U78A 4A7KA 1ND3A 3E5QA 5FLIA 4R9CA 2PHUA 2HWB3 5LCWL 3IMNA 2KA3A 2J1SA 2ZACA 4RHV2 5CNAA 1S0BA 4IEVA 4NAOA 3I59B 3AYDA 2XKPA 3POGA 1YQ2A 1PVC2 2ET7A 1G6NA 4YG0A 5DZFA 2CWSA 4RGAA 2JDYA 1FPN3 5IATA 3ZR5A 1LHUA 2AUYA 4JGZB 1PO23 1CX1A 3RMYA 2EF6A 2VZSA 3VBUA 3VZJA 4ARXA 4DRRA 4XACA 5C5UA 1PO12 2PHDA 1IKPA 4TYSA 4V1PA 2XBO1 4Q0QA 1JYCA 1ENSA 2WINB 3L9JT 3OBZA 1KDKA 1RXFA 4LBMA 3BN6A 1QJX3 3R0RA 1YRZA 2NZ9A 2PQSA 5FZBA 3AK0A 2C0ZA 1ONAA 3LPGA 4LORA 4R8HA 4ZZ5A 4PQ9A 3M3IA 4GMP3 5FK7A 3T2PA 3ZPYA 4XDPA 1VBA3 1NCQA 1DLCA 2VBDA 3RS6A 3RQ0A 3VD9A 3W5MA 4D6QA 1SLIA 5LY1A 5FQ0A 1UYPA 4HKOA 4NHXA 4GWJA 2VNGA 1VJ2A 5IVCA 5C71A 4KWJA 1NX9A 3TBDA 1LR5A 2CGPA 2QE3A 1AR83 2P1BA 3ATGA 4XUOA 3PTRB 3ZFFB 3LDBA 5BNOA 2EICA 4CEYC 3ZYIB 2BGPA 1RB8G 5D8AC 2CTVA 4XFCA 1HRI3 1WMXA 5J1XA 4N9IA 4WVVA 4LE3A 3WVJA 4XFBA 3OY8B 3P5BA 1UXZA 5CAZA 1R1A3 3WNKA 2OPKA 2E53A 5E8AA 5IFPA 1B09A 3AYEA 2DCTA 2W9XA 4M00A 1O4ZA 2BNMA 2BGOA 1ZZ8A 1N3PA 2YROA 2Q8CA 3FFQA 1E5HA 4FAGA 4ZS2A 4F3JA 3MW3A 1NA1A 2NLRA 2HWB1 1RINA 2YZ4A 4RGKA 4C1WA 4L0PA 2MHFA 4OYUA 1RUD2 2XGXA 4JGZC 4O7XA 3WQBA 2YPDA 3KB5A 5JDBA 1K42A 2QQJA 4UFLA 4BYYA 3SHRA 3WQ1A 1CPNA 2ZGKA 5FREA 5DDJ3 3H7YA 3WXPA 4IE6A 2WWUA 1FPN1 2UWBA 2ZGSA 4FTEA 3RWKX 4Y4RA 4AK3A 3V56A 2YUEA 1RUH3 3NV2A 4QM9A 1QU0A 2QQMA 1AXKA 2OZJA 4LXLA 2QBXA 2ZCWA 3LKJA 2B9VA 2X05A 5J3UA 2A6YA 2FBEA 1JBCA 3LF7A 1RUG3 1RUJ2 5FO8B 2ENRA 2FDJA 1FAYA 2O0OA 1C5HA 4E27A 2L9LA 1KJRA 4H14A 5FY1A 3UKTA 4D94A 2A75A 3M3CA 1KDMA 3RDIA 5CFCA 3MUY1 3FX3A 2AENA 2A3YA 3M7AA 1YFYA 3TN92 2R0FA 2ZX0A 1W2UA 4GMP1 1REEA 1SFPA 3PU3A 3ZFFC 4O9GA 1X8EA 3O1OA 2K46A 3A22A 4AF9A 2QQWA 3NNMA 3POFA 2BDRA 4YLZA 2DUOA 3B9IA 4NRQA 2R6QA 3N9MA 1NCRB 1AR81 1HW5A 4JHZA 2P34A 2XVKA 2EIDA 1PX4A 1EYBA 4RYDA 4IV3B 1LOFC 2YXSA 1GOHA 2DVGA 3CNAA 3HQUA 3PVNA 4LNVA 4XFHA 3SITA 3ZSMA 2IXIA 5JSOA 4YSFA 2Q30A 1W99A 2BVVA 4XXAA 4N43B 1RUNA 2VMEA 4HPKA 3FHIB 3KCXA 3A7QA 2Q8OA 1R1A1 5JI9A 1FMD2 3SH4A 3VDDA 4BPZA 4CXXA 1MEC3 5LEJA 1RIRA 1SFYA 1WCUA 4YWAA 5I8YA 4QPGB 1W6MB 4ASLA 1RUC3 2EALA 4G4FA 1RUE3 3HN3A 4Y1YA 4R4XA 1RHI2 1DHKB 4GD4A 4BLIA 1N3QA 1DGWA 3VD7A 4BA6A 4CCNA 4YW2A 2TUNA 4FI9A 2HWC2 5GLZA 3GHMA 4XPVA 5JCTA 4AAPA 2FDHA 3Q8FA 1H9PA 2D97A 5C3PA 1O3RA 4A6SA 1QF3A 4LHLA 2A73B 5BY5A 1FNZA 1KQRA 3NVCA 1C1FA 5DDJ1 4AI9A 1ZBA2 3SCHA 1WZXA 2B9UA 2J42A 1YJKA 1YI9A 2Y38A 4IL7A 4P9XA 5IK8A 1X8MA 1RUH1 2P3IA 4E4HA 1AYN2 1J3PA 4LK7A 5AFBA 2DCYA 3RG0A 3J8F3 3N7KA 1RUG1 4XZPA 1S55A 1MZFA 1HXS2 2OZ6A 1G8WA 3K4ZA 4FPYA 4LULA 5T3NA 4EYUA 1DDLA 1NXD1 1YWKA 3E5UA 1LTEA 4XURA 4YZ3A 1ND3B 5FXWA 2RHPA 5D2AA 4W65A 3ACIA 5TSWA 3S57A 2GC0A 5GLVA 2PAEA 2R073 3D0SA 1RVF3 1F8VA 3VD4A 2HWE3 2VM9A 2YBKA 3WNXA 4I0AA 1LOBA 2R061 2WN3A 3IDCB 2VPVA 5FZIA 2D6OX 5FXZA 1YIPA 2ARCA 5F2SA 3V0AA 4XJ8A 2OYZA 2Q1MA 3TWIA 3RMXA 4N43C 1J3QA 2A3WA 3OPZA 4BH9A 3ABZA 3VBUB 2JG8B 2P17A 4Q4X2 4DFSA 4LT5A 1C28A 1W6PB 4NROA 3ZKYA 1FV3A 4HFSA 2D7FA 3OF1A 1ND2A 5F6LB 2R042 4YGDA 5C4WA 2VBPA 2W08A 1EV13 2WFPA 3IWZA 4YG3A 4C1XA 5J09A 4QPGC 5KHKA 4HK8A 2PN5A 4AOCA 1ZZBA 2ZGNA 4QHOA 3CIHA 1WUVA 1TMF2 5B4NA 1MEC1 1RMU3 1KS4A 2BOIA 5JPNB 1Q8PA 3B94A 1UZ0A 2W94A 4PJYA 4UF0B 4B7KA 4QD2A 4WM7C 4XDQA 3OG2A 1LGCA 1SLLA 3O0WA 4XQDA 1RUC1 4OZOA 1JH5A 4OUSA 3MPPG 1L7QA 1RUE1 3AZZA 4Q2FA 5ANQA 3KF3A 4JKKA 4UFHA 4BIFA 3H3UA 1TZOA 3M4FA 2W0XA 2GU9A 2XWBB 4QKFA 3VDAA 4BQ1A 4E4DX 3F2ZA 4YZ2A 1BXHA 4X6QB 2SBAA 3D4KA 3OGSA 3SNMA 3IT8A 1OF3A 2VTFA 4CCJA 2IXHA 4PDWA 4MGKE 1IS4A 4LIVA 1SACA 1JZ3A 2VJXA 3IPVA 3INAA 1FOD2 2ZX2A 1S0JA 5HCBA 1E57A 5L7OA 1H8TB 1NLRA 1QGLA 2DFCA 3B9CA 3NJVA 1GZ9A 4IEZA 4CP2A 4IEYA 3WNPA 4LR4A 4Y20A 5C3QA 4TN7A 4CUCA 3GBGA 3J8F1 1JXNA 3NNFA 1DLLA 3LEIA 2G9FA 2OS2A 4LKSA 2P3KA 2WYSA 3FBYA 2DCKA 3WDTA 3PUIA 5T50A 5E89A 2FDKA 5FZGA 5EP9A 2H6BA 1UXXX 4S2DA 2R071 3BU7A 2GC1A 2VOKA 4GMP0 1RVF1 4LO8A 1CZTA 1LGNA 2JG8C 1WW7A 2HWE1 2WNVA 4I01A 3T30A 4R9AA 1IPJA 1MVEA 2PYTA 1BVP1 1IPSA 3USUA 4XCBA 2XJSA 5DUWA 2DBNA 1D0HA 4Q4V1 1GLHA 4WVMB 1EPZA 1W9WA 2IUWA 1PGW2 2LALA 2VE1A 5F1RA 1NT0A 2RDSA 4MH0E 2RM21 3O7OA 2ZBJA 4N8MA 4YG6A 1GZWA 3FN9A 4RQPC 2R30A 1ULDA 1EV11 1Q5OA 1VBD3 2EAKA 5C5TA 4YGEA 4N90A 5FPLA 4CVUA 3P3NA 2HWF3 4L92A 5KHGA 1PGL1 1RMU1 3IKWA 4Y5SA 3I3EA 3O1SA 3UETA 3LA3A 4WM8A 1ASJ2 4E2SA 2G1MA 1HB3A 1ZBE3 4C0BA 1GQHA 2J7MA 3APBA 3SC7X 4UFJA 3MFCA 1E5IA 4NPMA 4S2FA 1VIWB 4PT6A 3VBSA 1YI7A 4K8RB 3ZXDA 1H8TC 3ILRA 3JQWA 3S6PA 4CXYA 4LBQD 2GNDA 1ACCA 4MOAA 4QX5A 4ZXKA 3S5QA 3IMMA 4IXLA 3GZTB 1HJGA 1LHOA 1QXPA 4XJAA 1WA4A 3VBRA 3EQEA 1HKDA 1VR3A 5HXMA 1OURA 2JXAA 5T55A 4NJ4A 4RFT0 2VXJA 5IVBA 3WP4A 4I30A 2W3JA 5EFUA 4MGSA 1PMHX 3GXUA 2FZ2A 2ZMKA 4JQTA 5A3UA 2AEZA 5FP3A 2WFF3 4LBKA 2BYVE 2EIEA 1O7FA 2UY9A 4FOQA 2DTYA 5JOXA 2WSUA 5I0UA 5ISLA 1UWWA 1SPPB 3LIGA 4Y5TA 5L19A 3AMHA 3KD4A 4YZ1A 5JZGA 1FV2A 3ZXAC 4XZUG 3KV4A 5FZAA 1NAEA 2YDEA 5CA6A 3VUOA 2AYHA 2OUJA 3AKTA 3FHQA 1I1EA 1OKQA 3KV9A 3MLLA 4K7JA 4CYDA 1RUF3 4S2GA 1QHDA 1QDCA 4CCLA 1HN0A 2G9GA 4META 2VZVA 2NQYA 5A7WA 3ZYHA 5A3PA 4QU1A 1J1TA 1XB9A 2LTNA 2ZEXA 1QJU2 3HBKA 2CYFA 3OD4A 3KGZA 3OEBA 2E51A 2XJTA 5ANNA 4DO0A 3KVAA 4Q4Y2 2VR4A 4AEMA 3VN4A 2E6VA 3TEZA 4XMAA 1LU1A 4QXKA 4I0BA 5F5QA 3O1TA 1FXZA 1E5RA 1ZM1A 3BPZA 1YEWA 2VZ1A 4UWDA 3E6CC 1R1ZA 2B5HA 1U0AA 4MX3A 4DNYA 4DXRA 1DQ4A 1JUIA 3CKHA 3VB9A 1PVXA 1VBD1 1GNYA 4W4ZA 2VXRA 5LBFA 1CAUB 1XE0A 1CVNA 2WL1A 4XVHA 4MO3M 4XF0A 5A33B 2W1QA 3BU0A 1W8HA 1JW6A 3AP7A 5DG2A 2HH9A 1QQP3 4AQ6A 2D40A 2WZPP 1GR3A 4XFIA 3OGGA 3VKNA 4YM0A 1N47A 4KWKA 2GZWA 5ERLA 1OH4A 3N7MA 1N1TA 2GP5A 3S7EA 3ZDSA 5FPAA 3Q8CA 1GYKA 3Q8BA 4B4QA 3EHKA 1FT9A 3GYDA 4B29A 1MACA 4BQ5A 1GP4A 2R1DA 3HD8B 1QXRA 3UV9A 4CEYA 4HN1A 5D8AA 4XUTA 1V6KA 1DF0A 4MGTA 1I3HA 1OUXA 1AR63 3B01A 3WW1A 2VZRA 5A3NA 2VZ3A 1G86A 4FQ4A 2D3SA 3KV5A 5AC92 3AMNA 4MLOA 5LBBA 3WF3A 2X8KA 2WFF1 5F7UA 3OBAA 3ZXEA 3Q9OA 4JDOA 2V5YA 3OYWB 2PELA 4AGVA 1MS8A 4IW3A 2KD7A 4XIKA 3OBRA 4K1YA 1QIQA 2B8MA 4AVCA 1Y7BA 1V6LA 2VMCA 3I59A 3TEYA 2VZOA 1Q8QA 2VQTA 4SBVA 1Q8VA 2RS32 2MEV2 3JBG2 2XMLA 4C8DA 5L9VA 1BBT3 4GAZA 4WBBA 1LHNA 3NJZA 5FYHA 1JU3A 5FZHA 5KXDA 3JUUA 1SG3A 2XQXA 3U37A 3SH5A 4PDWB 4GWIA 2YU2A 4JGZA 1H1MA 4YM2A 3R6SA 3WDWA 1VRH1 2UWCA 1W2AX 3IPVB 3I4IA 2WQ8A 4NHMA 1CWPA 1UX6A 3AFGA 2XUEA 4YW3A 4FPLA 2LW8A 2BNNA 3ELNA 4PCRA 3T3YA 2PMWB 2RS13 3RZZA 5JSPA 1NLSA 3LEGA 2O8QA 2EIBA 4LLFA 1NXMA 2DWRA 2ARAA 3I2GA 4IDZA 1AR93 1HDKA 1UY1A 2K9ZA 5FP4A 3WINE 5CIRA 2WKKA 1DQ6A 3FWEA 3IIAA 3C3VA 4DUXA 5FPXA 3A21A 3WNNA 3MF6A 2WNEA 1QJY3 4Y33A 1Q8OA 4CCKA 5BV6A 3K48A 4Y22B 3G6JB 3M2MA 3ORJA 4FFGA 3HVDA 2FDFA 4JAAA 2BWAA 4CCOA 1AL0G 3C7OA 5H9RA 4G9SB 1YC61 3ZFFA 2VTXA 2Y34A 3JB4C 3E97A 2A5ZA 3USUB 1XPWA 1RGSA 1HB2A 4LE4A 1QH6A 1HQLA 3RJRA 2JIJA 1E5SA 1PZ8A 1OH3A 2VNVA 2RS51 4JHTA 1US3A 4ISRA 4QB1A 3OY8A 5L73A 2W68A 4HANA 3TOJA 4AE2A 2W5FA 3J7MA 2IC1A 1UYZA 1G7YA 4MADA 5L9RA 1VALA 1LOFA 1H2NA 1XU2A 1JHNA 4ZZ8A 1AR61 3MV01 4EROA 1UCXA 1DIWA 1CX4A 3PVEA 4E2GA 1X9PA 1RUI2 2B7YA 3WF0A 1VB2A 2BUKA 4IEUA 3PNAA 4KBBA 3ZYFA 5FJHA 4CDXB 3ASIA 1Y9GA 3ZXFA 4QPYA 3MFAA 3LOIA 5DZGA 3MUZ1 1UQXA 1JYTA 3WDYA 1OXCA 1WKYA 2OPWA 3WDVA 1BYHA 1IPKA 3ES1A 4IERA 3BGAA 4XBQA 3VBSB 1Z7S2 1OQ1A 5J98B 1BBT1 3ZLIA 3PL0A 4NAMA 4B3NA 4LJHA 1J1LA 4AHXA 5EIYB 2ZS6B 2VNOA 4P9JA 2ZTNA 5C3SA 2GALA 1YYNA 1AF9A 2GSYA 1C57A 3VBRB 3AZWA 4OMCA 3KLSA 5D21A 2E7QA 4EWEA 3H1MA 2Y8KA 1QWRA 3VBHB 2ADDA 4KH9A 4P5HA 1BK0A 5FUPA 2WWSA 2DVAA 3RPQA 5FR3A 4A2UA 2RS11 4CCMA 1DBNA 4CSWA 3K3OA 1AX0A 3AJYA 1GP6A 5IAXA 1WLDA 4L11A 4TXWA 1AR91 3UKNA 4QX8A 4A41A 1MVQA 2DYCA 3ACGA 4WV8A 5GZDA 3K46A 1W6QA 1F31A 4JTNA 1UU4A 1IKQA 4QXHA 1QJY1 5DN2A 5FP9A 5IAVA 5FZFA 5LASA 2XJQA 4PF1A 5FWEA 1V9U3 1VAVA 4B8EA 4E8CA 1OUSA 4CUBA 2FCUA 3AP4A 2RMU3 1HRV2 1FYUA 1QDOA 3CU7A 4Q0SA 4P9LA 4DPNA 4RA0A 2N7GA 1ZRFA 4EWDA 5DAXA 1O3TA 2XBO3 4CEWB 4Y1XA 3JU9A 1UYXA 4XOGA 3IM0A 3QOPA 5GZEA 5I0TA 1XBFA 2PLV3 2OQ7A 4N43A 4AI3A 3AZYA 4YVWB 4A44A 2YC2A 1WCSA 2BVBA 3GNEA 2XHKA 2D6MA 3O1VA 2XONA 1W9SA 3NNLA 4BMBA 5KXCA 4A7ZA 4P02B 2Z2SB 4QQPA 5FYCA 4CDXC 4CP0A 4QPGA 4E8DA 2BGCA 1NLQA 2ET1A 3ACLA 1COV2 1BMV1 1GOGA 4MV2A 2RG4A 2D5FA 3UGGA 1ENRA 3GM8A 4YYOA 2VH9A 1SCSA 3T2TA 3MDPA 4JGYB 4WM7A 3QH6A 3DYPA 2YHJA 4JKMA 1Q8SA 2JKXA 2VZPA 4HN0A 3SKJE 3UGFA 4L99A 4AVTA 3U07A 1V0AA 3MEPA 5JI7A 3AX4A 3DUIA 3AZXA 3VBHC 2DFBA 1PX3A 4QX2A 1UZWA 1XYPA 1DGRA 3BODA 2WS91 4AHWA 3AFKA 4L97A 1WCDJ 4GULA 1EY2A 4CEYB 2QQLA 2Q1ZB 4TSVA 5EYYA 1QJEA 1AL23 3U0ZA 3KT1A 2O8OA 1OSGA 2W91A 1HX6A 1CD3G 3WUCA 1YQ8A 2JDPA 1S0CA 4A42A 4Z82A 5SV5A 1M4WA 1VBE3 5F3CA 3GGLA 5JIUA 3WUDA 2WLQA 2VAUA 3WNMA 5I93A 3NMBA 5JLVA 4UT5A 5SV8A 5C9AC 4Z07A 1WCKA 1YO8A 4Z2AA 1CPMA 1MPXA 1OLME 2XL9A 4D7SA 3WP3A 3HEIA 4RS5B 4CEWC 1MS9A 2V4AA 4O61A 4Y4YA 2ADEA 5FXVA 3ZXJA 1V9U1 3PLQA 4LPLA 5J7MA 2HBUA 4AVBA 1PO22 1VBB3 4CDQC 2RMU1 4JC1A 4YVWC 2OQ6A 3KV6A 1XNKA 2JG8A 1R083 4KQ7A 3WEZA 3QLQA 1YQ5A 3HT1A 5K0UC 1W6PA 4Y1UA 1EAH2 4NOTA 1QJX2 2E31A 3X29B 3TAYA 4LUKA 2CNAA 5EXOA 4B1LA 3VKLA 1ZX5A 2PLV1 1W0OA 4LBOA 4LMFA 4NE9A 1HV0A 4XAEA 1F9KA 3MIDA 3GZAA 4COVA 4RHV3 1VBA2 3CL1A 1S0DA 2H0VA 2W52A 2NMOA 3GDBA 3BTAA 5FY5A 1F4AA 4UF0A 1PVC3 4RQPA 4JGYC 4NVPA 1SCRA 2BQPA 4GA9A 4GXLA 3LZZA 3FLPA 5CG9A 1NY72 2JICA 3AKSA 1W2TA 2RR12 1JMUB 3MPBA 5FZ8A 2QQNA 3D6EA 1PO13 4PI0A 2GP3A 5IT6A 2WRAA 2RV9A 3I7DA 1HV1A 2YYOA 5DAQA 1HRI2 2VC9A 4ET7A 4MGYE 2JJ6A 2Y26A 5CFDC 2D6PA 5JIAA 1OPMA 2WNOA 1WMDA 1RJ8A 3T1LA 3NNGA 4LTAA 3UT0A 3RYRA 3THTA 1H8TA 5IK4A 1Y9MA 5FMDA 2DCZA 1UY3A 1W8OA 3THCA 5KHIA 2WZR2 1AL21 2ZGMA 3N9NA 4AHYA 2ZZQA 1H2MA 3V0BA 1MS4A 4LO6B 2EXHA 4K8FA 5FY9A 5HV4A 5D1IA 3C7EA 5L9BA 4M01A 4RS5C 3D3AA 1VBE1 5DQ0A 5EWSA 3AM2A 2PXJA 2A6WA 5FPBA 5I0RA 5A80A 4Y26A 3CF6E 1BEV2 1T6BX 3H50A 3MV11 4HZFA 3S7IA 4GH4B 4B7EA 3RNSA 1AYM2 1J84A 3M1HA 1UY2A 2QTWB 5ACA2 4YZ4A 1Y9QA 5A6YA 2XH6A 2W46A 1K3IA 3ETQA 5FZ0A 1J83A 1NQJA 2Y6KA 1VBB1 2R0HA 4WVMA 4IESA 3T2QA 4FQZA 1RUG2 1R081 2PAMA 2Y60A 3WG2A 1A8DA 3ZDVA 4N9HA 2EXIA 4QQLA 1W05A 4XUPA 1S0GA 5FYZA 5A70A 1W9FA 5GALA 3LOBA 3DXUA 1DGLA 4KU7A 4LKEA 4IE5A 3TEXA 2HJIA 1RUD3 1PHMA 4RHV1 1V6MA 1JN2P 4E4ZA 3PUHA 4HL0A 1PVC1 1W6QB 2VW0A 5FFOC 3WZ1A 2BNOA 3OSDA 2R063 1VMJA 2VZUA 4WZCA 4MXWA 4YW5A 2WQ4A 3WQ0A 4CUGA 1XSQA 1GQGA 1AR72 4COWA 1PO11 4FPCA 2QCSB 5C8CB 1RUJ3 2YGLA 4FSJA 5C33A 4XHXA 3LCPA 5JR7B 2ETEA 1LEMA 3K4DA 3BUCA 1VMFA 3Q8EA 1SBEA 5BPXA 1C8M2 1AJOA 4OVEA 3UNPA 3RYKA 3NJYA 2ZX1A 5FMCA 1POQA 4IGQA 4UW5A 1YCIA 2VQUA 4FPOB 4QT6A 4RR3C 4Z2WA 1JYXA 2DVDA 1VMHA 3KCYA 5CVRA 3NAPB 4AFMA 5F9TA 3POWA 4GH4C 3T4VA 4XF4A 1SPPA 1VP6A 4CCEA 2JDAA 3H1WA 3I2HA 2QZ2A 2ZZJA 3VD5A 3ZYJB 2ERFA 1JYVA 3H8RA 3RZKA 5IYYA 1TG7A 2B39A 4EZHA 3RZJA 2TBVA 4CA9A 2HWD2 3FC0A 4WM7B 4HSLA 1H9WA 1OLRA 1YHFA 2VECA 3LE0A 4XMIA 1G9FA 1H4HA 3PVOA 4KI5M 1W8WA 3IDEA 3NKGA 4LQRA 4K1ZA 3ZIWA 1RJ7A 3NV1A 4CCCA 4ASMB 4OUEA 1WLWA 3GCXA 3IDAA 2VNRA 3ZN4A 5IK5A 4PHZA 1W8ZA 2OUHA 5JVVA 5HI0A 4E2QA 5CU1A 5KBFA 1YXWA 4ZXEA 3W21A 1H2LA 1GNHA 3FJSA 1A3KA 2QKDA 3HJRA 4Z92B 5FYTA 4N53B 1IZ3A 4MYEA 1IGOA 3HQXA 4YGBA 3WV6A 4EN8B 5IVYA 1ULCA 1CAUA 2CL2A 3I2FA 3WY6A 5A33A 1RUD1 3ZN6A 2D6LX 4IEQA 2C5DA 2HYXA 2H6CA 4KG8A 4MZUA 5FZMA 5JWPA 1YUDA 5C8CC 2GDFA 3UESA 2YBPA 3GBFA 3AYAA 1H2KA 2D3RA 4D7TA 4BIOA 3OJBA 2UYBA 3PDQA 1QJFA 4LK6A 2W95A 3AP5A 2J1EA 1OF4A 3CBNA 4Q4V3 2ZGUA 3VDBA 1SHWB 1W90A 2FDGA 2A70A 3B02A 4JRAA 4FAHA 3KZ4C 5CADA 1RUJ1 3MLKA 5E88A 1HXS3 2BV4A 2RM23 1O3QA 1WWYA 3IAQA 1EV12 1SBFA 4UW4A 5IUQA 3JQXA 3DPRC 3NAPC 2A6ZA 3W9AA 3ITQA 4BZ4A 3N9LA 4IQPA 1LCLA 4AW7A 2WLPA 4D8MA 2I07B 3OEAA 3LQCA 4GB32 4LO4B 1PIV2 2B46X 4IEOA 1UNBA 2LM3A 4OHXA 2ES3A 3LGRA 4RQPB 3HWJA 3OYWA 3N9PA 1GV9A 4UXAA 1W03A 3TYJA 1PNFA 1JZ5A 1EPWA 4KNCA 5JXJA 2BWCA 3SQOA 4IE7A 4QDRA 5EHDA 3WF2A 1C4RA 3CMGA 4HBNA 1VB4A 1POV3 2BW8A 2J1UA 2R043 3DKWA 3GJAA 1Z0HA 1LNSA 4M3CE 4YW6A 2GMMA 1D2SA 3T0AA 4KU8A 4D3WA 3BALA 1ULPA 2JECA 3KF5A 3PMSA 3ACHA 4PIYA 5DUXA 1MZ6A 2RJ2A 1W9YA 3DL3A 2WO7A 1ENQA 1FMD1 1TMF3 1UD1A 3GCWA 4MGQA 4N53C 1ZZ6A 4YW4A 4AHZA 4TZDA 4OHWA 2IXCA 2HLEA 2XQRA 1OLMA 2VOXA 3CQOA 4CE8A 1G9CA 2G19A 2QDRA 4F7ZA 3PVBB 4NIDA 5FYYA 5EJ3A 3V0BB 1RHI1 4GQ7A 1PM7A 2JE8A 2BU9A 2JG9B 2HEVF 5FYIA 5A7OA 2EVXA 3OOXA 3U11A 1JUHA 2DV9A 1VBC2 4HK9A 2VMFA 3MLJA 5KXBA 2PA7A 3ZYBA 3A4UA 1W6NB 2GMPA 4Y22A 1AXZA 4MVTA 1OA2A 1KXGA 1YJLA 1CZVA 2V09A 4HETA 3UJQA 4A7YA 1MZ5A 4YZ5A 1ST8A 1FOD3 3MW4A 1ZBA1 3B5LB 2R1BA 3WDUA 2Y33A 2NPIA 2ZGRA 5C7GA 5FK8A 5GLUA 3VKMA 2WR9A 1Q43A 2NYYA 3ZYPA 1AYN1 2W39A 4JDNA 4ZU4A 5BNQA 2Y6GA 1GZTA 2FCVA 4LOTA 4Q0UA 4XHBA 4AWDA 3ZR6A 1S1AA 1DGWX 1HXS1 1WD3A 2EA7A 3E6DA 2Z69A 3G7DA 4JRLA 1W8TA 4QGMA 3I97A 4QPIC 4LA3A 2DURA 1J58A 3AC0A 5KC6A 1XYNA 1DGRN 5J96B 5F3GA 1LGBA 3D8CA 4Z8BA 2HWF2 3VKOA 3HBZA 3H0OA 4LHSA 1DQ5A 4CPBD 2YFUA 4ASKA 5A1FA 2D43A 3FLRA 3BCWA 4XTPA 2ZPXA 2NM1A 4FPGA 1O8PA 1NE6A 2VVFA 3NQHA 1ZBE2 1QJZA 2E26A 3KMHA 4IUGA 1MQTB 4NPRA 4CDXA 4MXWB 4XIOA 5J36A 2VO5A 1KJLA 4GKXA 1SBDA 5DAPA 3GZEA 5DUUA 2VQAA 2OXBA 2O14A 1JZ7A 2XLFA 1POV1 2R041 1NOVA 2F4PA 2E7AA 3O12A 4XQ4A 2ZEZA 1OD3A 4LIUA 4BDVB 1TME2 3BYWA 4BCUA 1HLCA 3D0JA 4PLNA 4YM3A 2C26A 5FAXA 1AVBA 3W20A 1X36A 2BTVC 2FMYA 2I45A 2VCAA 4URAA 5JSRA 2HEWF 1TMF1 3VBHA 4HXCA 1HQNA 2JG9C 2CDOA 2X5IC 2VMHA 4XEZA 5FZLA 3RZHA 4QB2A 2VZTA 1CZSA 2XDVA 3C7FA 3E1F1 4OI4A 3OTFA 1D4M2 2VD7A 1IOAA 1VLNA
chains in the Genus database with same CATH topology
5FY0A 3N9QA 3PUAA 5FP7A 3PUQA 5FWJA 3U4SA 4TN7A 5K4LA 5FZ4A 5FYVA 3N9PA 5IVEA 2OT7A 5F3CA 5FZBA 5FYUA 4XDOA 2Q8EA 2OS2A 4QXBA 5FYMA 4IGPA 5FZCA 5A3TA 5CEHA 5FZDA 5IVFA 5F5CA 4XDPA 4CUGA 5FJHA 4GD4A 4QWNA 5FZGA 5A3WA 4D6QA 5LY1A 3OPTA 4CCNA 5FXVA 4GJYA 4D6RA 3AVSA 5LWBA 3AVRA 4AAPA 5FPUA 5A7NA 5IVCA 3ZLIA 5FUNA 5LW9A 2OQ6A 2GP5A 5FZ7A 5FYBA 5F5IA 3KV6A 2P5BA 2Q8DA 3PTRB 5FPAA 4V2WA 5A7SA 3LDBA 2W2IA 3NJYA 4IGQA 5FPVA 3K2OA 2YBSA 4AI9A 5A7WB 5A7PA 5FYYA 5FUPA 2OX0A 4E4HA 5A7QA 5A3NA 4CCMA 4D6SA 5FZOA 4CSWA 3K3OA 5FYIA 3KV5A 5A7OA 5FY5A 3PU8A 4UF0A 3RVHA 5F3IA 4EYUA 5FPLA 4QX8A 4LITA 5A1LA 4GJZA 5FXWA 4EZHA 5F37A 3KVBA 5FZKA 5FZ6A 2Q8CA 5FP9A 4QXHA 4NUBA 5FZFA 5F39A 4QX7A 5FZ8A 5FWEA 3N9OA 2GP3A 2YBKA 2XMLA 4C8DA 4BXFA 3AL5A 4GAZA 5FZIA 5FYHA 5FZHA 2WWJA 2YPDA 5FXZA 5FY4A 3DXTA 5FY8A 5F2SA 5FZEA 2YU2A 5FY7A 5IVVA 2WWUA 4V2VA 3PURA 5FZ1A 3ZPOA 2XUEA 3PUSA 2OQ7A 5F3EA 4Y4RA 5F3GA 3K3NA 5FYTA 5FBJA 5F2WA 3N9NA 4HOOA 4LXLA 5IVBA 5F32A 4ASKA 5A1FA 5IVYA 5FY9A 5FZ3A 4IGOA 5FYCA 5FP4A 5FP3A 5FXXA 5LY2A 5FY1A 4HONA 5FZ9A 3UYJA 4EZ4A 5KR7A 5IW0A 5FZOB 5FZMA 5ISLA 5IVJA 2PXJA 4QXCA 5FPBA 4UF0B 3U78A 1VRBA 2YBPA 4Y33A 2XXZA 5A80A 5FJKA 4BU2A 4CCKA 3KV4A 5FZAA 3OPWA 3PU3A 5ANQA 5E6HA 3PDQA 3AL6A 3LD8A 2YU1A 4CCOA 5F5AA 3KV9A 4LIUA 5FZ0A 4CCLA 5FV3A 3N9MA 5A7WA 4CCJA 4BISA 5FYSA 4URAA 5A3PA 4QU1A 4LIVA 5FZLA 4DIQA 2VD7A 3N9LA 4DO0A 2XDVA 3KVAA 4Y3OA 5FYZA 5FP8A 3DXUA 5IWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FY0 A;  3N9Q A;  3PUA A;  5FP7 A;  3PUQ A;  5FWJ A;  3U4S A;  4TN7 A;  5K4L A;  5FZ4 A;  5FYV A;  3N9P A;  5IVE A;  2OT7 A;  5F3C A;  5FZB A;  5FYU A;  4XDO A;  2Q8E A;  2OS2 A;  4QXB A;  5FYM A;  4IGP A;  5FZC A;  5A3T A;  5CEH A;  5FZD A;  5IVF A;  5F5C A;  4XDP A;  4CUG A;  5FJH A;  4GD4 A;  4QWN A;  5FZG A;  5A3W A;  4D6Q A;  5LY1 A;  3OPT A;  4CCN A;  5FXV A;  4GJY A;  4D6R A;  3AVS A;  5LWB A;  3AVR A;  4AAP A;  5FPU A;  5A7N A;  5IVC A;  3ZLI A;  5FUN A;  5LW9 A;  2OQ6 A;  2GP5 A;  5FZ7 A;  5FYB A;  5F5I A;  3KV6 A;  2P5B A;  2Q8D A;  3PTR B;  5FPA A;  4V2W A;  5A7S A;  3LDB A;  2W2I A;  3NJY A;  4IGQ A;  5FPV A;  3K2O A;  2YBS A;  4AI9 A;  5A7W B;  5A7P A;  5FYY A;  5FUP A;  2OX0 A;  4E4H A;  5A7Q A;  5A3N A;  4CCM A;  4D6S A;  5FZO A;  4CSW A;  3K3O A;  5FYI A;  3KV5 A;  5A7O A;  5FY5 A;  3PU8 A;  4UF0 A;  3RVH A;  5F3I A;  4EYU A;  5FPL A;  4QX8 A;  4LIT A;  5A1L A;  4GJZ A;  5FXW A;  4EZH A;  5F37 A;  3KVB A;  5FZK A;  5FZ6 A;  2Q8C A;  5FP9 A;  4QXH A;  4NUB A;  5FZF A;  5F39 A;  4QX7 A;  5FZ8 A;  5FWE A;  3N9O A;  2GP3 A;  2YBK A;  2XML A;  4C8D A;  4BXF A;  3AL5 A;  4GAZ A;  5FZI A;  5FYH A;  5FZH A;  2WWJ A;  2YPD A;  5FXZ A;  5FY4 A;  3DXT A;  5FY8 A;  5F2S A;  5FZE A;  2YU2 A;  5FY7 A;  5IVV A;  2WWU A;  4V2V A;  3PUR A;  5FZ1 A;  3ZPO A;  2XUE A;  3PUS A;  2OQ7 A;  5F3E A;  4Y4R A;  5F3G A;  3K3N A;  5FYT A;  5FBJ A;  5F2W A;  3N9N A;  4HOO A;  4LXL A;  5IVB A;  5F32 A;  4ASK A;  5A1F A;  5IVY A;  5FY9 A;  5FZ3 A;  4IGO A;  5FYC A;  5FP4 A;  5FP3 A;  5FXX A;  5LY2 A;  5FY1 A;  4HON A;  5FZ9 A;  3UYJ A;  4EZ4 A;  5KR7 A;  5IW0 A;  5FZO B;  5FZM A;  5ISL A;  5IVJ A;  2PXJ A;  4QXC A;  5FPB A;  4UF0 B;  3U78 A;  1VRB A;  2YBP A;  4Y33 A;  2XXZ A;  5A80 A;  5FJK A;  4BU2 A;  4CCK A;  3KV4 A;  5FZA A;  3OPW A;  3PU3 A;  5ANQ A;  5E6H A;  3PDQ A;  3AL6 A;  3LD8 A;  2YU1 A;  4CCO A;  5F5A A;  3KV9 A;  4LIU A;  5FZ0 A;  4CCL A;  5FV3 A;  3N9M A;  5A7W A;  4CCJ A;  4BIS A;  5FYS A;  4URA A;  5A3P A;  4QU1 A;  4LIV A;  5FZL A;  4DIQ A;  2VD7 A;  3N9L A;  4DO0 A;  2XDV A;  3KVA A;  4Y3O A;  5FYZ A;  5FP8 A;  3DXU A;  5IWF A; 
#chains in the Genus database with same CATH topology
 2UU8 A;  3PUQ A;  1LOG A;  4FFH A;  5FWJ A;  3VZM A;  1OD5 A;  5A1A A;  3CJI C;  1J3R A;  4B4R A;  4D69 A;  4YFW A;  4QU2 A;  2GH2 A;  2YY1 A;  2V5D A;  1NE4 A;  4K3U A;  4YGC A;  5FYU A;  2Q8E A;  5FYM A;  4QXB A;  1L7R A;  2LS6 A;  2D98 A;  4FFF A;  1P8J A;  4NHL A;  4FXG B;  1RUF 2;  5A3O A;  5F5C A;  5H9Q A;  3RSJ A;  3C7G A;  4QPW A;  1O6U A;  4MHU A;  5K8S A;  2P2K A;  4Q26 A;  5IHR A;  1CAW B;  3O1U A;  4U2A A;  1FOD 1;  2HEY F;  3KSC A;  5C9A A;  1MS1 A;  1VRH 3;  3HPN A;  4GJY A;  2GH8 A;  5I0S A;  1US2 A;  1RED A;  4CEW A;  4FOV A;  4M3C F;  2WC2 A;  4EJR A;  1W3V A;  2VUC A;  1R09 2;  3J7L A;  4KWU A;  4CDQ A;  3K51 A;  2WYF A;  1QKQ A;  4YVW A;  1EP0 A;  5FPV A;  1CJD A;  3UL2 A;  5K0U A;  1O3S A;  3KS7 A;  3PTY A;  3HIF A;  2VVE A;  1T6G C;  1MQT C;  2WO2 A;  1I5P A;  4U36 A;  1O8S A;  4XAA A;  5HBA A;  1QQP 2;  3ZN6 B;  4NIH A;  1QOT A;  4FVV A;  4L2N A;  3N4M A;  4LBQ A;  2ZGP A;  3WX5 A;  3J7N A;  3QH7 A;  4JGY A;  4R9D A;  3ZFE C;  5DAW A;  2CGO A;  4NO4 A;  1OFS A;  1DYP A;  1PGW 1;  1SQ4 A;  3VHO A;  4HVQ A;  2W47 A;  1IG3 A;  2ZX4 A;  1UX7 A;  1XE7 A;  5DG1 A;  2RS5 3;  3URF A;  4NRP A;  2RJL A;  4IEX A;  2IWG B;  3M8L A;  1JOB A;  4YW7 A;  5LA0 A;  2BPA 2;  3RJ2 X;  2BBV A;  3KT4 A;  4QKB A;  2GC3 A;  1S0E A;  4HSJ A;  3NWK A;  4P9W A;  3UKV A;  5CFD A;  4DXZ A;  1JS9 A;  4XF1 A;  5JAX A;  1Y4W A;  3CZJ A;  2E7T A;  5KHH A;  5LRR A;  3O5S A;  3PIJ A;  2J22 A;  5IVV A;  1DP0 A;  2W92 A;  5CKN A;  4XF9 A;  4ZU7 A;  1OI6 A;  2D5H A;  2VBB A;  5BNN B;  2GNM A;  3AMM A;  5EPA A;  1DFQ A;  1GBG A;  2DVB A;  1ASJ 1;  2DF7 A;  1ULE A;  2OII A;  2RE9 A;  4YM1 A;  3BOP A;  3ZXG A;  2IXJ A;  4EZ4 A;  1OOP B;  3I3D A;  1Q56 A;  3MBW A;  1XNA A;  3FZ3 A;  5KHJ A;  1XQN A;  5IVJ A;  4HKL A;  4C90 A;  5JR2 A;  3ZYG A;  2GN7 A;  4RS5 A;  5FMO S;  3BVC A;  2QZ3 A;  2ZHM A;  5H9P A;  4ZHN A;  4Q4W 2;  2R7E B;  4LO7 A;  2CWM A;  2WT2 A;  5FUI A;  4AFC A;  4OZX A;  2H0B A;  2XJV A;  3UK9 A;  5A3L A;  3J4U H;  2W1S A;  2GME A;  2JDN A;  3MW2 A;  3U1X A;  1W2N A;  4IE4 A;  4J1W A;  4BHP A;  5AC9 3;  1ZZ9 A;  5HCA A;  4CZS A;  4HT1 T;  4YNI A;  3SMH A;  5I91 A;  1O59 A;  4E4S A;  5FYS A;  1Q3E A;  1IHM A;  3RWN A;  4HMZ A;  3ROU A;  4FPH A;  1GWL A;  1AZD A;  1WLC A;  4CTE A;  2JX9 A;  2DDU A;  2NN8 A;  2X29 A;  1KRI A;  2R32 A;  2A3X A;  1XYO A;  5IWF A;  2C9K A;  5C70 A;  1H8V A;  1PZ9 A;  2RS3 3;  3PUA A;  4W6X A;  2XG3 A;  3HAG A;  3LWC A;  1UOF A;  4QKD A;  3I49 A;  4LBL A;  4YVS B;  1UKG A;  3LAG A;  4XFA A;  4TLG A;  3HNM A;  2W87 A;  1LOC A;  2XVG A;  4IGP A;  1QMJ A;  2P4E A;  2ZKL A;  4PF5 A;  5CEH A;  2R16 A;  3WG3 A;  1W3X A;  1IG0 A;  3MI8 A;  4NHY A;  1GKB A;  4RGG A;  3VZO A;  5IJR A;  1KIT A;  1UY0 A;  2QQI A;  2W1W A;  3LA2 A;  4F83 A;  4H2A A;  4Q4Y 1;  3N35 A;  4OI2 A;  1D2Q A;  5FMO L;  3AVR A;  4B4P A;  2ZHN A;  1YQC A;  4N7I A;  1A8M A;  3UJO A;  5HV0 A;  5LK7 B;  5EJ1 B;  1POV 0;  5J37 A;  4OQ8 A;  5BNN C;  1K45 A;  4ARY A;  5K7P A;  3I2O A;  1O5L A;  3CZU A;  1D7P M;  5DMY A;  3O0V A;  1WBL A;  3LB9 A;  1V6I A;  4XUQ A;  3THD A;  2WA3 A;  4M3C A;  2Z79 A;  1OOP C;  3BPS A;  1URX A;  5GZF A;  1A34 A;  2QDN A;  2F6B A;  3QCW A;  4Q8L A;  3JD7 3;  4LLO A;  3UGH A;  4H3W A;  4YPJ A;  1UU6 A;  4RR3 A;  2ZAB A;  2KXL A;  3MIH A;  1LB2 A;  2VG9 A;  2ZGL A;  3HNY M;  1JZ4 A;  3FE5 A;  2WNU B;  5F3I A;  5T5L A;  5FOB B;  5LAT A;  4GH4 A;  2BRT A;  5CZK A;  5K9Y A;  1LHV A;  2LUW A;  2BFU S;  1TNR A;  3KQR A;  4DIN B;  2TEP A;  3LPF A;  5F39 A;  4HLT A;  4CDU C;  4Q29 A;  2VUJ A;  2WS9 3;  3N9O A;  4AYU A;  1QOO A;  3SIS A;  4CU7 A;  3CDZ B;  3CEW A;  3LFI A;  3WSO A;  1NUK A;  3OCP A;  4DMI A;  1X50 A;  5I0D A;  3DXT A;  5FY8 A;  5AC9 1;  5LA9 A;  3O1R A;  4SLI A;  1RUI 3;  3NV3 A;  4V2V A;  1UU5 A;  3PUR A;  4FO9 A;  4IEW A;  4YVS C;  2CGN A;  2BBA A;  4DRV A;  4XE9 A;  3U4X A;  5F2W A;  1V6N A;  2VOV A;  5JOY A;  2CY6 A;  2X53 S;  2IXK A;  4XIL A;  1BQP A;  5T5P A;  5BYN A;  2RS3 1;  1UPS A;  3JBG 1;  4UFM A;  3ILF A;  1EUT A;  1OA4 A;  3HQR A;  4HON A;  5LA1 A;  4AED B;  4FT8 A;  1IS6 A;  4Y24 A;  2WAB A;  3W5N A;  3Q8A A;  3W58 A;  1WW4 A;  1YIF A;  5FZO B;  4AI8 A;  1WMF A;  1JOD A;  1HJF A;  5BXX A;  3N36 A;  2WO1 A;  3POS A;  2QQP A;  5FJK A;  4DEQ A;  5FLJ A;  5C8C A;  3FL7 A;  1ALY A;  2AZ5 A;  5EJZ B;  1JOP A;  2XBO 2;  3K4A A;  3ZSL A;  5C9A B;  2BFU L;  3DCQ A;  2ZEY A;  5FRA A;  4ATF A;  1NYW A;  2PLV 2;  3HN1 A;  2JD9 A;  4ZON A;  1ZVF A;  4CDQ B;  4EN7 B;  2QVS B;  4NMI A;  4K20 A;  1AX2 A;  2EAA A;  3RGB A;  5K0U B;  1DU3 D;  1XNC A;  3SCG A;  1CN1 A;  3DPR A;  3WNO A;  2QQO A;  2CDP A;  3EBR A;  2WNU C;  3NAP A;  4WVW A;  4Y3O A;  3NW4 A;  3WR0 A;  4EE2 A;  1QXJ A;  1DQ0 A;  3DEC A;  3MGU A;  4FCA A;  3POJ A;  3VZN A;  4NII A;  1VE0 A;  1V6J A;  3U4S A;  3JD7 1;  1HRV 3;  5C3O A;  3FBM A;  1CAV B;  1ZRD A;  1LEN A;  4LHN A;  2FD8 A;  4K6B A;  1D4V B;  4LBQ B;  2F17 A;  3PME A;  4FFI A;  3WW4 A;  4BQ3 A;  5FOJ B;  4PIZ A;  5JMC A;  1QNW A;  3RI9 A;  5B2G B;  3SCF A;  3MF9 A;  3VHP A;  1O4T A;  5HCH A;  3EYP A;  2TNF A;  5F6K A;  2DBI A;  5GZC A;  4IND A;  3H42 B;  1OFN A;  2FZ1 A;  5LWB A;  2VQ0 A;  3WF1 A;  2WJS A;  3LIH A;  5C6C A;  1UYY A;  4A45 A;  2R49 A;  5FUN A;  3VD3 A;  2DUQ A;  4XTM A;  3RRD A;  3WDX A;  5CFD B;  3F95 A;  1JYI A;  4PBO A;  1KGY A;  2QFE A;  5A7S A;  1X33 A;  1VAK A;  4P14 A;  2AR6 A;  4E9K A;  2X10 A;  3OD0 A;  5FO9 B;  5I8T A;  4BOW A;  1RUI 1;  3AKP A;  4N53 A;  2MPF A;  1GUI A;  1UZV A;  2ZAA A;  3EO6 A;  3OGJ A;  3RYP A;  4R4Z A;  4DUV A;  5IK7 A;  4AED C;  5LA2 A;  4RSU A;  2HWB 2;  2VCM A;  2ZA9 A;  2Q4S A;  2JIG A;  2KM2 A;  5A7Q A;  3WHU A;  2RDN A;  2RJK A;  4BB3 A;  4UI9 L;  1WA6 X;  1Y43 B;  3I3Q A;  4QMA A;  1BCX A;  2B4K A;  4GIQ A;  3H8O A;  2YB7 A;  1Z7S 1;  2OW4 A;  3ALQ A;  4IET A;  4Q27 A;  1FI2 A;  4UW3 A;  4XUN A;  3USS A;  3ZIX A;  4Z1V A;  4W6Y A;  1FPN 2;  3RZG A;  2XJU A;  1AJK A;  1F5J A;  1U5I A;  4P5Y A;  5BNP B;  3ZKU A;  1YQ6 A;  4FOY A;  2Y64 A;  1CIW A;  3GAL A;  4UBH A;  5T5O A;  2PHL A;  4NIG A;  3VZL A;  2Y6L A;  3MYX A;  3MIC A;  1W6O B;  1LUL A;  1L3J A;  1JOJ A;  3TNQ A;  4XW3 A;  4J25 A;  2PHX A;  2PQQ A;  4ES9 A;  1MS5 A;  3ZM8 A;  1PK6 B;  3SKV A;  1UKR A;  3ZPO A;  1V00 A;  3PUS A;  4M0N A;  4DY3 A;  1XC6 A;  1UO9 A;  4QPI A;  5JXG A;  5FBJ A;  3B3Q E;  4HOO A;  3O14 A;  5A32 B;  1QY4 A;  1GSL A;  1ULO A;  2QJV A;  3POE A;  5G04 L;  4DXS A;  1DG6 A;  5FZ3 A;  2UWA A;  1HRV 1;  2WDB A;  4H7L A;  5FZ9 A;  1GNZ A;  1AR8 2;  3S5A A;  3CO2 A;  2C4X A;  4CP1 A;  1YFW A;  1EAH 3;  4IV1 C;  3ZVX A;  2BZD A;  4BE3 A;  4I2O A;  2XJP A;  4KG0 A;  1XNB A;  2EXK A;  2RVA A;  2ZAH A;  2GNB A;  3AL6 A;  4JQR A;  3ZYR A;  1ZA4 A;  1XRU A;  3NO8 A;  4M4R A;  1UZY A;  3H3Z A;  3MIG A;  4W50 A;  1R1A 2;  3T0D A;  1L7L A;  3LEM A;  1UIJ A;  1K5M B;  5FDB A;  5HXV A;  1F15 A;  5GLW A;  3VL8 A;  2WUH A;  3WP5 A;  1UMZ A;  4MG2 A;  3CLP A;  3N7J A;  3P3P A;  4M3C B;  1COV 1;  1LU2 A;  1ODN A;  2CAV A;  1HN1 A;  2DTW A;  2WQZ C;  2RR1 3;  2X5I A;  2JG9 A;  1JZ6 A;  1NKG A;  4UBG A;  4COZ A;  4ITC A;  4RR3 B;  1CGP A;  4K21 A;  5FY0 A;  5FP7 A;  1RUO A;  3N3H A;  4FPJ A;  2A6X A;  2QQU A;  3P1I A;  3FUO A;  4TWT A;  5CKM A;  5FZ4 A;  1W6N A;  4QDQ A;  5BNP C;  1PMI A;  4ONU A;  4AVV A;  1ZZC A;  1ULF A;  4J6G A;  1PNG A;  3CJI A;  2VMG A;  2UY8 A;  1OPO A;  4FP3 A;  4O9E A;  4CDW B;  4DQA A;  5DDJ 2;  4EV0 A;  5ABJ B;  3SXW A;  2P3J A;  4QGL A;  4AZZ A;  3KM5 A;  1KS5 A;  3RI8 A;  4DXT A;  1H6X A;  3VDC A;  1W04 A;  4QWN A;  1RUH 2;  1OKO A;  2WZR 3;  5FIX A;  2J1R A;  2YG0 A;  3I54 A;  4NHK A;  4AGG A;  4TTG A;  4ES8 A;  1PK6 C;  1GP5 A;  4A6O A;  1EUU A;  3VBF B;  2XB6 C;  3GBW A;  2CAU A;  3OB8 A;  4FXK B;  1UOB A;  2AAC A;  1A78 A;  4XC9 A;  5A7N A;  1S2E A;  1V70 A;  3ENR A;  3LEK A;  4X6R B;  2PHF A;  5LW9 A;  2WT0 A;  1W9T A;  2P5B A;  2Q8D A;  3VBO B;  3JCI A;  1H1A A;  1LJ7 A;  1YLL A;  1B35 B;  1WGP A;  2YBS A;  3B7M A;  1BEV 3;  2YPJ A;  4OCT A;  3MIF A;  4JCK A;  3J9S A;  3L2Y A;  1AYM 3;  2R06 2;  1LAJ A;  5ACA 3;  5A3M A;  5CB7 A;  5GJ6 A;  4AG4 A;  1MQT A;  3EJK A;  4AI2 A;  5EQU A;  1PO2 1;  5FCC A;  2Z42 A;  3NST A;  3R4U A;  4HVO A;  4CCD A;  2G9Z A;  2P6H A;  5A1L A;  2VVD A;  1HB1 A;  5FZK A;  4GWM A;  3TEW A;  1EAH 1;  1K5M C;  1NQD A;  1QJX 1;  2FQP A;  1UIK A;  3ZFE A;  4AEK A;  1GOF A;  2OA2 A;  2KR2 A;  4AQ2 A;  4CP9 B;  3NNJ A;  3TN9 3;  4Y1V A;  3KWV A;  3VKF C;  4LEJ A;  1VBA 1;  1MEC 2;  4UAP A;  2CSG A;  4OUM A;  1I9R A;  4YFZ A;  1SLT A;  1DQ2 A;  1RYY A;  3D82 A;  3ZFG B;  2FCT A;  5FY7 A;  4DS0 A;  1G9B A;  1JYW A;  1U5Z A;  5AVP A;  5G05 L;  1K12 A;  3DPR B;  4RFR B;  1RUC 2;  3GZU C;  4LKD A;  4QKN A;  1LKN A;  1RUE 2;  1T2X A;  3A0N A;  3LFM A;  5AFE A;  2XVL A;  1NY7 1;  1SEF A;  5ABJ C;  4CDW C;  1AR7 3;  2RR1 1;  3GF6 A;  4A4A A;  3I3M A;  5F32 A;  3WW2 A;  4FOW A;  4HG6 B;  3KCC A;  2A6V A;  4QQ2 A;  2D6K A;  5CYY A;  1HRI 1;  1XJA A;  4IE0 A;  4ORF A;  1C8M 3;  3H7J A;  3U10 A;  3VBF C;  4QX0 A;  1CAW A;  3LDK A;  4AR2 A;  2K2S A;  1O4Y A;  1BK1 A;  3SEE A;  2DVF A;  2JDU A;  5T52 A;  1IS5 A;  1FMD 3;  4QQH A;  3VBO C;  3WW3 A;  4O65 A;  5FBZ A;  2VCB A;  2YU1 A;  4KGQ A;  4L9B A;  2WZR 1;  5DXD A;  3ZXK A;  3T4H B;  1B35 C;  2VL4 A;  2Y6F A;  1SDD B;  3AZV A;  1S2B A;  2QQV A;  3J8F 2;  3RZL A;  1MS3 A;  5E16 A;  3BTZ A;  3THP A;  5FV3 A;  1RHI 3;  3M3O A;  4OI1 A;  2BOJ A;  1H0B A;  4XCA A;  2JE9 A;  2NMN A;  2HWC 3;  4K40 A;  1OT5 A;  1WW5 A;  2HWD 3;  1UOG A;  2WAA A;  2R07 2;  3DYM A;  2SLI A;  3R4D B;  1BEV 1;  4JVA A;  1RVF 2;  2VY0 A;  3EXU A;  3POY A;  4AAX A;  5FZE A;  4C91 A;  5KXE A;  2VCC A;  1AYM 1;  1ZYB A;  2HWE 2;  3H1Y A;  3I3B A;  2ZHK A;  4XFG A;  1CES A;  1RXG A;  4FPE A;  2ZHL A;  5FYV A;  5ACA 1;  4R9B A;  1ZBA 3;  5IVE A;  1JI6 A;  4DY5 A;  1X7N A;  2E63 A;  4Q4V 2;  2ZGQ A;  2Z4F A;  4P08 A;  2JDM A;  4XYX A;  1W28 A;  1SDW A;  1JZ8 A;  3WG1 A;  1OVS A;  1AYN 3;  1M06 G;  2RM2 2;  2UUR A;  2WII B;  2YV8 A;  4QQO A;  2V4V A;  5CIS A;  3PHM A;  3ZFG C;  2YGM A;  1UL9 A;  1KFX L;  3OPT A;  2ARB A;  5JUV A;  5DAB A;  5A6Z A;  1J59 A;  1O5U A;  2ILM A;  3AP6 A;  3AVS A;  4FPF A;  1N1Y A;  1U5X A;  2RDR A;  2ZJC A;  4D6R A;  3RZM A;  2GC2 A;  1XSR A;  2FDI A;  3TN9 1;  2BER A;  2GAU A;  1NCR C;  3R4S A;  5FYB A;  1YFX A;  4X8N A;  4YAR A;  1PGL 2;  1RMU 2;  2JB8 A;  2VOW A;  2GN3 A;  2ZMN A;  4QX3 A;  2AH2 A;  4IV3 C;  4XBN A;  3ZSJ A;  2ARX A;  5BNN A;  2E33 A;  3K75 B;  1A6C A;  4QPI B;  2D44 A;  1LED A;  3NL1 A;  2WZ8 A;  1BLZ A;  1ZRI A;  2OKX A;  1OOP A;  2CU5 A;  1AR7 1;  4D6S A;  4AI0 A;  3TRS B;  3VLB B;  1AHS A;  1GMM A;  2JDZ A;  2HBT A;  2Q1F A;  4Q4X 3;  3RVH A;  4W8J A;  5IFT A;  3AMQ A;  1N1V A;  1JZ2 A;  4F8A A;  4XJ9 A;  4MHR A;  1C8M 1;  5LBC A;  3AP9 A;  1ZA7 A;  4Q1R A;  5FZ6 A;  4PI2 A;  3S0M A;  1GU3 A;  5APA A;  3S30 A;  2RDQ A;  4PLM A;  3WG4 A;  5HPO A;  2JWP A;  1IQD C;  2ZML A;  1V6O A;  1OHF A;  4GKY A;  3SLI A;  3GHN A;  3HOB A;  1PIV 3;  4GB3 3;  5DUV A;  1NCQ B;  4RD7 A;  4C0H A;  4BXF A;  4CRQ A;  4CDU A;  2XWJ B;  1ZRE A;  1OQD A;  2VUA A;  3MO4 A;  1F2N A;  1STM A;  5FQ0 B;  4DOU A;  3KT7 A;  1UOJ A;  3DGT A;  4MGZ E;  1GZC A;  3HR9 A;  5T54 A;  2ORX A;  3ZX7 A;  4QX1 A;  3M3E A;  1RL3 A;  3T0B A;  2X5I B;  2HWC 1;  4AGR A;  5BNO B;  2HWD 1;  1W39 A;  3BI3 A;  1JYN A;  3T1M A;  4YVS A;  4AFD A;  1PMJ X;  1DYO A;  1NZC A;  4XF3 A;  1UMI A;  3I2I A;  1DZQ A;  1OQE A;  3CJI B;  4KL1 A;  2Q5T A;  4MGI E;  3UYJ A;  4CXW A;  1ND3 C;  2WZE A;  4AQT A;  4EN0 A;  1SLC A;  4ATE A;  1N1S A;  3D5O A;  3OUH A;  3TB0 A;  2XXZ A;  3T09 A;  4JKL A;  4OMD A;  1WBF A;  1AUY A;  3OUI A;  4XJU A;  3ZSE A;  3ST7 A;  2E32 A;  3ILN A;  4QDS A;  3LD8 A;  3ZO0 B;  1S4C A;  4D7Y A;  2JEM A;  1SZB A;  1NA1 B;  2V73 A;  1VBD 2;  3DKQ A;  3NRU A;  4Y1Z A;  4FTB A;  3HMY A;  4LHK A;  5H9S A;  1VBC 3;  4OHZ A;  1JU4 A;  2ZKN A;  4Q0P A;  1AXY A;  3VBU C;  4KMQ A;  4A3X A;  3CJX A;  1K5J A;  2PFW A;  3IBM A;  5GLT A;  1WCQ A;  1IS3 A;  1H6Y A;  1WD4 A;  5LRS A;  4PBP A;  5FP8 A;  4GWN A;  1SLB A;  4NPL A;  5JOW A;  2YC0 A;  4QAW A;  1WLT A;  2IZW A;  2WNU A;  4BK4 A;  1H1I A;  2EXJ A;  3J26 N;  2OT7 A;  3U75 A;  1CAX A;  4Q4X 1;  3FMG A;  4NWV A;  1NCQ C;  3LSD A;  2VW2 A;  1XNT A;  1XXN A;  5FKB A;  3J7H A;  5FZC A;  5IVF A;  5CFC B;  1DZR A;  2C9A A;  3ZFE B;  1UMH A;  4WVZ A;  4KWL A;  2FHR A;  3ME2 A;  3VGI A;  2VMD A;  3R05 A;  4EQV A;  4NIA A;  1X9T A;  1Y3T A;  2VU9 A;  1KEX A;  5DZE A;  4GB3 1;  3HT2 A;  1PIV 1;  3TNP B;  3WOG A;  4BXS V;  5FPZ A;  5FPU A;  5BNO C;  3H8X A;  2WFF 2;  1ZRC A;  5L36 A;  1BVV A;  4CU8 A;  3O1M A;  2CV6 A;  1FNY A;  1ASJ 3;  1PGS A;  1SFN A;  2HKX A;  4W6W A;  5FO7 B;  4FP2 A;  1ODM A;  3W59 A;  3K2O A;  4N7U A;  1C8N A;  5EYX A;  3P6B A;  4K9S A;  3CHX A;  3HNB M;  3I2J A;  4EN6 B;  2AGS A;  1AX1 A;  4QGN A;  4UYB A;  2ID4 A;  2JEN A;  4AED A;  3WT3 A;  5FZO A;  2A1X A;  1LOD A;  1S0F A;  1TME 3;  2B45 X;  2IFR A;  1U5Y A;  2ZX3 A;  3QAC A;  3LSE A;  4M4P A;  4BME A;  1GAN A;  1VRH 2;  4UFI A;  2LRO A;  4HPK B;  3GJB A;  1PM4 A;  1OVP A;  2WA4 A;  4GJZ A;  1YNA A;  2PTM A;  3VDD B;  1I5Z A;  4BWO A;  5F37 A;  1KFU L;  1NA1 C;  4P9Y A;  2C6S A;  5JXH A;  1G9A A;  1WME A;  4NUB A;  4CUA A;  3QBQ A;  3I2K A;  1FX5 A;  4QX7 A;  4OLL A;  1D4M 3;  1S2K A;  3M3Q A;  4QB6 A;  2I74 A;  1SMV A;  3DV8 A;  1G9D A;  5JOZ A;  2PHT A;  2J1V A;  5CG8 A;  4CPB A;  2Q0A A;  2AC1 A;  3JXS A;  5FY4 A;  3FLT A;  2CHH A;  4CU9 A;  1PZ7 A;  1VBC 1;  5A6Q A;  3WCR A;  2DUP A;  1LEC A;  5J48 A;  1U12 A;  1C5I A;  5F8P A;  3I8T A;  5LB6 A;  4AL9 A;  1C3H A;  3IAP A;  1W8N A;  4OFG A;  2DU0 A;  3EB7 A;  1CAV A;  1X82 A;  4LA2 A;  5M0T A;  4EWA A;  3BTY A;  2HYK A;  2K0G A;  1TNF A;  5CFC C;  1MR5 A;  4NN0 A;  1QJU 3;  1D0G A;  4I3P A;  2VW1 A;  4M0H A;  3AYC A;  4ZKT B;  3OBT A;  2RS5 2;  1R09 3;  4Q4Y 3;  4UFK A;  1OLQ A;  1GWM A;  3WHT A;  4I0W B;  2JKB A;  1HQW A;  4QXC A;  4P9I A;  4DEV A;  1R64 A;  4XXP A;  3H9A A;  4AFB A;  4RL7 A;  1BHG A;  2QNK A;  2XHN A;  4BU2 A;  3QD6 A;  4FBF A;  2QQK A;  4I02 A;  4IV1 A;  2W1U A;  2VUD A;  2DCJ A;  4JDM A;  4P00 B;  2YFZ A;  1LOA A;  1XOY A;  1AR6 2;  2HWF 1;  5FTT C;  3IN9 A;  5EZW A;  4EN9 B;  1W0P A;  2VZQ A;  5DAV A;  3BIW E;  5FKC A;  4KGG A;  1Z78 A;  4JX0 A;  1IQA A;  1ENX A;  1S0I A;  2IVJ A;  2P3Y A;  1ZBE 1;  3ZOI A;  5C8W A;  3V0A B;  1UN1 A;  1UY4 A;  1QOS A;  2WT1 A;  3PJY A;  4DIQ A;  4I09 A;  1H30 A;  3LDR A;  4OUL A;  1VAM A;  5HCF A;  4ZY9 A;  2D3P A;  4XJZ A;  2FMD A;  3BOW A;  3V64 A;  3C8X A;  3VDD C;  1BJQ A;  1BBT 2;  1REF A;  1WW6 A;  2C24 A;  3AXE A;  1ND2 B;  2QUO A;  4JZR A;  4COU A;  4OHY A;  3PIG A;  3WNL A;  5C4W B;  1LHW A;  3EMR A;  4GAL A;  5JMO A;  1TME 1;  2UYA A;  3ON7 A;  4XDO A;  3WD5 A;  1CQ9 A;  2V72 A;  4QHB A;  4XJW A;  5A3T A;  5BNP A;  5FZD A;  4DUW A;  3DN7 A;  3M70 A;  5EV7 A;  5CBL A;  2JDK A;  3H8U A;  4G3Y C;  4BQ2 A;  5KWR A;  4QM8 A;  4OHV A;  4XBL A;  3III A;  1W06 A;  2RS1 2;  2XL7 A;  4XFF A;  1F4H A;  4MXV A;  4AFA A;  4CDU B;  1W6O A;  1D4M 1;  1QNY A;  1SLA A;  4UOJ A;  2A71 A;  1JHJ A;  1UW8 A;  3NJX A;  1GFF 2;  1AR9 2;  1PK6 A;  5JXI A;  3IB3 A;  5FZ7 A;  1LES A;  3VHN A;  4TLF A;  4AVA A;  3MHZ A;  3B93 A;  3ZMO A;  1FAT A;  4B1M A;  1QJY 2;  2MEV 3;  3JBG 3;  5A32 A;  4BQX A;  3FFZ A;  1OMI A;  2J1A A;  3JZV A;  5A7P A;  4BQ4 A;  1LRH A;  1RUF 1;  4Q4W 3;  2XLA A;  5GZG A;  2OX0 A;  5B4X A;  4COY A;  1NZI A;  3AB0 A;  5KC5 A;  5L7O B;  3FHA A;  3PU8 A;  4BJ0 A;  1QJU 1;  4NWW A;  5JPM B;  2LRP A;  1H4G A;  4PLO A;  4Y20 B;  4LIT A;  3H3L A;  3MZH A;  4LBN A;  1R09 1;  4X8P A;  3KVB A;  1W2O A;  4AI1 A;  3KHC A;  4J1X A;  1APN A;  2ZGT A;  2E9Q A;  2AEY A;  1TEI A;  3C7H A;  1MZE A;  1QEX A;  1GIC A;  1K5M A;  4JTO A;  5BUV A;  2ATF A;  2ARE A;  4AXO A;  3AL5 A;  2Y0I A;  3ZXL A;  5C3R A;  2WWJ A;  2P6C A;  4BQW A;  1QQP 1;  5LK5 A;  3JD7 2;  1BMV 2;  1C1L A;  5GKA C;  4RN5 A;  1UPI A;  4ISQ A;  4BM8 A;  2WNV B;  3AXD A;  2XPJ A;  3WF4 A;  1ND2 C;  3A23 A;  1YFU A;  4URT A;  5C4W C;  4S2H A;  3BKZ A;  5F3E A;  1XND A;  2IXL A;  4Y5Z 0;  4UW6 A;  1TE1 B;  2XUM A;  2VTX J;  2VUL A;  2JE7 A;  2WN2 A;  2X09 A;  2XJR A;  3E6B A;  3ZSK A;  3NKT A;  2DU1 A;  2MNG A;  2ZXQ A;  4CDW A;  5LBE A;  5ABJ A;  3BIE A;  5E1R A;  5LY2 A;  5AVA A;  1CAX B;  4BK5 A;  3NV4 A;  1GZW B;  2WS9 2;  1OA3 A;  1W8F A;  5FMB A;  2BEO A;  5KR7 A;  5IW0 A;  3ZMN A;  2IFW A;  2JD4 A;  5FLH A;  3MIB A;  3O1P A;  1VRB A;  2Y6J A;  3LA7 A;  4NRM A;  4OI0 A;  2GNT A;  3OPW A;  3VBF A;  4LUM A;  3AJZ A;  1HB4 A;  1KD7 A;  2WBK A;  2WSV A;  1XE8 A;  2PHW A;  1DQ1 A;  4WM8 B;  5F5A A;  3VBO A;  4PDW C;  2D93 A;  1ZZ7 A;  1B35 A;  4Q5O A;  4BIS A;  3T08 A;  2A7A A;  4H7M A;  1QH7 A;  1CON A;  2O1Q A;  4HKW A;  5T5J A;  4Q0V A;  2G4I A;  5L7O C;  4ZS3 A;  4R52 A;  2VOT A;  2MEV 1;  1Z7S 3;  2B42 B;  1TQ5 A;  3ACF A;  2XLG A;  2BJS A;  1V9U 2;  3ES4 A;  4XAB A;  3BTX A;  4YRD A;  4L8Q A;  3N9Q A;  3DEM A;  4Q4W 1;  1O91 A;  4Q8K A;  1I6X A;  2RMU 2;  3SH3 A;  1RIT A;  2BP6 A;  3B00 A;  4QHZ A;  5K4L A;  4MUV A;  4FPK A;  3SEP A;  3WCS A;  2ZOE B;  4AVS A;  2WO3 A;  5I8S A;  3U14 A;  2ZGO A;  3ECQ A;  4GZ9 A;  4ZU5 A;  3AKQ A;  3PJQ A;  3A0K A;  3JB8 A;  4DZG A;  2Z5W A;  4OQ9 A;  3AKR A;  5A3W A;  4CP9 A;  4LO5 B;  5JZG B;  1W8U A;  2WNV C;  1UF2 C;  1GQP A;  1OC1 A;  1BZW A;  1DZT A;  3O0X A;  3VV1 A;  3DYO A;  2IVI B;  3ZFG A;  3AMP A;  1ZNP A;  5F5I A;  1JTZ X;  1RTV A;  2OVU A;  1NG0 A;  2Y6H A;  2YC4 A;  3RFR A;  4V2W A;  1ZRR A;  2W2I A;  3KHB A;  3WP6 A;  4A3Z A;  1UZZ A;  3ETP A;  1NCR A;  3BB6 A;  3WQ7 A;  3E5X A;  2YMZ A;  4FTS A;  5A7W B;  4IV3 A;  3VZK A;  5E6H A;  4JV4 A;  5A6X A;  4PQQ A;  2F4L A;  1DYK A;  4D0Q A;  2JB4 A;  3POI A;  2XR4 A;  2XKO A;  3OUJ A;  5LZ6 A;  3IDB B;  2J1T A;  3K77 A;  2XOM A;  5CKQ A;  2Y0O A;  1XU1 A;  2EIG A;  1HIX A;  4WM8 C;  2JDH A;  3IZO A;  4IEP A;  3T2O A;  1LOE A;  2I2S A;  2ORZ A;  3MIE A;  1AL2 2;  4IV1 B;  1W6M A;  4P9G A;  2VMI A;  4BQY A;  2ZEW A;  1OBN A;  4WZF A;  3WLU A;  3VBS C;  4KBZ A;  4H55 A;  3DF0 A;  1COV 3;  4YW1 A;  3V65 A;  4XET A;  1BKZ A;  1DCS A;  3C2U A;  1VBE 2;  4CU6 A;  4MSV A;  4XQW A;  4LOS A;  3L2H A;  3N7L A;  3FUQ A;  5DPN A;  1GWK A;  2D6N A;  3OGR A;  3VBR C;  3POB A;  2VGD A;  1RC6 A;  3I2D A;  3B69 A;  1VPH A;  4Q1P A;  5FZ1 A;  4AQS A;  5GM0 A;  4AEJ A;  5LEK A;  2NP0 A;  1F35 A;  1F5F A;  1UAI A;  3K3N A;  3KGL A;  4HVR A;  3OGV A;  1ULG A;  1TVG A;  4LBJ A;  4BLJ A;  2PAK A;  5D8A B;  3VHR A;  2WAO A;  1VBB 2;  4ZPI A;  4DB5 A;  4IGO A;  5FXX A;  4NR1 A;  2C1F A;  2P37 A;  4I3G A;  1CIY A;  4PIX A;  2PHR A;  5JZG C;  1R08 2;  4LKF A;  3VL9 A;  1MS0 A;  1CR7 A;  1CJP A;  3KQ4 B;  3ZN5 A;  1N3O A;  1W0N A;  3U78 A;  4A7K A;  1ND3 A;  3E5Q A;  5FLI A;  4R9C A;  2PHU A;  2HWB 3;  5LCW L;  3IMN A;  2KA3 A;  2J1S A;  2ZAC A;  4RHV 2;  5CNA A;  1S0B A;  4IEV A;  4NAO A;  3I59 B;  3AYD A;  2XKP A;  3POG A;  1YQ2 A;  1PVC 2;  2ET7 A;  1G6N A;  4YG0 A;  5DZF A;  2CWS A;  4RGA A;  2JDY A;  1FPN 3;  5IAT A;  3ZR5 A;  1LHU A;  2AUY A;  4JGZ B;  1PO2 3;  1CX1 A;  3RMY A;  2EF6 A;  2VZS A;  3VBU A;  3VZJ A;  4ARX A;  4DRR A;  4XAC A;  5C5U A;  1PO1 2;  2PHD A;  1IKP A;  4TYS A;  4V1P A;  2XBO 1;  4Q0Q A;  1JYC A;  1ENS A;  2WIN B;  3L9J T;  3OBZ A;  1KDK A;  1RXF A;  4LBM A;  3BN6 A;  1QJX 3;  3R0R A;  1YRZ A;  2NZ9 A;  2PQS A;  5FZB A;  3AK0 A;  2C0Z A;  1ONA A;  3LPG A;  4LOR A;  4R8H A;  4ZZ5 A;  4PQ9 A;  3M3I A;  4GMP 3;  5FK7 A;  3T2P A;  3ZPY A;  4XDP A;  1VBA 3;  1NCQ A;  1DLC A;  2VBD A;  3RS6 A;  3RQ0 A;  3VD9 A;  3W5M A;  4D6Q A;  1SLI A;  5LY1 A;  5FQ0 A;  1UYP A;  4HKO A;  4NHX A;  4GWJ A;  2VNG A;  1VJ2 A;  5IVC A;  5C71 A;  4KWJ A;  1NX9 A;  3TBD A;  1LR5 A;  2CGP A;  2QE3 A;  1AR8 3;  2P1B A;  3ATG A;  4XUO A;  3PTR B;  3ZFF B;  3LDB A;  5BNO A;  2EIC A;  4CEY C;  3ZYI B;  2BGP A;  1RB8 G;  5D8A C;  2CTV A;  4XFC A;  1HRI 3;  1WMX A;  5J1X A;  4N9I A;  4WVV A;  4LE3 A;  3WVJ A;  4XFB A;  3OY8 B;  3P5B A;  1UXZ A;  5CAZ A;  1R1A 3;  3WNK A;  2OPK A;  2E53 A;  5E8A A;  5IFP A;  1B09 A;  3AYE A;  2DCT A;  2W9X A;  4M00 A;  1O4Z A;  2BNM A;  2BGO A;  1ZZ8 A;  1N3P A;  2YRO A;  2Q8C A;  3FFQ A;  1E5H A;  4FAG A;  4ZS2 A;  4F3J A;  3MW3 A;  1NA1 A;  2NLR A;  2HWB 1;  1RIN A;  2YZ4 A;  4RGK A;  4C1W A;  4L0P A;  2MHF A;  4OYU A;  1RUD 2;  2XGX A;  4JGZ C;  4O7X A;  3WQB A;  2YPD A;  3KB5 A;  5JDB A;  1K42 A;  2QQJ A;  4UFL A;  4BYY A;  3SHR A;  3WQ1 A;  1CPN A;  2ZGK A;  5FRE A;  5DDJ 3;  3H7Y A;  3WXP A;  4IE6 A;  2WWU A;  1FPN 1;  2UWB A;  2ZGS A;  4FTE A;  3RWK X;  4Y4R A;  4AK3 A;  3V56 A;  2YUE A;  1RUH 3;  3NV2 A;  4QM9 A;  1QU0 A;  2QQM A;  1AXK A;  2OZJ A;  4LXL A;  2QBX A;  2ZCW A;  3LKJ A;  2B9V A;  2X05 A;  5J3U A;  2A6Y A;  2FBE A;  1JBC A;  3LF7 A;  1RUG 3;  1RUJ 2;  5FO8 B;  2ENR A;  2FDJ A;  1FAY A;  2O0O A;  1C5H A;  4E27 A;  2L9L A;  1KJR A;  4H14 A;  5FY1 A;  3UKT A;  4D94 A;  2A75 A;  3M3C A;  1KDM A;  3RDI A;  5CFC A;  3MUY 1;  3FX3 A;  2AEN A;  2A3Y A;  3M7A A;  1YFY A;  3TN9 2;  2R0F A;  2ZX0 A;  1W2U A;  4GMP 1;  1REE A;  1SFP A;  3PU3 A;  3ZFF C;  4O9G A;  1X8E A;  3O1O A;  2K46 A;  3A22 A;  4AF9 A;  2QQW A;  3NNM A;  3POF A;  2BDR A;  4YLZ A;  2DUO A;  3B9I A;  4NRQ A;  2R6Q A;  3N9M A;  1NCR B;  1AR8 1;  1HW5 A;  4JHZ A;  2P34 A;  2XVK A;  2EID A;  1PX4 A;  1EYB A;  4RYD A;  4IV3 B;  1LOF C;  2YXS A;  1GOH A;  2DVG A;  3CNA A;  3HQU A;  3PVN A;  4LNV A;  4XFH A;  3SIT A;  3ZSM A;  2IXI A;  5JSO A;  4YSF A;  2Q30 A;  1W99 A;  2BVV A;  4XXA A;  4N43 B;  1RUN A;  2VME A;  4HPK A;  3FHI B;  3KCX A;  3A7Q A;  2Q8O A;  1R1A 1;  5JI9 A;  1FMD 2;  3SH4 A;  3VDD A;  4BPZ A;  4CXX A;  1MEC 3;  5LEJ A;  1RIR A;  1SFY A;  1WCU A;  4YWA A;  5I8Y A;  4QPG B;  1W6M B;  4ASL A;  1RUC 3;  2EAL A;  4G4F A;  1RUE 3;  3HN3 A;  4Y1Y A;  4R4X A;  1RHI 2;  1DHK B;  4GD4 A;  4BLI A;  1N3Q A;  1DGW A;  3VD7 A;  4BA6 A;  4CCN A;  4YW2 A;  2TUN A;  4FI9 A;  2HWC 2;  5GLZ A;  3GHM A;  4XPV A;  5JCT A;  4AAP A;  2FDH A;  3Q8F A;  1H9P A;  2D97 A;  5C3P A;  1O3R A;  4A6S A;  1QF3 A;  4LHL A;  2A73 B;  5BY5 A;  1FNZ A;  1KQR A;  3NVC A;  1C1F A;  5DDJ 1;  4AI9 A;  1ZBA 2;  3SCH A;  1WZX A;  2B9U A;  2J42 A;  1YJK A;  1YI9 A;  2Y38 A;  4IL7 A;  4P9X A;  5IK8 A;  1X8M A;  1RUH 1;  2P3I A;  4E4H A;  1AYN 2;  1J3P A;  4LK7 A;  5AFB A;  2DCY A;  3RG0 A;  3J8F 3;  3N7K A;  1RUG 1;  4XZP A;  1S55 A;  1MZF A;  1HXS 2;  2OZ6 A;  1G8W A;  3K4Z A;  4FPY A;  4LUL A;  5T3N A;  4EYU A;  1DDL A;  1NXD 1;  1YWK A;  3E5U A;  1LTE A;  4XUR A;  4YZ3 A;  1ND3 B;  5FXW A;  2RHP A;  5D2A A;  4W65 A;  3ACI A;  5TSW A;  3S57 A;  2GC0 A;  5GLV A;  2PAE A;  2R07 3;  3D0S A;  1RVF 3;  1F8V A;  3VD4 A;  2HWE 3;  2VM9 A;  2YBK A;  3WNX A;  4I0A A;  1LOB A;  2R06 1;  2WN3 A;  3IDC B;  2VPV A;  5FZI A;  2D6O X;  5FXZ A;  1YIP A;  2ARC A;  5F2S A;  3V0A A;  4XJ8 A;  2OYZ A;  2Q1M A;  3TWI A;  3RMX A;  4N43 C;  1J3Q A;  2A3W A;  3OPZ A;  4BH9 A;  3ABZ A;  3VBU B;  2JG8 B;  2P17 A;  4Q4X 2;  4DFS A;  4LT5 A;  1C28 A;  1W6P B;  4NRO A;  3ZKY A;  1FV3 A;  4HFS A;  2D7F A;  3OF1 A;  1ND2 A;  5F6L B;  2R04 2;  4YGD A;  5C4W A;  2VBP A;  2W08 A;  1EV1 3;  2WFP A;  3IWZ A;  4YG3 A;  4C1X A;  5J09 A;  4QPG C;  5KHK A;  4HK8 A;  2PN5 A;  4AOC A;  1ZZB A;  2ZGN A;  4QHO A;  3CIH A;  1WUV A;  1TMF 2;  5B4N A;  1MEC 1;  1RMU 3;  1KS4 A;  2BOI A;  5JPN B;  1Q8P A;  3B94 A;  1UZ0 A;  2W94 A;  4PJY A;  4UF0 B;  4B7K A;  4QD2 A;  4WM7 C;  4XDQ A;  3OG2 A;  1LGC A;  1SLL A;  3O0W A;  4XQD A;  1RUC 1;  4OZO A;  1JH5 A;  4OUS A;  3MPP G;  1L7Q A;  1RUE 1;  3AZZ A;  4Q2F A;  5ANQ A;  3KF3 A;  4JKK A;  4UFH A;  4BIF A;  3H3U A;  1TZO A;  3M4F A;  2W0X A;  2GU9 A;  2XWB B;  4QKF A;  3VDA A;  4BQ1 A;  4E4D X;  3F2Z A;  4YZ2 A;  1BXH A;  4X6Q B;  2SBA A;  3D4K A;  3OGS A;  3SNM A;  3IT8 A;  1OF3 A;  2VTF A;  4CCJ A;  2IXH A;  4PDW A;  4MGK E;  1IS4 A;  4LIV A;  1SAC A;  1JZ3 A;  2VJX A;  3IPV A;  3INA A;  1FOD 2;  2ZX2 A;  1S0J A;  5HCB A;  1E57 A;  5L7O A;  1H8T B;  1NLR A;  1QGL A;  2DFC A;  3B9C A;  3NJV A;  1GZ9 A;  4IEZ A;  4CP2 A;  4IEY A;  3WNP A;  4LR4 A;  4Y20 A;  5C3Q A;  4TN7 A;  4CUC A;  3GBG A;  3J8F 1;  1JXN A;  3NNF A;  1DLL A;  3LEI A;  2G9F A;  2OS2 A;  4LKS A;  2P3K A;  2WYS A;  3FBY A;  2DCK A;  3WDT A;  3PUI A;  5T50 A;  5E89 A;  2FDK A;  5FZG A;  5EP9 A;  2H6B A;  1UXX X;  4S2D A;  2R07 1;  3BU7 A;  2GC1 A;  2VOK A;  4GMP 0;  1RVF 1;  4LO8 A;  1CZT A;  1LGN A;  2JG8 C;  1WW7 A;  2HWE 1;  2WNV A;  4I01 A;  3T30 A;  4R9A A;  1IPJ A;  1MVE A;  2PYT A;  1BVP 1;  1IPS A;  3USU A;  4XCB A;  2XJS A;  5DUW A;  2DBN A;  1D0H A;  4Q4V 1;  1GLH A;  4WVM B;  1EPZ A;  1W9W A;  2IUW A;  1PGW 2;  2LAL A;  2VE1 A;  5F1R A;  1NT0 A;  2RDS A;  4MH0 E;  2RM2 1;  3O7O A;  2ZBJ A;  4N8M A;  4YG6 A;  1GZW A;  3FN9 A;  4RQP C;  2R30 A;  1ULD A;  1EV1 1;  1Q5O A;  1VBD 3;  2EAK A;  5C5T A;  4YGE A;  4N90 A;  5FPL A;  4CVU A;  3P3N A;  2HWF 3;  4L92 A;  5KHG A;  1PGL 1;  1RMU 1;  3IKW A;  4Y5S A;  3I3E A;  3O1S A;  3UET A;  3LA3 A;  4WM8 A;  1ASJ 2;  4E2S A;  2G1M A;  1HB3 A;  1ZBE 3;  4C0B A;  1GQH A;  2J7M A;  3APB A;  3SC7 X;  4UFJ A;  3MFC A;  1E5I A;  4NPM A;  4S2F A;  1VIW B;  4PT6 A;  3VBS A;  1YI7 A;  4K8R B;  3ZXD A;  1H8T C;  3ILR A;  3JQW A;  3S6P A;  4CXY A;  4LBQ D;  2GND A;  1ACC A;  4MOA A;  4QX5 A;  4ZXK A;  3S5Q A;  3IMM A;  4IXL A;  3GZT B;  1HJG A;  1LHO A;  1QXP A;  4XJA A;  1WA4 A;  3VBR A;  3EQE A;  1HKD A;  1VR3 A;  5HXM A;  1OUR A;  2JXA A;  5T55 A;  4NJ4 A;  4RFT 0;  2VXJ A;  5IVB A;  3WP4 A;  4I30 A;  2W3J A;  5EFU A;  4MGS A;  1PMH X;  3GXU A;  2FZ2 A;  2ZMK A;  4JQT A;  5A3U A;  2AEZ A;  5FP3 A;  2WFF 3;  4LBK A;  2BYV E;  2EIE A;  1O7F A;  2UY9 A;  4FOQ A;  2DTY A;  5JOX A;  2WSU A;  5I0U A;  5ISL A;  1UWW A;  1SPP B;  3LIG A;  4Y5T A;  5L19 A;  3AMH A;  3KD4 A;  4YZ1 A;  5JZG A;  1FV2 A;  3ZXA C;  4XZU G;  3KV4 A;  5FZA A;  1NAE A;  2YDE A;  5CA6 A;  3VUO A;  2AYH A;  2OUJ A;  3AKT A;  3FHQ A;  1I1E A;  1OKQ A;  3KV9 A;  3MLL A;  4K7J A;  4CYD A;  1RUF 3;  4S2G A;  1QHD A;  1QDC A;  4CCL A;  1HN0 A;  2G9G A;  4MET A;  2VZV A;  2NQY A;  5A7W A;  3ZYH A;  5A3P A;  4QU1 A;  1J1T A;  1XB9 A;  2LTN A;  2ZEX A;  1QJU 2;  3HBK A;  2CYF A;  3OD4 A;  3KGZ A;  3OEB A;  2E51 A;  2XJT A;  5ANN A;  4DO0 A;  3KVA A;  4Q4Y 2;  2VR4 A;  4AEM A;  3VN4 A;  2E6V A;  3TEZ A;  4XMA A;  1LU1 A;  4QXK A;  4I0B A;  5F5Q A;  3O1T A;  1FXZ A;  1E5R A;  1ZM1 A;  3BPZ A;  1YEW A;  2VZ1 A;  4UWD A;  3E6C C;  1R1Z A;  2B5H A;  1U0A A;  4MX3 A;  4DNY A;  4DXR A;  1DQ4 A;  1JUI A;  3CKH A;  3VB9 A;  1PVX A;  1VBD 1;  1GNY A;  4W4Z A;  2VXR A;  5LBF A;  1CAU B;  1XE0 A;  1CVN A;  2WL1 A;  4XVH A;  4MO3 M;  4XF0 A;  5A33 B;  2W1Q A;  3BU0 A;  1W8H A;  1JW6 A;  3AP7 A;  5DG2 A;  2HH9 A;  1QQP 3;  4AQ6 A;  2D40 A;  2WZP P;  1GR3 A;  4XFI A;  3OGG A;  3VKN A;  4YM0 A;  1N47 A;  4KWK A;  2GZW A;  5ERL A;  1OH4 A;  3N7M A;  1N1T A;  2GP5 A;  3S7E A;  3ZDS A;  5FPA A;  3Q8C A;  1GYK A;  3Q8B A;  4B4Q A;  3EHK A;  1FT9 A;  3GYD A;  4B29 A;  1MAC A;  4BQ5 A;  1GP4 A;  2R1D A;  3HD8 B;  1QXR A;  3UV9 A;  4CEY A;  4HN1 A;  5D8A A;  4XUT A;  1V6K A;  1DF0 A;  4MGT A;  1I3H A;  1OUX A;  1AR6 3;  3B01 A;  3WW1 A;  2VZR A;  5A3N A;  2VZ3 A;  1G86 A;  4FQ4 A;  2D3S A;  3KV5 A;  5AC9 2;  3AMN A;  4MLO A;  5LBB A;  3WF3 A;  2X8K A;  2WFF 1;  5F7U A;  3OBA A;  3ZXE A;  3Q9O A;  4JDO A;  2V5Y A;  3OYW B;  2PEL A;  4AGV A;  1MS8 A;  4IW3 A;  2KD7 A;  4XIK A;  3OBR A;  4K1Y A;  1QIQ A;  2B8M A;  4AVC A;  1Y7B A;  1V6L A;  2VMC A;  3I59 A;  3TEY A;  2VZO A;  1Q8Q A;  2VQT A;  4SBV A;  1Q8V A;  2RS3 2;  2MEV 2;  3JBG 2;  2XML A;  4C8D A;  5L9V A;  1BBT 3;  4GAZ A;  4WBB A;  1LHN A;  3NJZ A;  5FYH A;  1JU3 A;  5FZH A;  5KXD A;  3JUU A;  1SG3 A;  2XQX A;  3U37 A;  3SH5 A;  4PDW B;  4GWI A;  2YU2 A;  4JGZ A;  1H1M A;  4YM2 A;  3R6S A;  3WDW A;  1VRH 1;  2UWC A;  1W2A X;  3IPV B;  3I4I A;  2WQ8 A;  4NHM A;  1CWP A;  1UX6 A;  3AFG A;  2XUE A;  4YW3 A;  4FPL A;  2LW8 A;  2BNN A;  3ELN A;  4PCR A;  3T3Y A;  2PMW B;  2RS1 3;  3RZZ A;  5JSP A;  1NLS A;  3LEG A;  2O8Q A;  2EIB A;  4LLF A;  1NXM A;  2DWR A;  2ARA A;  3I2G A;  4IDZ A;  1AR9 3;  1HDK A;  1UY1 A;  2K9Z A;  5FP4 A;  3WIN E;  5CIR A;  2WKK A;  1DQ6 A;  3FWE A;  3IIA A;  3C3V A;  4DUX A;  5FPX A;  3A21 A;  3WNN A;  3MF6 A;  2WNE A;  1QJY 3;  4Y33 A;  1Q8O A;  4CCK A;  5BV6 A;  3K48 A;  4Y22 B;  3G6J B;  3M2M A;  3ORJ A;  4FFG A;  3HVD A;  2FDF A;  4JAA A;  2BWA A;  4CCO A;  1AL0 G;  3C7O A;  5H9R A;  4G9S B;  1YC6 1;  3ZFF A;  2VTX A;  2Y34 A;  3JB4 C;  3E97 A;  2A5Z A;  3USU B;  1XPW A;  1RGS A;  1HB2 A;  4LE4 A;  1QH6 A;  1HQL A;  3RJR A;  2JIJ A;  1E5S A;  1PZ8 A;  1OH3 A;  2VNV A;  2RS5 1;  4JHT A;  1US3 A;  4ISR A;  4QB1 A;  3OY8 A;  5L73 A;  2W68 A;  4HAN A;  3TOJ A;  4AE2 A;  2W5F A;  3J7M A;  2IC1 A;  1UYZ A;  1G7Y A;  4MAD A;  5L9R A;  1VAL A;  1LOF A;  1H2N A;  1XU2 A;  1JHN A;  4ZZ8 A;  1AR6 1;  3MV0 1;  4ERO A;  1UCX A;  1DIW A;  1CX4 A;  3PVE A;  4E2G A;  1X9P A;  1RUI 2;  2B7Y A;  3WF0 A;  1VB2 A;  2BUK A;  4IEU A;  3PNA A;  4KBB A;  3ZYF A;  5FJH A;  4CDX B;  3ASI A;  1Y9G A;  3ZXF A;  4QPY A;  3MFA A;  3LOI A;  5DZG A;  3MUZ 1;  1UQX A;  1JYT A;  3WDY A;  1OXC A;  1WKY A;  2OPW A;  3WDV A;  1BYH A;  1IPK A;  3ES1 A;  4IER A;  3BGA A;  4XBQ A;  3VBS B;  1Z7S 2;  1OQ1 A;  5J98 B;  1BBT 1;  3ZLI A;  3PL0 A;  4NAM A;  4B3N A;  4LJH A;  1J1L A;  4AHX A;  5EIY B;  2ZS6 B;  2VNO A;  4P9J A;  2ZTN A;  5C3S A;  2GAL A;  1YYN A;  1AF9 A;  2GSY A;  1C57 A;  3VBR B;  3AZW A;  4OMC A;  3KLS A;  5D21 A;  2E7Q A;  4EWE A;  3H1M A;  2Y8K A;  1QWR A;  3VBH B;  2ADD A;  4KH9 A;  4P5H A;  1BK0 A;  5FUP A;  2WWS A;  2DVA A;  3RPQ A;  5FR3 A;  4A2U A;  2RS1 1;  4CCM A;  1DBN A;  4CSW A;  3K3O A;  1AX0 A;  3AJY A;  1GP6 A;  5IAX A;  1WLD A;  4L11 A;  4TXW A;  1AR9 1;  3UKN A;  4QX8 A;  4A41 A;  1MVQ A;  2DYC A;  3ACG A;  4WV8 A;  5GZD A;  3K46 A;  1W6Q A;  1F31 A;  4JTN A;  1UU4 A;  1IKQ A;  4QXH A;  1QJY 1;  5DN2 A;  5FP9 A;  5IAV A;  5FZF A;  5LAS A;  2XJQ A;  4PF1 A;  5FWE A;  1V9U 3;  1VAV A;  4B8E A;  4E8C A;  1OUS A;  4CUB A;  2FCU A;  3AP4 A;  2RMU 3;  1HRV 2;  1FYU A;  1QDO A;  3CU7 A;  4Q0S A;  4P9L A;  4DPN A;  4RA0 A;  2N7G A;  1ZRF A;  4EWD A;  5DAX A;  1O3T A;  2XBO 3;  4CEW B;  4Y1X A;  3JU9 A;  1UYX A;  4XOG A;  3IM0 A;  3QOP A;  5GZE A;  5I0T A;  1XBF A;  2PLV 3;  2OQ7 A;  4N43 A;  4AI3 A;  3AZY A;  4YVW B;  4A44 A;  2YC2 A;  1WCS A;  2BVB A;  3GNE A;  2XHK A;  2D6M A;  3O1V A;  2XON A;  1W9S A;  3NNL A;  4BMB A;  5KXC A;  4A7Z A;  4P02 B;  2Z2S B;  4QQP A;  5FYC A;  4CDX C;  4CP0 A;  4QPG A;  4E8D A;  2BGC A;  1NLQ A;  2ET1 A;  3ACL A;  1COV 2;  1BMV 1;  1GOG A;  4MV2 A;  2RG4 A;  2D5F A;  3UGG A;  1ENR A;  3GM8 A;  4YYO A;  2VH9 A;  1SCS A;  3T2T A;  3MDP A;  4JGY B;  4WM7 A;  3QH6 A;  3DYP A;  2YHJ A;  4JKM A;  1Q8S A;  2JKX A;  2VZP A;  4HN0 A;  3SKJ E;  3UGF A;  4L99 A;  4AVT A;  3U07 A;  1V0A A;  3MEP A;  5JI7 A;  3AX4 A;  3DUI A;  3AZX A;  3VBH C;  2DFB A;  1PX3 A;  4QX2 A;  1UZW A;  1XYP A;  1DGR A;  3BOD A;  2WS9 1;  4AHW A;  3AFK A;  4L97 A;  1WCD J;  4GUL A;  1EY2 A;  4CEY B;  2QQL A;  2Q1Z B;  4TSV A;  5EYY A;  1QJE A;  1AL2 3;  3U0Z A;  3KT1 A;  2O8O A;  1OSG A;  2W91 A;  1HX6 A;  1CD3 G;  3WUC A;  1YQ8 A;  2JDP A;  1S0C A;  4A42 A;  4Z82 A;  5SV5 A;  1M4W A;  1VBE 3;  5F3C A;  3GGL A;  5JIU A;  3WUD A;  2WLQ A;  2VAU A;  3WNM A;  5I93 A;  3NMB A;  5JLV A;  4UT5 A;  5SV8 A;  5C9A C;  4Z07 A;  1WCK A;  1YO8 A;  4Z2A A;  1CPM A;  1MPX A;  1OLM E;  2XL9 A;  4D7S A;  3WP3 A;  3HEI A;  4RS5 B;  4CEW C;  1MS9 A;  2V4A A;  4O61 A;  4Y4Y A;  2ADE A;  5FXV A;  3ZXJ A;  1V9U 1;  3PLQ A;  4LPL A;  5J7M A;  2HBU A;  4AVB A;  1PO2 2;  1VBB 3;  4CDQ C;  2RMU 1;  4JC1 A;  4YVW C;  2OQ6 A;  3KV6 A;  1XNK A;  2JG8 A;  1R08 3;  4KQ7 A;  3WEZ A;  3QLQ A;  1YQ5 A;  3HT1 A;  5K0U C;  1W6P A;  4Y1U A;  1EAH 2;  4NOT A;  1QJX 2;  2E31 A;  3X29 B;  3TAY A;  4LUK A;  2CNA A;  5EXO A;  4B1L A;  3VKL A;  1ZX5 A;  2PLV 1;  1W0O A;  4LBO A;  4LMF A;  4NE9 A;  1HV0 A;  4XAE A;  1F9K A;  3MID A;  3GZA A;  4COV A;  4RHV 3;  1VBA 2;  3CL1 A;  1S0D A;  2H0V A;  2W52 A;  2NMO A;  3GDB A;  3BTA A;  5FY5 A;  1F4A A;  4UF0 A;  1PVC 3;  4RQP A;  4JGY C;  4NVP A;  1SCR A;  2BQP A;  4GA9 A;  4GXL A;  3LZZ A;  3FLP A;  5CG9 A;  1NY7 2;  2JIC A;  3AKS A;  1W2T A;  2RR1 2;  1JMU B;  3MPB A;  5FZ8 A;  2QQN A;  3D6E A;  1PO1 3;  4PI0 A;  2GP3 A;  5IT6 A;  2WRA A;  2RV9 A;  3I7D A;  1HV1 A;  2YYO A;  5DAQ A;  1HRI 2;  2VC9 A;  4ET7 A;  4MGY E;  2JJ6 A;  2Y26 A;  5CFD C;  2D6P A;  5JIA A;  1OPM A;  2WNO A;  1WMD A;  1RJ8 A;  3T1L A;  3NNG A;  4LTA A;  3UT0 A;  3RYR A;  3THT A;  1H8T A;  5IK4 A;  1Y9M A;  5FMD A;  2DCZ A;  1UY3 A;  1W8O A;  3THC A;  5KHI A;  2WZR 2;  1AL2 1;  2ZGM A;  3N9N A;  4AHY A;  2ZZQ A;  1H2M A;  3V0B A;  1MS4 A;  4LO6 B;  2EXH A;  4K8F A;  5FY9 A;  5HV4 A;  5D1I A;  3C7E A;  5L9B A;  4M01 A;  4RS5 C;  3D3A A;  1VBE 1;  5DQ0 A;  5EWS A;  3AM2 A;  2PXJ A;  2A6W A;  5FPB A;  5I0R A;  5A80 A;  4Y26 A;  3CF6 E;  1BEV 2;  1T6B X;  3H50 A;  3MV1 1;  4HZF A;  3S7I A;  4GH4 B;  4B7E A;  3RNS A;  1AYM 2;  1J84 A;  3M1H A;  1UY2 A;  2QTW B;  5ACA 2;  4YZ4 A;  1Y9Q A;  5A6Y A;  2XH6 A;  2W46 A;  1K3I A;  3ETQ A;  5FZ0 A;  1J83 A;  1NQJ A;  2Y6K A;  1VBB 1;  2R0H A;  4WVM A;  4IES A;  3T2Q A;  4FQZ A;  1RUG 2;  1R08 1;  2PAM A;  2Y60 A;  3WG2 A;  1A8D A;  3ZDV A;  4N9H A;  2EXI A;  4QQL A;  1W05 A;  4XUP A;  1S0G A;  5FYZ A;  5A70 A;  1W9F A;  5GAL A;  3LOB A;  3DXU A;  1DGL A;  4KU7 A;  4LKE A;  4IE5 A;  3TEX A;  2HJI A;  1RUD 3;  1PHM A;  4RHV 1;  1V6M A;  1JN2 P;  4E4Z A;  3PUH A;  4HL0 A;  1PVC 1;  1W6Q B;  2VW0 A;  5FFO C;  3WZ1 A;  2BNO A;  3OSD A;  2R06 3;  1VMJ A;  2VZU A;  4WZC A;  4MXW A;  4YW5 A;  2WQ4 A;  3WQ0 A;  4CUG A;  1XSQ A;  1GQG A;  1AR7 2;  4COW A;  1PO1 1;  4FPC A;  2QCS B;  5C8C B;  1RUJ 3;  2YGL A;  4FSJ A;  5C33 A;  4XHX A;  3LCP A;  5JR7 B;  2ETE A;  1LEM A;  3K4D A;  3BUC A;  1VMF A;  3Q8E A;  1SBE A;  5BPX A;  1C8M 2;  1AJO A;  4OVE A;  3UNP A;  3RYK A;  3NJY A;  2ZX1 A;  5FMC A;  1POQ A;  4IGQ A;  4UW5 A;  1YCI A;  2VQU A;  4FPO B;  4QT6 A;  4RR3 C;  4Z2W A;  1JYX A;  2DVD A;  1VMH A;  3KCY A;  5CVR A;  3NAP B;  4AFM A;  5F9T A;  3POW A;  4GH4 C;  3T4V A;  4XF4 A;  1SPP A;  1VP6 A;  4CCE A;  2JDA A;  3H1W A;  3I2H A;  2QZ2 A;  2ZZJ A;  3VD5 A;  3ZYJ B;  2ERF A;  1JYV A;  3H8R A;  3RZK A;  5IYY A;  1TG7 A;  2B39 A;  4EZH A;  3RZJ A;  2TBV A;  4CA9 A;  2HWD 2;  3FC0 A;  4WM7 B;  4HSL A;  1H9W A;  1OLR A;  1YHF A;  2VEC A;  3LE0 A;  4XMI A;  1G9F A;  1H4H A;  3PVO A;  4KI5 M;  1W8W A;  3IDE A;  3NKG A;  4LQR A;  4K1Z A;  3ZIW A;  1RJ7 A;  3NV1 A;  4CCC A;  4ASM B;  4OUE A;  1WLW A;  3GCX A;  3IDA A;  2VNR A;  3ZN4 A;  5IK5 A;  4PHZ A;  1W8Z A;  2OUH A;  5JVV A;  5HI0 A;  4E2Q A;  5CU1 A;  5KBF A;  1YXW A;  4ZXE A;  3W21 A;  1H2L A;  1GNH A;  3FJS A;  1A3K A;  2QKD A;  3HJR A;  4Z92 B;  5FYT A;  4N53 B;  1IZ3 A;  4MYE A;  1IGO A;  3HQX A;  4YGB A;  3WV6 A;  4EN8 B;  5IVY A;  1ULC A;  1CAU A;  2CL2 A;  3I2F A;  3WY6 A;  5A33 A;  1RUD 1;  3ZN6 A;  2D6L X;  4IEQ A;  2C5D A;  2HYX A;  2H6C A;  4KG8 A;  4MZU A;  5FZM A;  5JWP A;  1YUD A;  5C8C C;  2GDF A;  3UES A;  2YBP A;  3GBF A;  3AYA A;  1H2K A;  2D3R A;  4D7T A;  4BIO A;  3OJB A;  2UYB A;  3PDQ A;  1QJF A;  4LK6 A;  2W95 A;  3AP5 A;  2J1E A;  1OF4 A;  3CBN A;  4Q4V 3;  2ZGU A;  3VDB A;  1SHW B;  1W90 A;  2FDG A;  2A70 A;  3B02 A;  4JRA A;  4FAH A;  3KZ4 C;  5CAD A;  1RUJ 1;  3MLK A;  5E88 A;  1HXS 3;  2BV4 A;  2RM2 3;  1O3Q A;  1WWY A;  3IAQ A;  1EV1 2;  1SBF A;  4UW4 A;  5IUQ A;  3JQX A;  3DPR C;  3NAP C;  2A6Z A;  3W9A A;  3ITQ A;  4BZ4 A;  3N9L A;  4IQP A;  1LCL A;  4AW7 A;  2WLP A;  4D8M A;  2I07 B;  3OEA A;  3LQC A;  4GB3 2;  4LO4 B;  1PIV 2;  2B46 X;  4IEO A;  1UNB A;  2LM3 A;  4OHX A;  2ES3 A;  3LGR A;  4RQP B;  3HWJ A;  3OYW A;  3N9P A;  1GV9 A;  4UXA A;  1W03 A;  3TYJ A;  1PNF A;  1JZ5 A;  1EPW A;  4KNC A;  5JXJ A;  2BWC A;  3SQO A;  4IE7 A;  4QDR A;  5EHD A;  3WF2 A;  1C4R A;  3CMG A;  4HBN A;  1VB4 A;  1POV 3;  2BW8 A;  2J1U A;  2R04 3;  3DKW A;  3GJA A;  1Z0H A;  1LNS A;  4M3C E;  4YW6 A;  2GMM A;  1D2S A;  3T0A A;  4KU8 A;  4D3W A;  3BAL A;  1ULP A;  2JEC A;  3KF5 A;  3PMS A;  3ACH A;  4PIY A;  5DUX A;  1MZ6 A;  2RJ2 A;  1W9Y A;  3DL3 A;  2WO7 A;  1ENQ A;  1FMD 1;  1TMF 3;  1UD1 A;  3GCW A;  4MGQ A;  4N53 C;  1ZZ6 A;  4YW4 A;  4AHZ A;  4TZD A;  4OHW A;  2IXC A;  2HLE A;  2XQR A;  1OLM A;  2VOX A;  3CQO A;  4CE8 A;  1G9C A;  2G19 A;  2QDR A;  4F7Z A;  3PVB B;  4NID A;  5FYY A;  5EJ3 A;  3V0B B;  1RHI 1;  4GQ7 A;  1PM7 A;  2JE8 A;  2BU9 A;  2JG9 B;  2HEV F;  5FYI A;  5A7O A;  2EVX A;  3OOX A;  3U11 A;  1JUH A;  2DV9 A;  1VBC 2;  4HK9 A;  2VMF A;  3MLJ A;  5KXB A;  2PA7 A;  3ZYB A;  3A4U A;  1W6N B;  2GMP A;  4Y22 A;  1AXZ A;  4MVT A;  1OA2 A;  1KXG A;  1YJL A;  1CZV A;  2V09 A;  4HET A;  3UJQ A;  4A7Y A;  1MZ5 A;  4YZ5 A;  1ST8 A;  1FOD 3;  3MW4 A;  1ZBA 1;  3B5L B;  2R1B A;  3WDU A;  2Y33 A;  2NPI A;  2ZGR A;  5C7G A;  5FK8 A;  5GLU A;  3VKM A;  2WR9 A;  1Q43 A;  2NYY A;  3ZYP A;  1AYN 1;  2W39 A;  4JDN A;  4ZU4 A;  5BNQ A;  2Y6G A;  1GZT A;  2FCV A;  4LOT A;  4Q0U A;  4XHB A;  4AWD A;  3ZR6 A;  1S1A A;  1DGW X;  1HXS 1;  1WD3 A;  2EA7 A;  3E6D A;  2Z69 A;  3G7D A;  4JRL A;  1W8T A;  4QGM A;  3I97 A;  4QPI C;  4LA3 A;  2DUR A;  1J58 A;  3AC0 A;  5KC6 A;  1XYN A;  1DGR N;  5J96 B;  5F3G A;  1LGB A;  3D8C A;  4Z8B A;  2HWF 2;  3VKO A;  3HBZ A;  3H0O A;  4LHS A;  1DQ5 A;  4CPB D;  2YFU A;  4ASK A;  5A1F A;  2D43 A;  3FLR A;  3BCW A;  4XTP A;  2ZPX A;  2NM1 A;  4FPG A;  1O8P A;  1NE6 A;  2VVF A;  3NQH A;  1ZBE 2;  1QJZ A;  2E26 A;  3KMH A;  4IUG A;  1MQT B;  4NPR A;  4CDX A;  4MXW B;  4XIO A;  5J36 A;  2VO5 A;  1KJL A;  4GKX A;  1SBD A;  5DAP A;  3GZE A;  5DUU A;  2VQA A;  2OXB A;  2O14 A;  1JZ7 A;  2XLF A;  1POV 1;  2R04 1;  1NOV A;  2F4P A;  2E7A A;  3O12 A;  4XQ4 A;  2ZEZ A;  1OD3 A;  4LIU A;  4BDV B;  1TME 2;  3BYW A;  4BCU A;  1HLC A;  3D0J A;  4PLN A;  4YM3 A;  2C26 A;  5FAX A;  1AVB A;  3W20 A;  1X36 A;  2BTV C;  2FMY A;  2I45 A;  2VCA A;  4URA A;  5JSR A;  2HEW F;  1TMF 1;  3VBH A;  4HXC A;  1HQN A;  2JG9 C;  2CDO A;  2X5I C;  2VMH A;  4XEZ A;  5FZL A;  3RZH A;  4QB2 A;  2VZT A;  1CZS A;  2XDV A;  3C7F A;  3E1F 1;  4OI4 A;  3OTF A;  1D4M 2;  2VD7 A;  1IOA A;  1VLN A; 
#chains in the Genus database with same CATH homology
 5FY0 A;  3N9Q A;  3PUA A;  5FP7 A;  3PUQ A;  5FWJ A;  3U4S A;  4TN7 A;  5K4L A;  5FZ4 A;  5FYV A;  3N9P A;  5IVE A;  2OT7 A;  5F3C A;  5FZB A;  5FYU A;  4XDO A;  2Q8E A;  2OS2 A;  4QXB A;  5FYM A;  4IGP A;  5FZC A;  5A3T A;  5CEH A;  5FZD A;  5IVF A;  5F5C A;  4XDP A;  4CUG A;  5FJH A;  4GD4 A;  4QWN A;  5FZG A;  5A3W A;  4D6Q A;  5LY1 A;  3OPT A;  4CCN A;  5FXV A;  4GJY A;  4D6R A;  3AVS A;  5LWB A;  3AVR A;  4AAP A;  5FPU A;  5A7N A;  5IVC A;  3ZLI A;  5FUN A;  5LW9 A;  2OQ6 A;  2GP5 A;  5FZ7 A;  5FYB A;  5F5I A;  3KV6 A;  2P5B A;  2Q8D A;  3PTR B;  5FPA A;  4V2W A;  5A7S A;  3LDB A;  2W2I A;  3NJY A;  4IGQ A;  5FPV A;  3K2O A;  2YBS A;  4AI9 A;  5A7W B;  5A7P A;  5FYY A;  5FUP A;  2OX0 A;  4E4H A;  5A7Q A;  5A3N A;  4CCM A;  4D6S A;  5FZO A;  4CSW A;  3K3O A;  5FYI A;  3KV5 A;  5A7O A;  5FY5 A;  3PU8 A;  4UF0 A;  3RVH A;  5F3I A;  4EYU A;  5FPL A;  4QX8 A;  4LIT A;  5A1L A;  4GJZ A;  5FXW A;  4EZH A;  5F37 A;  3KVB A;  5FZK A;  5FZ6 A;  2Q8C A;  5FP9 A;  4QXH A;  4NUB A;  5FZF A;  5F39 A;  4QX7 A;  5FZ8 A;  5FWE A;  3N9O A;  2GP3 A;  2YBK A;  2XML A;  4C8D A;  4BXF A;  3AL5 A;  4GAZ A;  5FZI A;  5FYH A;  5FZH A;  2WWJ A;  2YPD A;  5FXZ A;  5FY4 A;  3DXT A;  5FY8 A;  5F2S A;  5FZE A;  2YU2 A;  5FY7 A;  5IVV A;  2WWU A;  4V2V A;  3PUR A;  5FZ1 A;  3ZPO A;  2XUE A;  3PUS A;  2OQ7 A;  5F3E A;  4Y4R A;  5F3G A;  3K3N A;  5FYT A;  5FBJ A;  5F2W A;  3N9N A;  4HOO A;  4LXL A;  5IVB A;  5F32 A;  4ASK A;  5A1F A;  5IVY A;  5FY9 A;  5FZ3 A;  4IGO A;  5FYC A;  5FP4 A;  5FP3 A;  5FXX A;  5LY2 A;  5FY1 A;  4HON A;  5FZ9 A;  3UYJ A;  4EZ4 A;  5KR7 A;  5IW0 A;  5FZO B;  5FZM A;  5ISL A;  5IVJ A;  2PXJ A;  4QXC A;  5FPB A;  4UF0 B;  3U78 A;  1VRB A;  2YBP A;  4Y33 A;  2XXZ A;  5A80 A;  5FJK A;  4BU2 A;  4CCK A;  3KV4 A;  5FZA A;  3OPW A;  3PU3 A;  5ANQ A;  5E6H A;  3PDQ A;  3AL6 A;  3LD8 A;  2YU1 A;  4CCO A;  5F5A A;  3KV9 A;  4LIU A;  5FZ0 A;  4CCL A;  5FV3 A;  3N9M A;  5A7W A;  4CCJ A;  4BIS A;  5FYS A;  4URA A;  5A3P A;  4QU1 A;  4LIV A;  5FZL A;  4DIQ A;  2VD7 A;  3N9L A;  4DO0 A;  2XDV A;  3KVA A;  4Y3O A;  5FYZ A;  5FP8 A;  3DXU A;  5IWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...