5A7QA

Crystal structure of human jmjd2a in complex with compound 30
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
351
structure length
351
Chain Sequence
b'SESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title Docking and Linking of Fragments to Discover Jumonji Histone Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 109
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a7qA01
5FYUA 5IVBA 4HONA 2GP5A 5FUNA 3PU3A 4GJYA 2XMLA 3K3OA 5FP7A 5FYMA 4CSWA 5FYSA 2Q8DA 5F3CA 5F3IA 5FXVA 2PXJA 5FZAA 5FZ4A 5FXZA 5FYYA 4D6SA 4IGQA 5A7SA 5FZ0A 5A3WA 3N9NA 5F3GA 4UF0A 5F5IA 5FYHA 5FYVA 4AAPA 4AI9A 5FY5A 2OQ6A 2YU2A 5FBJA 5IVCA 3PUSA 5FYZA 3PUAA 5A7WA 5IVYA 3PDQA 5FJHA 5IWFA 5FY7A 5FZGA 5A1FA 2GP3A 2YBSA 2OQ7A 3N9QA 4UF0B 3DXTA 4LXLA 4ASKA 4CUGA 5A1LA 3AVRA 4QXCA 3RVHA 4DO0A 4BXFA 5A3NA 5A7WB 5IVJA 3N9LA 2YPDA 4XDOA 5F5CA 5FP8A 5LW9A 3KVAA 3N9MA 4CCJA 5FZ7A 5FP9A 3LD8A 3N9OA 5A7QA 5A3PA 5F2WA 5FYCA 4Y3OA 5IVVA 3K2OA 5KR7A 3OPWA 4IGPA 5FZCA 5A7PA 5FY0A 3N9PA 3NJYA 4LIVA 3U4SA 4URAA 3KV5A 3PTRB 3LDBA 5A7NA 4EZ4A 2P5BA 2XXZA 2WWJA 5FYIA 2YU1A 2OT7A 5IW0A 4CCLA 5FY8A 3KVBA 4DIQA 4QWNA 5FZLA 2YBPA 5F32A 5F5AA 4V2WA 2XUEA 5FZKA 5A3TA 5FZ8A 4BISA 5F3EA 5FXXA 4C8DA 4Y33A 5FZ6A 5FWJA 5FXWA 5F37A 4GD4A 4QU1A 4CCOA 5IVEA 4GJZA 5FP3A 3U78A 5FJKA 4HOOA 2Q8EA 4QXHA 5FV3A 5FWEA 5A7OA 5FUPA 5FPLA 4QX8A 5LWBA 4IGOA 3PU8A 2YBKA 2OX0A 3KV6A 5FPUA 1VRBA 3OPTA 5FY1A 4E4HA 5FZEA 5LY1A 5FZHA 4LIUA 5FZIA 4CCMA 2W2IA 3AL6A 5FPVA 4CCNA 4NUBA 5FZBA 2XDVA 3AL5A 4GAZA 2VD7A 5FYBA 4D6RA 5F39A 5FZOB 5CEHA 4EZHA 4Y4RA 3UYJA 5FZDA 5FP4A 5FZ1A 5A80A 4BU2A 3PUQA 3ZPOA 5K4LA 5E6HA 3AVSA 2Q8CA 5FPAA 4CCKA 5F2SA 5FZ3A 2WWUA 4XDPA 5FYTA 2OS2A 5LY2A 5FY4A 4TN7A 4D6QA 4QX7A 3PURA 5FZFA 4EYUA 4LITA 3ZLIA 5FZOA 3KV4A 5ANQA 5FZ9A 5IVFA 3K3NA 4QXBA 4V2VA 5FY9A 3DXUA 5FPBA 5ISLA 5FZMA 3KV9A
chains in the Genus database with same CATH superfamily
3HN3A 1GWKA 5HV0A 4DUWA 3JUUA 1H2LA 2HH9A 1MVQA 4Q4X2 1ZZBA 2DCJA 4ZKTB 5L19A 2XJRA 4ZXKA 4XC9A 2IXIA 1US3A 1FV3A 2Y6HA 3JBG1 4E27A 3M3CA 4EWEA 3VD5A 4AEDB 2MEV3 4AK3A 3BUCA 1W2OA 2KXLA 5FTTC 5GZFA 4FP3A 4I09A 2VE1A 4AXOA 5A7SA 3TNPB 2B46X 5C3PA 1H6XA 3THPA 4A7ZA 4A2UA 2AACA 4XFCA 2RR12 2W95A 1LB2A 3FJSA 3HNBM 3I2FA 3ZDSA 5CADA 4EV0A 4MGTA 1FPN2 2FCVA 1PMHX 2HWD3 4XQDA 4YW4A 2WFF2 1YHFA 5H9QA 1UY0A 2GP3A 1GP6A 1RUJ2 2YBSA 1BXHA 1LHVA 3JD73 4ASKA 1KJRA 4QMAA 4EWAA 3HPNA 4GB32 4BXFA 3UJQA 5EXOA 2JB4A 1QJU2 3ZMOA 4XMAA 1UO9A 5C3OA 1E5HA 2J1RA 4TXWA 5LA0A 2EIDA 1GZCA 5FP9A 2VMFA 1YNAA 3B9CA 1WLTA 2C1FA 1VBD2 2VMHA 2EF6A 1RUF1 3ILNA 1EP0A 5KC6A 1MS5A 3C7EA 1O6UA 2O8OA 5FLIA 1CPMA 1W8FA 4LO5B 1IS4A 2VM9A 3H3ZA 3A23A 3OSDA 4XJWA 1DGWX 2DFCA 4CP2A 3LDBA 3M3IA 4GKYA 2VVFA 4RS5A 2AREA 3POEA 4FTBA 1K5MA 2GC0A 3JBG2 3MIGA 2ET7A 4CYDA 5BUVA 4EJRA 5GLWA 1X50A 3BVCA 2DVGA 2FHRA 4HANA 5F3EA 2YC4A 3VDCA 3NWKA 1TZOA 1UF2C 3NV3A 3Q8FA 1OD5A 4Q29A 2PHTA 2FBEA 1CAVA 1VAVA 4GMP0 1AR63 2E33A 2ZZQA 5A1AA 4XHBA 4P02B 2CY6A 1AF9A 4QX8A 1OOPC 1O5LA 2ILMA 4YGEA 5CA6A 3C7OA 4CU8A 1NE6A 3M1HA 1RUG1 1UQXA 4UFLA 2QQOA 1DQ1A 1R1A1 2RS33 3AKRA 4WZFA 4NIGA 2EXJA 2BVBA 1GR3A 2JDYA 2W94A 3GBWA 2XJTA 4OZOA 5A32B 2V5YA 1ZBA1 5IAVA 3WUCA 5CAZA 3OEAA 2R49A 5EYXA 2WO7A 5T5JA 3VBFC 4QQ2A 2P34A 4D6RA 3JQXA 2Y6JA 3MIHA 1RUE1 2FDJA 5CYYA 1YWKA 4YLZA 1PMIA 1RVF3 1K42A 1GZ9A 1QNWA 2D5FA 1CAWA 3AKPA 5FLHA 2RS52 5A80A 3VB9A 3WCRA 4IV1A 1EPZA 4YG0A 2GDFA 4ZHNA 1OOPB 4XE9A 4BIOA 3AVSA 4YM3A 2VMDA 1NUKA 3MLLA 2RDNA 5IATA 1PX3A 3U0ZA 1ZREA 1SZBA 3SCFA 3UK9A 1LECA 2JG8B 3A0NA 3PTYA 4YG3A 1F2NA 3CJIC 1UX6A 4UT5A 1MS3A 3DYMA 4PIZA 3VBFB 2WWSA 1LEDA 4QQPA 3ETPA 2P3IA 1POV1 2VW2A 3IAQA 2FMDA 5FZ9A 1JBCA 1X36A 2HBUA 4JCKA 5IK8A 4E2GA 3WG1A 1RUNA 4XTMA 1RUOA 4JV4A 4O7XA 3HAGA 1OFNA 1QU0A 4XF3A 2HWF2 3C3VA 2H0VA 3E6CC 4Y20B 4FPJA 2P2KA 5I0UA 1NY71 3M70A 1GBGA 1TME1 2XBO3 3GXUA 5FLJA 5FREA 3VBSA 5C3SA 3EO6A 1R1A2 3VN4A 5FXVA 5T3NA 3CJIB 3DECA 1HB1A 3S7IA 4FOVA 1VMJA 4FVVA 4QX5A 3UGGA 5JIUA 2QNKA 2WA3A 4IL7A 5T5LA 3QBQA 2RM22 4AQSA 4Z2AA 2QVSB 5A6XA 1GQPA 1RUE2 3OGSA 4LO8A 4CTEA 4CUAA 3FHQA 1YI7A 4OI2A 4XJ9A 4XZPA 1VR3A 1XE7A 2OUJA 3FFQA 3CBNA 2YZ4A 3AFKA 3CU7A 1J1TA 3H42B 3RSJA 2BTVC 5JZGC 3DPRC 1JZ3A 1BVP1 3I2KA 3W5MA 2XVLA 5A3NA 2Q0AA 3T0BA 2WS91 2QQNA 4HPKB 3RWNA 4OUEA 2E53A 1QF3A 1CQ9A 2K0GA 2E6VA 4JKMA 5DAPA 5A3PA 4UFJA 1WW6A 3VKNA 3WQBA 4I3GA 1I3HA 1EV11 4GZ9A 4S2FA 5CFDA 3WX5A 4BOWA 2WO1A 2JG9A 4AEDA 1CESA 1SLAA 2XXZA 1UY1A 3ENRA 2Y6KA 5JZGB 3DPRB 1JYNA 1NY72 1PNGA 2V73A 3WP5A 1TME2 1YC61 2VZVA 1B35C 4C90A 4MGZE 1E5IA 2O1QA 1W6MB 1VBC3 1U5ZA 3AKSA 4XUOA 5FZ6A 5FK8A 1HV0A 2EIGA 2D6PA 4G9SB 1N3QA 2QQKA 5JMOA 1AHSA 1J83A 2D44A 3J8F1 3T3YA 5DZFA 4RR3C 2Q8EA 4IQPA 2WLPA 2JDAA 3HOBA 1ZA7A 1IQDC 4QDSA 4CCEA 4BK5A 1GUIA 1RMU3 1UXXX 5FPUA 3AMPA 1Q8VA 1IGOA 1UOGA 3HR9A 1B35B 3R4SA 4MXVA 5E1RA 4HBNA 3AP4A 5FZIA 3WF2A 4MHRA 4QQLA 2WS92 5JOWA 2XDVA 3X29B 3IKWA 2ES3A 4JGZA 2ZMLA 2D3SA 5FZOB 1S0IA 1H9PA 1AR81 2R6QA 5T54A 2TUNA 4Y4RA 4YGBA 3FX3A 4RR3B 3WW3A 1YFXA 1W9FA 3PUQA 3WDTA 1EV12 1W6QA 1YLLA 4YYOA 3ZPOA 1D7PM 3N36A 1AR72 5J36A 3H8RA 5EPAA 2CDPA 3W5NA 3LPFA 4XDPA 5GLUA 3VGIA 4Y5SA 1MVEA 4MX3A 2R071 3AZWA 5LY2A 4B7KA 1SCSA 1QQP1 5GKAC 4M0NA 3W9AA 1RUI3 1S55A 3FMGA 4Y5Z0 1CJPA 1K3IA 3SH3A 1ZZ6A 4HT1T 1VB2A 3VKMA 2WRAA 3MV01 3UV9A 4EQVA 1YIPA 5FPBA 2PAKA 5FZMA 4LA2A 2HWB1 1MZ5A 5FYUA 3D5OA 2WSUA 3LA2A 2ZGPA 3B01A 1JOJA 3IZOA 4Q0QA 4YZ3A 5J98B 3ZSMA 2PLV3 4NROA 1KGYA 1W2NA 3FWEA 4JC1A 1OPOA 2W5FA 1HQLA 1W8NA 5JPNB 2QE3A 5JI9A 1PGL1 5HBAA 4QPWA 4OI1A 1MS4A 2Q30A 2GMPA 3UL2A 4FFIA 3K46A 4JX0A 2E63A 1S2EA 3AP7A 1W9TA 5F3GA 2ZGRA 2GNDA 3SLIA 4MH0E 5FYVA 2WL1A 3KD4A 1VAKA 2VOTA 4LULA 4Q0UA 5FBZA 4BJ0A 1AR82 1H1IA 5CKQA 5A6YA 3T1LA 2VQ0A 2FCUA 4LT5A 3M3EA 2BZDA 5FRAA 3BOPA 1UW8A 2B4KA 2LW8A 1W0OA 3HEIA 4Q26A 2XOMA 3ZSKA 1I5PA 2ZKLA 4CUBA 5C4WC 3USUA 1WW5A 2D40A 3GBGA 4UF0B 3HNYM 3N9QA 3KS7A 1W9SA 3IM0A 2R072 4BMEA 4BYYA 1RIRA 2V72A 1F5JA 4Q4Y1 4XURA 4D7TA 2XHKA 5C8WA 1JYCA 4XFBA 3CJXA 2B42B 2HEVF 4NIDA 1DQ6A 1VBE3 2ZGNA 1BEV1 1GYKA 1P8JA 1RHI3 2K46A 4NHMA 2WQZC 1GFF2 4OFGA 3ZIWA 5F2WA 3O1OA 2RDRA 4DEQA 3ZFGA 3OPWA 4ASMB 4JZRA 1HRV3 5FZCA 4Z2WA 1A3KA 2HWB2 2BJSA 1QWRA 1W8UA 1OURA 2WFPA 4FI9A 2MNGA 3PTRB 4LKEA 5C4WB 3L2HA 4LHSA 4BQXA 2R1DA 3SNMA 4XUTA 3HJRA 1D4M2 3Q8EA 3Q8AA 2RS11 3ZFEC 3EYPA 4FFGA 1PGL2 4FPEA 3IBMA 4PDWC 4QB6A 3ZYFA 3RS6A 4BH9A 1WCDJ 4CDUC 5FCCA 3U07A 3ZM8A 1R082 3E5QA 3UKVA 4K8FA 4I2OA 2A6ZA 1HRI1 1DCSA 1PIV3 1F4AA 1L3JA 1QDCA 3PVNA 5FJKA 4QXHA 4D69A 5C71A 5J1XA 1DYKA 5KXEA 2VJXA 1J58A 3H7YA 2JD9A 1YXWA 2WQ4A 3SEPA 5FY1A 3AZXA 1A78A 2D6MA 3ZFEB 4MVTA 3OY8B 1MS1A 4FPLA 4Q4Y2 4PDWB 1XE0A 4LBQB 3V0BB 4AZZA 1S0CA 3OF1A 3I4IA 4WBBA 2BNOA 4YZ1A 3TEZA 4M4PA 5F39A 1AYN3 3LZZA 4AGGA 1BEV2 2ZHMA 1DQ4A 3C7FA 4NR1A 2CSGA 5FPXA 1W9WA 2JG8A 1G86A 2VZPA 1UWWA 3FLTA 4AI0A 2X53S 5IJRA 4Q8KA 4N43C 3VD3A 4U36A 3VBFA 4GKXA 5JI7A 5FQ0B 2A70A 2OS2A 3RMXA 1RUD3 3MO4A 1GQHA 5DAVA 2A5ZA 3EMRA 2RS12 2EA7A 5H9SA 2QQVA 3TWIA 3ES4A 2A6YA 4LO6B 3ZSLA 3WP3A 4N9IA 1YUDA 2D93A 2VXRA 1ND2C 3ZYHA 2WZR3 3GCXA 4Y24A 1OF4A 1UZ0A 4FPYA 4OUMA 1HRI2 1ENSA 1H1MA 3CJIA 4M00A 1AZDA 2E32A 5I0RA 2H6BA 4AEKA 1JYTA 4C1WA 3RZMA 4HXCA 4N43B 3RI8A 5FOJB 1RL3A 2F4PA 2WNUC 3K3OA 1FPN3 4AG4A 2WYFA 1NAEA 2PAEA 2W0XA 4UWDA 4ES8A 1WKYA 2FDFA 4LBJA 3ME2A 1Z0HA 3ZSEA 1GANA 2ZX0A 2XJPA 1PZ8A 3WW1A 4AQ2A 5ANNA 1HB4A 1N47A 2ZACA 4KMQA 5C8CC 1VJ2A 3NVCA 2BPA2 1COV1 1ND2B 3M4FA 3OPZA 1REDA 4E2SA 4XJUA 3H1MA 2Y64A 1OPMA 4QPGC 4AHZA 3DKQA 3J7HA 1AYM1 2E51A 5IVYA 2ET1A 4CUCA 3VZNA 5FY7A 3NSTA 2WNUB 4CDQC 3O1VA 4BQ2A 4UW4A 3SEEA 1AX0A 1PO13 4AEMA 1W2UA 5E16A 2CGPA 2ZAHA 3AVRA 3OTFA 2ARCA 1WWYA 2QQJA 2OIIA 4F3JA 3WP4A 5F5CA 1GP5A 1O4ZA 1NT0A 5C8CB 1C8M2 2ZAAA 2YB7A 1ZRIA 1W8WA 4BQ4A 4ZZ8A 1UU4A 2WLQA 2YGMA 3DPRA 2PFWA 4XW3A 4DY5A 1HKDA 1STMA 3KZ4C 4QPGB 2RJ2A 2ZXQA 1JOBA 1XNDA 2CGNA 3LE0A 3QLQA 5FUIA 1RTVA 4CDQB 5JAXA 4IEQA 2W1SA 2YYOA 1BLZA 3J7MA 1OA4A 5FZLA 3SH5A 1LU1A 1LULA 2W39A 2UYAA 4IDZA 3EBRA 2Y34A 2XUEA 2JDHA 4R9CA 5I8TA 1KDMA 2EXKA 3LEMA 2D43A 3MIEA 1COV2 4OUSA 2PTMA 1DQ5A 5HXMA 4NIIA 4N53A 5IVEA 1B35A 4YG6A 1NXD1 4HOOA 3NV2A 3BOWA 5FWEA 5CG8A 1JYWA 1C1FA 1RUF3 1AYM2 3AP9A 4FP2A 3POJA 1NA1C 2D6NA 5DDJ3 4N9HA 3WF1A 4RQPC 2PELA 1QJY1 2FDIA 3WQ7A 4LHKA 3U14A 2BVVA 1AX1A 1JXNA 1W0NA 4JAAA 4PLOA 1YJLA 4XF0A 5FZHA 3U75A 4OQ8A 4CCMA 1OI6A 2H6CA 4LNVA 2ZOEB 3KT1A 5FPVA 4D94A 4DPNA 2PHXA 3PIGA 4QB2A 3N7KA 1TVGA 2PA7A 3ZN4A 3FFZA 4P5HA 3WINE 3ZFFB 2FDKA 2VOVA 4Y1ZA 2A3XA 2VUAA 4M01A 4NIAA 2DUOA 1NA1B 3B3QE 3CDZB 1TQ5A 4RQPB 4HVOA 2UWCA 4YGCA 4IEUA 3H8XA 3SKVA 3E5XA 2VNRA 5KHHA 2J22A 4AR2A 1DF0A 1RUG3 3WXPA 2P17A 4S2HA 1QIQA 4I30A 3UGFA 3VBOB 3NKTA 2VBPA 3O1MA 5ANQA 1ZBA3 3HT1A 3KCXA 4RA0A 4J1XA 1JUIA 1K45A 5ISLA 1D2SA 5DAWA 3ZVXA 4NOTA 3ELNA 2VZ3A 2G4IA 3I7DA 4HONA 4LBKA 2PHRA 3LAGA 1MACA 1W6OA 1W8HA 2GALA 1LGBA 4KWJA 4RD7A 3ZXLA 1Y3TA 4BZ4A 5LK7B 1WA6X 1YO8A 4RFT0 4XDQA 4LBOA 2XH6A 1SLIA 1OLRA 2BERA 3MF9A 2BWAA 4L9BA 1RXFA 3THTA 1WCQA 4INDA 4AHYA 3R05A 2E7QA 4BQ3A 4UF0A 3D8CA 4XBQA 1A8MA 1S0JA 3WDXA 4Y5TA 4HZFA 1POV3 3PLQA 1X8EA 1Y7BA 2P37A 4LE4A 5HPOA 3NO8A 5C3QA 4CXYA 1YFUA 1AR91 4BB3A 1Q8QA 2B8MA 5A1FA 3ACFA 1JYVA 2Y6LA 3ZKUA 4QD2A 2D97A 4QDQA 3ZMNA 4CUGA 3QH6A 2Z2SB 2DU1A 1FATA 4EE2A 3N9LA 4JHTA 2D7FA 5JXJA 3N9MA 1WMDA 5C4WA 4A42A 4AI1A 1ASJ1 1J3QA 1PGSA 2ENRA 2JDKA 1O8SA 2KM2A 2EIBA 1VMFA 2GNBA 2XQRA 2ZGQA 3GNEA 3N9OA 4YZ4A 2XR4A 2OPWA 5DN2A 5FMOS 4XF9A 2QFEA 4QQOA 5K0UA 1LOBA 1TNRA 3UT0A 1OQDA 4IGPA 5IVVA 2BBVA 5FY0A 4I01A 2WZEA 1WUVA 3CKHA 3TEXA 3S5AA 1PM4A 1DP0A 2IVJA 4QM8A 3I3MA 3W21A 4HKWA 1H2KA 3CF6E 3DYPA 5FYIA 4JRAA 4OLLA 4AEJA 4CDXC 3KVBA 4QKNA 3RI9A 1JZ2A 3O1TA 3I2JA 2QBXA 1D2QA 3NQHA 5A3UA 1ZZ8A 5D2AA 3ECQA 4XHXA 2FZ2A 2O0OA 1V6NA 4HVRA 2WS93 5FWJA 4BQYA 3MBWA 4LA3A 3P1IA 2ZX2A 4IETA 4WM7B 2RMU3 1O5UA 1YEWA 1FXZA 4O9EA 5DUXA 3WR0A 4QKDA 2CNAA 5A7OA 1WBLA 5L9RA 5BNOA 4GH4B 3TN91 3I8TA 1EV13 4RL7A 2YBKA 4LLFA 4N7UA 2PHWA 2Z42A 3FN9A 4CDXB 2A6VA 2VGDA 2H0BA 4WVVA 3KHCA 1POQA 4P9LA 3LIHA 4JGYA 5AC91 2W2IA 1Q56A 4Q1RA 3SCGA 2XL9A 1GOGA 3W58A 1ASJ2 2VCBA 3MIBA 4XJ8A 3USSA 3BYWA 2ZS6B 4NRPA 3HQUA 1T6GC 3H3UA 3O0WA 1Y4WA 4Z82A 4IEVA 3ZYRA 2VTXJ 3THCA 3J8F3 1I5ZA 1O4TA 4YRDA 5A33B 2V4AA 4W6XA 4R9DA 4CRQA 1HW5A 4XAAA 3WF4A 3GHMA 4UW3A 4XF1A 3FLRA 4W8JA 5FZFA 3DUIA 4XF4A 5DUUA 4B4QA 1NLQA 1PVC2 2WAAA 5LCWL 4LHNA 2D98A 4A45A 4LEJA 3ZDVA 5JUVA 3ACLA 3DKWA 4NAOA 5HV4A 3KV4A 4MO3M 3ZPYA 1RGSA 3VD9A 4FSJA 1OUXA 3RRDA 3KF3A 4CPBA 4EN8B 2RDQA 1JOPA 2WA4A 5FMBA 5I93A 2J7MA 3MZHA 1CN1A 4JVAA 3NKGA 5D8AC 5EZWA 1LOCA 1LGCA 2XLAA 4NWWA 1RJ8A 2DDUA 1YIFA 4YVSC 1RUC3 2UU8A 2B5HA 4DXSA 5KXCA 3MF6A 2ZGTA 3WDWA 4YW7A 5FOBB 4UFMA 1KQRA 1YQCA 4JQTA 1L7LA 5AC92 4FQZA 4D6SA 4IGQA 5FZ0A 1QQP3 3OGRA 1WMEA 4GB31 5LATA 1MQTA 2P6CA 3MW2A 2J42A 4M3CE 1Q8PA 1QJU1 1RUH3 1GOFA 4Q4W2 4YFZA 4M3CB 4Z92B 1X8MA 2I07B 2WBKA 1SFPA 4NHKA 3RDIA 5D8AB 4NN0A 5HCHA 3AZYA 3AYCA 3PJQA 1VBD1 4MXWA 2SLIA 1DHKB 5JXIA 5SV8A 2HWB3 4MHUA 4Z07A 1S2KA 2JDZA 1NX9A 3VZOA 2DCYA 1LRHA 1UCXA 3VBRC 1SCRA 1Z78A 3T4HB 2K9ZA 2Y0OA 2Y0IA 4OMDA 4QPGA 5FP8A 4NO4A 5FZ7A 3RZHA 2V4VA 4LO4B 1ZBE2 3HN1A 2QZ2A 5A7QA 4CEWC 2RJLA 3T4VA 3VV1A 3UKNA 4LHLA 2P6HA 4PT6A 2QJVA 1WLCA 4ITCA 5CFCA 5KR7A 2BOJA 3B00A 3N9PA 4URAA 1PNFA 4G3YC 4KGQA 1NLSA 2WSVA 4O61A 2XVGA 4X6QB 2YU1A 4XVHA 1CX1A 3JB4C 1R091 3VBRB 4V1PA 2R041 4L92A 2XJQA 2UWAA 2VMEA 2WABA 3NNLA 4GIQA 4E9KA 2HWE2 4L99A 1UZWA 5A3TA 4P00B 4BISA 4QPIA 2YDEA 2BU9A 1C1LA 1QNYA 4W6YA 4ZONA 3RZKA 2J1VA 4CCOA 3RFRA 3V64A 1H30A 1SACA 5KHJA 4DXRA 2YXSA 1EY2A 3SMHA 1JU4A 1BEV3 3IWZA 3BTXA 5FPLA 2ZHLA 1IPJA 1IOAA 3AJYA 2P4EA 5JOXA 1WCSA 3VZMA 4P9GA 3WOGA 3WUDA 3ZXKA 3OJBA 2RS51 1H8TC 2IVIB 5ABJA 3OYWB 2JDNA 4QX3A 1BK0A 1UYXA 1X7NA 1DG6A 3ZFFA 2AEZA 3UGHA 1WD3A 2I74A 4RQPA 1PHMA 3LPGA 5JOZA 1AJOA 3AYAA 3U4XA 1AL22 1XRUA 2JKBA 2Y6GA 4BLIA 2ATFA 3MLKA 1Q43A 4KNCA 3I2HA 3NJVA 1GOHA 3VBOA 2DURA 2QQPA 2XPJA 1H8TB 2GN7A 1CPNA 1JODA 2BV4A 4EN6B 2HWF1 1GNHA 1OLME 1BQPA 1R092 3PURA 3HBZA 2R042 1RB8G 4DY3A 5BNQA 1D0GA 3I49A 2CDOA 3ZLIA 1UY4A 2LM3A 3NAPC 4A41A 1J3PA 4GXLA 1S0EA 2WNEA 5DAQA 3RZZA 1O7FA 4XUPA 2FD8A 1VBA1 4JKLA 4FTSA 4Q1PA 2RM21 1FOD1 4WV8A 3VBUC 3FLPA 4OI4A 4XACA 4COZA 2IFRA 4UXAA 2B45X 1YCIA 2D6LX 3DEMA 4QKBA 1W6NA 1A6CA 2A71A 4B3NA 5GZEA 3IAPA 1J3RA 5H9PA 5EJZB 4DOUA 5DUWA 4R4XA 2ZZJA 1XU1A 2Z69A 1O8PA 3IPVA 3NAPB 4CU6A 5ACA1 2W87A 4UBGA 4TZDA 2WT1A 3V65A 4X6RB 1DFQA 4ES9A 3GBFA 5IK7A 2X5IC 1AXYA 1HDKA 3SC7X 5IVCA 3VBUB 2X29A 4JHZA 5IWFA 3I2IA 3IDCB 2XONA 5J96B 5L9BA 4MGQA 3AP5A 1NLRA 3W59A 5A3LA 1ZZ9A 2BW8A 2UY8A 3J7NA 4K6BA 3L2YA 4BE3A 1O3SA 1VBB3 1ND3C 1V9U3 3OB8A 4H14A 5LBCA 4QHOA 4UI9L 1RINA 2YFUA 2ZTNA 4Y26A 2ARXA 2X5IB 2J1EA 1HX6A 1HXS1 1QEXA 2J1TA 1ONAA 3PUIA 4OHVA 1VBA2 4JQRA 2PMWB 1COV3 2QQIA 3K48A 4RSUA 3NJYA 1FOD2 3CMGA 4IEXA 2DV9A 3P5BA 4EZ4A 1FAYA 4XILA 4I0AA 1CVNA 2P5BA 1GV9A 2JDPA 1AYM3 2OT7A 3LEIA 3JB8A 3NW4A 2HJIA 5FY8A 2WNVA 1TEIA 3RMYA 4WM7A 3WLUA 4DIQA 1SMVA 2CHHA 1ND3B 2A3WA 2B9UA 1GQGA 3AKQA 5ACA2 4META 4GH4A 3RYPA 2I45A 2IXJA 1NCRC 1C8NA 4GD4A 3B7MA 3LQCA 4ISQA 4QU1A 3K75B 5FMOL 4KI5M 4OHZA 1LOFA 1W0PA 3S5QA 1CIWA 1CZSA 2OW4A 4YM2A 1NKGA 4IGOA 1ULPA 3UNPA 2OX0A 1YJKA 2ZGMA 2ZEYA 2CU5A 1AR71 3MHZA 2VNGA 4GA9A 3DN7A 4TLGA 1SHWB 2WN2A 4ZS2A 1ZZ7A 2IZWA 1UMIA 2IXKA 3TBDA 3AL5A 4AFCA 2LUWA 2VD7A 3ZYIB 4UBHA 1NCRB 1O91A 3VUOA 3CO2A 3OG2A 2LALA 1IPSA 2GH8A 4YGDA 1HXS2 4XYXA 2AENA 3HBKA 2D5HA 1JMUB 5GZCA 1MPXA 2RG4A 4CCCA 4Q5OA 4D7YA 3FBMA 1DZTA 2OVUA 2GN3A 4QX7A 2C0ZA 2NN8A 2XVKA 2UWBA 4G4FA 4PIYA 1X33A 1QJY3 4W4ZA 2DCTA 4J1WA 1WW7A 5CB7A 4PBOA 4COWA 4N8MA 4KU8A 4S2GA 2P3KA 2E31A 3ABZA 1OSGA 2XKOA 5FO8B 4ARYA 1GU3A 2CV6A 4MG2A 3ILRA 4OI0A 1XU2A 1Q8SA 4CP9B 3WF3A 4XFIA 5EV7A 5LB6A 2CTVA 5LBBA 3NV1A 2XLGA 3VDDA 1F15A 1KS4A 2BGOA 3P6BA 3POBA 5FKBA 3M3QA 4FCAA 3R4DB 5LK5A 1OHFA 1UL9A 3ZX7A 5D8AA 3MEPA 3PVBB 1W6PB 1K5JA 2A75A 3DV8A 1O3RA 1SG3A 1T6BX 2BFUS 2BP6A 2YU2A 5FBJA 3ACIA 1UZYA 4LLOA 5JIAA 3PDQA 2G9FA 1WMFA 2ARAA 2XJUA 4NE9A 2FCTA 5LA1A 4YFWA 1N1SA 1HQNA 2ZPXA 4PF1A 3PL0A 5FFOC 3LOBA 1D4M1 4HL0A 4X8NA 4D0QA 1XXNA 3LWCA 4A6OA 1F9KA 3B94A 3Q9OA 2WNOA 1SLBA 3KB5A 5FYCA 1FX5A 4FT8A 2W68A 5CIRA 3RPQA 1R081 2IC1A 5F6KA 2R30A 2VMGA 1ZYBA 1XNKA 2VAUA 2W3JA 3KV5A 4I02A 2OKXA 4NRQA 3PVEA 2YC0A 4M0HA 3T2TA 4DXZA 4BDVB 4MSVA 3K51A 4OHXA 3FHAA 4KU7A 1AR93 3HT2A 1TMF2 2WJSA 2K2SA 4L11A 1DYPA 1OVSA 5F32A 2G9ZA 4QHZA 1QJZA 3GZTB 2RHPA 2VL4A 4EN0A 3I54A 4FQ4A 1ULCA 5FXWA 3KM5A 3LSEA 1G9CA 3O1RA 3BIWE 1KITA 3OYWA 1PO23 1DLLA 1GMMA 3C8XA 1OLQA 1OKQA 4YZ2A 1FNYA 2VMCA 3SQOA 3TAYA 4GULA 1VRBA 4RGGA 2ZEWA 3P3PA 2G1MA 1SLCA 1JTZX 2VZTA 4A7KA 2AZ5A 5LY1A 2JE9A 1TG7A 3HVDA 1F31A 5CBLA 3ALQA 1PGW2 4XIOA 5I8SA 1W99A 4LR4A 1IQAA 1RXGA 2RV9A 3JD71 4BHPA 2R061 4C1XA 4AVTA 3CZUA 1UY2A 1U5XA 2YFZA 4BIFA 1SDWA 4DXTA 1OA2A 1KFXL 1JI6A 5KHIA 2DCZA 3GJAA 1QGLA 2JENA 4LE3A 1VMHA 3I3DA 4FPGA 3BKZA 3ACHA 4WZCA 2P3JA 2DBNA 2YY1A 5A32A 2AEYA 2EXIA 3G7DA 4KBBA 4NHYA 3TN93 4DINB 1CR7A 4ZY9A 1WLWA 1ZRRA 3E97A 2QKDA 4YM0A 2VOXA 2AH2A 5AC93 1YRZA 2WO2A 4LBMA 4V2VA 3EQEA 5FMCA 4CDUB 5BNPC 4RFRB 3IMMA 1OOPA 2MEV2 4PI2A 1CZVA 2E7AA 3FL7A 4LO7A 1LAJA 3NAPA 3PU3A 3MPBA 1C28A 5FP7A 1H4HA 2VZQA 4IEZA 4XCAA 5F3CA 1NOVA 4N7IA 5FZAA 4IXLA 1SFNA 2AUYA 4HSLA 3KT7A 4NVPA 1W9YA 3VBUA 1H4GA 1NZIA 2HWD2 4Q4X3 4GWMA 1JZ7A 2EAAA 3VKLA 4ZXEA 1GSLA 1LU2A 5F5IA 3JD72 2R062 3ZXFA 5BNPB 3BTAA 3F2ZA 2W9XA 2KR2A 1C8M1 4OVEA 2DYCA 4Y20A 4SLIA 3U37A 1ZRCA 2B9VA 4Q0VA 4ZU4A 4A6SA 1RC6A 4XAEA 1OD3A 2RR13 5GJ6A 4CEYC 2XQXA 3MW4A 4BQ1A 5JMCA 2ORZA 3AC0A 2ZGKA 2WFF3 4L2NA 2PAMA 4AF9A 1RUJ3 4EWDA 4B1LA 4ZU7A 4GB33 2VUJA 2YGLA 3FZ3A 1QJU3 1FMD1 1VBD3 2VZ1A 5T50A 4HPKA 3KGZA 3WEZA 2YUEA 4YZ5A 1IG0A 1JZ5A 4WM8C 1POV0 1SFYA 1YYNA 5A70A 3GJBA 5FZKA 1GWMA 1W90A 3CNAA 1QMJA 1UYPA 2QQMA 1F4HA 2RS32 5FO9B 3E5UA 2GNTA 1DQ0A 3QH7A 2R16A 3VDBA 1ST8A 3JBG3 3AXEA 2R32A 2WINB 5JZGA 4AHXA 2ZBJA 1TNFA 2ZABA 3K4AA 4B4RA 3CL1A 5IFTA 5E8AA 1S0DA 1RVF2 4Y1VA 1W6MA 2DFBA 4WM8B 1ALYA 3AL6A 1R093 3AM2A 2JECA 1ZNPA 2R043 5JDBA 3ZYGA 4E4SA 1CWPA 5IT6A 1MZEA 2HYXA 3J7LA 3OD4A 1N3OA 5DABA 5ERLA 5F6LB 3VDAA 1V6OA 2V5DA 4FAGA 4QKFA 3CZJA 4HETA 2IFWA 5IUQA 1PZ7A 5K4LA 1LTEA 3V56A 2WWUA 1UMZA 1FMD2 4UW5A 3WD5A 3I3BA 3ORJA 1OKOA 2EALA 3GZAA 4YW5A 4AAXA 2RS53 2F4LA 4U2AA 3VLBB 3H0OA 1IKPA 1C5HA 1SDDB 3WHTA 5FZOA 4CP0A 5C3RA 1H0BA 2JXAA 4RR3A 2P1BA 3A4UA 5LBEA 4CXXA 5KWRA 1V6IA 3DXUA 1F8VA 2W1UA 2Q1FA 1BJQA 2ZGLA 4HLTA 4IW3A 3DCQA 2FZ1A 3FUOA 3POIA 1NCQC 2A1XA 4GMP1 2GSYA 4RHV1 1KDKA 5DXDA 1O3QA 2OXBA 4CPBD 5FYMA 4CSWA 4CVUA 1W6PA 1JN2P 5FMDA 3LIGA 1UKGA 5B4XA 4EN9B 1FI2A 2L9LA 3IDAA 5FZ4A 5FXZA 1V6MA 3KCYA 5JSPA 3BTYA 1K5MC 2HWF3 1XNCA 3KQ4B 3BGAA 4OHYA 4FPOB 3WP6A 5AFBA 4M3CF 3TB0A 4B29A 1CAUB 2J1UA 3CEWA 3VL8A 1R1A3 1VPHA 2WZ8A 2YPJA 5FY5A 4AAPA 1G9BA 5JXGA 4QM9A 4D7SA 3PUAA 2ERFA 1NCQB 3H8OA 2ZGOA 4K40A 3H3LA 1PMJX 2RM23 2BUKA 1QJEA 3DXTA 4KWUA 1RUE3 3J9SA 3ZIXA 5BNNC 3A22A 1QDOA 1V70A 2ZHNA 5A7WB 5TSWA 3WCSA 1UOFA 1K5MB 2W08A 4XDOA 5DUVA 2FDGA 2DF7A 4M4RA 4FOQA 1XE8A 1IKQA 1ENQA 4PIXA 1CONA 3LA3A 3UETA 2QZ3A 3NV4A 1H9WA 2BFUL 4CA9A 3O1PA 1UPIA 1OT5A 2FDHA 2VW1A 3I3QA 1D4VB 1AXKA 4LIVA 2WAOA 4BQWA 3LDKA 1ULFA 5HXVA 5A7NA 4NJ4A 1SQ4A 1VBC2 4RHV2 3ZXDA 4IV1C 4GQ7A 1NZCA 2W92A 4H7MA 2BNNA 1CIYA 1H2MA 4CCLA 1GWLA 4ET7A 5BNNB 2AGSA 3MIFA 1ULDA 3OUJA 3WW2A 3AP6A 1ZRFA 4KG8A 2XJVA 3BN6A 3WDYA 2X09A 2PLV1 4QX1A 1RMU2 3WSOA 1LOGA 1TME3 2Y33A 1KXGA 3L9JT 5FV3A 2DCKA 4COYA 4NHLA 1CAWB 2YROA 1W2TA 4ARXA 4XXAA 2WUHA 2UY9A 3KV6A 1GZWB 5T55A 1UZZA 5A6QA 4PI0A 4LQRA 3VBSC 2DVBA 4LIUA 3GZEA 1SBEA 2VBDA 3HMYA 3LEKA 4XABA 4XFGA 1PM7A 2Q1MA 3URFA 4WVZA 5FYBA 2VNVA 5EJ3A 1PVC1 2QQLA 4P9IA 5DPNA 3ZXEA 1GICA 1XYNA 3UYJA 1CJDA 1X82A 2XUMA 4COUA 5FZ1A 4H7LA 1DZRA 4LBLA 3ACGA 4FOYA 3D3AA 4BM8A 1RUI2 4CP1A 3MI8A 1WD4A 4CCKA 3ILFA 1T2XA 2W1WA 4IEYA 1JHJA 1RHI1 4MADA 5E89A 4YW1A 5FZ3A 3ZFEA 4DUXA 3OY8A 5A6ZA 1KS5A 2GZWA 4PDWA 4QX2A 3VZKA 2BRTA 4CDUA 1HV1A 4LBQA 5DG1A 3V0BA 3N35A 3K4DA 2ETEA 3ZR6A 1AR73 4IE7A 3KMHA 4PHZA 1RITA 2PLV2 1DBNA 4E4ZA 1S0FA 4QXBA 2JDUA 2Y26A 5FZGA 2DVAA 2IWGB 2LTNA 3FBYA 5IHRA 2VMIA 3MV11 4FTEA 1XYOA 2FMYA 4Q4W1 3JZVA 4XIKA 5FQ0A 4PF5A 3N3HA 5LRSA 3SXWA 5FYSA 1Y9MA 2JG9C 2VW0A 4AEDC 5F7UA 1PIV1 5BNPA 5FYYA 2Z79A 5JOYA 2PQQA 3POWA 3MYXA 2ZGSA 2QTWB 2C9KA 4F7ZA 1OH4A 1VB4A 2BBAA 4AVCA 3CQOA 5F5QA 3FE5A 1QH6A 1XB9A 2VZUA 2GNMA 1XBFA 1ZBE1 4N43A 4OHWA 2QQWA 5C5UA 5EIYB 1W2AX 2QUOA 4AQTA 4BCUA 3B02A 2BOIA 3N7MA 5FPZA 1YQ6A 3H7JA 1AX2A 4Q27A 1VBE2 4DQAA 2IXLA 4ISRA 2JG9B 3HD8B 1RHI2 1X9PA 2C4XA 1YI9A 3BCWA 1OVPA 4QGNA 3PVOA 4BWOA 1AR83 1V6KA 2MPFA 2Y60A 5F9TA 3S57A 2VTXA 5DG2A 2VNOA 4FPFA 2ARBA 5FIXA 1C3HA 2WO3A 1HRV2 4DEVA 3EB7A 3KVAA 5F1RA 4CDWC 1MS8A 2VUCA 1HLCA 1ND2A 4QGMA 1HB3A 1UIJA 4DNYA 1FT9A 3OCPA 1R64A 3AMHA 4QHBA 2HWE1 1RUD1 2R073 1QOTA 4JGZC 4MGIE 4KWLA 1ULGA 4Y3OA 3ZR5A 3ATGA 5E88A 1DGLA 3VHRA 2WNUA 4AQ6A 1QY4A 2VOWA 1WCUA 3PIJA 2GH2A 4KGGA 4AI3A 2WZR1 1Y43B 2VZOA 3AZVA 3EXUA 1VRH1 5CNAA 4H3WA 1SLTA 1PIV2 3THDA 1QH7A 4YVSB 4RYDA 3TOJA 5C8CA 5T52A 3NJZA 4CDWB 4R4ZA 3B69A 2HWC1 2JWPA 1H8VA 3HIFA 3WV6A 5LA2A 2J1AA 2WDBA 2DUQA 3T2PA 3NRUA 3VHOA 1SPPB 1D4M3 4JGZB 2RE9A 5L7OC 5GLZA 1ULEA 3BPZA 2N7GA 4WM8A 4CDQA 4K9SA 5D21A 4TLFA 1AL21 1VE0A 3DF0A 1DDLA 1R083 1UYZA 1J59A 2D3RA 2VQAA 1HQWA 3IB3A 4UFKA 4E4HA 5A3MA 4E4DX 5HCAA 1G9DA 3ZYJB 4O65A 2HBTA 3AMQA 2DWRA 4CCNA 1KRIA 2VR4A 4CXWA 4ONUA 4FPHA 1PO11 1CZTA 2CYFA 2Q5TA 2D3PA 3OBAA 4GWIA 3WDVA 4WVMB 5L7OB 4IE0A 3LEGA 1RUD2 1US2A 3FUQA 5FO7B 4UFHA 2DVFA 2ZEXA 3IIIA 4Q4Y3 1G8WA 4CEWB 3VKFC 3POSA 3H1WA 3UJOA 1NG0A 2CGOA 3IIAA 4OQ9A 3WG3A 4AFBA 2WZR2 1I9RA 1LR5A 1LJ7A 1VRH2 4D3WA 1MS0A 1JHNA 5LEJA 3BIEA 2JIGA 2HWC2 1QXJA 3AYDA 3OOXA 1REEA 3H50A 3D82A 2R063 1NA1A 2RS13 3GDBA 3ZFGC 4XZUG 3GM8A 1U12A 2XMLA 4Y1XA 4CZSA 2PHDA 3SKJE 2A6XA 1WGPA 3USUB 4H2AA 2GMMA 1CAUA 1XSQA 4KQ7A 4YVWC 5A3OA 1HRI3 4DUVA 2VG9A 2F6BA 5EWSA 2VCAA 2YV8A 3BODA 2Y38A 1NCQA 3OGJA 4MGYE 5DDJ1 5A3WA 3MUY1 1ZZCA 2PHLA 3KF5A 4RGKA 4LUMA 2ZMNA 4S2DA 1WA4A 1PO12 1YFYA 5JSRA 1ODNA 5BYNA 3POFA 1W8TA 4MV2A 3PUSA 2R0HA 5A7WA 3ZFGB 1BHGA 3JXSA 2DUPA 3O1SA 3RYRA 2VCCA 3RNSA 4CE8A 3MPPG 3VZLA 4LXLA 4F83A 4HSJA 3WT3A 1TE1B 2VQUA 4YVWB 3T09A 4R9AA 4J6GA 4QXKA 1UPSA 2Q4SA 2ZJCA 1OQ1A 5FK7A 3MW3A 3TEYA 3WG4A 5LW9A 5C70A 1ACCA 4E2QA 2XWJB 4DMIA 2UYBA 4UW6A 2AR6A 1JYXA 2XJSA 1MEC1 1XC6A 3K2OA 5BNNA 4LKFA 1WZXA 3VL9A 4L97A 5L36A 2R0FA 1EAH1 5KC5A 2JG8C 1C8M3 3LFIA 4R8HA 3RGBA 3KT4A 1AJKA 4LK7A 5IW0A 2HYKA 3UKTA 4AYUA 5CISA 1E57A 5GZGA 5CKNA 3Q8BA 1OFSA 1QJFA 4OYUA 1RUF2 5F5AA 4QQHA 1H1AA 2PHFA 2I2SA 3C7GA 1BBT1 3MDPA 2ORXA 3ON7A 5DDJ2 5EJ1B 3T0AA 2KA3A 1O59A 1GZWA 2JB8A 2Y8KA 5HCBA 3RJRA 1G7YA 1RJ7A 4F8AA 5BV6A 1XNAA 4AWDA 5FUPA 2VUDA 3BTZA 2VULA 3PJYA 4P9WA 4XJAA 3FHIB 3T1MA 1C5IA 2GC1A 3SCHA 3S30A 1W05A 4COVA 4ATEA 1EUTA 2XGXA 2XKPA 4NWVA 4C0BA 3E1F1 2JD4A 5FZEA 2BDRA 4EN7B 1FMD3 1ZX5A 4JDNA 4Q4V1 3UESA 1UX7A 3D6EA 4LKDA 4LORA 4HK8A 1XYPA 1YQ2A 1JZ6A 2CAVA 3LCPA 3RWKX 3BI3A 1MEC2 3BPSA 2WR9A 3DYOA 5CKMA 5LBFA 1RUG2 4B7EA 3O1UA 3VHPA 3MFAA 3IT8A 2TEPA 1FV2A 1YFWA 3AFGA 4IUGA 1EAH2 4CDXA 4K7JA 5JR7B 1ZBA2 2GC2A 2Y6FA 5AVPA 5FY4A 4D6QA 3D0SA 2EICA 4YW3A 3IDBB 5KHKA 4QAWA 4IE4A 3MUZ1 3WQ0A 4LITA 4Z8BA 3GHNA 3MFCA 4QU2A 4BLJA 3R0RA 4NPLA 2NMOA 4A3XA 3ZXGA 1WMXA 1BBT2 3BALA 2NM1A 2C9AA 1W04A 4FFFA 1ODMA 4P9XA 2A73B 1N3PA 1XPWA 1LNSA 5I8YA 5A33A 3J26N 2EVXA 3ZYBA 2E9QA 1IG3A 2CWSA 2O8QA 1IHMA 4YPJA 4XFFA 2Q8DA 3T2QA 1REFA 1Y9QA 1QJX1 1GZTA 1KD7A 2RJKA 2RMU1 3I3EA 4KWKA 3AXDA 4Y4YA 2WT0A 3U10A 1V00A 1BMV1 1ENRA 4Q4V2 1JU3A 4HFSA 2ZKNA 5FYHA 1LCLA 3VHNA 4UFIA 4GALA 3ROUA 3RG0A 1W8ZA 1JZ8A 4XFHA 2VXJA 2C26A 2CAUA 4N53C 4OULA 3ZXJA 3K77A 2OQ7A 2BEOA 2C24A 4RHV3 4GMP3 3NNGA 4QXCA 4R9BA 3RQ0A 1UMHA 4KL1A 1V0AA 4J25A 4GWJA 1XJAA 2OPKA 4K21A 1TMF1 4M3CA 4IERA 1N1TA 2XWBB 4XJZA 1DU3D 1ZRDA 1ZVFA 1APNA 1NXMA 2PN5A 3HWJA 4YVSA 5T5OA 4A3ZA 4XBLA 1MS9A 1DYOA 4N53B 1UYYA 5GALA 2OYZA 3M7AA 3U4SA 3JU9A 4CDWA 1VLNA 3VBHC 3I59B 3LSDA 5B4NA 4PBPA 1W28A 1DGRA 3K4ZA 2VZRA 4IEWA 3VD7A 1JZ4A 1SPPA 2DTYA 1QJX2 2RMU2 1LHUA 3OEBA 2XG3A 2VVEA 4I3PA 1LHOA 1QXPA 2E7TA 1RUC1 1BMV2 3AMMA 1UIKA 2W52A 2O14A 5FXXA 4BK4A 4MYEA 5LEKA 3NNJA 5DMYA 1E5RA 1PGW1 2BGPA 4Y22B 5FP3A 2DVDA 3R6SA 1UXZA 1D0HA 1KEXA 2BYVE 4IESA 4DFSA 4XUQA 1HN0A 4XBNA 3VBHB 2C6SA 2A3YA 2ZEZA 3VBRA 1RUH1 1Z7S1 2QDNA 3TNQA 4NIHA 4MOAA 4WVMA 5L7OA 3U11A 2EAKA 1UY3A 2HKXA 4X8PA 3O0XA 4CEWA 3J8F2 4NPRA 4XOGA 4A44A 2MHFA 5L9VA 2X05A 4AVBA 3RZLA 5CEHA 3LF7A 3NL1A 4D8MA 5J7MA 4AI2A 4HKLA 4OZXA 5I0DA 2WT2A 3H9AA 4FPCA 3I2OA 1S1AA 2LROA 1U0AA 5FPAA 3NMBA 2LS6A 3AMNA 2MEV1 1ASJ3 1SEFA 3MICA 3QOPA 4P14A 3I2GA 1W6OB 1ENXA 1LGNA 2JKXA 3ZOIA 3T0DA 3H1YA 1G9FA 4EYUA 3T30A 4B1MA 1GNYA 2B39A 1NQDA 1FYUA 1HJGA 2P3YA 2JDMA 3GCWA 4YNIA 4RGAA 1RUC2 1H6YA 1XSRA 4OMCA 4DB5A 1HJFA 2HWD1 4LOTA 5FY9A 3AB0A 5EYYA 1AVBA 1PVC3 1W03A 2PYTA 2VPVA 4HG6B 5APAA 5FUNA 2GP5A 1JH5A 4JRLA 4CU7A 5K0UC 1H8TA 2DBIA 1QQP2 1YQ8A 3T2OA 1UU5A 4GJYA 2R7EB 3LB9A 3OUHA 4TSVA 3ZN5A 1RUH2 1Z7S2 4KH9A 2QQUA 5BPXA 1OLMA 4XCBA 4AFDA 1GP4A 2PXJA 1LESA 2WQ8A 2VZSA 3SH4A 3AZZA 3O12A 3QD6A 4FFHA 4L8QA 5C9AC 4UYBA 5C33A 3TEWA 5BXXA 3SISA 3C7HA 4PLNA 4AI9A 1HN1A 4YVWA 2OQ6A 1BZWA 1XOYA 3LDRA 3HQXA 1BVVA 5FYZA 2D6OX 2R1BA 5K0UB 5HI0A 5FJHA 1QOSA 2VY0A 2JICA 2YG0A 4QT6A 5EQUA 4IEOA 5BNOC 1UD1A 3V0AB 1QXRA 3A21A 3HQRA 4Q4W3 1B09A 1OC1A 1QOOA 3MLJA 2FQPA 3RVHA 3ZSJA 5JLVA 2XLFA 1N1YA 5CG9A 1GNZA 2YPDA 2NPIA 2HLEA 4JGYC 4NPMA 3ZYPA 3QCWA 1SBFA 1G9AA 3OUIA 5EHDA 1AR61 5C9AB 5KXBA 1UOJA 3LD8A 3PHMA 1URXA 5FKCA 1BKZA 2VVDA 1FNZA 4QGLA 3PUHA 4RN5A 5GLVA 3P3NA 5GM0A 3ZXAC 2RS31 5B2GB 3VD4A 5EP9A 1ZBE3 3POYA 2OZJA 4FOWA 5BNOB 2VBBA 4MLOA 5J09A 4FBFA 3J4UH 5D1IA 2EIEA 3G6JB 2BGCA 1V6JA 1AUYA 2ADDA 1DLCA 1EYBA 4R52A 1OQEA 4JGYB 1PK6C 1UN1A 2QDRA 4PQ9A 1RVF1 1BYHA 2X5IA 2F17A 5FZ8A 5IAXA 3INAA 2NMNA 4NRMA 1EPWA 2AC1A 1XNTA 1O4YA 2C5DA 3QACA 4TWTA 4JTNA 4L0PA 3LKJA 2HWE3 2VOKA 4MZUA 1DQ2A 4XQ4A 4JDMA 5LWBA 5JSOA 3BU0A 4Q2FA 2WC2A 1ND3A 3OPTA 3KWVA 5IK4A 2ZMKA 2IXHA 5IK5A 1J1LA 4ZPIA 2XHNA 5DQ0A 3RZJA 5CU1A 4AVAA 5K9YA 4BMBA 3ZN6B 4Y1YA 4AVVA 1M4WA 1PK6B 1VRH3 2VQTA 4NUBA 5C7GA 4N90A 4LBNA 4MUVA 5I91A 3N7JA 4LK6A 4ZS3A 4CEYB 4IV3C 1AR62 1PX4A 3F95A 2HWC3 1MQTC 5FZDA 5SV5A 1VBB1 1V9U1 2Q1ZB 1S0GA 2ZHKA 4Q0SA 3AX4A 3C2UA 3O0VA 3OGVA 2OUHA 5CVRA 5JR2A 1K12A 2XBO1 1AL0G 5EFUA 3WNKA 5J3UA 2W91A 1JS9A 4KG0A 4P9YA 4XFAA 1W06A 3SITA 2XB6C 5LASA 5FYTA 1H2NA 4HMZA 5FP4A 1AL23 4TN7A 1A8DA 2W1QA 4XUNA 2GU9A 3T08A 5LRRA 2YMZA 4LMFA 2WN3A 1NCRA 4LOSA 2SBAA 4FAHA 1AXZA 1MZFA 3AK0A 3A0KA 4IV3B 5JXHA 4C91A 4IE5A 1F35A 2BNMA 1U5IA 4DZGA 1MQTB 1HIXA 4LBQD 4HKOA 2VO5A 1DZQA 2VU9A 4O9GA 4B4PA 4BXSV 3WHUA 5J37A 4A7YA 3O7OA 5CFCC 1CAXB 1S2BA 2Z5WA 4XEZA 4MXWB 4HN0A 4K3UA 1ZA4A 3TYJA 3AJZA 4ORFA 3LGRA 3ASIA 4Q0PA 2OZ6A 4BPZA 4I0BA 2VECA 5IFPA 1O3TA 1LHNA 2PHUA 4HN1A 5JVVA 2EXHA 1Q3EA 3CHXA 3JCIA 3O14A 4CP9A 2YC2A 4QPIC 4I0WB 4IEPA 4FPKA 3OD0A 3WNNA 3CLPA 1VBB2 1V9U2 1MR5A 4UAPA 1JW6A 2JE7A 5CFCB 2XBO2 3EJKA 3O5SA 1E5SA 1NQJA 3E6BA 5KBFA 5A1LA 3OBZA 4XQWA 4DO0A 1VBC1 1UKRA 3NNFA 3S7EA 2ZA9A 5ABJC 5IVJA 5KXDA 2IXCA 3M3OA 3WVJA 1JUHA 4URTA 5FAXA 2WZPP 3GZUC 3WNOA 3ZFFC 3IMNA 4RS5C 4UOJA 3I59A 2BWCA 3HNMA 5IYYA 1OH3A 5DAXA 4QPIB 1PVXA 3M8LA 3OBRA 1EUUA 4XPVA 4ZZ5A 1NYWA 1RMU1 3BU7A 4CU9A 1DIWA 3EHKA 4LUKA 3DGTA 2ZGUA 4GWNA 1N1VA 2WWJA 1SBDA 1SLLA 2NQYA 4YSFA 1ZM1A 4IE6A 1YQ5A 3VBOC 1QKQA 4DRVA 4Y22A 4QWNA 1VBA3 5ABJB 3JQWA 2ZCWA 2YBPA 3MIDA 1FOD3 3S6PA 3AYEA 4V2WA 4RS5B 5JPMB 3VBHA 4C8DA 2X8KA 4K8RB 3I97A 4CCDA 3AKTA 3ZKYA 2NLRA 1WLDA 3RYKA 3CIHA 3TRSB 3U78A 5JWPA 3WNLA 5CZKA 4AFMA 2JJ6A 1G6NA 1MEC3 2RDSA 4HK9A 4W50A 1U5YA 2HEWF 4E8DA 5ACA3 1Q5OA 1WBFA 1EAH3 3PNAA 1ULOA 1WCKA 1RUI1 4K1YA 1CAVB 2BQPA 4QB1A 3LA7A 4PJYA 2GMEA 2GC3A 3GF6A 4AE2A 1C4RA 4NMIA 1OUSA 4A4AA 3B5LB 5I0SA 2HEYF 5FZBA 1CGPA 4KBZA 2CWMA 5L73A 4EZHA 4NAMA 2ZX3A 1J84A 1CX4A 1W3XA 2W46A 1BBT3 3B93A 3ITQA 1QJY2 1VALA 3MGUA 4Y1UA 3RZGA 3H8UA 3LFMA 5E6HA 2J1SA 3S0MA 3E6DA 2KD7A 2JX9A 2A7AA 1IZ3A 4BQ5A 2TNFA 2VCMA 2ZX1A 3W20A 1UZVA 4PCRA 1W39A 3KCCA 1R1ZA 1HXS3 3VKOA 1LHWA 4ZU5A 1KFUL 5HCFA 4AFAA 1F5FA 1LENA 1L7QA 1UOBA 1W6NB 1DGRN 2VC9A 4IV1B 3WNPA 5DZEA 3N7LA 2ADEA 2D6KA 2YHJA 3WF0A 3IPVB 1A34A 4Q4V3 3D4KA 2UURA 1W3VA 1I6XA 1KJLA 4XXPA 3WNXA 3RJ2X 1QHDA 5IVBA 3LOIA 4FXKB 4Z1VA 4PLMA 2JE8A 2JEMA 3KGLA 4QDRA 5KHGA 1IS5A 3WDUA 3ZO0B 1PO21 1PZ9A 5F3IA 1Q8OA 4MGKE 2NP0A 4P08A 1VIWB 2VTFA 1VBE1 3R4UA 2WNVC 3DL3A 5H9RA 4WM7C 3KQRA 4W6WA 4HVQA 3BB6A 1W8OA 4PQQA 4AI8A 4WVWA 3B9IA 2E26A 3N9NA 3VBSB 5K7PA 4K20A 2Q8OA 1HRV1 2NZ9A 4P5YA 1LOEA 2G19A 4ASLA 3V0AA 2DU0A 4GH4C 4TTGA 4YM1A 4AGVA 5AVAA 3PMSA 3IDEA 5F8PA 1GKBA 4W65A 4LTAA 2CL2A 4AGRA 5JCTA 1LOFC 1LKNA 3SHRA 2AYHA 1IS6A 2GAUA 4BA6A 4XMIA 1OBNA 4DS0A 3FC0A 5C9AA 5K8SA 5GLTA 3Q8CA 1OF3A 5LA9A 2X10A 4XTPA 2PQSA 3IN9A 5AFEA 4AVSA 2WNVB 5C5TA 5CFDC 4LKSA 3WQ1A 1OMIA 1QJX3 2NYYA 5DZGA 4CCJA 3OBTA 1BK1A 4DRRA 1IPKA 1I1EA 5BY5A 4FXGB 1M06G 5C6CA 1NE4A 3WG2A 1AR92 2W47A 5A7PA 4NHXA 5J48A 4K1ZA 1XNBA 3PMEA 1XQNA 4OCTA 2TBVA 4FO9A 2ID4A 4H55A 1JYIA 2WIIB 1IS3A 5FR3A 1PO22 3NNMA 2JIJA 4QPYA 3GGLA 5GZDA 5CFDB 1AYN1 4YWAA 1OA3A 1C57A 1OXCA 2DTWA 3ES1A 2WKKA 3I2DA 4Y33A 5F37A 3OGGA 4P9JA 4GJZA 5M0TA 1CD3G 4TYSA 1TMF3 2Z4FA 3WW4A 2XL7A 4Q4X1 3ZN6A 1PK6A 1UU6A 1S4CA 2IUWA 3M2MA 3PU8A 3NJXA 1LODA 1L7RA 4AW7A 1VAMA 4CEYA 4E8CA 3N4MA 1HB2A 1S0BA 1UAIA 2OA2A 4JKKA 4LJHA 3POGA 4B8EA 4YW6A 3VDDC 4ATFA 3WY6A 3KHBA 4XETA 4EROA 5T5PA 3APBA 4GAZA 1X9TA 2WYSA 3KLSA 1VP6A 4QX0A 5G05L 2RVAA 4SBVA 5I0TA 2B7YA 1DGWA 3D0JA 3U1XA 2RR11 1LOAA 3TN92 4JTOA 1MZ6A 4BU2A 1FPN1 2V09A 4YW2A 5FDBA 1GLHA 2QCSB 1UNBA 2WFF1 3GYDA 4C0HA 1RYYA 2Q8CA 1RUJ1 4YARA 1Y9GA 5F2SA 4AOCA 4LPLA 4IV3A 5LZ6A 4MGSA 3VZJA 4Q8LA 1V6LA 3ST7A 4AL9A 3VDDB 1W6QB 1Z7S3 3WNMA 3ETQA 1BCXA 3A7QA 1AYN2 2G9GA 1CAXA 1WW4A 2A6WA 3KSCA 2LRPA 5IVFA 2VH9A 3K3NA 5G04L 1LEMA 3WZ1A 4JDOA 3GALA 3KV9A 4AHWA 2ZX4A
chains in the Genus database with same CATH topology
5FYUA 5IVBA 4HONA 2GP5A 5FUNA 3PU3A 4GJYA 2XMLA 3K3OA 5FP7A 5FYMA 4CSWA 5FYSA 2Q8DA 5F3CA 5F3IA 5FXVA 2PXJA 5FZAA 5FZ4A 5FXZA 5FYYA 4D6SA 4IGQA 5A7SA 5FZ0A 5A3WA 3N9NA 5F3GA 4UF0A 5F5IA 5FYHA 5FYVA 4AAPA 4AI9A 5FY5A 2OQ6A 2YU2A 5FBJA 5IVCA 3PUSA 5FYZA 3PUAA 5A7WA 5IVYA 3PDQA 5FJHA 5IWFA 5FY7A 5FZGA 5A1FA 2GP3A 2YBSA 2OQ7A 3N9QA 4UF0B 3DXTA 4LXLA 4ASKA 4CUGA 5A1LA 3AVRA 4QXCA 3RVHA 4DO0A 4BXFA 5A3NA 5A7WB 5IVJA 3N9LA 2YPDA 4XDOA 5F5CA 5FP8A 5LW9A 3KVAA 3N9MA 4CCJA 5FZ7A 5FP9A 3LD8A 3N9OA 5A7QA 5A3PA 5F2WA 5FYCA 4Y3OA 5IVVA 3K2OA 5KR7A 3OPWA 4IGPA 5FZCA 5A7PA 5FY0A 3N9PA 3NJYA 4LIVA 3U4SA 4URAA 3KV5A 3PTRB 3LDBA 5A7NA 4EZ4A 2P5BA 2XXZA 2WWJA 5FYIA 2YU1A 2OT7A 5IW0A 4CCLA 5FY8A 3KVBA 4DIQA 4QWNA 5FZLA 2YBPA 5F32A 5F5AA 4V2WA 2XUEA 5FZKA 5A3TA 5FZ8A 4BISA 5F3EA 5FXXA 4C8DA 4Y33A 5FZ6A 5FWJA 5FXWA 5F37A 4GD4A 4QU1A 4CCOA 5IVEA 4GJZA 5FP3A 3U78A 5FJKA 4HOOA 2Q8EA 4QXHA 5FV3A 5FWEA 5A7OA 5FUPA 5FPLA 4QX8A 5LWBA 4IGOA 3PU8A 2YBKA 2OX0A 3KV6A 5FPUA 1VRBA 3OPTA 5FY1A 4E4HA 5FZEA 5LY1A 5FZHA 4LIUA 5FZIA 4CCMA 2W2IA 3AL6A 5FPVA 4CCNA 4NUBA 5FZBA 2XDVA 3AL5A 4GAZA 2VD7A 5FYBA 4D6RA 5F39A 5FZOB 5CEHA 4EZHA 4Y4RA 3UYJA 5FZDA 5FP4A 5FZ1A 5A80A 4BU2A 3PUQA 3ZPOA 5K4LA 5E6HA 3AVSA 2Q8CA 5FPAA 4CCKA 5F2SA 5FZ3A 2WWUA 4XDPA 5FYTA 2OS2A 5LY2A 5FY4A 4TN7A 4D6QA 4QX7A 3PURA 5FZFA 4EYUA 4LITA 3ZLIA 5FZOA 3KV4A 5ANQA 5FZ9A 5IVFA 3K3NA 4QXBA 4V2VA 5FY9A 3DXUA 5FPBA 5ISLA 5FZMA 3KV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FYU A;  5IVB A;  4HON A;  2GP5 A;  5FUN A;  3PU3 A;  4GJY A;  2XML A;  3K3O A;  5FP7 A;  5FYM A;  4CSW A;  5FYS A;  2Q8D A;  5F3C A;  5F3I A;  5FXV A;  2PXJ A;  5FZA A;  5FZ4 A;  5FXZ A;  5FYY A;  4D6S A;  4IGQ A;  5A7S A;  5FZ0 A;  5A3W A;  3N9N A;  5F3G A;  4UF0 A;  5F5I A;  5FYH A;  5FYV A;  4AAP A;  4AI9 A;  5FY5 A;  2OQ6 A;  2YU2 A;  5FBJ A;  5IVC A;  3PUS A;  5FYZ A;  3PUA A;  5A7W A;  5IVY A;  3PDQ A;  5FJH A;  5IWF A;  5FY7 A;  5FZG A;  5A1F A;  2GP3 A;  2YBS A;  2OQ7 A;  3N9Q A;  4UF0 B;  3DXT A;  4LXL A;  4ASK A;  4CUG A;  5A1L A;  3AVR A;  4QXC A;  3RVH A;  4DO0 A;  4BXF A;  5A3N A;  5A7W B;  5IVJ A;  3N9L A;  2YPD A;  4XDO A;  5F5C A;  5FP8 A;  5LW9 A;  3KVA A;  3N9M A;  4CCJ A;  5FZ7 A;  5FP9 A;  3LD8 A;  3N9O A;  5A7Q A;  5A3P A;  5F2W A;  5FYC A;  4Y3O A;  5IVV A;  3K2O A;  5KR7 A;  3OPW A;  4IGP A;  5FZC A;  5A7P A;  5FY0 A;  3N9P A;  3NJY A;  4LIV A;  3U4S A;  4URA A;  3KV5 A;  3PTR B;  3LDB A;  5A7N A;  4EZ4 A;  2P5B A;  2XXZ A;  2WWJ A;  5FYI A;  2YU1 A;  2OT7 A;  5IW0 A;  4CCL A;  5FY8 A;  3KVB A;  4DIQ A;  4QWN A;  5FZL A;  2YBP A;  5F32 A;  5F5A A;  4V2W A;  2XUE A;  5FZK A;  5A3T A;  5FZ8 A;  4BIS A;  5F3E A;  5FXX A;  4C8D A;  4Y33 A;  5FZ6 A;  5FWJ A;  5FXW A;  5F37 A;  4GD4 A;  4QU1 A;  4CCO A;  5IVE A;  4GJZ A;  5FP3 A;  3U78 A;  5FJK A;  4HOO A;  2Q8E A;  4QXH A;  5FV3 A;  5FWE A;  5A7O A;  5FUP A;  5FPL A;  4QX8 A;  5LWB A;  4IGO A;  3PU8 A;  2YBK A;  2OX0 A;  3KV6 A;  5FPU A;  1VRB A;  3OPT A;  5FY1 A;  4E4H A;  5FZE A;  5LY1 A;  5FZH A;  4LIU A;  5FZI A;  4CCM A;  2W2I A;  3AL6 A;  5FPV A;  4CCN A;  4NUB A;  5FZB A;  2XDV A;  3AL5 A;  4GAZ A;  2VD7 A;  5FYB A;  4D6R A;  5F39 A;  5FZO B;  5CEH A;  4EZH A;  4Y4R A;  3UYJ A;  5FZD A;  5FP4 A;  5FZ1 A;  5A80 A;  4BU2 A;  3PUQ A;  3ZPO A;  5K4L A;  5E6H A;  3AVS A;  2Q8C A;  5FPA A;  4CCK A;  5F2S A;  5FZ3 A;  2WWU A;  4XDP A;  5FYT A;  2OS2 A;  5LY2 A;  5FY4 A;  4TN7 A;  4D6Q A;  4QX7 A;  3PUR A;  5FZF A;  4EYU A;  4LIT A;  3ZLI A;  5FZO A;  3KV4 A;  5ANQ A;  5FZ9 A;  5IVF A;  3K3N A;  4QXB A;  4V2V A;  5FY9 A;  3DXU A;  5FPB A;  5ISL A;  5FZM A;  3KV9 A; 
#chains in the Genus database with same CATH topology
 3HN3 A;  1GWK A;  5HV0 A;  4DUW A;  3JUU A;  1H2L A;  2HH9 A;  1MVQ A;  4Q4X 2;  1ZZB A;  2DCJ A;  4ZKT B;  5L19 A;  2XJR A;  4ZXK A;  4XC9 A;  2IXI A;  1US3 A;  1FV3 A;  2Y6H A;  3JBG 1;  4E27 A;  3M3C A;  4EWE A;  3VD5 A;  4AED B;  2MEV 3;  4AK3 A;  3BUC A;  1W2O A;  2KXL A;  5FTT C;  5GZF A;  4FP3 A;  4I09 A;  2VE1 A;  4AXO A;  5A7S A;  3TNP B;  2B46 X;  5C3P A;  1H6X A;  3THP A;  4A7Z A;  4A2U A;  2AAC A;  4XFC A;  2RR1 2;  2W95 A;  1LB2 A;  3FJS A;  3HNB M;  3I2F A;  3ZDS A;  5CAD A;  4EV0 A;  4MGT A;  1FPN 2;  2FCV A;  1PMH X;  2HWD 3;  4XQD A;  4YW4 A;  2WFF 2;  1YHF A;  5H9Q A;  1UY0 A;  2GP3 A;  1GP6 A;  1RUJ 2;  2YBS A;  1BXH A;  1LHV A;  3JD7 3;  4ASK A;  1KJR A;  4QMA A;  4EWA A;  3HPN A;  4GB3 2;  4BXF A;  3UJQ A;  5EXO A;  2JB4 A;  1QJU 2;  3ZMO A;  4XMA A;  1UO9 A;  5C3O A;  1E5H A;  2J1R A;  4TXW A;  5LA0 A;  2EID A;  1GZC A;  5FP9 A;  2VMF A;  1YNA A;  3B9C A;  1WLT A;  2C1F A;  1VBD 2;  2VMH A;  2EF6 A;  1RUF 1;  3ILN A;  1EP0 A;  5KC6 A;  1MS5 A;  3C7E A;  1O6U A;  2O8O A;  5FLI A;  1CPM A;  1W8F A;  4LO5 B;  1IS4 A;  2VM9 A;  3H3Z A;  3A23 A;  3OSD A;  4XJW A;  1DGW X;  2DFC A;  4CP2 A;  3LDB A;  3M3I A;  4GKY A;  2VVF A;  4RS5 A;  2ARE A;  3POE A;  4FTB A;  1K5M A;  2GC0 A;  3JBG 2;  3MIG A;  2ET7 A;  4CYD A;  5BUV A;  4EJR A;  5GLW A;  1X50 A;  3BVC A;  2DVG A;  2FHR A;  4HAN A;  5F3E A;  2YC4 A;  3VDC A;  3NWK A;  1TZO A;  1UF2 C;  3NV3 A;  3Q8F A;  1OD5 A;  4Q29 A;  2PHT A;  2FBE A;  1CAV A;  1VAV A;  4GMP 0;  1AR6 3;  2E33 A;  2ZZQ A;  5A1A A;  4XHB A;  4P02 B;  2CY6 A;  1AF9 A;  4QX8 A;  1OOP C;  1O5L A;  2ILM A;  4YGE A;  5CA6 A;  3C7O A;  4CU8 A;  1NE6 A;  3M1H A;  1RUG 1;  1UQX A;  4UFL A;  2QQO A;  1DQ1 A;  1R1A 1;  2RS3 3;  3AKR A;  4WZF A;  4NIG A;  2EXJ A;  2BVB A;  1GR3 A;  2JDY A;  2W94 A;  3GBW A;  2XJT A;  4OZO A;  5A32 B;  2V5Y A;  1ZBA 1;  5IAV A;  3WUC A;  5CAZ A;  3OEA A;  2R49 A;  5EYX A;  2WO7 A;  5T5J A;  3VBF C;  4QQ2 A;  2P34 A;  4D6R A;  3JQX A;  2Y6J A;  3MIH A;  1RUE 1;  2FDJ A;  5CYY A;  1YWK A;  4YLZ A;  1PMI A;  1RVF 3;  1K42 A;  1GZ9 A;  1QNW A;  2D5F A;  1CAW A;  3AKP A;  5FLH A;  2RS5 2;  5A80 A;  3VB9 A;  3WCR A;  4IV1 A;  1EPZ A;  4YG0 A;  2GDF A;  4ZHN A;  1OOP B;  4XE9 A;  4BIO A;  3AVS A;  4YM3 A;  2VMD A;  1NUK A;  3MLL A;  2RDN A;  5IAT A;  1PX3 A;  3U0Z A;  1ZRE A;  1SZB A;  3SCF A;  3UK9 A;  1LEC A;  2JG8 B;  3A0N A;  3PTY A;  4YG3 A;  1F2N A;  3CJI C;  1UX6 A;  4UT5 A;  1MS3 A;  3DYM A;  4PIZ A;  3VBF B;  2WWS A;  1LED A;  4QQP A;  3ETP A;  2P3I A;  1POV 1;  2VW2 A;  3IAQ A;  2FMD A;  5FZ9 A;  1JBC A;  1X36 A;  2HBU A;  4JCK A;  5IK8 A;  4E2G A;  3WG1 A;  1RUN A;  4XTM A;  1RUO A;  4JV4 A;  4O7X A;  3HAG A;  1OFN A;  1QU0 A;  4XF3 A;  2HWF 2;  3C3V A;  2H0V A;  3E6C C;  4Y20 B;  4FPJ A;  2P2K A;  5I0U A;  1NY7 1;  3M70 A;  1GBG A;  1TME 1;  2XBO 3;  3GXU A;  5FLJ A;  5FRE A;  3VBS A;  5C3S A;  3EO6 A;  1R1A 2;  3VN4 A;  5FXV A;  5T3N A;  3CJI B;  3DEC A;  1HB1 A;  3S7I A;  4FOV A;  1VMJ A;  4FVV A;  4QX5 A;  3UGG A;  5JIU A;  2QNK A;  2WA3 A;  4IL7 A;  5T5L A;  3QBQ A;  2RM2 2;  4AQS A;  4Z2A A;  2QVS B;  5A6X A;  1GQP A;  1RUE 2;  3OGS A;  4LO8 A;  4CTE A;  4CUA A;  3FHQ A;  1YI7 A;  4OI2 A;  4XJ9 A;  4XZP A;  1VR3 A;  1XE7 A;  2OUJ A;  3FFQ A;  3CBN A;  2YZ4 A;  3AFK A;  3CU7 A;  1J1T A;  3H42 B;  3RSJ A;  2BTV C;  5JZG C;  3DPR C;  1JZ3 A;  1BVP 1;  3I2K A;  3W5M A;  2XVL A;  5A3N A;  2Q0A A;  3T0B A;  2WS9 1;  2QQN A;  4HPK B;  3RWN A;  4OUE A;  2E53 A;  1QF3 A;  1CQ9 A;  2K0G A;  2E6V A;  4JKM A;  5DAP A;  5A3P A;  4UFJ A;  1WW6 A;  3VKN A;  3WQB A;  4I3G A;  1I3H A;  1EV1 1;  4GZ9 A;  4S2F A;  5CFD A;  3WX5 A;  4BOW A;  2WO1 A;  2JG9 A;  4AED A;  1CES A;  1SLA A;  2XXZ A;  1UY1 A;  3ENR A;  2Y6K A;  5JZG B;  3DPR B;  1JYN A;  1NY7 2;  1PNG A;  2V73 A;  3WP5 A;  1TME 2;  1YC6 1;  2VZV A;  1B35 C;  4C90 A;  4MGZ E;  1E5I A;  2O1Q A;  1W6M B;  1VBC 3;  1U5Z A;  3AKS A;  4XUO A;  5FZ6 A;  5FK8 A;  1HV0 A;  2EIG A;  2D6P A;  4G9S B;  1N3Q A;  2QQK A;  5JMO A;  1AHS A;  1J83 A;  2D44 A;  3J8F 1;  3T3Y A;  5DZF A;  4RR3 C;  2Q8E A;  4IQP A;  2WLP A;  2JDA A;  3HOB A;  1ZA7 A;  1IQD C;  4QDS A;  4CCE A;  4BK5 A;  1GUI A;  1RMU 3;  1UXX X;  5FPU A;  3AMP A;  1Q8V A;  1IGO A;  1UOG A;  3HR9 A;  1B35 B;  3R4S A;  4MXV A;  5E1R A;  4HBN A;  3AP4 A;  5FZI A;  3WF2 A;  4MHR A;  4QQL A;  2WS9 2;  5JOW A;  2XDV A;  3X29 B;  3IKW A;  2ES3 A;  4JGZ A;  2ZML A;  2D3S A;  5FZO B;  1S0I A;  1H9P A;  1AR8 1;  2R6Q A;  5T54 A;  2TUN A;  4Y4R A;  4YGB A;  3FX3 A;  4RR3 B;  3WW3 A;  1YFX A;  1W9F A;  3PUQ A;  3WDT A;  1EV1 2;  1W6Q A;  1YLL A;  4YYO A;  3ZPO A;  1D7P M;  3N36 A;  1AR7 2;  5J36 A;  3H8R A;  5EPA A;  2CDP A;  3W5N A;  3LPF A;  4XDP A;  5GLU A;  3VGI A;  4Y5S A;  1MVE A;  4MX3 A;  2R07 1;  3AZW A;  5LY2 A;  4B7K A;  1SCS A;  1QQP 1;  5GKA C;  4M0N A;  3W9A A;  1RUI 3;  1S55 A;  3FMG A;  4Y5Z 0;  1CJP A;  1K3I A;  3SH3 A;  1ZZ6 A;  4HT1 T;  1VB2 A;  3VKM A;  2WRA A;  3MV0 1;  3UV9 A;  4EQV A;  1YIP A;  5FPB A;  2PAK A;  5FZM A;  4LA2 A;  2HWB 1;  1MZ5 A;  5FYU A;  3D5O A;  2WSU A;  3LA2 A;  2ZGP A;  3B01 A;  1JOJ A;  3IZO A;  4Q0Q A;  4YZ3 A;  5J98 B;  3ZSM A;  2PLV 3;  4NRO A;  1KGY A;  1W2N A;  3FWE A;  4JC1 A;  1OPO A;  2W5F A;  1HQL A;  1W8N A;  5JPN B;  2QE3 A;  5JI9 A;  1PGL 1;  5HBA A;  4QPW A;  4OI1 A;  1MS4 A;  2Q30 A;  2GMP A;  3UL2 A;  4FFI A;  3K46 A;  4JX0 A;  2E63 A;  1S2E A;  3AP7 A;  1W9T A;  5F3G A;  2ZGR A;  2GND A;  3SLI A;  4MH0 E;  5FYV A;  2WL1 A;  3KD4 A;  1VAK A;  2VOT A;  4LUL A;  4Q0U A;  5FBZ A;  4BJ0 A;  1AR8 2;  1H1I A;  5CKQ A;  5A6Y A;  3T1L A;  2VQ0 A;  2FCU A;  4LT5 A;  3M3E A;  2BZD A;  5FRA A;  3BOP A;  1UW8 A;  2B4K A;  2LW8 A;  1W0O A;  3HEI A;  4Q26 A;  2XOM A;  3ZSK A;  1I5P A;  2ZKL A;  4CUB A;  5C4W C;  3USU A;  1WW5 A;  2D40 A;  3GBG A;  4UF0 B;  3HNY M;  3N9Q A;  3KS7 A;  1W9S A;  3IM0 A;  2R07 2;  4BME A;  4BYY A;  1RIR A;  2V72 A;  1F5J A;  4Q4Y 1;  4XUR A;  4D7T A;  2XHK A;  5C8W A;  1JYC A;  4XFB A;  3CJX A;  2B42 B;  2HEV F;  4NID A;  1DQ6 A;  1VBE 3;  2ZGN A;  1BEV 1;  1GYK A;  1P8J A;  1RHI 3;  2K46 A;  4NHM A;  2WQZ C;  1GFF 2;  4OFG A;  3ZIW A;  5F2W A;  3O1O A;  2RDR A;  4DEQ A;  3ZFG A;  3OPW A;  4ASM B;  4JZR A;  1HRV 3;  5FZC A;  4Z2W A;  1A3K A;  2HWB 2;  2BJS A;  1QWR A;  1W8U A;  1OUR A;  2WFP A;  4FI9 A;  2MNG A;  3PTR B;  4LKE A;  5C4W B;  3L2H A;  4LHS A;  4BQX A;  2R1D A;  3SNM A;  4XUT A;  3HJR A;  1D4M 2;  3Q8E A;  3Q8A A;  2RS1 1;  3ZFE C;  3EYP A;  4FFG A;  1PGL 2;  4FPE A;  3IBM A;  4PDW C;  4QB6 A;  3ZYF A;  3RS6 A;  4BH9 A;  1WCD J;  4CDU C;  5FCC A;  3U07 A;  3ZM8 A;  1R08 2;  3E5Q A;  3UKV A;  4K8F A;  4I2O A;  2A6Z A;  1HRI 1;  1DCS A;  1PIV 3;  1F4A A;  1L3J A;  1QDC A;  3PVN A;  5FJK A;  4QXH A;  4D69 A;  5C71 A;  5J1X A;  1DYK A;  5KXE A;  2VJX A;  1J58 A;  3H7Y A;  2JD9 A;  1YXW A;  2WQ4 A;  3SEP A;  5FY1 A;  3AZX A;  1A78 A;  2D6M A;  3ZFE B;  4MVT A;  3OY8 B;  1MS1 A;  4FPL A;  4Q4Y 2;  4PDW B;  1XE0 A;  4LBQ B;  3V0B B;  4AZZ A;  1S0C A;  3OF1 A;  3I4I A;  4WBB A;  2BNO A;  4YZ1 A;  3TEZ A;  4M4P A;  5F39 A;  1AYN 3;  3LZZ A;  4AGG A;  1BEV 2;  2ZHM A;  1DQ4 A;  3C7F A;  4NR1 A;  2CSG A;  5FPX A;  1W9W A;  2JG8 A;  1G86 A;  2VZP A;  1UWW A;  3FLT A;  4AI0 A;  2X53 S;  5IJR A;  4Q8K A;  4N43 C;  3VD3 A;  4U36 A;  3VBF A;  4GKX A;  5JI7 A;  5FQ0 B;  2A70 A;  2OS2 A;  3RMX A;  1RUD 3;  3MO4 A;  1GQH A;  5DAV A;  2A5Z A;  3EMR A;  2RS1 2;  2EA7 A;  5H9S A;  2QQV A;  3TWI A;  3ES4 A;  2A6Y A;  4LO6 B;  3ZSL A;  3WP3 A;  4N9I A;  1YUD A;  2D93 A;  2VXR A;  1ND2 C;  3ZYH A;  2WZR 3;  3GCX A;  4Y24 A;  1OF4 A;  1UZ0 A;  4FPY A;  4OUM A;  1HRI 2;  1ENS A;  1H1M A;  3CJI A;  4M00 A;  1AZD A;  2E32 A;  5I0R A;  2H6B A;  4AEK A;  1JYT A;  4C1W A;  3RZM A;  4HXC A;  4N43 B;  3RI8 A;  5FOJ B;  1RL3 A;  2F4P A;  2WNU C;  3K3O A;  1FPN 3;  4AG4 A;  2WYF A;  1NAE A;  2PAE A;  2W0X A;  4UWD A;  4ES8 A;  1WKY A;  2FDF A;  4LBJ A;  3ME2 A;  1Z0H A;  3ZSE A;  1GAN A;  2ZX0 A;  2XJP A;  1PZ8 A;  3WW1 A;  4AQ2 A;  5ANN A;  1HB4 A;  1N47 A;  2ZAC A;  4KMQ A;  5C8C C;  1VJ2 A;  3NVC A;  2BPA 2;  1COV 1;  1ND2 B;  3M4F A;  3OPZ A;  1RED A;  4E2S A;  4XJU A;  3H1M A;  2Y64 A;  1OPM A;  4QPG C;  4AHZ A;  3DKQ A;  3J7H A;  1AYM 1;  2E51 A;  5IVY A;  2ET1 A;  4CUC A;  3VZN A;  5FY7 A;  3NST A;  2WNU B;  4CDQ C;  3O1V A;  4BQ2 A;  4UW4 A;  3SEE A;  1AX0 A;  1PO1 3;  4AEM A;  1W2U A;  5E16 A;  2CGP A;  2ZAH A;  3AVR A;  3OTF A;  2ARC A;  1WWY A;  2QQJ A;  2OII A;  4F3J A;  3WP4 A;  5F5C A;  1GP5 A;  1O4Z A;  1NT0 A;  5C8C B;  1C8M 2;  2ZAA A;  2YB7 A;  1ZRI A;  1W8W A;  4BQ4 A;  4ZZ8 A;  1UU4 A;  2WLQ A;  2YGM A;  3DPR A;  2PFW A;  4XW3 A;  4DY5 A;  1HKD A;  1STM A;  3KZ4 C;  4QPG B;  2RJ2 A;  2ZXQ A;  1JOB A;  1XND A;  2CGN A;  3LE0 A;  3QLQ A;  5FUI A;  1RTV A;  4CDQ B;  5JAX A;  4IEQ A;  2W1S A;  2YYO A;  1BLZ A;  3J7M A;  1OA4 A;  5FZL A;  3SH5 A;  1LU1 A;  1LUL A;  2W39 A;  2UYA A;  4IDZ A;  3EBR A;  2Y34 A;  2XUE A;  2JDH A;  4R9C A;  5I8T A;  1KDM A;  2EXK A;  3LEM A;  2D43 A;  3MIE A;  1COV 2;  4OUS A;  2PTM A;  1DQ5 A;  5HXM A;  4NII A;  4N53 A;  5IVE A;  1B35 A;  4YG6 A;  1NXD 1;  4HOO A;  3NV2 A;  3BOW A;  5FWE A;  5CG8 A;  1JYW A;  1C1F A;  1RUF 3;  1AYM 2;  3AP9 A;  4FP2 A;  3POJ A;  1NA1 C;  2D6N A;  5DDJ 3;  4N9H A;  3WF1 A;  4RQP C;  2PEL A;  1QJY 1;  2FDI A;  3WQ7 A;  4LHK A;  3U14 A;  2BVV A;  1AX1 A;  1JXN A;  1W0N A;  4JAA A;  4PLO A;  1YJL A;  4XF0 A;  5FZH A;  3U75 A;  4OQ8 A;  4CCM A;  1OI6 A;  2H6C A;  4LNV A;  2ZOE B;  3KT1 A;  5FPV A;  4D94 A;  4DPN A;  2PHX A;  3PIG A;  4QB2 A;  3N7K A;  1TVG A;  2PA7 A;  3ZN4 A;  3FFZ A;  4P5H A;  3WIN E;  3ZFF B;  2FDK A;  2VOV A;  4Y1Z A;  2A3X A;  2VUA A;  4M01 A;  4NIA A;  2DUO A;  1NA1 B;  3B3Q E;  3CDZ B;  1TQ5 A;  4RQP B;  4HVO A;  2UWC A;  4YGC A;  4IEU A;  3H8X A;  3SKV A;  3E5X A;  2VNR A;  5KHH A;  2J22 A;  4AR2 A;  1DF0 A;  1RUG 3;  3WXP A;  2P17 A;  4S2H A;  1QIQ A;  4I30 A;  3UGF A;  3VBO B;  3NKT A;  2VBP A;  3O1M A;  5ANQ A;  1ZBA 3;  3HT1 A;  3KCX A;  4RA0 A;  4J1X A;  1JUI A;  1K45 A;  5ISL A;  1D2S A;  5DAW A;  3ZVX A;  4NOT A;  3ELN A;  2VZ3 A;  2G4I A;  3I7D A;  4HON A;  4LBK A;  2PHR A;  3LAG A;  1MAC A;  1W6O A;  1W8H A;  2GAL A;  1LGB A;  4KWJ A;  4RD7 A;  3ZXL A;  1Y3T A;  4BZ4 A;  5LK7 B;  1WA6 X;  1YO8 A;  4RFT 0;  4XDQ A;  4LBO A;  2XH6 A;  1SLI A;  1OLR A;  2BER A;  3MF9 A;  2BWA A;  4L9B A;  1RXF A;  3THT A;  1WCQ A;  4IND A;  4AHY A;  3R05 A;  2E7Q A;  4BQ3 A;  4UF0 A;  3D8C A;  4XBQ A;  1A8M A;  1S0J A;  3WDX A;  4Y5T A;  4HZF A;  1POV 3;  3PLQ A;  1X8E A;  1Y7B A;  2P37 A;  4LE4 A;  5HPO A;  3NO8 A;  5C3Q A;  4CXY A;  1YFU A;  1AR9 1;  4BB3 A;  1Q8Q A;  2B8M A;  5A1F A;  3ACF A;  1JYV A;  2Y6L A;  3ZKU A;  4QD2 A;  2D97 A;  4QDQ A;  3ZMN A;  4CUG A;  3QH6 A;  2Z2S B;  2DU1 A;  1FAT A;  4EE2 A;  3N9L A;  4JHT A;  2D7F A;  5JXJ A;  3N9M A;  1WMD A;  5C4W A;  4A42 A;  4AI1 A;  1ASJ 1;  1J3Q A;  1PGS A;  2ENR A;  2JDK A;  1O8S A;  2KM2 A;  2EIB A;  1VMF A;  2GNB A;  2XQR A;  2ZGQ A;  3GNE A;  3N9O A;  4YZ4 A;  2XR4 A;  2OPW A;  5DN2 A;  5FMO S;  4XF9 A;  2QFE A;  4QQO A;  5K0U A;  1LOB A;  1TNR A;  3UT0 A;  1OQD A;  4IGP A;  5IVV A;  2BBV A;  5FY0 A;  4I01 A;  2WZE A;  1WUV A;  3CKH A;  3TEX A;  3S5A A;  1PM4 A;  1DP0 A;  2IVJ A;  4QM8 A;  3I3M A;  3W21 A;  4HKW A;  1H2K A;  3CF6 E;  3DYP A;  5FYI A;  4JRA A;  4OLL A;  4AEJ A;  4CDX C;  3KVB A;  4QKN A;  3RI9 A;  1JZ2 A;  3O1T A;  3I2J A;  2QBX A;  1D2Q A;  3NQH A;  5A3U A;  1ZZ8 A;  5D2A A;  3ECQ A;  4XHX A;  2FZ2 A;  2O0O A;  1V6N A;  4HVR A;  2WS9 3;  5FWJ A;  4BQY A;  3MBW A;  4LA3 A;  3P1I A;  2ZX2 A;  4IET A;  4WM7 B;  2RMU 3;  1O5U A;  1YEW A;  1FXZ A;  4O9E A;  5DUX A;  3WR0 A;  4QKD A;  2CNA A;  5A7O A;  1WBL A;  5L9R A;  5BNO A;  4GH4 B;  3TN9 1;  3I8T A;  1EV1 3;  4RL7 A;  2YBK A;  4LLF A;  4N7U A;  2PHW A;  2Z42 A;  3FN9 A;  4CDX B;  2A6V A;  2VGD A;  2H0B A;  4WVV A;  3KHC A;  1POQ A;  4P9L A;  3LIH A;  4JGY A;  5AC9 1;  2W2I A;  1Q56 A;  4Q1R A;  3SCG A;  2XL9 A;  1GOG A;  3W58 A;  1ASJ 2;  2VCB A;  3MIB A;  4XJ8 A;  3USS A;  3BYW A;  2ZS6 B;  4NRP A;  3HQU A;  1T6G C;  3H3U A;  3O0W A;  1Y4W A;  4Z82 A;  4IEV A;  3ZYR A;  2VTX J;  3THC A;  3J8F 3;  1I5Z A;  1O4T A;  4YRD A;  5A33 B;  2V4A A;  4W6X A;  4R9D A;  4CRQ A;  1HW5 A;  4XAA A;  3WF4 A;  3GHM A;  4UW3 A;  4XF1 A;  3FLR A;  4W8J A;  5FZF A;  3DUI A;  4XF4 A;  5DUU A;  4B4Q A;  1NLQ A;  1PVC 2;  2WAA A;  5LCW L;  4LHN A;  2D98 A;  4A45 A;  4LEJ A;  3ZDV A;  5JUV A;  3ACL A;  3DKW A;  4NAO A;  5HV4 A;  3KV4 A;  4MO3 M;  3ZPY A;  1RGS A;  3VD9 A;  4FSJ A;  1OUX A;  3RRD A;  3KF3 A;  4CPB A;  4EN8 B;  2RDQ A;  1JOP A;  2WA4 A;  5FMB A;  5I93 A;  2J7M A;  3MZH A;  1CN1 A;  4JVA A;  3NKG A;  5D8A C;  5EZW A;  1LOC A;  1LGC A;  2XLA A;  4NWW A;  1RJ8 A;  2DDU A;  1YIF A;  4YVS C;  1RUC 3;  2UU8 A;  2B5H A;  4DXS A;  5KXC A;  3MF6 A;  2ZGT A;  3WDW A;  4YW7 A;  5FOB B;  4UFM A;  1KQR A;  1YQC A;  4JQT A;  1L7L A;  5AC9 2;  4FQZ A;  4D6S A;  4IGQ A;  5FZ0 A;  1QQP 3;  3OGR A;  1WME A;  4GB3 1;  5LAT A;  1MQT A;  2P6C A;  3MW2 A;  2J42 A;  4M3C E;  1Q8P A;  1QJU 1;  1RUH 3;  1GOF A;  4Q4W 2;  4YFZ A;  4M3C B;  4Z92 B;  1X8M A;  2I07 B;  2WBK A;  1SFP A;  4NHK A;  3RDI A;  5D8A B;  4NN0 A;  5HCH A;  3AZY A;  3AYC A;  3PJQ A;  1VBD 1;  4MXW A;  2SLI A;  1DHK B;  5JXI A;  5SV8 A;  2HWB 3;  4MHU A;  4Z07 A;  1S2K A;  2JDZ A;  1NX9 A;  3VZO A;  2DCY A;  1LRH A;  1UCX A;  3VBR C;  1SCR A;  1Z78 A;  3T4H B;  2K9Z A;  2Y0O A;  2Y0I A;  4OMD A;  4QPG A;  5FP8 A;  4NO4 A;  5FZ7 A;  3RZH A;  2V4V A;  4LO4 B;  1ZBE 2;  3HN1 A;  2QZ2 A;  5A7Q A;  4CEW C;  2RJL A;  3T4V A;  3VV1 A;  3UKN A;  4LHL A;  2P6H A;  4PT6 A;  2QJV A;  1WLC A;  4ITC A;  5CFC A;  5KR7 A;  2BOJ A;  3B00 A;  3N9P A;  4URA A;  1PNF A;  4G3Y C;  4KGQ A;  1NLS A;  2WSV A;  4O61 A;  2XVG A;  4X6Q B;  2YU1 A;  4XVH A;  1CX1 A;  3JB4 C;  1R09 1;  3VBR B;  4V1P A;  2R04 1;  4L92 A;  2XJQ A;  2UWA A;  2VME A;  2WAB A;  3NNL A;  4GIQ A;  4E9K A;  2HWE 2;  4L99 A;  1UZW A;  5A3T A;  4P00 B;  4BIS A;  4QPI A;  2YDE A;  2BU9 A;  1C1L A;  1QNY A;  4W6Y A;  4ZON A;  3RZK A;  2J1V A;  4CCO A;  3RFR A;  3V64 A;  1H30 A;  1SAC A;  5KHJ A;  4DXR A;  2YXS A;  1EY2 A;  3SMH A;  1JU4 A;  1BEV 3;  3IWZ A;  3BTX A;  5FPL A;  2ZHL A;  1IPJ A;  1IOA A;  3AJY A;  2P4E A;  5JOX A;  1WCS A;  3VZM A;  4P9G A;  3WOG A;  3WUD A;  3ZXK A;  3OJB A;  2RS5 1;  1H8T C;  2IVI B;  5ABJ A;  3OYW B;  2JDN A;  4QX3 A;  1BK0 A;  1UYX A;  1X7N A;  1DG6 A;  3ZFF A;  2AEZ A;  3UGH A;  1WD3 A;  2I74 A;  4RQP A;  1PHM A;  3LPG A;  5JOZ A;  1AJO A;  3AYA A;  3U4X A;  1AL2 2;  1XRU A;  2JKB A;  2Y6G A;  4BLI A;  2ATF A;  3MLK A;  1Q43 A;  4KNC A;  3I2H A;  3NJV A;  1GOH A;  3VBO A;  2DUR A;  2QQP A;  2XPJ A;  1H8T B;  2GN7 A;  1CPN A;  1JOD A;  2BV4 A;  4EN6 B;  2HWF 1;  1GNH A;  1OLM E;  1BQP A;  1R09 2;  3PUR A;  3HBZ A;  2R04 2;  1RB8 G;  4DY3 A;  5BNQ A;  1D0G A;  3I49 A;  2CDO A;  3ZLI A;  1UY4 A;  2LM3 A;  3NAP C;  4A41 A;  1J3P A;  4GXL A;  1S0E A;  2WNE A;  5DAQ A;  3RZZ A;  1O7F A;  4XUP A;  2FD8 A;  1VBA 1;  4JKL A;  4FTS A;  4Q1P A;  2RM2 1;  1FOD 1;  4WV8 A;  3VBU C;  3FLP A;  4OI4 A;  4XAC A;  4COZ A;  2IFR A;  4UXA A;  2B45 X;  1YCI A;  2D6L X;  3DEM A;  4QKB A;  1W6N A;  1A6C A;  2A71 A;  4B3N A;  5GZE A;  3IAP A;  1J3R A;  5H9P A;  5EJZ B;  4DOU A;  5DUW A;  4R4X A;  2ZZJ A;  1XU1 A;  2Z69 A;  1O8P A;  3IPV A;  3NAP B;  4CU6 A;  5ACA 1;  2W87 A;  4UBG A;  4TZD A;  2WT1 A;  3V65 A;  4X6R B;  1DFQ A;  4ES9 A;  3GBF A;  5IK7 A;  2X5I C;  1AXY A;  1HDK A;  3SC7 X;  5IVC A;  3VBU B;  2X29 A;  4JHZ A;  5IWF A;  3I2I A;  3IDC B;  2XON A;  5J96 B;  5L9B A;  4MGQ A;  3AP5 A;  1NLR A;  3W59 A;  5A3L A;  1ZZ9 A;  2BW8 A;  2UY8 A;  3J7N A;  4K6B A;  3L2Y A;  4BE3 A;  1O3S A;  1VBB 3;  1ND3 C;  1V9U 3;  3OB8 A;  4H14 A;  5LBC A;  4QHO A;  4UI9 L;  1RIN A;  2YFU A;  2ZTN A;  4Y26 A;  2ARX A;  2X5I B;  2J1E A;  1HX6 A;  1HXS 1;  1QEX A;  2J1T A;  1ONA A;  3PUI A;  4OHV A;  1VBA 2;  4JQR A;  2PMW B;  1COV 3;  2QQI A;  3K48 A;  4RSU A;  3NJY A;  1FOD 2;  3CMG A;  4IEX A;  2DV9 A;  3P5B A;  4EZ4 A;  1FAY A;  4XIL A;  4I0A A;  1CVN A;  2P5B A;  1GV9 A;  2JDP A;  1AYM 3;  2OT7 A;  3LEI A;  3JB8 A;  3NW4 A;  2HJI A;  5FY8 A;  2WNV A;  1TEI A;  3RMY A;  4WM7 A;  3WLU A;  4DIQ A;  1SMV A;  2CHH A;  1ND3 B;  2A3W A;  2B9U A;  1GQG A;  3AKQ A;  5ACA 2;  4MET A;  4GH4 A;  3RYP A;  2I45 A;  2IXJ A;  1NCR C;  1C8N A;  4GD4 A;  3B7M A;  3LQC A;  4ISQ A;  4QU1 A;  3K75 B;  5FMO L;  4KI5 M;  4OHZ A;  1LOF A;  1W0P A;  3S5Q A;  1CIW A;  1CZS A;  2OW4 A;  4YM2 A;  1NKG A;  4IGO A;  1ULP A;  3UNP A;  2OX0 A;  1YJK A;  2ZGM A;  2ZEY A;  2CU5 A;  1AR7 1;  3MHZ A;  2VNG A;  4GA9 A;  3DN7 A;  4TLG A;  1SHW B;  2WN2 A;  4ZS2 A;  1ZZ7 A;  2IZW A;  1UMI A;  2IXK A;  3TBD A;  3AL5 A;  4AFC A;  2LUW A;  2VD7 A;  3ZYI B;  4UBH A;  1NCR B;  1O91 A;  3VUO A;  3CO2 A;  3OG2 A;  2LAL A;  1IPS A;  2GH8 A;  4YGD A;  1HXS 2;  4XYX A;  2AEN A;  3HBK A;  2D5H A;  1JMU B;  5GZC A;  1MPX A;  2RG4 A;  4CCC A;  4Q5O A;  4D7Y A;  3FBM A;  1DZT A;  2OVU A;  2GN3 A;  4QX7 A;  2C0Z A;  2NN8 A;  2XVK A;  2UWB A;  4G4F A;  4PIY A;  1X33 A;  1QJY 3;  4W4Z A;  2DCT A;  4J1W A;  1WW7 A;  5CB7 A;  4PBO A;  4COW A;  4N8M A;  4KU8 A;  4S2G A;  2P3K A;  2E31 A;  3ABZ A;  1OSG A;  2XKO A;  5FO8 B;  4ARY A;  1GU3 A;  2CV6 A;  4MG2 A;  3ILR A;  4OI0 A;  1XU2 A;  1Q8S A;  4CP9 B;  3WF3 A;  4XFI A;  5EV7 A;  5LB6 A;  2CTV A;  5LBB A;  3NV1 A;  2XLG A;  3VDD A;  1F15 A;  1KS4 A;  2BGO A;  3P6B A;  3POB A;  5FKB A;  3M3Q A;  4FCA A;  3R4D B;  5LK5 A;  1OHF A;  1UL9 A;  3ZX7 A;  5D8A A;  3MEP A;  3PVB B;  1W6P B;  1K5J A;  2A75 A;  3DV8 A;  1O3R A;  1SG3 A;  1T6B X;  2BFU S;  2BP6 A;  2YU2 A;  5FBJ A;  3ACI A;  1UZY A;  4LLO A;  5JIA A;  3PDQ A;  2G9F A;  1WMF A;  2ARA A;  2XJU A;  4NE9 A;  2FCT A;  5LA1 A;  4YFW A;  1N1S A;  1HQN A;  2ZPX A;  4PF1 A;  3PL0 A;  5FFO C;  3LOB A;  1D4M 1;  4HL0 A;  4X8N A;  4D0Q A;  1XXN A;  3LWC A;  4A6O A;  1F9K A;  3B94 A;  3Q9O A;  2WNO A;  1SLB A;  3KB5 A;  5FYC A;  1FX5 A;  4FT8 A;  2W68 A;  5CIR A;  3RPQ A;  1R08 1;  2IC1 A;  5F6K A;  2R30 A;  2VMG A;  1ZYB A;  1XNK A;  2VAU A;  2W3J A;  3KV5 A;  4I02 A;  2OKX A;  4NRQ A;  3PVE A;  2YC0 A;  4M0H A;  3T2T A;  4DXZ A;  4BDV B;  4MSV A;  3K51 A;  4OHX A;  3FHA A;  4KU7 A;  1AR9 3;  3HT2 A;  1TMF 2;  2WJS A;  2K2S A;  4L11 A;  1DYP A;  1OVS A;  5F32 A;  2G9Z A;  4QHZ A;  1QJZ A;  3GZT B;  2RHP A;  2VL4 A;  4EN0 A;  3I54 A;  4FQ4 A;  1ULC A;  5FXW A;  3KM5 A;  3LSE A;  1G9C A;  3O1R A;  3BIW E;  1KIT A;  3OYW A;  1PO2 3;  1DLL A;  1GMM A;  3C8X A;  1OLQ A;  1OKQ A;  4YZ2 A;  1FNY A;  2VMC A;  3SQO A;  3TAY A;  4GUL A;  1VRB A;  4RGG A;  2ZEW A;  3P3P A;  2G1M A;  1SLC A;  1JTZ X;  2VZT A;  4A7K A;  2AZ5 A;  5LY1 A;  2JE9 A;  1TG7 A;  3HVD A;  1F31 A;  5CBL A;  3ALQ A;  1PGW 2;  4XIO A;  5I8S A;  1W99 A;  4LR4 A;  1IQA A;  1RXG A;  2RV9 A;  3JD7 1;  4BHP A;  2R06 1;  4C1X A;  4AVT A;  3CZU A;  1UY2 A;  1U5X A;  2YFZ A;  4BIF A;  1SDW A;  4DXT A;  1OA2 A;  1KFX L;  1JI6 A;  5KHI A;  2DCZ A;  3GJA A;  1QGL A;  2JEN A;  4LE3 A;  1VMH A;  3I3D A;  4FPG A;  3BKZ A;  3ACH A;  4WZC A;  2P3J A;  2DBN A;  2YY1 A;  5A32 A;  2AEY A;  2EXI A;  3G7D A;  4KBB A;  4NHY A;  3TN9 3;  4DIN B;  1CR7 A;  4ZY9 A;  1WLW A;  1ZRR A;  3E97 A;  2QKD A;  4YM0 A;  2VOX A;  2AH2 A;  5AC9 3;  1YRZ A;  2WO2 A;  4LBM A;  4V2V A;  3EQE A;  5FMC A;  4CDU B;  5BNP C;  4RFR B;  3IMM A;  1OOP A;  2MEV 2;  4PI2 A;  1CZV A;  2E7A A;  3FL7 A;  4LO7 A;  1LAJ A;  3NAP A;  3PU3 A;  3MPB A;  1C28 A;  5FP7 A;  1H4H A;  2VZQ A;  4IEZ A;  4XCA A;  5F3C A;  1NOV A;  4N7I A;  5FZA A;  4IXL A;  1SFN A;  2AUY A;  4HSL A;  3KT7 A;  4NVP A;  1W9Y A;  3VBU A;  1H4G A;  1NZI A;  2HWD 2;  4Q4X 3;  4GWM A;  1JZ7 A;  2EAA A;  3VKL A;  4ZXE A;  1GSL A;  1LU2 A;  5F5I A;  3JD7 2;  2R06 2;  3ZXF A;  5BNP B;  3BTA A;  3F2Z A;  2W9X A;  2KR2 A;  1C8M 1;  4OVE A;  2DYC A;  4Y20 A;  4SLI A;  3U37 A;  1ZRC A;  2B9V A;  4Q0V A;  4ZU4 A;  4A6S A;  1RC6 A;  4XAE A;  1OD3 A;  2RR1 3;  5GJ6 A;  4CEY C;  2XQX A;  3MW4 A;  4BQ1 A;  5JMC A;  2ORZ A;  3AC0 A;  2ZGK A;  2WFF 3;  4L2N A;  2PAM A;  4AF9 A;  1RUJ 3;  4EWD A;  4B1L A;  4ZU7 A;  4GB3 3;  2VUJ A;  2YGL A;  3FZ3 A;  1QJU 3;  1FMD 1;  1VBD 3;  2VZ1 A;  5T50 A;  4HPK A;  3KGZ A;  3WEZ A;  2YUE A;  4YZ5 A;  1IG0 A;  1JZ5 A;  4WM8 C;  1POV 0;  1SFY A;  1YYN A;  5A70 A;  3GJB A;  5FZK A;  1GWM A;  1W90 A;  3CNA A;  1QMJ A;  1UYP A;  2QQM A;  1F4H A;  2RS3 2;  5FO9 B;  3E5U A;  2GNT A;  1DQ0 A;  3QH7 A;  2R16 A;  3VDB A;  1ST8 A;  3JBG 3;  3AXE A;  2R32 A;  2WIN B;  5JZG A;  4AHX A;  2ZBJ A;  1TNF A;  2ZAB A;  3K4A A;  4B4R A;  3CL1 A;  5IFT A;  5E8A A;  1S0D A;  1RVF 2;  4Y1V A;  1W6M A;  2DFB A;  4WM8 B;  1ALY A;  3AL6 A;  1R09 3;  3AM2 A;  2JEC A;  1ZNP A;  2R04 3;  5JDB A;  3ZYG A;  4E4S A;  1CWP A;  5IT6 A;  1MZE A;  2HYX A;  3J7L A;  3OD4 A;  1N3O A;  5DAB A;  5ERL A;  5F6L B;  3VDA A;  1V6O A;  2V5D A;  4FAG A;  4QKF A;  3CZJ A;  4HET A;  2IFW A;  5IUQ A;  1PZ7 A;  5K4L A;  1LTE A;  3V56 A;  2WWU A;  1UMZ A;  1FMD 2;  4UW5 A;  3WD5 A;  3I3B A;  3ORJ A;  1OKO A;  2EAL A;  3GZA A;  4YW5 A;  4AAX A;  2RS5 3;  2F4L A;  4U2A A;  3VLB B;  3H0O A;  1IKP A;  1C5H A;  1SDD B;  3WHT A;  5FZO A;  4CP0 A;  5C3R A;  1H0B A;  2JXA A;  4RR3 A;  2P1B A;  3A4U A;  5LBE A;  4CXX A;  5KWR A;  1V6I A;  3DXU A;  1F8V A;  2W1U A;  2Q1F A;  1BJQ A;  2ZGL A;  4HLT A;  4IW3 A;  3DCQ A;  2FZ1 A;  3FUO A;  3POI A;  1NCQ C;  2A1X A;  4GMP 1;  2GSY A;  4RHV 1;  1KDK A;  5DXD A;  1O3Q A;  2OXB A;  4CPB D;  5FYM A;  4CSW A;  4CVU A;  1W6P A;  1JN2 P;  5FMD A;  3LIG A;  1UKG A;  5B4X A;  4EN9 B;  1FI2 A;  2L9L A;  3IDA A;  5FZ4 A;  5FXZ A;  1V6M A;  3KCY A;  5JSP A;  3BTY A;  1K5M C;  2HWF 3;  1XNC A;  3KQ4 B;  3BGA A;  4OHY A;  4FPO B;  3WP6 A;  5AFB A;  4M3C F;  3TB0 A;  4B29 A;  1CAU B;  2J1U A;  3CEW A;  3VL8 A;  1R1A 3;  1VPH A;  2WZ8 A;  2YPJ A;  5FY5 A;  4AAP A;  1G9B A;  5JXG A;  4QM9 A;  4D7S A;  3PUA A;  2ERF A;  1NCQ B;  3H8O A;  2ZGO A;  4K40 A;  3H3L A;  1PMJ X;  2RM2 3;  2BUK A;  1QJE A;  3DXT A;  4KWU A;  1RUE 3;  3J9S A;  3ZIX A;  5BNN C;  3A22 A;  1QDO A;  1V70 A;  2ZHN A;  5A7W B;  5TSW A;  3WCS A;  1UOF A;  1K5M B;  2W08 A;  4XDO A;  5DUV A;  2FDG A;  2DF7 A;  4M4R A;  4FOQ A;  1XE8 A;  1IKQ A;  1ENQ A;  4PIX A;  1CON A;  3LA3 A;  3UET A;  2QZ3 A;  3NV4 A;  1H9W A;  2BFU L;  4CA9 A;  3O1P A;  1UPI A;  1OT5 A;  2FDH A;  2VW1 A;  3I3Q A;  1D4V B;  1AXK A;  4LIV A;  2WAO A;  4BQW A;  3LDK A;  1ULF A;  5HXV A;  5A7N A;  4NJ4 A;  1SQ4 A;  1VBC 2;  4RHV 2;  3ZXD A;  4IV1 C;  4GQ7 A;  1NZC A;  2W92 A;  4H7M A;  2BNN A;  1CIY A;  1H2M A;  4CCL A;  1GWL A;  4ET7 A;  5BNN B;  2AGS A;  3MIF A;  1ULD A;  3OUJ A;  3WW2 A;  3AP6 A;  1ZRF A;  4KG8 A;  2XJV A;  3BN6 A;  3WDY A;  2X09 A;  2PLV 1;  4QX1 A;  1RMU 2;  3WSO A;  1LOG A;  1TME 3;  2Y33 A;  1KXG A;  3L9J T;  5FV3 A;  2DCK A;  4COY A;  4NHL A;  1CAW B;  2YRO A;  1W2T A;  4ARX A;  4XXA A;  2WUH A;  2UY9 A;  3KV6 A;  1GZW B;  5T55 A;  1UZZ A;  5A6Q A;  4PI0 A;  4LQR A;  3VBS C;  2DVB A;  4LIU A;  3GZE A;  1SBE A;  2VBD A;  3HMY A;  3LEK A;  4XAB A;  4XFG A;  1PM7 A;  2Q1M A;  3URF A;  4WVZ A;  5FYB A;  2VNV A;  5EJ3 A;  1PVC 1;  2QQL A;  4P9I A;  5DPN A;  3ZXE A;  1GIC A;  1XYN A;  3UYJ A;  1CJD A;  1X82 A;  2XUM A;  4COU A;  5FZ1 A;  4H7L A;  1DZR A;  4LBL A;  3ACG A;  4FOY A;  3D3A A;  4BM8 A;  1RUI 2;  4CP1 A;  3MI8 A;  1WD4 A;  4CCK A;  3ILF A;  1T2X A;  2W1W A;  4IEY A;  1JHJ A;  1RHI 1;  4MAD A;  5E89 A;  4YW1 A;  5FZ3 A;  3ZFE A;  4DUX A;  3OY8 A;  5A6Z A;  1KS5 A;  2GZW A;  4PDW A;  4QX2 A;  3VZK A;  2BRT A;  4CDU A;  1HV1 A;  4LBQ A;  5DG1 A;  3V0B A;  3N35 A;  3K4D A;  2ETE A;  3ZR6 A;  1AR7 3;  4IE7 A;  3KMH A;  4PHZ A;  1RIT A;  2PLV 2;  1DBN A;  4E4Z A;  1S0F A;  4QXB A;  2JDU A;  2Y26 A;  5FZG A;  2DVA A;  2IWG B;  2LTN A;  3FBY A;  5IHR A;  2VMI A;  3MV1 1;  4FTE A;  1XYO A;  2FMY A;  4Q4W 1;  3JZV A;  4XIK A;  5FQ0 A;  4PF5 A;  3N3H A;  5LRS A;  3SXW A;  5FYS A;  1Y9M A;  2JG9 C;  2VW0 A;  4AED C;  5F7U A;  1PIV 1;  5BNP A;  5FYY A;  2Z79 A;  5JOY A;  2PQQ A;  3POW A;  3MYX A;  2ZGS A;  2QTW B;  2C9K A;  4F7Z A;  1OH4 A;  1VB4 A;  2BBA A;  4AVC A;  3CQO A;  5F5Q A;  3FE5 A;  1QH6 A;  1XB9 A;  2VZU A;  2GNM A;  1XBF A;  1ZBE 1;  4N43 A;  4OHW A;  2QQW A;  5C5U A;  5EIY B;  1W2A X;  2QUO A;  4AQT A;  4BCU A;  3B02 A;  2BOI A;  3N7M A;  5FPZ A;  1YQ6 A;  3H7J A;  1AX2 A;  4Q27 A;  1VBE 2;  4DQA A;  2IXL A;  4ISR A;  2JG9 B;  3HD8 B;  1RHI 2;  1X9P A;  2C4X A;  1YI9 A;  3BCW A;  1OVP A;  4QGN A;  3PVO A;  4BWO A;  1AR8 3;  1V6K A;  2MPF A;  2Y60 A;  5F9T A;  3S57 A;  2VTX A;  5DG2 A;  2VNO A;  4FPF A;  2ARB A;  5FIX A;  1C3H A;  2WO3 A;  1HRV 2;  4DEV A;  3EB7 A;  3KVA A;  5F1R A;  4CDW C;  1MS8 A;  2VUC A;  1HLC A;  1ND2 A;  4QGM A;  1HB3 A;  1UIJ A;  4DNY A;  1FT9 A;  3OCP A;  1R64 A;  3AMH A;  4QHB A;  2HWE 1;  1RUD 1;  2R07 3;  1QOT A;  4JGZ C;  4MGI E;  4KWL A;  1ULG A;  4Y3O A;  3ZR5 A;  3ATG A;  5E88 A;  1DGL A;  3VHR A;  2WNU A;  4AQ6 A;  1QY4 A;  2VOW A;  1WCU A;  3PIJ A;  2GH2 A;  4KGG A;  4AI3 A;  2WZR 1;  1Y43 B;  2VZO A;  3AZV A;  3EXU A;  1VRH 1;  5CNA A;  4H3W A;  1SLT A;  1PIV 2;  3THD A;  1QH7 A;  4YVS B;  4RYD A;  3TOJ A;  5C8C A;  5T52 A;  3NJZ A;  4CDW B;  4R4Z A;  3B69 A;  2HWC 1;  2JWP A;  1H8V A;  3HIF A;  3WV6 A;  5LA2 A;  2J1A A;  2WDB A;  2DUQ A;  3T2P A;  3NRU A;  3VHO A;  1SPP B;  1D4M 3;  4JGZ B;  2RE9 A;  5L7O C;  5GLZ A;  1ULE A;  3BPZ A;  2N7G A;  4WM8 A;  4CDQ A;  4K9S A;  5D21 A;  4TLF A;  1AL2 1;  1VE0 A;  3DF0 A;  1DDL A;  1R08 3;  1UYZ A;  1J59 A;  2D3R A;  2VQA A;  1HQW A;  3IB3 A;  4UFK A;  4E4H A;  5A3M A;  4E4D X;  5HCA A;  1G9D A;  3ZYJ B;  4O65 A;  2HBT A;  3AMQ A;  2DWR A;  4CCN A;  1KRI A;  2VR4 A;  4CXW A;  4ONU A;  4FPH A;  1PO1 1;  1CZT A;  2CYF A;  2Q5T A;  2D3P A;  3OBA A;  4GWI A;  3WDV A;  4WVM B;  5L7O B;  4IE0 A;  3LEG A;  1RUD 2;  1US2 A;  3FUQ A;  5FO7 B;  4UFH A;  2DVF A;  2ZEX A;  3III A;  4Q4Y 3;  1G8W A;  4CEW B;  3VKF C;  3POS A;  3H1W A;  3UJO A;  1NG0 A;  2CGO A;  3IIA A;  4OQ9 A;  3WG3 A;  4AFB A;  2WZR 2;  1I9R A;  1LR5 A;  1LJ7 A;  1VRH 2;  4D3W A;  1MS0 A;  1JHN A;  5LEJ A;  3BIE A;  2JIG A;  2HWC 2;  1QXJ A;  3AYD A;  3OOX A;  1REE A;  3H50 A;  3D82 A;  2R06 3;  1NA1 A;  2RS1 3;  3GDB A;  3ZFG C;  4XZU G;  3GM8 A;  1U12 A;  2XML A;  4Y1X A;  4CZS A;  2PHD A;  3SKJ E;  2A6X A;  1WGP A;  3USU B;  4H2A A;  2GMM A;  1CAU A;  1XSQ A;  4KQ7 A;  4YVW C;  5A3O A;  1HRI 3;  4DUV A;  2VG9 A;  2F6B A;  5EWS A;  2VCA A;  2YV8 A;  3BOD A;  2Y38 A;  1NCQ A;  3OGJ A;  4MGY E;  5DDJ 1;  5A3W A;  3MUY 1;  1ZZC A;  2PHL A;  3KF5 A;  4RGK A;  4LUM A;  2ZMN A;  4S2D A;  1WA4 A;  1PO1 2;  1YFY A;  5JSR A;  1ODN A;  5BYN A;  3POF A;  1W8T A;  4MV2 A;  3PUS A;  2R0H A;  5A7W A;  3ZFG B;  1BHG A;  3JXS A;  2DUP A;  3O1S A;  3RYR A;  2VCC A;  3RNS A;  4CE8 A;  3MPP G;  3VZL A;  4LXL A;  4F83 A;  4HSJ A;  3WT3 A;  1TE1 B;  2VQU A;  4YVW B;  3T09 A;  4R9A A;  4J6G A;  4QXK A;  1UPS A;  2Q4S A;  2ZJC A;  1OQ1 A;  5FK7 A;  3MW3 A;  3TEY A;  3WG4 A;  5LW9 A;  5C70 A;  1ACC A;  4E2Q A;  2XWJ B;  4DMI A;  2UYB A;  4UW6 A;  2AR6 A;  1JYX A;  2XJS A;  1MEC 1;  1XC6 A;  3K2O A;  5BNN A;  4LKF A;  1WZX A;  3VL9 A;  4L97 A;  5L36 A;  2R0F A;  1EAH 1;  5KC5 A;  2JG8 C;  1C8M 3;  3LFI A;  4R8H A;  3RGB A;  3KT4 A;  1AJK A;  4LK7 A;  5IW0 A;  2HYK A;  3UKT A;  4AYU A;  5CIS A;  1E57 A;  5GZG A;  5CKN A;  3Q8B A;  1OFS A;  1QJF A;  4OYU A;  1RUF 2;  5F5A A;  4QQH A;  1H1A A;  2PHF A;  2I2S A;  3C7G A;  1BBT 1;  3MDP A;  2ORX A;  3ON7 A;  5DDJ 2;  5EJ1 B;  3T0A A;  2KA3 A;  1O59 A;  1GZW A;  2JB8 A;  2Y8K A;  5HCB A;  3RJR A;  1G7Y A;  1RJ7 A;  4F8A A;  5BV6 A;  1XNA A;  4AWD A;  5FUP A;  2VUD A;  3BTZ A;  2VUL A;  3PJY A;  4P9W A;  4XJA A;  3FHI B;  3T1M A;  1C5I A;  2GC1 A;  3SCH A;  3S30 A;  1W05 A;  4COV A;  4ATE A;  1EUT A;  2XGX A;  2XKP A;  4NWV A;  4C0B A;  3E1F 1;  2JD4 A;  5FZE A;  2BDR A;  4EN7 B;  1FMD 3;  1ZX5 A;  4JDN A;  4Q4V 1;  3UES A;  1UX7 A;  3D6E A;  4LKD A;  4LOR A;  4HK8 A;  1XYP A;  1YQ2 A;  1JZ6 A;  2CAV A;  3LCP A;  3RWK X;  3BI3 A;  1MEC 2;  3BPS A;  2WR9 A;  3DYO A;  5CKM A;  5LBF A;  1RUG 2;  4B7E A;  3O1U A;  3VHP A;  3MFA A;  3IT8 A;  2TEP A;  1FV2 A;  1YFW A;  3AFG A;  4IUG A;  1EAH 2;  4CDX A;  4K7J A;  5JR7 B;  1ZBA 2;  2GC2 A;  2Y6F A;  5AVP A;  5FY4 A;  4D6Q A;  3D0S A;  2EIC A;  4YW3 A;  3IDB B;  5KHK A;  4QAW A;  4IE4 A;  3MUZ 1;  3WQ0 A;  4LIT A;  4Z8B A;  3GHN A;  3MFC A;  4QU2 A;  4BLJ A;  3R0R A;  4NPL A;  2NMO A;  4A3X A;  3ZXG A;  1WMX A;  1BBT 2;  3BAL A;  2NM1 A;  2C9A A;  1W04 A;  4FFF A;  1ODM A;  4P9X A;  2A73 B;  1N3P A;  1XPW A;  1LNS A;  5I8Y A;  5A33 A;  3J26 N;  2EVX A;  3ZYB A;  2E9Q A;  1IG3 A;  2CWS A;  2O8Q A;  1IHM A;  4YPJ A;  4XFF A;  2Q8D A;  3T2Q A;  1REF A;  1Y9Q A;  1QJX 1;  1GZT A;  1KD7 A;  2RJK A;  2RMU 1;  3I3E A;  4KWK A;  3AXD A;  4Y4Y A;  2WT0 A;  3U10 A;  1V00 A;  1BMV 1;  1ENR A;  4Q4V 2;  1JU3 A;  4HFS A;  2ZKN A;  5FYH A;  1LCL A;  3VHN A;  4UFI A;  4GAL A;  3ROU A;  3RG0 A;  1W8Z A;  1JZ8 A;  4XFH A;  2VXJ A;  2C26 A;  2CAU A;  4N53 C;  4OUL A;  3ZXJ A;  3K77 A;  2OQ7 A;  2BEO A;  2C24 A;  4RHV 3;  4GMP 3;  3NNG A;  4QXC A;  4R9B A;  3RQ0 A;  1UMH A;  4KL1 A;  1V0A A;  4J25 A;  4GWJ A;  1XJA A;  2OPK A;  4K21 A;  1TMF 1;  4M3C A;  4IER A;  1N1T A;  2XWB B;  4XJZ A;  1DU3 D;  1ZRD A;  1ZVF A;  1APN A;  1NXM A;  2PN5 A;  3HWJ A;  4YVS A;  5T5O A;  4A3Z A;  4XBL A;  1MS9 A;  1DYO A;  4N53 B;  1UYY A;  5GAL A;  2OYZ A;  3M7A A;  3U4S A;  3JU9 A;  4CDW A;  1VLN A;  3VBH C;  3I59 B;  3LSD A;  5B4N A;  4PBP A;  1W28 A;  1DGR A;  3K4Z A;  2VZR A;  4IEW A;  3VD7 A;  1JZ4 A;  1SPP A;  2DTY A;  1QJX 2;  2RMU 2;  1LHU A;  3OEB A;  2XG3 A;  2VVE A;  4I3P A;  1LHO A;  1QXP A;  2E7T A;  1RUC 1;  1BMV 2;  3AMM A;  1UIK A;  2W52 A;  2O14 A;  5FXX A;  4BK4 A;  4MYE A;  5LEK A;  3NNJ A;  5DMY A;  1E5R A;  1PGW 1;  2BGP A;  4Y22 B;  5FP3 A;  2DVD A;  3R6S A;  1UXZ A;  1D0H A;  1KEX A;  2BYV E;  4IES A;  4DFS A;  4XUQ A;  1HN0 A;  4XBN A;  3VBH B;  2C6S A;  2A3Y A;  2ZEZ A;  3VBR A;  1RUH 1;  1Z7S 1;  2QDN A;  3TNQ A;  4NIH A;  4MOA A;  4WVM A;  5L7O A;  3U11 A;  2EAK A;  1UY3 A;  2HKX A;  4X8P A;  3O0X A;  4CEW A;  3J8F 2;  4NPR A;  4XOG A;  4A44 A;  2MHF A;  5L9V A;  2X05 A;  4AVB A;  3RZL A;  5CEH A;  3LF7 A;  3NL1 A;  4D8M A;  5J7M A;  4AI2 A;  4HKL A;  4OZX A;  5I0D A;  2WT2 A;  3H9A A;  4FPC A;  3I2O A;  1S1A A;  2LRO A;  1U0A A;  5FPA A;  3NMB A;  2LS6 A;  3AMN A;  2MEV 1;  1ASJ 3;  1SEF A;  3MIC A;  3QOP A;  4P14 A;  3I2G A;  1W6O B;  1ENX A;  1LGN A;  2JKX A;  3ZOI A;  3T0D A;  3H1Y A;  1G9F A;  4EYU A;  3T30 A;  4B1M A;  1GNY A;  2B39 A;  1NQD A;  1FYU A;  1HJG A;  2P3Y A;  2JDM A;  3GCW A;  4YNI A;  4RGA A;  1RUC 2;  1H6Y A;  1XSR A;  4OMC A;  4DB5 A;  1HJF A;  2HWD 1;  4LOT A;  5FY9 A;  3AB0 A;  5EYY A;  1AVB A;  1PVC 3;  1W03 A;  2PYT A;  2VPV A;  4HG6 B;  5APA A;  5FUN A;  2GP5 A;  1JH5 A;  4JRL A;  4CU7 A;  5K0U C;  1H8T A;  2DBI A;  1QQP 2;  1YQ8 A;  3T2O A;  1UU5 A;  4GJY A;  2R7E B;  3LB9 A;  3OUH A;  4TSV A;  3ZN5 A;  1RUH 2;  1Z7S 2;  4KH9 A;  2QQU A;  5BPX A;  1OLM A;  4XCB A;  4AFD A;  1GP4 A;  2PXJ A;  1LES A;  2WQ8 A;  2VZS A;  3SH4 A;  3AZZ A;  3O12 A;  3QD6 A;  4FFH A;  4L8Q A;  5C9A C;  4UYB A;  5C33 A;  3TEW A;  5BXX A;  3SIS A;  3C7H A;  4PLN A;  4AI9 A;  1HN1 A;  4YVW A;  2OQ6 A;  1BZW A;  1XOY A;  3LDR A;  3HQX A;  1BVV A;  5FYZ A;  2D6O X;  2R1B A;  5K0U B;  5HI0 A;  5FJH A;  1QOS A;  2VY0 A;  2JIC A;  2YG0 A;  4QT6 A;  5EQU A;  4IEO A;  5BNO C;  1UD1 A;  3V0A B;  1QXR A;  3A21 A;  3HQR A;  4Q4W 3;  1B09 A;  1OC1 A;  1QOO A;  3MLJ A;  2FQP A;  3RVH A;  3ZSJ A;  5JLV A;  2XLF A;  1N1Y A;  5CG9 A;  1GNZ A;  2YPD A;  2NPI A;  2HLE A;  4JGY C;  4NPM A;  3ZYP A;  3QCW A;  1SBF A;  1G9A A;  3OUI A;  5EHD A;  1AR6 1;  5C9A B;  5KXB A;  1UOJ A;  3LD8 A;  3PHM A;  1URX A;  5FKC A;  1BKZ A;  2VVD A;  1FNZ A;  4QGL A;  3PUH A;  4RN5 A;  5GLV A;  3P3N A;  5GM0 A;  3ZXA C;  2RS3 1;  5B2G B;  3VD4 A;  5EP9 A;  1ZBE 3;  3POY A;  2OZJ A;  4FOW A;  5BNO B;  2VBB A;  4MLO A;  5J09 A;  4FBF A;  3J4U H;  5D1I A;  2EIE A;  3G6J B;  2BGC A;  1V6J A;  1AUY A;  2ADD A;  1DLC A;  1EYB A;  4R52 A;  1OQE A;  4JGY B;  1PK6 C;  1UN1 A;  2QDR A;  4PQ9 A;  1RVF 1;  1BYH A;  2X5I A;  2F17 A;  5FZ8 A;  5IAX A;  3INA A;  2NMN A;  4NRM A;  1EPW A;  2AC1 A;  1XNT A;  1O4Y A;  2C5D A;  3QAC A;  4TWT A;  4JTN A;  4L0P A;  3LKJ A;  2HWE 3;  2VOK A;  4MZU A;  1DQ2 A;  4XQ4 A;  4JDM A;  5LWB A;  5JSO A;  3BU0 A;  4Q2F A;  2WC2 A;  1ND3 A;  3OPT A;  3KWV A;  5IK4 A;  2ZMK A;  2IXH A;  5IK5 A;  1J1L A;  4ZPI A;  2XHN A;  5DQ0 A;  3RZJ A;  5CU1 A;  4AVA A;  5K9Y A;  4BMB A;  3ZN6 B;  4Y1Y A;  4AVV A;  1M4W A;  1PK6 B;  1VRH 3;  2VQT A;  4NUB A;  5C7G A;  4N90 A;  4LBN A;  4MUV A;  5I91 A;  3N7J A;  4LK6 A;  4ZS3 A;  4CEY B;  4IV3 C;  1AR6 2;  1PX4 A;  3F95 A;  2HWC 3;  1MQT C;  5FZD A;  5SV5 A;  1VBB 1;  1V9U 1;  2Q1Z B;  1S0G A;  2ZHK A;  4Q0S A;  3AX4 A;  3C2U A;  3O0V A;  3OGV A;  2OUH A;  5CVR A;  5JR2 A;  1K12 A;  2XBO 1;  1AL0 G;  5EFU A;  3WNK A;  5J3U A;  2W91 A;  1JS9 A;  4KG0 A;  4P9Y A;  4XFA A;  1W06 A;  3SIT A;  2XB6 C;  5LAS A;  5FYT A;  1H2N A;  4HMZ A;  5FP4 A;  1AL2 3;  4TN7 A;  1A8D A;  2W1Q A;  4XUN A;  2GU9 A;  3T08 A;  5LRR A;  2YMZ A;  4LMF A;  2WN3 A;  1NCR A;  4LOS A;  2SBA A;  4FAH A;  1AXZ A;  1MZF A;  3AK0 A;  3A0K A;  4IV3 B;  5JXH A;  4C91 A;  4IE5 A;  1F35 A;  2BNM A;  1U5I A;  4DZG A;  1MQT B;  1HIX A;  4LBQ D;  4HKO A;  2VO5 A;  1DZQ A;  2VU9 A;  4O9G A;  4B4P A;  4BXS V;  3WHU A;  5J37 A;  4A7Y A;  3O7O A;  5CFC C;  1CAX B;  1S2B A;  2Z5W A;  4XEZ A;  4MXW B;  4HN0 A;  4K3U A;  1ZA4 A;  3TYJ A;  3AJZ A;  4ORF A;  3LGR A;  3ASI A;  4Q0P A;  2OZ6 A;  4BPZ A;  4I0B A;  2VEC A;  5IFP A;  1O3T A;  1LHN A;  2PHU A;  4HN1 A;  5JVV A;  2EXH A;  1Q3E A;  3CHX A;  3JCI A;  3O14 A;  4CP9 A;  2YC2 A;  4QPI C;  4I0W B;  4IEP A;  4FPK A;  3OD0 A;  3WNN A;  3CLP A;  1VBB 2;  1V9U 2;  1MR5 A;  4UAP A;  1JW6 A;  2JE7 A;  5CFC B;  2XBO 2;  3EJK A;  3O5S A;  1E5S A;  1NQJ A;  3E6B A;  5KBF A;  5A1L A;  3OBZ A;  4XQW A;  4DO0 A;  1VBC 1;  1UKR A;  3NNF A;  3S7E A;  2ZA9 A;  5ABJ C;  5IVJ A;  5KXD A;  2IXC A;  3M3O A;  3WVJ A;  1JUH A;  4URT A;  5FAX A;  2WZP P;  3GZU C;  3WNO A;  3ZFF C;  3IMN A;  4RS5 C;  4UOJ A;  3I59 A;  2BWC A;  3HNM A;  5IYY A;  1OH3 A;  5DAX A;  4QPI B;  1PVX A;  3M8L A;  3OBR A;  1EUU A;  4XPV A;  4ZZ5 A;  1NYW A;  1RMU 1;  3BU7 A;  4CU9 A;  1DIW A;  3EHK A;  4LUK A;  3DGT A;  2ZGU A;  4GWN A;  1N1V A;  2WWJ A;  1SBD A;  1SLL A;  2NQY A;  4YSF A;  1ZM1 A;  4IE6 A;  1YQ5 A;  3VBO C;  1QKQ A;  4DRV A;  4Y22 A;  4QWN A;  1VBA 3;  5ABJ B;  3JQW A;  2ZCW A;  2YBP A;  3MID A;  1FOD 3;  3S6P A;  3AYE A;  4V2W A;  4RS5 B;  5JPM B;  3VBH A;  4C8D A;  2X8K A;  4K8R B;  3I97 A;  4CCD A;  3AKT A;  3ZKY A;  2NLR A;  1WLD A;  3RYK A;  3CIH A;  3TRS B;  3U78 A;  5JWP A;  3WNL A;  5CZK A;  4AFM A;  2JJ6 A;  1G6N A;  1MEC 3;  2RDS A;  4HK9 A;  4W50 A;  1U5Y A;  2HEW F;  4E8D A;  5ACA 3;  1Q5O A;  1WBF A;  1EAH 3;  3PNA A;  1ULO A;  1WCK A;  1RUI 1;  4K1Y A;  1CAV B;  2BQP A;  4QB1 A;  3LA7 A;  4PJY A;  2GME A;  2GC3 A;  3GF6 A;  4AE2 A;  1C4R A;  4NMI A;  1OUS A;  4A4A A;  3B5L B;  5I0S A;  2HEY F;  5FZB A;  1CGP A;  4KBZ A;  2CWM A;  5L73 A;  4EZH A;  4NAM A;  2ZX3 A;  1J84 A;  1CX4 A;  1W3X A;  2W46 A;  1BBT 3;  3B93 A;  3ITQ A;  1QJY 2;  1VAL A;  3MGU A;  4Y1U A;  3RZG A;  3H8U A;  3LFM A;  5E6H A;  2J1S A;  3S0M A;  3E6D A;  2KD7 A;  2JX9 A;  2A7A A;  1IZ3 A;  4BQ5 A;  2TNF A;  2VCM A;  2ZX1 A;  3W20 A;  1UZV A;  4PCR A;  1W39 A;  3KCC A;  1R1Z A;  1HXS 3;  3VKO A;  1LHW A;  4ZU5 A;  1KFU L;  5HCF A;  4AFA A;  1F5F A;  1LEN A;  1L7Q A;  1UOB A;  1W6N B;  1DGR N;  2VC9 A;  4IV1 B;  3WNP A;  5DZE A;  3N7L A;  2ADE A;  2D6K A;  2YHJ A;  3WF0 A;  3IPV B;  1A34 A;  4Q4V 3;  3D4K A;  2UUR A;  1W3V A;  1I6X A;  1KJL A;  4XXP A;  3WNX A;  3RJ2 X;  1QHD A;  5IVB A;  3LOI A;  4FXK B;  4Z1V A;  4PLM A;  2JE8 A;  2JEM A;  3KGL A;  4QDR A;  5KHG A;  1IS5 A;  3WDU A;  3ZO0 B;  1PO2 1;  1PZ9 A;  5F3I A;  1Q8O A;  4MGK E;  2NP0 A;  4P08 A;  1VIW B;  2VTF A;  1VBE 1;  3R4U A;  2WNV C;  3DL3 A;  5H9R A;  4WM7 C;  3KQR A;  4W6W A;  4HVQ A;  3BB6 A;  1W8O A;  4PQQ A;  4AI8 A;  4WVW A;  3B9I A;  2E26 A;  3N9N A;  3VBS B;  5K7P A;  4K20 A;  2Q8O A;  1HRV 1;  2NZ9 A;  4P5Y A;  1LOE A;  2G19 A;  4ASL A;  3V0A A;  2DU0 A;  4GH4 C;  4TTG A;  4YM1 A;  4AGV A;  5AVA A;  3PMS A;  3IDE A;  5F8P A;  1GKB A;  4W65 A;  4LTA A;  2CL2 A;  4AGR A;  5JCT A;  1LOF C;  1LKN A;  3SHR A;  2AYH A;  1IS6 A;  2GAU A;  4BA6 A;  4XMI A;  1OBN A;  4DS0 A;  3FC0 A;  5C9A A;  5K8S A;  5GLT A;  3Q8C A;  1OF3 A;  5LA9 A;  2X10 A;  4XTP A;  2PQS A;  3IN9 A;  5AFE A;  4AVS A;  2WNV B;  5C5T A;  5CFD C;  4LKS A;  3WQ1 A;  1OMI A;  1QJX 3;  2NYY A;  5DZG A;  4CCJ A;  3OBT A;  1BK1 A;  4DRR A;  1IPK A;  1I1E A;  5BY5 A;  4FXG B;  1M06 G;  5C6C A;  1NE4 A;  3WG2 A;  1AR9 2;  2W47 A;  5A7P A;  4NHX A;  5J48 A;  4K1Z A;  1XNB A;  3PME A;  1XQN A;  4OCT A;  2TBV A;  4FO9 A;  2ID4 A;  4H55 A;  1JYI A;  2WII B;  1IS3 A;  5FR3 A;  1PO2 2;  3NNM A;  2JIJ A;  4QPY A;  3GGL A;  5GZD A;  5CFD B;  1AYN 1;  4YWA A;  1OA3 A;  1C57 A;  1OXC A;  2DTW A;  3ES1 A;  2WKK A;  3I2D A;  4Y33 A;  5F37 A;  3OGG A;  4P9J A;  4GJZ A;  5M0T A;  1CD3 G;  4TYS A;  1TMF 3;  2Z4F A;  3WW4 A;  2XL7 A;  4Q4X 1;  3ZN6 A;  1PK6 A;  1UU6 A;  1S4C A;  2IUW A;  3M2M A;  3PU8 A;  3NJX A;  1LOD A;  1L7R A;  4AW7 A;  1VAM A;  4CEY A;  4E8C A;  3N4M A;  1HB2 A;  1S0B A;  1UAI A;  2OA2 A;  4JKK A;  4LJH A;  3POG A;  4B8E A;  4YW6 A;  3VDD C;  4ATF A;  3WY6 A;  3KHB A;  4XET A;  4ERO A;  5T5P A;  3APB A;  4GAZ A;  1X9T A;  2WYS A;  3KLS A;  1VP6 A;  4QX0 A;  5G05 L;  2RVA A;  4SBV A;  5I0T A;  2B7Y A;  1DGW A;  3D0J A;  3U1X A;  2RR1 1;  1LOA A;  3TN9 2;  4JTO A;  1MZ6 A;  4BU2 A;  1FPN 1;  2V09 A;  4YW2 A;  5FDB A;  1GLH A;  2QCS B;  1UNB A;  2WFF 1;  3GYD A;  4C0H A;  1RYY A;  2Q8C A;  1RUJ 1;  4YAR A;  1Y9G A;  5F2S A;  4AOC A;  4LPL A;  4IV3 A;  5LZ6 A;  4MGS A;  3VZJ A;  4Q8L A;  1V6L A;  3ST7 A;  4AL9 A;  3VDD B;  1W6Q B;  1Z7S 3;  3WNM A;  3ETQ A;  1BCX A;  3A7Q A;  1AYN 2;  2G9G A;  1CAX A;  1WW4 A;  2A6W A;  3KSC A;  2LRP A;  5IVF A;  2VH9 A;  3K3N A;  5G04 L;  1LEM A;  3WZ1 A;  4JDO A;  3GAL A;  3KV9 A;  4AHW A;  2ZX4 A; 
#chains in the Genus database with same CATH homology
 5FYU A;  5IVB A;  4HON A;  2GP5 A;  5FUN A;  3PU3 A;  4GJY A;  2XML A;  3K3O A;  5FP7 A;  5FYM A;  4CSW A;  5FYS A;  2Q8D A;  5F3C A;  5F3I A;  5FXV A;  2PXJ A;  5FZA A;  5FZ4 A;  5FXZ A;  5FYY A;  4D6S A;  4IGQ A;  5A7S A;  5FZ0 A;  5A3W A;  3N9N A;  5F3G A;  4UF0 A;  5F5I A;  5FYH A;  5FYV A;  4AAP A;  4AI9 A;  5FY5 A;  2OQ6 A;  2YU2 A;  5FBJ A;  5IVC A;  3PUS A;  5FYZ A;  3PUA A;  5A7W A;  5IVY A;  3PDQ A;  5FJH A;  5IWF A;  5FY7 A;  5FZG A;  5A1F A;  2GP3 A;  2YBS A;  2OQ7 A;  3N9Q A;  4UF0 B;  3DXT A;  4LXL A;  4ASK A;  4CUG A;  5A1L A;  3AVR A;  4QXC A;  3RVH A;  4DO0 A;  4BXF A;  5A3N A;  5A7W B;  5IVJ A;  3N9L A;  2YPD A;  4XDO A;  5F5C A;  5FP8 A;  5LW9 A;  3KVA A;  3N9M A;  4CCJ A;  5FZ7 A;  5FP9 A;  3LD8 A;  3N9O A;  5A7Q A;  5A3P A;  5F2W A;  5FYC A;  4Y3O A;  5IVV A;  3K2O A;  5KR7 A;  3OPW A;  4IGP A;  5FZC A;  5A7P A;  5FY0 A;  3N9P A;  3NJY A;  4LIV A;  3U4S A;  4URA A;  3KV5 A;  3PTR B;  3LDB A;  5A7N A;  4EZ4 A;  2P5B A;  2XXZ A;  2WWJ A;  5FYI A;  2YU1 A;  2OT7 A;  5IW0 A;  4CCL A;  5FY8 A;  3KVB A;  4DIQ A;  4QWN A;  5FZL A;  2YBP A;  5F32 A;  5F5A A;  4V2W A;  2XUE A;  5FZK A;  5A3T A;  5FZ8 A;  4BIS A;  5F3E A;  5FXX A;  4C8D A;  4Y33 A;  5FZ6 A;  5FWJ A;  5FXW A;  5F37 A;  4GD4 A;  4QU1 A;  4CCO A;  5IVE A;  4GJZ A;  5FP3 A;  3U78 A;  5FJK A;  4HOO A;  2Q8E A;  4QXH A;  5FV3 A;  5FWE A;  5A7O A;  5FUP A;  5FPL A;  4QX8 A;  5LWB A;  4IGO A;  3PU8 A;  2YBK A;  2OX0 A;  3KV6 A;  5FPU A;  1VRB A;  3OPT A;  5FY1 A;  4E4H A;  5FZE A;  5LY1 A;  5FZH A;  4LIU A;  5FZI A;  4CCM A;  2W2I A;  3AL6 A;  5FPV A;  4CCN A;  4NUB A;  5FZB A;  2XDV A;  3AL5 A;  4GAZ A;  2VD7 A;  5FYB A;  4D6R A;  5F39 A;  5FZO B;  5CEH A;  4EZH A;  4Y4R A;  3UYJ A;  5FZD A;  5FP4 A;  5FZ1 A;  5A80 A;  4BU2 A;  3PUQ A;  3ZPO A;  5K4L A;  5E6H A;  3AVS A;  2Q8C A;  5FPA A;  4CCK A;  5F2S A;  5FZ3 A;  2WWU A;  4XDP A;  5FYT A;  2OS2 A;  5LY2 A;  5FY4 A;  4TN7 A;  4D6Q A;  4QX7 A;  3PUR A;  5FZF A;  4EYU A;  4LIT A;  3ZLI A;  5FZO A;  3KV4 A;  5ANQ A;  5FZ9 A;  5IVF A;  3K3N A;  4QXB A;  4V2V A;  5FY9 A;  3DXU A;  5FPB A;  5ISL A;  5FZM A;  3KV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...