5A7QA

Crystal structure of human jmjd2a in complex with compound 30
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
351
structure length
351
Chain Sequence
SESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Docking and Linking of Fragments to Discover Jumonji Histone Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
total genus 109
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a7qA01
5FPBA 5A7NA 2XMLA 5ISLA 4Y33A 5FZHA 5A7PA 4AI9A 5A7SA 3AL5A 4D6RA 4V2VA 5IW0A 5FPUA 3K2OA 5FPLA 5E6HA 5FY0A 4CCJA 5FZCA 2GP5A 5FZIA 5FZOB 4D6SA 5F37A 3ZPOA 3PTRB 4ASKA 5FYTA 5FZKA 5IVBA 5LY1A 4GD4A 2GP3A 4QXCA 4QX7A 4XDPA 5FY7A 5FPAA 5FYCA 5K4LA 5FZ9A 4UF0B 5FUNA 3AL6A 2XUEA 5ANQA 4BISA 5FZ1A 3KV9A 3KV6A 3N9MA 4C8DA 4CCMA 4Y3OA 5FZMA 5FZEA 5FXVA 5FYZA 5FY9A 2P5BA 5FBJA 5F5CA 4NUBA 2YBSA 3N9LA 2VD7A 3KVBA 5FXXA 4DO0A 5FPVA 4V2WA 2WWJA 3KV4A 5FP8A 4BXFA 4QU1A 3LDBA 5FZ8A 4Y4RA 4HONA 4GJZA 4UF0A 4LIUA 5FP3A 5FY1A 5FZ4A 3DXUA 5FZ6A 5LY2A 4LIVA 4BU2A 5A80A 5A7OA 5FP9A 5FYYA 5IWFA 4DIQA 2OQ7A 5FXZA 5A7WA 4QX8A 2YU2A 2OS2A 2Q8CA 2Q8EA 2YPDA 3PURA 5FJKA 5F5IA 2WWUA 1VRBA 3AVRA 3NJYA 5FV3A 5F5AA 3PU8A 3DXTA 2OT7A 5IVVA 5FYSA 2Q8DA 5FY4A 5A3NA 5FYMA 2OX0A 5IVEA 5IVYA 5FZBA 4EYUA 5F3GA 2XXZA 3RVHA 5FWEA 4GJYA 4QWNA 4D6QA 4CUGA 3U78A 5LW9A 3UYJA 4IGQA 5FZ3A 3U4SA 5FWJA 5F39A 5FZ7A 5FUPA 3N9NA 3PU3A 5F2WA 3N9QA 5A3TA 5FP7A 5FZFA 4GAZA 4XDOA 3OPTA 4CSWA 5IVJA 2YBKA 4QXHA 4IGOA 5A3WA 4AAPA 5CEHA 4EZ4A 2OQ6A 5FYIA 4CCKA 5FYBA 5F3EA 3K3NA 4LITA 5FYVA 3LD8A 5F32A 5FZDA 2YBPA 4EZHA 3KV5A 5FZGA 3KVAA 5FZAA 4CCOA 5A7WB 3PUSA 5FZ0A 5FYHA 5LWBA 5A1LA 3PUQA 2PXJA 3K3OA 5FP4A 4HOOA 3AVSA 5A7QA 4URAA 5FY8A 5F2SA 5A3PA 2XDVA 5A1FA 5FJHA 2W2IA 5FY5A 3PUAA 3PDQA 4LXLA 4CCNA 3OPWA 4TN7A 3ZLIA 5FZOA 5IVFA 5KR7A 2YU1A 3N9PA 4IGPA 5FYUA 4CCLA 4E4HA 4QXBA 5F3IA 5F3CA 5IVCA 5FZLA 3N9OA 5FXWA
chains in the Genus database with same CATH superfamily
4UBGA 4NIHA 5D21A 5ISLA 5FO8B 1JZ2A 2P34A 3MLJA 2BFUL 3WW2A 5HBAA 5FPUA 2LROA 1BEV1 2X5IA 3MBWA 1MPXA 2E31A 1ZX5A 3CJIB 5FZCA 2GP5A 3O12A 3CBNA 4QHOA 3WW4A 4W8JA 3PL0A 1T6BX 4AHWA 4UFLA 5I0TA 1S0DA 3LWCA 4Q4Y1 3RYKA 4H7MA 4I09A 5JOZA 3O1MA 3MFCA 5K4LA 1UIJA 2O1QA 4CXYA 2W47A 1YQCA 3IDAA 5LA0A 3OCPA 4KI5M 3QCWA 1DYOA 4FFIA 4HL0A 4L9BA 2VG9A 4UFHA 1YFUA 1WMDA 2VUCA 2PHUA 3I2DA 1Z7S2 4MOAA 3I97A 1QJU2 2GC3A 3MIFA 4W50A 5FPVA 4AYUA 2W46A 4UW3A 4RSUA 3KV4A 1X82A 1MACA 4Y4RA 4H3WA 5FP3A 1WCSA 3AKTA 4QM8A 4XDQA 5LBEA 2O0OA 3ZXEA 2VH9A 2WNVB 5HCAA 4HVOA 2BVVA 5DDJ2 2WINB 2VTFA 3E5XA 2HEWF 2ORXA 3WV6A 1W28A 1YQ8A 2WFF2 5H9QA 4DY3A 5IHRA 4C1XA 4XJ8A 1IS6A 1KS4A 3NV4A 1AR63 2OS2A 2FCUA 4GB31 3MIEA 4IQPA 1W9YA 4A41A 5IFTA 5KXEA 1TZOA 2GC0A 3OGGA 1LEMA 4AOCA 2GNTA 2PHWA 5DZEA 5KC5A 2Y6KA 4HSJA 3JXSA 4FOVA 2Y60A 4RS5C 4J1XA 1IKQA 1ULEA 1XSRA 4QPYA 3IWZA 1U5XA 3HQUA 2DCYA 2CU5A 3V0BA 4NRMA 1YXWA 4AFCA 4KGQA 2D6LX 3AJYA 2CWMA 3CEWA 4HPKB 1BQPA 4I01A 3MI8A 4QWNA 2UU8A 3U0ZA 2Y6GA 2ZHLA 1IQAA 1O8PA 3BODA 4IE4A 1H6YA 4N9HA 1SFPA 3TN92 5EJZB 3T2OA 3VBRC 4ET7A 3I59B 3VD4A 2BOIA 3GBFA 2Q1FA 4S2FA 3LEGA 3OPTA 1AR71 4Y1YA 4Y1UA 2ZEXA 2XJUA 4LNVA 5A3WA 3URFA 1OMIA 4SLIA 5DPNA 2H0BA 2RDNA 3AX4A 5FYIA 3W21A 3ZYIB 2QJVA 4DRVA 4NR1A 4Z92B 2RJLA 3DKWA 1WD4A 3O0WA 2W52A 5DAQA 1YLLA 3SCFA 1K3IA 1IPKA 4K6BA 1RJ7A 5J98B 4NPLA 3WF4A 3V0AA 4F7ZA 1YQ6A 1CVNA 4ITCA 2YDEA 3AKRA 4N7IA 5A1LA 1OOPA 5FP4A 3ZR5A 3TOJA 3U11A 2MEV2 4H55A 2K9ZA 1UYZA 5LK5A 3PDQA 3JD72 5I8TA 1SHWB 1KQRA 1O4YA 3ZMNA 3OBZA 3EYPA 1S0IA 1K5MC 4GWMA 1VBB1 1QOSA 5FYUA 2NN8A 3ZKUA 1D2QA 1XNCA 1DQ4A 1VRH1 2V4AA 2VZRA 4OHXA 3VBUC 5LA2A 5JXHA 4NHYA 4Q4X2 1FMD3 1VR3A 1G9CA 2XMLA 1QH7A 3HNMA 3MDPA 4KQ7A 4YNIA 3SLIA 2ENRA 4AVSA 4AEMA 3NNJA 3RMYA 4IDZA 3LOBA 4V2VA 3FJSA 1UXZA 5BY5A 3WNXA 3WG4A 1UOJA 4YW6A 5I0UA 3C7OA 3VKOA 1FOD3 3GJAA 1VBA1 4XZPA 1JZ6A 2LRPA 2RMU3 2FDJA 4MGYE 5EHDA 3AM2A 4LK7A 3VBSA 2PAEA 3RGBA 4ZY9A 5HXMA 3P6BA 1AR73 2A7AA 3NMBA 3WR0A 3SKJE 1OHFA 3C3VA 5GM0A 1QNWA 2E26A 3C2UA 4CA9A 1GWMA 2J7MA 3A22A 2OPWA 1J59A 4HKOA 4FT8A 4Y3OA 5GLZA 2ILMA 1OKQA 4FPJA 5BNNB 4NHXA 2W1WA 1WUVA 2J1UA 3JUUA 2G4IA 1GICA 3HT1A 2FZ2A 1GBGA 2VQAA 5A3OA 3MUZ1 2ZX1A 1LENA 5CG8A 4GB33 1AR61 2CAUA 4Q0SA 3WQ1A 2VMIA 4YVWB 3P3NA 3WUCA 2R062 2ZGUA 5FP9A 3I3DA 1Q8VA 4Y5Z0 1UZYA 4EN8B 1D4M1 2ZGOA 4CPBD 2JE9A 3PVNA 1JYWA 2O14A 4XTMA 3NV2A 4JTOA 2WNUB 1H9PA 2XQXA 2J1EA 4XURA 3WF0A 4M3CA 3NNMA 4WM7B 1YYNA 3TB0A 4FVVA 2WT0A 1XQNA 2BBVA 1PNGA 3LB9A 1KS5A 1ZZ6A 4XEZA 2XR4A 1RUI1 3VZOA 4XC9A 3T09A 4E9KA 4YSFA 4A4AA 2VW2A 3WY6A 5JCTA 2ZOEB 2XJTA 4CXWA 1KDKA 2D5HA 3UYJA 3KQRA 1O3TA 1XOYA 3N9NA 3PU3A 3SISA 1GZCA 4WVZA 4OCTA 4NWVA 1DBNA 1QWRA 1J3QA 4XIOA 1VLNA 2WFF1 1LKNA 1R091 3M2MA 5BNPB 4PDWC 3ZYHA 3ZYRA 4M4RA 1QJZA 5DZFA 3LKJA 3J26N 5JIAA 4AG4A 5ABJB 3JQWA 3AYEA 3AK0A 4WM8A 1NCQA 4LKFA 2XONA 1EYBA 1BEV3 1VRH2 2VVEA 3ZMOA 3UETA 4JHZA 1JOJA 3V64A 5JIUA 4OVEA 2IC1A 1ZVFA 3ZO0B 1V0AA 2FMYA 1UMHA 1XJAA 1COV3 5J96B 2QQJA 2GMMA 4Y20B 5EV7A 4CU6A 5C8WA 5J48A 3FZ3A 2Y38A 5CFCB 2DVAA 5A6ZA 3V0BB 1UX7A 4LKDA 1DLLA 2WA3A 3IPVA 4Z2WA 1MS8A 5FZLA 4CEWA 5F5IA 2Q0AA 3LEMA 4PIXA 3MO4A 1JW6A 2E6VA 1N1SA 1UYPA 3PJYA 4FPLA 4NIIA 4Q29A 1ACCA 4BCUA 1GR3A 2JG9A 1CAUB 3J8F3 2ZPXA 3E6CC 2PAMA 1W6OB 1OI6A 2D6MA 1IS3A 4F3JA 3GNEA 1V6IA 4XCBA 4GIQA 1W8NA 4D0QA 1CX1A 5IUQA 4B1MA 1SEFA 4A42A 4MVTA 2CAVA 3UGGA 3TWIA 3H9AA 1RHI1 4M0NA 3RS6A 3S30A 1ULDA 2PHLA 3LDKA 2FBEA 2BWAA 2PA7A 1OOPB 3VZJA 3ALQA 4AQ6A 5C3OA 1AVBA 3POEA 4BYYA 3H1YA 1DGRA 1GFF2 3ACHA 3WDVA 3KHCA 2RM23 4YYOA 2JECA 1ZA4A 1H4GA 2D3PA 1HXS1 4YW1A 3WG1A 4ARYA 3ACFA 4E4SA 2P37A 1XBFA 3MIGA 4JRAA 1BKZA 1FPN3 1QXPA 2Q30A 3J7NA 4JDNA 3OTFA 4MXWA 4QQ2A 2WWJA 5H9PA 5T52A 1PO13 1AR81 1WLCA 3BU7A 4M0HA 1IG3A 1HRV3 1PGSA 1X9PA 3RNSA 1RIRA 2E7TA 2OUJA 5FLJA 4AVVA 3S57A 4PT6A 1HXS2 4LIVA 1PO23 1YHFA 3V65A 3OJBA 4YFZA 4BE3A 1UOFA 1ZZ8A 5A7OA 4HVQA 5FYYA 1NAEA 1RB8G 1PK6A 4QQHA 2YU2A 4W6WA 2A71A 4JDOA 4YLZA 1AR92 4YWAA 1W6QA 2BW8A 2VZQA 1VBB3 5C4WB 1HB3A 5FMOS 2Q8OA 3KZ4C 4DINB 1QQP1 2ZX0A 3GHMA 1H30A 1C5HA 2VUAA 2HWB2 3WQBA 2CHHA 2XLFA 1O5UA 5AFBA 4KGGA 4MGSA 1DU3D 3WHTA 1HDKA 4L97A 1OOPC 3VHNA 2XPJA 3POGA 3U14A 5LATA 3VBHA 3VZLA 2NP0A 2RS31 4WVWA 5LW9A 1QQP2 1ZZ7A 3VZMA 4DEQA 3BTZA 2C4XA 5C70A 4TYSA 4CZSA 1QF3A 4NAOA 5I0RA 2XVLA 3NV3A 4IGOA 2ZJCA 1J3PA 4QDSA 2PFWA 5LBCA 1AL21 4Q4W3 4H2AA 4A45A 2JDNA 3EMRA 4FPGA 1GQGA 5DZGA 4BM8A 1H6XA 1W6NA 1US2A 4P9IA 4AFMA 3PVOA 4MHUA 1UY1A 3SHRA 3KV5A 5FZAA 1H2NA 1LOBA 1ZRFA 4ZS3A 4LHLA 2V4VA 1R083 5JWPA 2EXKA 3OGRA 2A6XA 5DUXA 4FPCA 2WQ4A 1POV0 3F95A 3BTYA 1SBFA 4YZ4A 2ES3A 4FXKB 4HXCA 5CYYA 4YW2A 3FBYA 3NO8A 2D6OX 1UAIA 3VN4A 3TNPB 4BQ3A 3K77A 4I0WB 1SDDB 2VVDA 4LBMA 5BUVA 5EIYB 1WLTA 2ATFA 1YO8A 3N9PA 3PVEA 4QGLA 5J7MA 3AFGA 3RZJA 2DBNA 3H7JA 2KR2A 1WW7A 3IKWA 3OY8A 4LBJA 4Y5TA 3T1MA 1Y4WA 5JI7A 5BXXA 4E4ZA 3VBFA 1RVF1 2VBBA 2DF7A 3OGVA 4Q8LA 4DUVA 4WM8C 3O1RA 5CNAA 3NJZA 1W3VA 4FPYA 1Q56A 1YQ2A 4Q0VA 4CEWC 4ZS2A 2DYCA 2W95A 2LTNA 1QXRA 4IE6A 1UYYA 4JGYA 3ETQA 1GOHA 4FPHA 1Z7S3 2YGLA 4I3PA 5JOWA 3AP9A 1F5JA 1RUH1 5A3LA 1I5PA 4XDPA 5FY7A 1HLCA 1UO9A 1SACA 1TG7A 2VMEA 2JKXA 4LUKA 2BJSA 4WM7C 2ZX2A 4IV1C 2WS91 2KD7A 3H8OA 1YCIA 4XJWA 2WZEA 1HJFA 3GBGA 4GKYA 4FAGA 3OD0A 1TEIA 1RUC2 1UY2A 3MW4A 2WNVC 4IUGA 3ZXDA 5E1RA 1W6MB 1AHSA 1V6NA 2P5BA 3MZHA 2Q1MA 5HV0A 4CDUC 4MGTA 1RUE3 4NUBA 1JN2P 1OFNA 2JDZA 1JH5A 2O8QA 1NLSA 2GDFA 2JWPA 1KDMA 4QU1A 2YMZA 2ZGSA 3CDZB 2J42A 2JDYA 3Q8EA 5TSWA 3S7EA 4HK9A 3CJIA 3M3QA 3OG2A 1V6MA 1W6OA 4XFCA 1YI7A 1QKQA 4OUEA 4PLOA 2EICA 2P3KA 3FFQA 3PLQA 3Q8AA 5IAXA 4PIZA 2Z5WA 4A7ZA 2GNDA 4X8PA 1E5IA 1JYIA 1RINA 2IXKA 3POBA 1LHNA 3C7HA 1X50A 1JYTA 1UPSA 5L9VA 5FBZA 2FHRA 3BGAA 3SKVA 2WS92 3H7YA 1W03A 2HBTA 5IVEA 2VZUA 2GMPA 3L2HA 2AREA 2VZ3A 5F3GA 3WG3A 2ZAAA 2WN2A 3LOIA 1K5JA 3RYRA 2Z4FA 2GZWA 2ZCWA 2R32A 4IEVA 4PJYA 4WZCA 1OPOA 4UBHA 1WMFA 3ZFFC 3JB4C 5FWJA 4Y24A 3WHUA 4D7TA 4EWAA 1OH3A 1AL0G 1XE7A 3PVBB 4MV2A 2DV9A 2W39A 5HI0A 3RWKX 5FZFA 1FMD2 2XGXA 3RZMA 1JZ7A 2A6WA 1SBDA 1HN1A 4ATFA 1R082 2OQ6A 3AMPA 2HWB1 3HT2A 1Z0HA 3ITQA 5C5UA 3W59A 1ENQA 1S55A 3SMHA 4ISQA 3WP3A 3SNMA 4COVA 2ZMNA 5ERLA 1ZBE3 1XB9A 5M0TA 2UWCA 5FYHA 1BMV1 3A7QA 2JKBA 2QQOA 2D93A 4A7YA 3RZLA 1MQTB 2WBKA 1JU4A 2XDVA 3MICA 4XUQA 2W2IA 2BYVE 3HQRA 1LHOA 4K9SA 4Q0UA 3ORJA 4C0BA 4O9GA 3P5BA 2XG3A 5DUWA 3N3HA 1VBD2 1R1A1 1Q3EA 4E4HA 1JU3A 3PTYA 4Z07A 2XQRA 5H9SA 5A7NA 5E8AA 1WW6A 1JYCA 3JCIA 3ZN6A 5JMCA 1RUD1 2JB4A 4JDMA 3POIA 1NLRA 3SH3A 4YG3A 5A7SA 5BNOC 2JICA 4JCKA 5D8AC 1XPWA 4N43B 4YZ2A 1QJX2 1TMF1 3LEIA 3VBOC 2Z69A 5FQ0A 2VU9A 5JSRA 3T30A 2VC9A 5FZOB 4AW7A 3N7LA 1H2KA 1DYPA 1FATA 1SLAA 1Y7BA 1H8VA 3PUHA 2WL1A 5D8AB 1PO22 4YZ3A 2WNUA 1J1TA 3B00A 4OHWA 4GD4A 1J84A 4Y1XA 2J1TA 1DG6A 4QX7A 5CZKA 4AI0A 3MGUA 4LO7A 4RFT0 2PELA 3VKFC 4ZONA 2PQSA 3Q8CA 2WS93 1FPN2 1VBB2 2BVBA 1QJU3 4LBOA 3KV6A 4YVWA 4C8DA 2QQWA 2ZMKA 1WMXA 2B39A 1FYUA 4DS0A 2Q5TA 4P00B 4R4XA 1ZM1A 5SV8A 1YJLA 3ATGA 4O65A 3UNPA 4LJHA 2YV8A 3CF6E 3CZUA 1BVVA 4FQ4A 2DUQA 3G7DA 4JGYC 4NAMA 2YHJA 1LOEA 3HIFA 3QD6A 1K45A 1TE1B 3OYWA 3POSA 4CXXA 5F1RA 1PZ9A 4N53C 1W9SA 5CFDC 3DXUA 4TLFA 2HYXA 1GANA 5EYYA 4AFAA 4NRPA 4UXAA 1TME2 2X5IC 3CLPA 4CDUB 1S0CA 1W9WA 4QPGB 5EXOA 3H3ZA 3K51A 3WF2A 5A70A 3WDUA 2DVGA 1JOPA 4K3UA 2IUWA 5LBBA 1WCKA 1NXD1 3NJYA 3VDBA 1ZRDA 2BPA2 3DXTA 5JZGB 3WNKA 4AQSA 1T2XA 3NAPC 3B7MA 1MEC1 2ARXA 2VBPA 1NCRB 5A33B 5F8PA 1R092 3ZYGA 5I93A 5K7PA 2OXBA 2XKPA 1GOGA 2RJ2A 2RG4A 1ULCA 3LF7A 4GMP1 4K8FA 1XE8A 3RPQA 3ENRA 3R4DB 4AGVA 3EB7A 1FV2A 1F4AA 5FZ7A 1OUSA 4FFHA 1W6PB 1I3HA 2J1RA 3M3CA 5D1IA 5F2WA 3I2KA 1CR7A 4K1YA 5DAVA 4JAAA 5C9AA 1WA6X 4IERA 5L7OB 1D0HA 4Q4W1 4I3GA 3USUB 3T2TA 1DZTA 5DDJ1 4LITA 1LB2A 4YM0A 1C57A 2XWBB 3FMGA 4META 3O1UA 2R16A 3WCRA 2VJXA 3ZN4A 3AZYA 2GSYA 1UZVA 2O8OA 4XBLA 1RMU1 3T2PA 3RI9A 4BB3A 1OUXA 3NV1A 4IV1A 4QPIC 2EIEA 2ETEA 3BOPA 5CFDB 4Z1VA 4E4DX 1AR91 4WM7A 3POFA 1HN0A 4KBZA 2X5IB 2GNBA 1UD1A 4Q4V2 3UESA 3I2HA 1MS0A 4WVMA 4EJRA 3PIGA 1DQ1A 5F9TA 1QJX3 5FOJB 3FUQA 1GU3A 1V6OA 2VOKA 3VUOA 2BU9A 4QX3A 4AEJA 1GMMA 4ONUA 3ACGA 2SLIA 3BYWA 1IZ3A 1ZA7A 4M00A 1F5FA 4RL7A 1VIWB 4XACA 4AGGA 4D6RA 5G04L 1DGRN 3INAA 4Q4W2 1HRV1 1UNBA 3GF6A 5FTTC 2X05A 1PO11 3WINE 3UGHA 4D6SA 2P2KA 4DEVA 3WNMA 3R4SA 4L99A 3KF5A 3TN93 3BPZA 1HV1A 1O7FA 3KS7A 3I49A 1W6QB 4TTGA 2GP3A 3GALA 4QB6A 2Y6HA 3B3QE 1G8WA 1JZ3A 4FTEA 4HKWA 5T5PA 3F2ZA 1OF4A 1UWWA 2IXCA 3ZFEC 3RFRA 5DG1A 4OQ9A 3LSEA 1VPHA 1UPIA 5C3SA 2QQPA 3HVDA 4QKDA 3ZSLA 5LEJA 1QJX1 4OI0A 2QDRA 1JTZX 2ZA9A 4RQPC 3AKQA 4BQ4A 4EV0A 1UXXX 1TMF2 5IK7A 4RS5B 2B5HA 3BUCA 4Q4X1 2BP6A 4QXKA 3IB3A 2PLV2 1Q8OA 1QH6A 2WFF3 3L2YA 4FI9A 4CU8A 5BNQA 1OLRA 4BK5A 4IV3B 5CADA 4UF0A 1VBC3 4CPBA 3CKHA 3I2JA 3J8F1 3WG2A 1VMFA 1S0FA 4DB5A 2EAAA 1ENRA 1GWKA 3LCPA 3OEBA 4MZUA 1GNHA 4RR3B 3W9AA 4BU2A 3AMMA 4Y1ZA 2Y26A 5EWSA 4XUNA 1F15A 1B35A 3HBZA 4HFSA 1YRZA 4W65A 3RG0A 4DIQA 2FQPA 3E97A 3VBHB 5EJ3A 2JDAA 3SQOA 5F7UA 2H0VA 2Q4SA 4A3XA 5JSPA 3PUIA 1O91A 1MS3A 2Q8DA 2G1MA 2A3WA 2OA2A 1RC6A 4GMP3 1DGWA 2CV6A 2OIIA 3AB0A 4DXTA 5FRAA 2OUHA 2DVFA 4XABA 3FC0A 2ZGNA 1MEC3 2HEYF 1GZWA 1L7LA 1OVSA 5FP7A 2HWC3 4JHTA 4MADA 2W0XA 4D3WA 3OYWB 4YW5A 1U5IA 3JB8A 2ZHNA 3DCQA 2A3XA 5I0SA 4CCCA 2J22A 4JRLA 1QY4A 1RJ8A 4JZRA 1GQPA 3N7JA 4TSVA 3HPNA 4ZZ5A 3LD8A 4CDUA 3IBMA 3KVAA 4FOQA 2R072 3PUSA 1RL3A 4JTNA 2XBO1 5FZ0A 5C3RA 3WDYA 3WF3A 1DIWA 1NKGA 1PX3A 2E7QA 5EZWA 2PN5A 2CWSA 4K40A 3OEAA 1BHGA 5C9AB 5C8CB 1W04A 3GYDA 4IESA 3K48A 4IL7A 4LXLA 3FLRA 3OPZA 2UWBA 2WYFA 1XE0A 2A1XA 3LA3A 4MGIE 4B7KA 1HV0A 4Z82A 2FZ1A 2ZGRA 1BK1A 1FOD1 1QDCA 4YM2A 2JEMA 1QJU1 3AMNA 2JDHA 3VDDC 1ULGA 2K0GA 3D8CA 5J1XA 5CFCC 4UT5A 4DXRA 1C28A 1Q8SA 1FV3A 4LKEA 1LU1A 4LT5A 5FPLA 3RI8A 2EA7A 2QQIA 5E6HA 2BNOA 3U1XA 4BLIA 1FMD1 3VDDA 1F31A 3VD5A 2NZ9A 2UYBA 3RJ2X 1QXJA 2AZ5A 2E9QA 3PTRB 1H8TB 5I8YA 2RS51 5A1AA 5IVBA 2R071 5AVPA 4XETA 3ZYBA 2W5FA 4FCAA 2YZ4A 2PLV1 3THDA 5K0UA 4BQYA 1CJPA 1ZZ9A 1ENXA 5FUPA 4R9BA 2OPKA 3VBFC 1E5HA 1A78A 2PYTA 1W06A 2V5YA 4GQ7A 2IVIB 2W1QA 3ZXJA 1C3HA 4L92A 4BQWA 1ZRIA 3R05A 4PCRA 3ZXGA 4DRRA 2RDQA 4ZU4A 2WQZC 4XJUA 5FO9B 2D97A 2BWCA 1DGWX 4QDQA 1OBNA 4IEYA 1DLCA 2E32A 4LE4A 5F5CA 5DDJ3 1N3OA 5FXXA 2AUYA 3ILFA 4NIDA 4ARXA 3D5OA 5LCWL 4DZGA 1DQ2A 1D7PM 2P17A 1NYWA 2A6YA 2HWE2 1OA4A 2I45A 4KWUA 3ZN5A 2DVBA 1XYNA 2OYZA 5FY1A 2YGMA 3O0XA 4UYBA 2RMU2 2B9VA 5LASA 2HH9A 1LJ7A 2CDOA 2W3JA 2EXJA 1N47A 4QHBA 4P9WA 5A3NA 2VQUA 4IEZA 1HRI1 4AQTA 4GH4A 4RGAA 1SCRA 4EWDA 2HWB3 3AZXA 3ZSMA 4XHXA 1BVP1 1NE6A 4AE2A 2EF6A 1ZBA3 3THCA 4LA3A 4C91A 3AVRA 4XMIA 4EWEA 2VW0A 2VXRA 1K5MA 3K46A 4LR4A 5F5AA 5IT6A 1CD3G 1AYN2 1UZWA 5IVVA 2IVJA 2WT2A 3ELNA 1OVPA 1X9TA 4GMP0 4RHV3 3VBHC 5BYNA 4AI3A 2C9AA 3OBAA 1PVC3 3QLQA 5FWEA 2VMFA 4WM8B 5L9RA 2BRTA 4KU8A 4FTSA 2ZACA 1PGL1 3GZUC 3JBG1 1RUE2 3ILNA 4IGQA 4PQ9A 2VNRA 3M3OA 4XXPA 3VL9A 5CA6A 4IEQA 4DUXA 3HMYA 1SLLA 1F35A 2ZS6B 3GGLA 3MEPA 3QH6A 4HN0A 5T55A 1I5ZA 4XDOA 5CAZA 5BV6A 1VB2A 1I6XA 1MQTA 4QXHA 4NO4A 1CAXB 2J1AA 1EUTA 4AAPA 1QNYA 5A6QA 2EAKA 5FQ0B 5JLVA 1IOAA 3I3MA 3FLTA 3IDBB 5GZDA 2BUKA 3MHZA 4NVPA 1G9AA 3AMQA 4S2GA 3KMHA 4SBVA 2A6VA 3SC7X 3T08A 3A0KA 3FWEA 4RGKA 3EHKA 4YM1A 4ZU7A 3Q8FA 3IMMA 4AVBA 1CQ9A 1UX6A 3PJQA 2RDRA 4LQRA 5F2SA 3AP6A 3S5QA 3WOGA 1C4RA 3DGTA 3OB8A 5FJHA 4AVTA 1CAUA 2VZTA 3LIHA 3BIWE 5DN2A 1PVC2 2AC1A 3PUAA 4MX3A 2VPVA 1RUE1 1WZXA 2H6BA 4YGDA 5BNOB 1PX4A 4ZPIA 3LA7A 1GP4A 5EFUA 5KBFA 4BOWA 2ADEA 1H2LA 1ND2C 2QVSB 2VE1A 2GMEA 1WCQA 2R1BA 1NQJA 4OHVA 1EP0A 3W20A 4CDQC 1U5ZA 5FPBA 4P08A 3WX5A 3ZFEA 5DABA 3KCCA 2HKXA 2P4EA 1RUJ2 3N7KA 1Z7S1 2ZXQA 1VAMA 1R1ZA 2VUJA 1JUIA 3LSDA 5FZIA 3VKMA 1V9U1 4INDA 1EY2A 4Q27A 4DPNA 1WBLA 3DEMA 3CJXA 5CU1A 1V9U3 3BALA 3CO2A 5JPNB 3DN7A 1OLMA 5C3PA 4QXCA 1PGW1 1O3QA 1S0BA 3A0NA 4FXGB 4NWWA 5FMDA 4QPIA 2BGCA 5ANQA 3IT8A 4BISA 1MZ5A 4CUBA 3NW4A 1JYNA 4AAXA 2R49A 1ZRCA 3GCWA 4J25A 1GSLA 1ZBE1 5FZEA 1ZYBA 2OKXA 2XJVA 3KT4A 2PAKA 4CCEA 4OI2A 2EIGA 4PDWA 1CGPA 3WP5A 4BXFA 2MEV3 3L9JT 1J83A 4Z2AA 4NPRA 2WT1A 5L7OA 2QQMA 2WC2A 3USSA 1VALA 5IK4A 4IE7A 4FFGA 4N43A 1MEC2 3V56A 5KHJA 2G19A 2JE7A 4H7LA 1HRI3 2NMOA 1T6GC 1DQ0A 1V9U2 2WSUA 1QIQA 5JR7B 1IG0A 5IATA 3D0SA 3U75A 1JI6A 1MR5A 1ND3C 1H8TA 2D5FA 1OQEA 2Z42A 2QQUA 4LA2A 1LNSA 1PMHX 5FPXA 3VV1A 3FX3A 1UKGA 4PI0A 1W6PA 2DCKA 2DUOA 5C9AC 5FV3A 2TNFA 4AFBA 5LRRA 5B4NA 2IXHA 4PF1A 5C3QA 4G4FA 2HWE1 3HN3A 3USUA 4LPLA 2XJRA 4FPFA 2GN7A 2XXZA 4XQWA 1PVC1 2A3YA 4WBBA 4N53B 1CN1A 3I7DA 2XHKA 4RHV1 1ONAA 3U78A 2C6SA 4XXAA 1IPJA 1C8M1 5CIRA 3MFAA 1RUC1 3OGJA 4FOYA 5BPXA 3U4SA 1KFXL 1RYYA 3H1WA 1RTVA 1NA1C 2R0HA 4JVAA 5IVJA 1RUJ3 2UY9A 4IV1B 2R073 5CFDA 3NJVA 3TNQA 3WVJA 1GNYA 1XNBA 2VVFA 2QCSB 2ZEYA 2BEOA 2OZ6A 5GLWA 5T5JA 4DMIA 3VD3A 5FYBA 3TEXA 3K3NA 4C1WA 1QOTA 2PHFA 3H3UA 4XILA 4CE8A 4QPGA 5KXDA 1BCXA 1ZBA2 5FZGA 3I3QA 1UY0A 1FI2A 2JJ6A 1UZZA 2VZPA 1PO21 3CHXA 1VAVA 1U5YA 2VZOA 3HOBA 2WWSA 4B7EA 1LRHA 2PXJA 3PUQA 1IS5A 3JBG2 1AR83 5A3PA 4IW3A 1N3QA 1O6UA 4CRQA 5A1FA 2QUOA 4W4ZA 1PZ7A 2BTVC 3PNAA 4NRQA 2B8MA 1RUH3 4COZA 3B94A 4MLOA 3VB9A 2QZ3A 1IQDC 2DU1A 2X29A 3FLPA 4PI2A 1EV13 4TN7A 2WYSA 2XJSA 4H14A 4UOJA 5J09A 4KWLA 4HPKA 1K12A 3U4XA 4HG6B 4MYEA 4HBNA 5KHIA 1MS1A 3FUOA 3I59A 2XBO3 2HWF2 4XF4A 1JHNA 5IW0A 3JU9A 3Q9OA 3H3LA 3ZPYA 5BNOA 2IXLA 4O9EA 4YPJA 2WLQA 4RR3A 4W6YA 2E63A 1RGSA 4X6RB 2C1FA 3J7MA 4XBQA 3WDXA 4AEDC 4Q8KA 2IWGB 5GLUA 5J36A 5DXDA 4CYDA 2FDKA 1N1TA 3VL8A 1XNKA 5IAVA 1DHKB 2JD9A 5FPAA 4DXZA 5C71A 3O1OA 1WMEA 2Y6LA 5FZ9A 5GLTA 2JDUA 4UF0B 2GH2A 3E6BA 3I4IA 3D0JA 4MG2A 5FUIA 2DURA 2LM3A 1NE4A 2VNOA 2Z79A 4DOUA 1M06G 3GZAA 1YWKA 2XOMA 4LHKA 5FYZA 1LGNA 2Y6JA 5FY9A 2E53A 2XUMA 1Y9MA 3MLKA 5FLHA 3WDTA 4R52A 5I8SA 3VHPA 3ZSEA 2B45X 2A6ZA 4BQ5A 2ZEWA 3IDCB 1PM7A 2D6KA 3B01A 1Y9GA 1CZTA 1REFA 3ST7A 1ASJ1 5LY2A 3T1LA 4U2AA 1BLZA 2F17A 4WZFA 2DBIA 3ZFFB 3EQEA 2P3IA 3ZYJB 5GALA 2EIDA 1O3SA 1DZRA 2RS33 1CX4A 1G86A 5IWFA 2K2SA 4LBLA 3WNLA 4AVCA 1FX5A 5FREA 3UKVA 2W9XA 2WR9A 3KCXA 1KITA 4BMBA 1GKBA 1LOGA 1R093 2YUEA 3PURA 4UW4A 3LDRA 1NXMA 3IZOA 1RUG2 4LORA 4BMEA 2JX9A 3ACIA 3MW3A 3U07A 4LMFA 1BK0A 2HWC1 1POQA 1QQP3 2P3YA 2XLAA 4RQPA 5FYSA 1SLTA 5E88A 4NIAA 3VBRB 4AHZA 4F83A 2XLGA 2JIGA 3IAQA 5FYMA 3W58A 4AEDB 5FZBA 2DTWA 5FMBA 4P02B 1VE0A 1QJFA 3I2FA 4EN6B 4CP9B 1S2BA 5FZ3A 2ZX4A 4AHXA 3HN1A 5F39A 3M7AA 3J7LA 1NLQA 4M3CB 4QX5A 4XFGA 4JC1A 1A6CA 1OKOA 3NRUA 3AYDA 1V6LA 3JQXA 1W0PA 4YZ1A 4QD2A 1E57A 2WNOA 3KCYA 1W8OA 3QBQA 4O61A 5GLVA 5ACA3 1OQ1A 4RFRB 4LULA 5HV4A 1W05A 3OF1A 4Y5SA 2VOWA 4P14A 4UI9L 4GKXA 1B35B 1A8DA 4R8HA 1NA1B 5LK7B 4BWOA 3RZZA 1DCSA 4BJ0A 1AXKA 1PO12 2VBDA 1NQDA 4HOOA 3KLSA 4N7UA 4DXSA 3DYPA 1OQDA 1OPMA 4LOTA 2Y64A 3MIBA 2DCZA 1RHI3 4AF9A 1ODNA 4RHV2 5FZOA 3M4FA 1GYKA 1SPPB 4HVRA 4JKLA 4YVSA 4Y26A 4CCLA 1O4ZA 4QM9A 5JZGC 3SCHA 3QH7A 3DUIA 1AR93 3B93A 4YVWC 3N9OA 4NPMA 1IPSA 1VP6A 2J1VA 1HKDA 4K21A 4MGZE 3AL5A 1V70A 1QDOA 4NHMA 3KF3A 4RGGA 4YGCA 4PHZA 2WNUC 3KD4A 3T3YA 1YC61 3S7IA 2CGNA 3PIJA 1RITA 2JB8A 2WO3A 2WNEA 1W9FA 3B9CA 4FPOB 3ABZA 1CESA 3ZX7A 3VD7A 1AR82 1UW8A 2WZ8A 3HNYM 4A44A 5I0DA 2FD8A 2JDMA 2R30A 1V6JA 2JG9B 4XTPA 1PIV3 1W2TA 3OUIA 4CP1A 4LKSA 4ES9A 3POWA 5IYYA 1L7RA 1BEV2 1VRH3 3KB5A 2VMCA 4KG0A 1POV1 2ZEZA 3ZKYA 2ZHKA 4LOSA 4COUA 1MS5A 2AH2A 2ERFA 2W92A 3AYAA 1UOBA 4CEYA 1DDLA 1I1EA 2I07B 3NJXA 4W6XA 2VCAA 2JIJA 5EJ1B 3PHMA 2XB6C 1GOFA 4KG8A 4AR2A 4COYA 1OSGA 1NCRC 4I0AA 5FZ8A 4HONA 4GJZA 2XJQA 4XBNA 3UJQA 1RMU3 4IXLA 1TNFA 1BBT1 3J7HA 4MGQA 3VBUB 1REDA 1CZVA 5C33A 2RDSA 4CDXA 1VMJA 2DUPA 2WKKA 4GA9A 3V0AB 1GUIA 3EJKA 2YC4A 3BTXA 2RR12 3N7MA 1JUHA 2E33A 5FLIA 1ND2A 4YM3A 1MQTC 5FPZA 2PHRA 5JSOA 1OURA 5K0UB 5KC6A 2FDFA 3UGFA 1RXGA 3ZXFA 3M3EA 1JZ4A 1FXZA 1V00A 1CAXA 2VTXJ 3ZFFA 1ENSA 1JOBA 1ODMA 2QQNA 5IVYA 2WFPA 4EYUA 2JG8C 4YGEA 3WW3A 1R1A2 3PMEA 2WJSA 4GZ9A 3ZFEB 2B9UA 3JZVA 4OYUA 4CU9A 1QJY2 1LOCA 1RUG1 2CSGA 1RMU2 2DVDA 2ZKNA 3AXEA 5DAWA 2ZTNA 5FMCA 2QFEA 5C7GA 4GAZA 2ID4A 2ET1A 2WAAA 4GWJA 4QGNA 4RQPB 4AI8A 5JR2A 4DQAA 4C90A 3E6DA 1N3PA 4AEDA 3EO6A 4ORFA 5CVRA 1GP6A 4LO8A 2VMDA 1W2NA 5F3EA 4AK3A 4HETA 3HD8B 4TXWA 4CDWC 3WXPA 4E27A 4EROA 3ZXLA 4E2GA 3FFZA 4CP9A 1MZFA 2DTYA 2CGPA 4FP2A 1UN1A 3RMXA 1OA3A 4Q4V3 4Z8BA 5LWBA 1URXA 5JXJA 4JKKA 5C4WA 1HB1A 3AVSA 5H9RA 5A7QA 1CJDA 3RQ0A 1JZ5A 3B69A 2VY0A 2ZMLA 3WNOA 1NX9A 1HRV2 4XUTA 4XYXA 1RUI2 3OPWA 3ZLIA 1QHDA 4OFGA 4Q2FA 3UV9A 1CAVB 1HB4A 1OXCA 4IGPA 2A73B 1NG0A 1LHWA 2D3SA 2DFCA 3AZVA 5JOXA 2B42B 1L7QA 1ULPA 2EVXA 2VMGA 2W94A 3DKQA 5LBFA 3MF9A 2NYYA 1DQ5A 2XVKA 4BZ4A 1PZ8A 1H0BA 1KFUL 2YG0A 4R4ZA 3VGIA 1O8SA 3K2OA 5CB7A 2LUWA 2WZR1 2V5DA 4XFFA 2JG8B 1XC6A 3MUY1 3BCWA 1HJGA 5J3UA 3ZPOA 3NWKA 3M70A 5EYXA 3VDAA 2YFUA 4QB1A 1UF2C 5FYTA 2IXJA 4NN0A 5L19A 1AR62 3BN6A 2HWF1 1NA1A 4PLNA 4R9CA 5E89A 2F4PA 5JAXA 4AZZA 5L9BA 1POV3 5C6CA 1S0GA 3FN9A 1PVXA 3FHAA 2HWD3 4JGZA 4M01A 4UFIA 1BJQA 1C1FA 1OD3A 3LA2A 3POYA 3H8XA 1XXNA 3MLLA 2YROA 1O3RA 3I2IA 4EN9B 2GC1A 5DQ0A 5FZMA 3X29B 3B9IA 1LEDA 1O59A 5APAA 4JGYB 1OC1A 3HWJA 1I9RA 1OLME 2ORZA 2DCTA 2EXIA 3B5LB 2FCTA 5D2AA 3S0MA 1AF9A 2E7AA 1CAWA 3ZFGA 5C8CC 4Y1VA 1XU1A 3W5NA 4LBQA 1W8ZA 2R043 4B4RA 4NE9A 5FZ6A 1VBA2 5FAXA 3O0VA 4P9YA 3CJIC 1P8JA 1MVEA 2Q1ZB 1C8NA 2VQ0A 2RS52 1W39A 4XVHA 4C0HA 2BFUS 5F6KA 4QQLA 4X8NA 2ARAA 1LOFA 4Q1RA 2P6HA 4UFMA 5EQUA 1UMIA 5HCBA 1GZWB 3CU7A 1GWLA 3PU8A 4X6QB 3O1PA 4GWNA 3DV8A 4NJ4A 2HJIA 5LEKA 5ABJC 1JS9A 2W08A 4MO3M 5FY4A 3WQ0A 4CDXB 4JV4A 5GZCA 2OW4A 3B02A 2ZGKA 4XF3A 1OA2A 4E2QA 1JODA 1IGOA 5FDBA 4BQ1A 5C4WC 4CUGA 5FO7B 1H1IA 1HQLA 2MNGA 1YFXA 3M8LA 3SEEA 2WUHA 2YXSA 4CEYB 4LHNA 5AC92 2G9GA 2ZGTA 4XFAA 3N9QA 3CIHA 4BK4A 4R9AA 1XSQA 2NQYA 2YBKA 4XF0A 4ZU5A 4YZ5A 3NKGA 4RYDA 4DY5A 4CCKA 3FE5A 2FMDA 3O1VA 1B35C 3O1TA 5FZDA 4XFBA 4EZHA 4XF1A 2BDRA 2VECA 4QT6A 2RM22 4XHBA 4BHPA 1BYHA 5G05L 3BIEA 2Y0OA 2C0ZA 3MF6A 3DF0A 1H1AA 4PBPA 1SCSA 2BQPA 2NMNA 3EXUA 1AL22 1W9TA 3LPGA 3IIIA 2VMHA 4ZHNA 1ND2B 1Y3TA 2KA3A 3WNNA 3WCSA 1LGCA 3NL1A 3RYPA 4CDQA 3BU0A 3MV11 3C8XA 4JGZC 5JOYA 1F8VA 1C8M2 4IEUA 3ZYPA 2PQQA 4LO5B 1H2MA 5C5TA 1Q5OA 4Q4Y3 4LBQD 4LO4B 4QX2A 5FOBB 4IE0A 2WLPA 4GWIA 4QKNA 2RHPA 4HZFA 4QU2A 5F3IA 4L8QA 5CKMA 5FXWA 2ZKLA 3KGZA 4LEJA 4YRDA 3AZZA 2V73A 5FK7A 1GNZA 3ASIA 2VL4A 4LLOA 5DG2A 5A7PA 3WQ7A 1YIFA 4EQVA 2C5DA 3OBRA 3CMGA 3TAYA 1VBE3 1SDWA 1ASJ3 3THPA 2W1SA 1W8TA 4TZDA 2TEPA 5F37A 4URTA 3CQOA 1VJ2A 5KXBA 4CCDA 3IAPA 3BPSA 1TME1 2X09A 1EPWA 1Q8QA 4JKMA 2ZBJA 2PHTA 1YI9A 5T5LA 5DAPA 2JG9C 3CNAA 3RDIA 4FQZA 1FNYA 4NMIA 4AVAA 3JBG3 3DPRA 2WABA 3VZKA 5FUNA 1ASJ2 3AL6A 3A21A 2AYHA 4CUCA 2JG8A 3LAGA 2K46A 3VD9A 1W8HA 4MGKE 2XJPA 2BNMA 4CVUA 4PLMA 4QQPA 1DZQA 4UFJA 3ZDVA 5FMOL 1GP5A 2ZABA 3FL7A 5DAXA 1XU2A 1ALYA 3AP7A 1GV9A 4KH9A 5T5OA 3KQ4B 4FTBA 3DL3A 4LIUA 3JD73 4UWDA 5FZ4A 4O7XA 3VHRA 4LUMA 2J1SA 3LEKA 5LB6A 5FCCA 3VBRA 4ES8A 2VM9A 1NCQC 4HSLA 5A80A 2QNKA 1KXGA 4ATEA 2OQ7A 1ZZBA 4G3YC 4HN1A 2A75A 4KWKA 3SEPA 1W90A 2D7FA 2Q8CA 1PIV2 1OD5A 2WO7A 3C7FA 3I2GA 2BERA 4GXLA 3BI3A 3MPPG 3N35A 5CBLA 2OT7A 3LE0A 4U36A 4FFFA 5LA1A 2WDBA 2V72A 3GZEA 3BTAA 4BIOA 1HB2A 5F6LB 4OQ8A 1ZREA 4OULA 3W5MA 1W6NB 2VTXA 4XQDA 2RVAA 4XAEA 1LU2A 4BPZA 2XKOA 3ZSKA 1K42A 3D3AA 4YFWA 1EUUA 3WT3A 1UIKA 3CZJA 2F4LA 1SLCA 4ISRA 2JENA 2YC2A 1UOGA 2PLV3 2CTVA 1UL9A 1S2KA 1N1YA 4QPGC 1RUF2 4QMAA 1AX2A 1A3KA 1BMV2 1NCRA 3AJZA 4EZ4A 1REEA 2WQ8A 4AL9A 3FHIB 3ZDSA 4KNCA 3D6EA 2D6PA 1A34A 4QDRA 3WLUA 4CEYC 1BBT2 5KWRA 1SPPA 3ROUA 4YGBA 4A2UA 2LS6A 1YUDA 1Y43B 1EPZA 1UQXA 1UU6A 2YC0A 3E1F1 4Q4Y2 4OZXA 2RV9A 4DFSA 3SITA 4XFHA 2NLRA 2QZ2A 1WLWA 1QU0A 3VBFB 4EN0A 1MVQA 4MHRA 2VO5A 1DGLA 1AUYA 5JZGA 2HWE3 2CNAA 1FPN1 4QX1A 4COWA 1V6KA 2R063 3MV01 3R4UA 1PGL2 2VUDA 1ST8A 3NAPA 1WBFA 1X8EA 5E16A 5IVFA 5KR7A 4Q5OA 3ON7A 3KM5A 1F9KA 1NY72 3TRSB 1PGW2 2RS13 3ZXKA 2IZWA 1LOAA 1J1LA 4OI4A 1XNAA 4MSVA 1HX6A 2FDIA 2X8KA 4OHYA 4HANA 4AI9A 4B29A 3LQCA 4F8AA 4BH9A 2Y34A 4YG6A 3H1MA 4YARA 4AI2A 5AVAA 3AYCA 3P3PA 4QPIB 5K9YA 1AYN3 4K1ZA 5B4XA 4CCJA 1JYXA 2YY1A 4CTEA 1AYM3 4FAHA 2HWD2 1DP0A 4E8DA 2IFRA 4KBBA 1RUD2 5LZ6A 4BA6A 2W68A 3HNBM 1W6MA 1Q43A 4ASKA 1D4VB 1OF3A 5LY1A 2VAUA 3TEZA 5CISA 2A5ZA 2TUNA 4XE9A 1TNRA 4A7KA 3H8RA 3TEYA 2HLEA 5KHHA 1ND3B 5T3NA 1CIWA 3RWNA 3ZR6A 1LR5A 2VOXA 3VBUA 1LGBA 4K8RB 1WW5A 1SMVA 4LBKA 1XYOA 2NM1A 3LFMA 4BLJA 3O5SA 3OUJA 4WVMB 4AHYA 2UY8A 1W8UA 2VCCA 1ZNPA 5ANNA 4S2DA 1PM4A 1EAH2 2YBSA 1JYVA 2VD7A 1TME3 3I3BA 4XFIA 1X8MA 3T4VA 1W0OA 1RUNA 3DECA 1COV1 1STMA 3DPRB 1CWPA 3QOPA 4LK6A 3ZIXA 1D4M3 2TBVA 1ULOA 3VBOA 3WUDA 1TVGA 3RSJA 4FSJA 4WV8A 2UWAA 1S4CA 1HQWA 1UKRA 1UYXA 1W2OA 1Y9QA 2PHXA 5BNNA 4UAPA 1YFWA 4N53A 1QGLA 2B7YA 1AX1A 2HBUA 4IEXA 4QKBA 2L9LA 4QX8A 2LW8A 3WEZA 1MZ6A 4MXVA 1VAKA 2WWUA 3A4UA 4IV3A 4L2NA 2GALA 4Q4X3 1U12A 3AXDA 4PF5A 2BGOA 2P1BA 4P9GA 3KHBA 2ZAHA 3AFKA 4JX0A 2BBAA 1US3A 4LO6B 1Q8PA 1XNDA 1YFYA 5ACA2 2Z2SB 4XIKA 2H6CA 1VMHA 4BIFA 2DU0A 2VZVA 2YYOA 3M3IA 3NVCA 3H50A 3I3EA 3WNPA 1RUI3 4OMDA 2AGSA 5IK8A 4KWJA 3ZN6B 4CDWB 2GAUA 4RS5A 3P1IA 1IS4A 1HRI2 4XMAA 2OVUA 1PNFA 2HYKA 5T50A 1LAJA 4FO9A 1MS4A 2RMU1 4TLGA 5FR3A 2X10A 5JMOA 1W0NA 4NHLA 4ZKTB 2XL9A 4AQ2A 2VCMA 3J4UH 5F32A 2R1DA 2YBPA 3RJRA 1CAVA 2D43A 1D2SA 5D8AA 5JI9A 2QQLA 3R0RA 4P9LA 1X36A 2VULA 5GKAC 3KWVA 4A3ZA 1MZEA 1FT9A 1VBC2 1KGYA 4JGZB 3VZNA 1TQ5A 1D0GA 4N90A 2RS32 5FKBA 1FNZA 5ABJA 1SLBA 4XUOA 3H8UA 3O14A 4D7SA 1ZBA1 4QXBA 4Q0QA 4FOWA 1LOFC 1W3XA 3VHOA 2QQVA 2VW1A 3SH5A 1W2AX 3K75B 3KT1A 2MHFA 4N8MA 4EE2A 2GH8A 1H8TC 3OGSA 2WZR3 4Y33A 3HQXA 5A3UA 2C24A 2AENA 2VXJA 3I2OA 2KM2A 2XVGA 1CZSA 4LBQB 5IFPA 4QGMA 2G9ZA 2R041 1NZCA 3ES1A 3E5UA 4K7JA 2Y6FA 4D94A 1C5IA 2WRAA 3H42B 1VBA3 2D98A 2BNNA 2R7EB 4I02A 3HJRA 3ECQA 4Y4YA 3LPFA 4XJZA 1WWYA 3IDEA 1C1LA 4QQOA 3OBTA 4IEPA 3D4KA 4CEWB 4QB2A 1WW4A 5CKQA 2D6NA 3GZTB 2VGDA 3GXUA 4FP3A 1CIYA 4ZXKA 4P9JA 4D8MA 3HR9A 2XUEA 2MPFA 2RS12 2PMWB 3APBA 3KV9A 1UU4A 3N9MA 1GZTA 3VDDB 3ACLA 2YFZA 3WDWA 2HWD1 5HXVA 4CCMA 1HIXA 3BOWA 1DYKA 1UMZA 4OUSA 1A8MA 4K20A 5KXCA 4OI1A 1G7YA 2EALA 2HWF3 2JE8A 2P6CA 2RS53 3KVBA 3N9LA 4DO0A 5BNPC 1AXYA 4XCAA 4CP2A 1WLDA 2WIIB 3LDBA 2I74A 1ND3A 3R6SA 1UCXA 1RHI2 1AYM2 4IE5A 2VR4A 5A33A 2R6QA 3HAGA 4XAAA 3LFIA 3D82A 2Y33A 4D7YA 2ZZJA 1RUH2 3WP4A 4HMZA 1SBEA 5L7OC 2R0FA 5A7WA 1RXFA 1WD3A 4L11A 3E5QA 2Q8EA 5FJKA 4QX0A 4M3CE 1KEXA 3U37A 2I2SA 2WNVA 1M4WA 1J58A 2ARBA 4S2HA 1SZBA 2Y0IA 5JPMB 2OX0A 4PQQA 1ZZCA 4BDVB 4GH4B 3RVHA 4GJYA 4Q4V1 1FOD2 2AR6A 1PMJX 3NKTA 3VKNA 4RA0A 1QEXA 4CP0A 3VDCA 1WA4A 2WN3A 3RZKA 5A3TA 1K5MB 2WA4A 4ZXEA 4N43C 3WW1A 1S0EA 2HEVF 2G9FA 4G9SB 3WZ1A 1SLIA 4V1PA 2W91A 2FDHA 1JHJA 3BVCA 5GZEA 3MIHA 4OMCA 2HWC2 2ZGMA 1RUG3 1B09A 3EBRA 4XPVA 1XRUA 4YVSB 5A32A 4CCOA 4BQXA 4GULA 3ZYFA 4E8CA 3ZFGB 1GLHA 1RUD3 1KJRA 3GCXA 2R042 1AZDA 1PIV1 4AXOA 5GZGA 1SG3A 1LHUA 1S1AA 1JMUB 1Z78A 2VZ1A 1YIPA 3WD5A 1YEWA 5JVVA 1R1A3 3GM8A 3T4HB 1LCLA 4CCNA 5EPAA 1L3JA 1WGPA 5JXIA 1AJOA 3KGLA 2XL7A 4P5YA 1NUKA 4XF9A 2CL2A 3LZZA 1JZ8A 2KXLA 5K8SA 1NOVA 4E2SA 1RUOA 3MPBA 2UURA 4QKFA 4I2OA 4LE3A 3DPRC 5FZHA 2LALA 4D69A 4B4QA 2RR13 3N4MA 1VB4A 4Y22A 3TYJA 1N1VA 5IK5A 1LULA 1BBT3 2E51A 1EAH1 3T0BA 3DYOA 1VBC1 3M1HA 3IM0A 1PHMA 4YG0A 1F4HA 5JXGA 2A70A 3I54A 1MS9A 1ULFA 3ETPA 3OY8B 5IJRA 4XJAA 4ASMB 1AYM1 5FZKA 5DMYA 2V09A 1QJEA 2WAOA 2AEYA 3GJBA 1H9WA 1AYN1 3ZIWA 2VZSA 3ZOIA 4ZZ8A 2CDPA 1PMIA 3C7GA 2XHNA 1W99A 2N7GA 4J6GA 4CU7A 4EN7B 4IEOA 4CDQB 2PTMA 2WZPP 1E5SA 4LBNA 3IIAA 2JD4A 5CG9A 5AC91 1G6NA 5FXVA 3VBSB 1NT0A 4NOTA 2PHDA 3O7OA 2NPIA 2YB7A 1BXHA 3AKPA 3TN91 5ACA1 5I91A 2DFBA 4PIYA 2C26A 4TWTA 4QPWA 1PK6C 2UYAA 3RRDA 1GZ9A 4GH4C 2FCVA 1VBE2 2ZGLA 3SCGA 1RUF3 4I30A 2QQKA 4AFDA 3LIGA 1YQ5A 1AJKA 1WKYA 4KMQA 3THTA 4AWDA 4CUAA 2BOJA 1YNAA 2QDNA 4JQTA 4WVVA 4QHZA 2CY6A 3G6JB 4PDWB 3A23A 1VRBA 3MYXA 4HK8A 1KD7A 2ZGQA 4YVSC 4Y20A 3VKLA 1DQ6A 1AXZA 3N36A 3NAPB 3POJA 5A3MA 3OD4A 3ZFGC 5DUVA 4N9IA 1S0JA 2ZZQA 4QAWA 4FBFA 2IFWA 2DWRA 5FKCA 2BZDA 3ZVXA 4D6QA 1LESA 3IPVB 1OLQA 1FAYA 3ILRA 4LTAA 5K0UC 1LODA 1D4M2 1VBD3 2XWJB 4M3CF 2W1UA 4CDXC 3CL1A 4UFKA 3AMHA 5LA9A 4CSWA 3NNFA 3OOXA 5A6XA 4HT1T 4OLLA 4AEKA 5C8CA 1O5LA 1S2EA 1HQNA 5LRSA 2GN3A 2CYFA 2VQTA 2DCJA 4M4PA 1APNA 2JDPA 1UY4A 3ME2A 3AKSA 4RD7A 1AX0A 3T0DA 1IHMA 5A7WB 3OSDA 5FK8A 1RVF3 5JUVA 1QMJA 1QOOA 1R64A 3K4DA 4OUMA 4PBOA 3K3OA 5DUUA 5HCFA 4B4PA 4XQ4A 4URAA 2D3RA 3BKZA 1E5RA 2IXIA 1W8WA 5FY5A 5BNPA 4FPKA 1JXNA 1HW5A 3J9SA 4NIGA 1OT5A 1ZRRA 5A32B 1QJY3 1DFQA 2YU1A 1NCQB 2QE3A 2RE9A 3LGRA 5SV5A 2GC2A 2VOTA 3Q8BA 4MXWB 5A6YA 2WSVA 1H1MA 1WCDJ 3AZWA 3IMNA 1R081 4UW5A 1W2UA 2QBXA 4Q1PA 1KJLA 1F2NA 3K4ZA 5KHGA 4KU7A 3AP5A 4BQ2A 5FY0A 5CFCA 1BZWA 2JDKA 3VBSC 5F5QA 3WSOA 1PK6B 2RS11 1CONA 2JXAA 1AL23 3GHNA 2BGPA 2ZHMA 1LTEA 3I8TA 1EV11 4B3NA 5L36A 4HLTA 1COV2 3IN9A 4I0BA 1VBE1 3O1SA 2R061 1VBD1 3MIDA 4NHKA 5FYCA 2X53S 3DYMA 1CAWB 5CKNA 1H4HA 4NROA 1LHVA 3ZSJA 2SBAA 3AP4A 3TEWA 5FZ1A 1O4TA 4KL1A 4MH0E 2WO2A 2D44A 1NZIA 2BV4A 3VBOB 2QKDA 4A6OA 3ES4A 5L73A 2Y8KA 2GU9A 3K4AA 2WZR2 1QJY1 1UZ0A 1UY3A 4IEWA 4LHSA 2GNMA 1OFSA 5HCHA 2VCBA 5FBJA 2AACA 4B8EA 4CDWA 3UK9A 3QACA 2F6BA 4B1LA 4BXSV 1X7NA 1GQHA 1JBCA 5HPOA 4V2WA 5FP8A 2QTWB 3ZXAC 5J37A 3OUHA 1G9FA 2ET7A 3C7EA 2C9KA 4MUVA 2FDGA 4Y22B 3RZHA 4DUWA 3UKTA 4RR3C 1TMF3 3GBWA 4P5HA 1SFYA 4FPEA 1RUC3 3BB6A 4Q0PA 4YW4A 4AI1A 2DDUA 2ZGPA 4OHZA 1G9BA 3VLBB 4RN5A 3GDBA 5FXZA 4Q26A 3UT0A 2VNVA 3UL2A 4A6SA 1YJKA 3TBDA 2YPDA 2WO1A 3WF1A 4XJ9A 3RZGA 3U10A 3UJOA 3T0AA 1ZBE2 2RJKA 3NQHA 2OZJA 3NNLA 4GALA 1HXS3 1NY71 1XNTA 3AC0A 2RM21 2W87A 3NSTA 3H0OA 5T54A 2D40A 1SFNA 1UU5A 2EXHA 3SH4A 4P9XA 1DF0A 1OH4A 3KT7A 1XYPA 4UW6A 5FFOC 5BNNC 4YW7A 4GB32 4XUPA 2B46X 2VOVA 5GJ6A 5FIXA 3SXWA 4IETA 4L0PA 1CPMA 3JD71 3WP6A 3HBKA 4IV3C 4ASLA 1SQ4A 2MEV1 2VNGA 1LECA 3S6PA 1CPNA 2ADDA 5CEHA 1IKPA 1RVF2 5AFEA 3S5AA 1RUJ1 2ARCA 4HKLA 4JQRA 5FYVA 1U0AA 3KSCA 4LLFA 4XW3A 3J8F2 5EP9A 1EAH3 3FHQA 5KHKA 2CGOA 1C8M3 2B4KA 1WCUA 4XZUG 4XOGA 1RUF1 2ZX3A 3HEIA 4YW3A 3T2QA 2RR11 3UKNA 2EIBA 2XH6A 4R9DA 1EV12 3FBMA 2P3JA 5JDBA 1AR72 2AEZA 4J1WA 5FY8A 5GZFA 1KRIA 3MW2A 2YPJA 5B2GB 1J3RA 1X33A 3ZM8A 3PMSA 4OZOA 2XBO2 5AC93 3NNGA 4DNYA 5F3CA 5IVCA 1G9DA 1W8FA 4AGRA
chains in the Genus database with same CATH topology
5FPBA 5A7NA 2XMLA 5ISLA 4Y33A 5FZHA 5A7PA 4AI9A 5A7SA 3AL5A 4D6RA 4V2VA 5IW0A 5FPUA 3K2OA 5FPLA 5E6HA 5FY0A 4CCJA 5FZCA 2GP5A 5FZIA 5FZOB 4D6SA 5F37A 3ZPOA 3PTRB 4ASKA 5FYTA 5FZKA 5IVBA 5LY1A 4GD4A 2GP3A 4QXCA 4QX7A 4XDPA 5FY7A 5FPAA 5FYCA 5K4LA 5FZ9A 4UF0B 5FUNA 3AL6A 2XUEA 5ANQA 4BISA 5FZ1A 3KV9A 3KV6A 3N9MA 4C8DA 4CCMA 4Y3OA 5FZMA 5FZEA 5FXVA 5FYZA 5FY9A 2P5BA 5FBJA 5F5CA 4NUBA 2YBSA 3N9LA 2VD7A 3KVBA 5FXXA 4DO0A 5FPVA 4V2WA 2WWJA 3KV4A 5FP8A 4BXFA 4QU1A 3LDBA 5FZ8A 4Y4RA 4HONA 4GJZA 4UF0A 4LIUA 5FP3A 5FY1A 5FZ4A 3DXUA 5FZ6A 5LY2A 4LIVA 4BU2A 5A80A 5A7OA 5FP9A 5FYYA 5IWFA 4DIQA 2OQ7A 5FXZA 5A7WA 4QX8A 2YU2A 2OS2A 2Q8CA 2Q8EA 2YPDA 3PURA 5FJKA 5F5IA 2WWUA 1VRBA 3AVRA 3NJYA 5FV3A 5F5AA 3PU8A 3DXTA 2OT7A 5IVVA 5FYSA 2Q8DA 5FY4A 5A3NA 5FYMA 2OX0A 5IVEA 5IVYA 5FZBA 4EYUA 5F3GA 2XXZA 3RVHA 5FWEA 4GJYA 4QWNA 4D6QA 4CUGA 3U78A 5LW9A 3UYJA 4IGQA 5FZ3A 3U4SA 5FWJA 5F39A 5FZ7A 5FUPA 3N9NA 3PU3A 5F2WA 3N9QA 5A3TA 5FP7A 5FZFA 4GAZA 4XDOA 3OPTA 4CSWA 5IVJA 2YBKA 4QXHA 4IGOA 5A3WA 4AAPA 5CEHA 4EZ4A 2OQ6A 5FYIA 4CCKA 5FYBA 5F3EA 3K3NA 4LITA 5FYVA 3LD8A 5F32A 5FZDA 2YBPA 4EZHA 3KV5A 5FZGA 3KVAA 5FZAA 4CCOA 5A7WB 3PUSA 5FZ0A 5FYHA 5LWBA 5A1LA 3PUQA 2PXJA 3K3OA 5FP4A 4HOOA 3AVSA 5A7QA 4URAA 5FY8A 5F2SA 5A3PA 2XDVA 5A1FA 5FJHA 2W2IA 5FY5A 3PUAA 3PDQA 4LXLA 4CCNA 3OPWA 4TN7A 3ZLIA 5FZOA 5IVFA 5KR7A 2YU1A 3N9PA 4IGPA 5FYUA 4CCLA 4E4HA 4QXBA 5F3IA 5F3CA 5IVCA 5FZLA 3N9OA 5FXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FPB A;  5A7N A;  2XML A;  5ISL A;  4Y33 A;  5FZH A;  5A7P A;  4AI9 A;  5A7S A;  3AL5 A;  4D6R A;  4V2V A;  5IW0 A;  5FPU A;  3K2O A;  5FPL A;  5E6H A;  5FY0 A;  4CCJ A;  5FZC A;  2GP5 A;  5FZI A;  5FZO B;  4D6S A;  5F37 A;  3ZPO A;  3PTR B;  4ASK A;  5FYT A;  5FZK A;  5IVB A;  5LY1 A;  4GD4 A;  2GP3 A;  4QXC A;  4QX7 A;  4XDP A;  5FY7 A;  5FPA A;  5FYC A;  5K4L A;  5FZ9 A;  4UF0 B;  5FUN A;  3AL6 A;  2XUE A;  5ANQ A;  4BIS A;  5FZ1 A;  3KV9 A;  3KV6 A;  3N9M A;  4C8D A;  4CCM A;  4Y3O A;  5FZM A;  5FZE A;  5FXV A;  5FYZ A;  5FY9 A;  2P5B A;  5FBJ A;  5F5C A;  4NUB A;  2YBS A;  3N9L A;  2VD7 A;  3KVB A;  5FXX A;  4DO0 A;  5FPV A;  4V2W A;  2WWJ A;  3KV4 A;  5FP8 A;  4BXF A;  4QU1 A;  3LDB A;  5FZ8 A;  4Y4R A;  4HON A;  4GJZ A;  4UF0 A;  4LIU A;  5FP3 A;  5FY1 A;  5FZ4 A;  3DXU A;  5FZ6 A;  5LY2 A;  4LIV A;  4BU2 A;  5A80 A;  5A7O A;  5FP9 A;  5FYY A;  5IWF A;  4DIQ A;  2OQ7 A;  5FXZ A;  5A7W A;  4QX8 A;  2YU2 A;  2OS2 A;  2Q8C A;  2Q8E A;  2YPD A;  3PUR A;  5FJK A;  5F5I A;  2WWU A;  1VRB A;  3AVR A;  3NJY A;  5FV3 A;  5F5A A;  3PU8 A;  3DXT A;  2OT7 A;  5IVV A;  5FYS A;  2Q8D A;  5FY4 A;  5A3N A;  5FYM A;  2OX0 A;  5IVE A;  5IVY A;  5FZB A;  4EYU A;  5F3G A;  2XXZ A;  3RVH A;  5FWE A;  4GJY A;  4QWN A;  4D6Q A;  4CUG A;  3U78 A;  5LW9 A;  3UYJ A;  4IGQ A;  5FZ3 A;  3U4S A;  5FWJ A;  5F39 A;  5FZ7 A;  5FUP A;  3N9N A;  3PU3 A;  5F2W A;  3N9Q A;  5A3T A;  5FP7 A;  5FZF A;  4GAZ A;  4XDO A;  3OPT A;  4CSW A;  5IVJ A;  2YBK A;  4QXH A;  4IGO A;  5A3W A;  4AAP A;  5CEH A;  4EZ4 A;  2OQ6 A;  5FYI A;  4CCK A;  5FYB A;  5F3E A;  3K3N A;  4LIT A;  5FYV A;  3LD8 A;  5F32 A;  5FZD A;  2YBP A;  4EZH A;  3KV5 A;  5FZG A;  3KVA A;  5FZA A;  4CCO A;  5A7W B;  3PUS A;  5FZ0 A;  5FYH A;  5LWB A;  5A1L A;  3PUQ A;  2PXJ A;  3K3O A;  5FP4 A;  4HOO A;  3AVS A;  5A7Q A;  4URA A;  5FY8 A;  5F2S A;  5A3P A;  2XDV A;  5A1F A;  5FJH A;  2W2I A;  5FY5 A;  3PUA A;  3PDQ A;  4LXL A;  4CCN A;  3OPW A;  4TN7 A;  3ZLI A;  5FZO A;  5IVF A;  5KR7 A;  2YU1 A;  3N9P A;  4IGP A;  5FYU A;  4CCL A;  4E4H A;  4QXB A;  5F3I A;  5F3C A;  5IVC A;  5FZL A;  3N9O A;  5FXW A; 
#chains in the Genus database with same CATH topology
 4UBG A;  4NIH A;  5D21 A;  5ISL A;  5FO8 B;  1JZ2 A;  2P34 A;  3MLJ A;  2BFU L;  3WW2 A;  5HBA A;  5FPU A;  2LRO A;  1BEV 1;  2X5I A;  3MBW A;  1MPX A;  2E31 A;  1ZX5 A;  3CJI B;  5FZC A;  2GP5 A;  3O12 A;  3CBN A;  4QHO A;  3WW4 A;  4W8J A;  3PL0 A;  1T6B X;  4AHW A;  4UFL A;  5I0T A;  1S0D A;  3LWC A;  4Q4Y 1;  3RYK A;  4H7M A;  4I09 A;  5JOZ A;  3O1M A;  3MFC A;  5K4L A;  1UIJ A;  2O1Q A;  4CXY A;  2W47 A;  1YQC A;  3IDA A;  5LA0 A;  3OCP A;  4KI5 M;  3QCW A;  1DYO A;  4FFI A;  4HL0 A;  4L9B A;  2VG9 A;  4UFH A;  1YFU A;  1WMD A;  2VUC A;  2PHU A;  3I2D A;  1Z7S 2;  4MOA A;  3I97 A;  1QJU 2;  2GC3 A;  3MIF A;  4W50 A;  5FPV A;  4AYU A;  2W46 A;  4UW3 A;  4RSU A;  3KV4 A;  1X82 A;  1MAC A;  4Y4R A;  4H3W A;  5FP3 A;  1WCS A;  3AKT A;  4QM8 A;  4XDQ A;  5LBE A;  2O0O A;  3ZXE A;  2VH9 A;  2WNV B;  5HCA A;  4HVO A;  2BVV A;  5DDJ 2;  2WIN B;  2VTF A;  3E5X A;  2HEW F;  2ORX A;  3WV6 A;  1W28 A;  1YQ8 A;  2WFF 2;  5H9Q A;  4DY3 A;  5IHR A;  4C1X A;  4XJ8 A;  1IS6 A;  1KS4 A;  3NV4 A;  1AR6 3;  2OS2 A;  2FCU A;  4GB3 1;  3MIE A;  4IQP A;  1W9Y A;  4A41 A;  5IFT A;  5KXE A;  1TZO A;  2GC0 A;  3OGG A;  1LEM A;  4AOC A;  2GNT A;  2PHW A;  5DZE A;  5KC5 A;  2Y6K A;  4HSJ A;  3JXS A;  4FOV A;  2Y60 A;  4RS5 C;  4J1X A;  1IKQ A;  1ULE A;  1XSR A;  4QPY A;  3IWZ A;  1U5X A;  3HQU A;  2DCY A;  2CU5 A;  3V0B A;  4NRM A;  1YXW A;  4AFC A;  4KGQ A;  2D6L X;  3AJY A;  2CWM A;  3CEW A;  4HPK B;  1BQP A;  4I01 A;  3MI8 A;  4QWN A;  2UU8 A;  3U0Z A;  2Y6G A;  2ZHL A;  1IQA A;  1O8P A;  3BOD A;  4IE4 A;  1H6Y A;  4N9H A;  1SFP A;  3TN9 2;  5EJZ B;  3T2O A;  3VBR C;  4ET7 A;  3I59 B;  3VD4 A;  2BOI A;  3GBF A;  2Q1F A;  4S2F A;  3LEG A;  3OPT A;  1AR7 1;  4Y1Y A;  4Y1U A;  2ZEX A;  2XJU A;  4LNV A;  5A3W A;  3URF A;  1OMI A;  4SLI A;  5DPN A;  2H0B A;  2RDN A;  3AX4 A;  5FYI A;  3W21 A;  3ZYI B;  2QJV A;  4DRV A;  4NR1 A;  4Z92 B;  2RJL A;  3DKW A;  1WD4 A;  3O0W A;  2W52 A;  5DAQ A;  1YLL A;  3SCF A;  1K3I A;  1IPK A;  4K6B A;  1RJ7 A;  5J98 B;  4NPL A;  3WF4 A;  3V0A A;  4F7Z A;  1YQ6 A;  1CVN A;  4ITC A;  2YDE A;  3AKR A;  4N7I A;  5A1L A;  1OOP A;  5FP4 A;  3ZR5 A;  3TOJ A;  3U11 A;  2MEV 2;  4H55 A;  2K9Z A;  1UYZ A;  5LK5 A;  3PDQ A;  3JD7 2;  5I8T A;  1SHW B;  1KQR A;  1O4Y A;  3ZMN A;  3OBZ A;  3EYP A;  1S0I A;  1K5M C;  4GWM A;  1VBB 1;  1QOS A;  5FYU A;  2NN8 A;  3ZKU A;  1D2Q A;  1XNC A;  1DQ4 A;  1VRH 1;  2V4A A;  2VZR A;  4OHX A;  3VBU C;  5LA2 A;  5JXH A;  4NHY A;  4Q4X 2;  1FMD 3;  1VR3 A;  1G9C A;  2XML A;  1QH7 A;  3HNM A;  3MDP A;  4KQ7 A;  4YNI A;  3SLI A;  2ENR A;  4AVS A;  4AEM A;  3NNJ A;  3RMY A;  4IDZ A;  3LOB A;  4V2V A;  3FJS A;  1UXZ A;  5BY5 A;  3WNX A;  3WG4 A;  1UOJ A;  4YW6 A;  5I0U A;  3C7O A;  3VKO A;  1FOD 3;  3GJA A;  1VBA 1;  4XZP A;  1JZ6 A;  2LRP A;  2RMU 3;  2FDJ A;  4MGY E;  5EHD A;  3AM2 A;  4LK7 A;  3VBS A;  2PAE A;  3RGB A;  4ZY9 A;  5HXM A;  3P6B A;  1AR7 3;  2A7A A;  3NMB A;  3WR0 A;  3SKJ E;  1OHF A;  3C3V A;  5GM0 A;  1QNW A;  2E26 A;  3C2U A;  4CA9 A;  1GWM A;  2J7M A;  3A22 A;  2OPW A;  1J59 A;  4HKO A;  4FT8 A;  4Y3O A;  5GLZ A;  2ILM A;  1OKQ A;  4FPJ A;  5BNN B;  4NHX A;  2W1W A;  1WUV A;  2J1U A;  3JUU A;  2G4I A;  1GIC A;  3HT1 A;  2FZ2 A;  1GBG A;  2VQA A;  5A3O A;  3MUZ 1;  2ZX1 A;  1LEN A;  5CG8 A;  4GB3 3;  1AR6 1;  2CAU A;  4Q0S A;  3WQ1 A;  2VMI A;  4YVW B;  3P3N A;  3WUC A;  2R06 2;  2ZGU A;  5FP9 A;  3I3D A;  1Q8V A;  4Y5Z 0;  1UZY A;  4EN8 B;  1D4M 1;  2ZGO A;  4CPB D;  2JE9 A;  3PVN A;  1JYW A;  2O14 A;  4XTM A;  3NV2 A;  4JTO A;  2WNU B;  1H9P A;  2XQX A;  2J1E A;  4XUR A;  3WF0 A;  4M3C A;  3NNM A;  4WM7 B;  1YYN A;  3TB0 A;  4FVV A;  2WT0 A;  1XQN A;  2BBV A;  1PNG A;  3LB9 A;  1KS5 A;  1ZZ6 A;  4XEZ A;  2XR4 A;  1RUI 1;  3VZO A;  4XC9 A;  3T09 A;  4E9K A;  4YSF A;  4A4A A;  2VW2 A;  3WY6 A;  5JCT A;  2ZOE B;  2XJT A;  4CXW A;  1KDK A;  2D5H A;  3UYJ A;  3KQR A;  1O3T A;  1XOY A;  3N9N A;  3PU3 A;  3SIS A;  1GZC A;  4WVZ A;  4OCT A;  4NWV A;  1DBN A;  1QWR A;  1J3Q A;  4XIO A;  1VLN A;  2WFF 1;  1LKN A;  1R09 1;  3M2M A;  5BNP B;  4PDW C;  3ZYH A;  3ZYR A;  4M4R A;  1QJZ A;  5DZF A;  3LKJ A;  3J26 N;  5JIA A;  4AG4 A;  5ABJ B;  3JQW A;  3AYE A;  3AK0 A;  4WM8 A;  1NCQ A;  4LKF A;  2XON A;  1EYB A;  1BEV 3;  1VRH 2;  2VVE A;  3ZMO A;  3UET A;  4JHZ A;  1JOJ A;  3V64 A;  5JIU A;  4OVE A;  2IC1 A;  1ZVF A;  3ZO0 B;  1V0A A;  2FMY A;  1UMH A;  1XJA A;  1COV 3;  5J96 B;  2QQJ A;  2GMM A;  4Y20 B;  5EV7 A;  4CU6 A;  5C8W A;  5J48 A;  3FZ3 A;  2Y38 A;  5CFC B;  2DVA A;  5A6Z A;  3V0B B;  1UX7 A;  4LKD A;  1DLL A;  2WA3 A;  3IPV A;  4Z2W A;  1MS8 A;  5FZL A;  4CEW A;  5F5I A;  2Q0A A;  3LEM A;  4PIX A;  3MO4 A;  1JW6 A;  2E6V A;  1N1S A;  1UYP A;  3PJY A;  4FPL A;  4NII A;  4Q29 A;  1ACC A;  4BCU A;  1GR3 A;  2JG9 A;  1CAU B;  3J8F 3;  2ZPX A;  3E6C C;  2PAM A;  1W6O B;  1OI6 A;  2D6M A;  1IS3 A;  4F3J A;  3GNE A;  1V6I A;  4XCB A;  4GIQ A;  1W8N A;  4D0Q A;  1CX1 A;  5IUQ A;  4B1M A;  1SEF A;  4A42 A;  4MVT A;  2CAV A;  3UGG A;  3TWI A;  3H9A A;  1RHI 1;  4M0N A;  3RS6 A;  3S30 A;  1ULD A;  2PHL A;  3LDK A;  2FBE A;  2BWA A;  2PA7 A;  1OOP B;  3VZJ A;  3ALQ A;  4AQ6 A;  5C3O A;  1AVB A;  3POE A;  4BYY A;  3H1Y A;  1DGR A;  1GFF 2;  3ACH A;  3WDV A;  3KHC A;  2RM2 3;  4YYO A;  2JEC A;  1ZA4 A;  1H4G A;  2D3P A;  1HXS 1;  4YW1 A;  3WG1 A;  4ARY A;  3ACF A;  4E4S A;  2P37 A;  1XBF A;  3MIG A;  4JRA A;  1BKZ A;  1FPN 3;  1QXP A;  2Q30 A;  3J7N A;  4JDN A;  3OTF A;  4MXW A;  4QQ2 A;  2WWJ A;  5H9P A;  5T52 A;  1PO1 3;  1AR8 1;  1WLC A;  3BU7 A;  4M0H A;  1IG3 A;  1HRV 3;  1PGS A;  1X9P A;  3RNS A;  1RIR A;  2E7T A;  2OUJ A;  5FLJ A;  4AVV A;  3S57 A;  4PT6 A;  1HXS 2;  4LIV A;  1PO2 3;  1YHF A;  3V65 A;  3OJB A;  4YFZ A;  4BE3 A;  1UOF A;  1ZZ8 A;  5A7O A;  4HVQ A;  5FYY A;  1NAE A;  1RB8 G;  1PK6 A;  4QQH A;  2YU2 A;  4W6W A;  2A71 A;  4JDO A;  4YLZ A;  1AR9 2;  4YWA A;  1W6Q A;  2BW8 A;  2VZQ A;  1VBB 3;  5C4W B;  1HB3 A;  5FMO S;  2Q8O A;  3KZ4 C;  4DIN B;  1QQP 1;  2ZX0 A;  3GHM A;  1H30 A;  1C5H A;  2VUA A;  2HWB 2;  3WQB A;  2CHH A;  2XLF A;  1O5U A;  5AFB A;  4KGG A;  4MGS A;  1DU3 D;  3WHT A;  1HDK A;  4L97 A;  1OOP C;  3VHN A;  2XPJ A;  3POG A;  3U14 A;  5LAT A;  3VBH A;  3VZL A;  2NP0 A;  2RS3 1;  4WVW A;  5LW9 A;  1QQP 2;  1ZZ7 A;  3VZM A;  4DEQ A;  3BTZ A;  2C4X A;  5C70 A;  4TYS A;  4CZS A;  1QF3 A;  4NAO A;  5I0R A;  2XVL A;  3NV3 A;  4IGO A;  2ZJC A;  1J3P A;  4QDS A;  2PFW A;  5LBC A;  1AL2 1;  4Q4W 3;  4H2A A;  4A45 A;  2JDN A;  3EMR A;  4FPG A;  1GQG A;  5DZG A;  4BM8 A;  1H6X A;  1W6N A;  1US2 A;  4P9I A;  4AFM A;  3PVO A;  4MHU A;  1UY1 A;  3SHR A;  3KV5 A;  5FZA A;  1H2N A;  1LOB A;  1ZRF A;  4ZS3 A;  4LHL A;  2V4V A;  1R08 3;  5JWP A;  2EXK A;  3OGR A;  2A6X A;  5DUX A;  4FPC A;  2WQ4 A;  1POV 0;  3F95 A;  3BTY A;  1SBF A;  4YZ4 A;  2ES3 A;  4FXK B;  4HXC A;  5CYY A;  4YW2 A;  3FBY A;  3NO8 A;  2D6O X;  1UAI A;  3VN4 A;  3TNP B;  4BQ3 A;  3K77 A;  4I0W B;  1SDD B;  2VVD A;  4LBM A;  5BUV A;  5EIY B;  1WLT A;  2ATF A;  1YO8 A;  3N9P A;  3PVE A;  4QGL A;  5J7M A;  3AFG A;  3RZJ A;  2DBN A;  3H7J A;  2KR2 A;  1WW7 A;  3IKW A;  3OY8 A;  4LBJ A;  4Y5T A;  3T1M A;  1Y4W A;  5JI7 A;  5BXX A;  4E4Z A;  3VBF A;  1RVF 1;  2VBB A;  2DF7 A;  3OGV A;  4Q8L A;  4DUV A;  4WM8 C;  3O1R A;  5CNA A;  3NJZ A;  1W3V A;  4FPY A;  1Q56 A;  1YQ2 A;  4Q0V A;  4CEW C;  4ZS2 A;  2DYC A;  2W95 A;  2LTN A;  1QXR A;  4IE6 A;  1UYY A;  4JGY A;  3ETQ A;  1GOH A;  4FPH A;  1Z7S 3;  2YGL A;  4I3P A;  5JOW A;  3AP9 A;  1F5J A;  1RUH 1;  5A3L A;  1I5P A;  4XDP A;  5FY7 A;  1HLC A;  1UO9 A;  1SAC A;  1TG7 A;  2VME A;  2JKX A;  4LUK A;  2BJS A;  4WM7 C;  2ZX2 A;  4IV1 C;  2WS9 1;  2KD7 A;  3H8O A;  1YCI A;  4XJW A;  2WZE A;  1HJF A;  3GBG A;  4GKY A;  4FAG A;  3OD0 A;  1TEI A;  1RUC 2;  1UY2 A;  3MW4 A;  2WNV C;  4IUG A;  3ZXD A;  5E1R A;  1W6M B;  1AHS A;  1V6N A;  2P5B A;  3MZH A;  2Q1M A;  5HV0 A;  4CDU C;  4MGT A;  1RUE 3;  4NUB A;  1JN2 P;  1OFN A;  2JDZ A;  1JH5 A;  2O8Q A;  1NLS A;  2GDF A;  2JWP A;  1KDM A;  4QU1 A;  2YMZ A;  2ZGS A;  3CDZ B;  2J42 A;  2JDY A;  3Q8E A;  5TSW A;  3S7E A;  4HK9 A;  3CJI A;  3M3Q A;  3OG2 A;  1V6M A;  1W6O A;  4XFC A;  1YI7 A;  1QKQ A;  4OUE A;  4PLO A;  2EIC A;  2P3K A;  3FFQ A;  3PLQ A;  3Q8A A;  5IAX A;  4PIZ A;  2Z5W A;  4A7Z A;  2GND A;  4X8P A;  1E5I A;  1JYI A;  1RIN A;  2IXK A;  3POB A;  1LHN A;  3C7H A;  1X50 A;  1JYT A;  1UPS A;  5L9V A;  5FBZ A;  2FHR A;  3BGA A;  3SKV A;  2WS9 2;  3H7Y A;  1W03 A;  2HBT A;  5IVE A;  2VZU A;  2GMP A;  3L2H A;  2ARE A;  2VZ3 A;  5F3G A;  3WG3 A;  2ZAA A;  2WN2 A;  3LOI A;  1K5J A;  3RYR A;  2Z4F A;  2GZW A;  2ZCW A;  2R32 A;  4IEV A;  4PJY A;  4WZC A;  1OPO A;  4UBH A;  1WMF A;  3ZFF C;  3JB4 C;  5FWJ A;  4Y24 A;  3WHU A;  4D7T A;  4EWA A;  1OH3 A;  1AL0 G;  1XE7 A;  3PVB B;  4MV2 A;  2DV9 A;  2W39 A;  5HI0 A;  3RWK X;  5FZF A;  1FMD 2;  2XGX A;  3RZM A;  1JZ7 A;  2A6W A;  1SBD A;  1HN1 A;  4ATF A;  1R08 2;  2OQ6 A;  3AMP A;  2HWB 1;  3HT2 A;  1Z0H A;  3ITQ A;  5C5U A;  3W59 A;  1ENQ A;  1S55 A;  3SMH A;  4ISQ A;  3WP3 A;  3SNM A;  4COV A;  2ZMN A;  5ERL A;  1ZBE 3;  1XB9 A;  5M0T A;  2UWC A;  5FYH A;  1BMV 1;  3A7Q A;  2JKB A;  2QQO A;  2D93 A;  4A7Y A;  3RZL A;  1MQT B;  2WBK A;  1JU4 A;  2XDV A;  3MIC A;  4XUQ A;  2W2I A;  2BYV E;  3HQR A;  1LHO A;  4K9S A;  4Q0U A;  3ORJ A;  4C0B A;  4O9G A;  3P5B A;  2XG3 A;  5DUW A;  3N3H A;  1VBD 2;  1R1A 1;  1Q3E A;  4E4H A;  1JU3 A;  3PTY A;  4Z07 A;  2XQR A;  5H9S A;  5A7N A;  5E8A A;  1WW6 A;  1JYC A;  3JCI A;  3ZN6 A;  5JMC A;  1RUD 1;  2JB4 A;  4JDM A;  3POI A;  1NLR A;  3SH3 A;  4YG3 A;  5A7S A;  5BNO C;  2JIC A;  4JCK A;  5D8A C;  1XPW A;  4N43 B;  4YZ2 A;  1QJX 2;  1TMF 1;  3LEI A;  3VBO C;  2Z69 A;  5FQ0 A;  2VU9 A;  5JSR A;  3T30 A;  2VC9 A;  5FZO B;  4AW7 A;  3N7L A;  1H2K A;  1DYP A;  1FAT A;  1SLA A;  1Y7B A;  1H8V A;  3PUH A;  2WL1 A;  5D8A B;  1PO2 2;  4YZ3 A;  2WNU A;  1J1T A;  3B00 A;  4OHW A;  4GD4 A;  1J84 A;  4Y1X A;  2J1T A;  1DG6 A;  4QX7 A;  5CZK A;  4AI0 A;  3MGU A;  4LO7 A;  4RFT 0;  2PEL A;  3VKF C;  4ZON A;  2PQS A;  3Q8C A;  2WS9 3;  1FPN 2;  1VBB 2;  2BVB A;  1QJU 3;  4LBO A;  3KV6 A;  4YVW A;  4C8D A;  2QQW A;  2ZMK A;  1WMX A;  2B39 A;  1FYU A;  4DS0 A;  2Q5T A;  4P00 B;  4R4X A;  1ZM1 A;  5SV8 A;  1YJL A;  3ATG A;  4O65 A;  3UNP A;  4LJH A;  2YV8 A;  3CF6 E;  3CZU A;  1BVV A;  4FQ4 A;  2DUQ A;  3G7D A;  4JGY C;  4NAM A;  2YHJ A;  1LOE A;  3HIF A;  3QD6 A;  1K45 A;  1TE1 B;  3OYW A;  3POS A;  4CXX A;  5F1R A;  1PZ9 A;  4N53 C;  1W9S A;  5CFD C;  3DXU A;  4TLF A;  2HYX A;  1GAN A;  5EYY A;  4AFA A;  4NRP A;  4UXA A;  1TME 2;  2X5I C;  3CLP A;  4CDU B;  1S0C A;  1W9W A;  4QPG B;  5EXO A;  3H3Z A;  3K51 A;  3WF2 A;  5A70 A;  3WDU A;  2DVG A;  1JOP A;  4K3U A;  2IUW A;  5LBB A;  1WCK A;  1NXD 1;  3NJY A;  3VDB A;  1ZRD A;  2BPA 2;  3DXT A;  5JZG B;  3WNK A;  4AQS A;  1T2X A;  3NAP C;  3B7M A;  1MEC 1;  2ARX A;  2VBP A;  1NCR B;  5A33 B;  5F8P A;  1R09 2;  3ZYG A;  5I93 A;  5K7P A;  2OXB A;  2XKP A;  1GOG A;  2RJ2 A;  2RG4 A;  1ULC A;  3LF7 A;  4GMP 1;  4K8F A;  1XE8 A;  3RPQ A;  3ENR A;  3R4D B;  4AGV A;  3EB7 A;  1FV2 A;  1F4A A;  5FZ7 A;  1OUS A;  4FFH A;  1W6P B;  1I3H A;  2J1R A;  3M3C A;  5D1I A;  5F2W A;  3I2K A;  1CR7 A;  4K1Y A;  5DAV A;  4JAA A;  5C9A A;  1WA6 X;  4IER A;  5L7O B;  1D0H A;  4Q4W 1;  4I3G A;  3USU B;  3T2T A;  1DZT A;  5DDJ 1;  4LIT A;  1LB2 A;  4YM0 A;  1C57 A;  2XWB B;  3FMG A;  4MET A;  3O1U A;  2R16 A;  3WCR A;  2VJX A;  3ZN4 A;  3AZY A;  2GSY A;  1UZV A;  2O8O A;  4XBL A;  1RMU 1;  3T2P A;  3RI9 A;  4BB3 A;  1OUX A;  3NV1 A;  4IV1 A;  4QPI C;  2EIE A;  2ETE A;  3BOP A;  5CFD B;  4Z1V A;  4E4D X;  1AR9 1;  4WM7 A;  3POF A;  1HN0 A;  4KBZ A;  2X5I B;  2GNB A;  1UD1 A;  4Q4V 2;  3UES A;  3I2H A;  1MS0 A;  4WVM A;  4EJR A;  3PIG A;  1DQ1 A;  5F9T A;  1QJX 3;  5FOJ B;  3FUQ A;  1GU3 A;  1V6O A;  2VOK A;  3VUO A;  2BU9 A;  4QX3 A;  4AEJ A;  1GMM A;  4ONU A;  3ACG A;  2SLI A;  3BYW A;  1IZ3 A;  1ZA7 A;  4M00 A;  1F5F A;  4RL7 A;  1VIW B;  4XAC A;  4AGG A;  4D6R A;  5G04 L;  1DGR N;  3INA A;  4Q4W 2;  1HRV 1;  1UNB A;  3GF6 A;  5FTT C;  2X05 A;  1PO1 1;  3WIN E;  3UGH A;  4D6S A;  2P2K A;  4DEV A;  3WNM A;  3R4S A;  4L99 A;  3KF5 A;  3TN9 3;  3BPZ A;  1HV1 A;  1O7F A;  3KS7 A;  3I49 A;  1W6Q B;  4TTG A;  2GP3 A;  3GAL A;  4QB6 A;  2Y6H A;  3B3Q E;  1G8W A;  1JZ3 A;  4FTE A;  4HKW A;  5T5P A;  3F2Z A;  1OF4 A;  1UWW A;  2IXC A;  3ZFE C;  3RFR A;  5DG1 A;  4OQ9 A;  3LSE A;  1VPH A;  1UPI A;  5C3S A;  2QQP A;  3HVD A;  4QKD A;  3ZSL A;  5LEJ A;  1QJX 1;  4OI0 A;  2QDR A;  1JTZ X;  2ZA9 A;  4RQP C;  3AKQ A;  4BQ4 A;  4EV0 A;  1UXX X;  1TMF 2;  5IK7 A;  4RS5 B;  2B5H A;  3BUC A;  4Q4X 1;  2BP6 A;  4QXK A;  3IB3 A;  2PLV 2;  1Q8O A;  1QH6 A;  2WFF 3;  3L2Y A;  4FI9 A;  4CU8 A;  5BNQ A;  1OLR A;  4BK5 A;  4IV3 B;  5CAD A;  4UF0 A;  1VBC 3;  4CPB A;  3CKH A;  3I2J A;  3J8F 1;  3WG2 A;  1VMF A;  1S0F A;  4DB5 A;  2EAA A;  1ENR A;  1GWK A;  3LCP A;  3OEB A;  4MZU A;  1GNH A;  4RR3 B;  3W9A A;  4BU2 A;  3AMM A;  4Y1Z A;  2Y26 A;  5EWS A;  4XUN A;  1F15 A;  1B35 A;  3HBZ A;  4HFS A;  1YRZ A;  4W65 A;  3RG0 A;  4DIQ A;  2FQP A;  3E97 A;  3VBH B;  5EJ3 A;  2JDA A;  3SQO A;  5F7U A;  2H0V A;  2Q4S A;  4A3X A;  5JSP A;  3PUI A;  1O91 A;  1MS3 A;  2Q8D A;  2G1M A;  2A3W A;  2OA2 A;  1RC6 A;  4GMP 3;  1DGW A;  2CV6 A;  2OII A;  3AB0 A;  4DXT A;  5FRA A;  2OUH A;  2DVF A;  4XAB A;  3FC0 A;  2ZGN A;  1MEC 3;  2HEY F;  1GZW A;  1L7L A;  1OVS A;  5FP7 A;  2HWC 3;  4JHT A;  4MAD A;  2W0X A;  4D3W A;  3OYW B;  4YW5 A;  1U5I A;  3JB8 A;  2ZHN A;  3DCQ A;  2A3X A;  5I0S A;  4CCC A;  2J22 A;  4JRL A;  1QY4 A;  1RJ8 A;  4JZR A;  1GQP A;  3N7J A;  4TSV A;  3HPN A;  4ZZ5 A;  3LD8 A;  4CDU A;  3IBM A;  3KVA A;  4FOQ A;  2R07 2;  3PUS A;  1RL3 A;  4JTN A;  2XBO 1;  5FZ0 A;  5C3R A;  3WDY A;  3WF3 A;  1DIW A;  1NKG A;  1PX3 A;  2E7Q A;  5EZW A;  2PN5 A;  2CWS A;  4K40 A;  3OEA A;  1BHG A;  5C9A B;  5C8C B;  1W04 A;  3GYD A;  4IES A;  3K48 A;  4IL7 A;  4LXL A;  3FLR A;  3OPZ A;  2UWB A;  2WYF A;  1XE0 A;  2A1X A;  3LA3 A;  4MGI E;  4B7K A;  1HV0 A;  4Z82 A;  2FZ1 A;  2ZGR A;  1BK1 A;  1FOD 1;  1QDC A;  4YM2 A;  2JEM A;  1QJU 1;  3AMN A;  2JDH A;  3VDD C;  1ULG A;  2K0G A;  3D8C A;  5J1X A;  5CFC C;  4UT5 A;  4DXR A;  1C28 A;  1Q8S A;  1FV3 A;  4LKE A;  1LU1 A;  4LT5 A;  5FPL A;  3RI8 A;  2EA7 A;  2QQI A;  5E6H A;  2BNO A;  3U1X A;  4BLI A;  1FMD 1;  3VDD A;  1F31 A;  3VD5 A;  2NZ9 A;  2UYB A;  3RJ2 X;  1QXJ A;  2AZ5 A;  2E9Q A;  3PTR B;  1H8T B;  5I8Y A;  2RS5 1;  5A1A A;  5IVB A;  2R07 1;  5AVP A;  4XET A;  3ZYB A;  2W5F A;  4FCA A;  2YZ4 A;  2PLV 1;  3THD A;  5K0U A;  4BQY A;  1CJP A;  1ZZ9 A;  1ENX A;  5FUP A;  4R9B A;  2OPK A;  3VBF C;  1E5H A;  1A78 A;  2PYT A;  1W06 A;  2V5Y A;  4GQ7 A;  2IVI B;  2W1Q A;  3ZXJ A;  1C3H A;  4L92 A;  4BQW A;  1ZRI A;  3R05 A;  4PCR A;  3ZXG A;  4DRR A;  2RDQ A;  4ZU4 A;  2WQZ C;  4XJU A;  5FO9 B;  2D97 A;  2BWC A;  1DGW X;  4QDQ A;  1OBN A;  4IEY A;  1DLC A;  2E32 A;  4LE4 A;  5F5C A;  5DDJ 3;  1N3O A;  5FXX A;  2AUY A;  3ILF A;  4NID A;  4ARX A;  3D5O A;  5LCW L;  4DZG A;  1DQ2 A;  1D7P M;  2P17 A;  1NYW A;  2A6Y A;  2HWE 2;  1OA4 A;  2I45 A;  4KWU A;  3ZN5 A;  2DVB A;  1XYN A;  2OYZ A;  5FY1 A;  2YGM A;  3O0X A;  4UYB A;  2RMU 2;  2B9V A;  5LAS A;  2HH9 A;  1LJ7 A;  2CDO A;  2W3J A;  2EXJ A;  1N47 A;  4QHB A;  4P9W A;  5A3N A;  2VQU A;  4IEZ A;  1HRI 1;  4AQT A;  4GH4 A;  4RGA A;  1SCR A;  4EWD A;  2HWB 3;  3AZX A;  3ZSM A;  4XHX A;  1BVP 1;  1NE6 A;  4AE2 A;  2EF6 A;  1ZBA 3;  3THC A;  4LA3 A;  4C91 A;  3AVR A;  4XMI A;  4EWE A;  2VW0 A;  2VXR A;  1K5M A;  3K46 A;  4LR4 A;  5F5A A;  5IT6 A;  1CD3 G;  1AYN 2;  1UZW A;  5IVV A;  2IVJ A;  2WT2 A;  3ELN A;  1OVP A;  1X9T A;  4GMP 0;  4RHV 3;  3VBH C;  5BYN A;  4AI3 A;  2C9A A;  3OBA A;  1PVC 3;  3QLQ A;  5FWE A;  2VMF A;  4WM8 B;  5L9R A;  2BRT A;  4KU8 A;  4FTS A;  2ZAC A;  1PGL 1;  3GZU C;  3JBG 1;  1RUE 2;  3ILN A;  4IGQ A;  4PQ9 A;  2VNR A;  3M3O A;  4XXP A;  3VL9 A;  5CA6 A;  4IEQ A;  4DUX A;  3HMY A;  1SLL A;  1F35 A;  2ZS6 B;  3GGL A;  3MEP A;  3QH6 A;  4HN0 A;  5T55 A;  1I5Z A;  4XDO A;  5CAZ A;  5BV6 A;  1VB2 A;  1I6X A;  1MQT A;  4QXH A;  4NO4 A;  1CAX B;  2J1A A;  1EUT A;  4AAP A;  1QNY A;  5A6Q A;  2EAK A;  5FQ0 B;  5JLV A;  1IOA A;  3I3M A;  3FLT A;  3IDB B;  5GZD A;  2BUK A;  3MHZ A;  4NVP A;  1G9A A;  3AMQ A;  4S2G A;  3KMH A;  4SBV A;  2A6V A;  3SC7 X;  3T08 A;  3A0K A;  3FWE A;  4RGK A;  3EHK A;  4YM1 A;  4ZU7 A;  3Q8F A;  3IMM A;  4AVB A;  1CQ9 A;  1UX6 A;  3PJQ A;  2RDR A;  4LQR A;  5F2S A;  3AP6 A;  3S5Q A;  3WOG A;  1C4R A;  3DGT A;  3OB8 A;  5FJH A;  4AVT A;  1CAU A;  2VZT A;  3LIH A;  3BIW E;  5DN2 A;  1PVC 2;  2AC1 A;  3PUA A;  4MX3 A;  2VPV A;  1RUE 1;  1WZX A;  2H6B A;  4YGD A;  5BNO B;  1PX4 A;  4ZPI A;  3LA7 A;  1GP4 A;  5EFU A;  5KBF A;  4BOW A;  2ADE A;  1H2L A;  1ND2 C;  2QVS B;  2VE1 A;  2GME A;  1WCQ A;  2R1B A;  1NQJ A;  4OHV A;  1EP0 A;  3W20 A;  4CDQ C;  1U5Z A;  5FPB A;  4P08 A;  3WX5 A;  3ZFE A;  5DAB A;  3KCC A;  2HKX A;  2P4E A;  1RUJ 2;  3N7K A;  1Z7S 1;  2ZXQ A;  1VAM A;  1R1Z A;  2VUJ A;  1JUI A;  3LSD A;  5FZI A;  3VKM A;  1V9U 1;  4IND A;  1EY2 A;  4Q27 A;  4DPN A;  1WBL A;  3DEM A;  3CJX A;  5CU1 A;  1V9U 3;  3BAL A;  3CO2 A;  5JPN B;  3DN7 A;  1OLM A;  5C3P A;  4QXC A;  1PGW 1;  1O3Q A;  1S0B A;  3A0N A;  4FXG B;  4NWW A;  5FMD A;  4QPI A;  2BGC A;  5ANQ A;  3IT8 A;  4BIS A;  1MZ5 A;  4CUB A;  3NW4 A;  1JYN A;  4AAX A;  2R49 A;  1ZRC A;  3GCW A;  4J25 A;  1GSL A;  1ZBE 1;  5FZE A;  1ZYB A;  2OKX A;  2XJV A;  3KT4 A;  2PAK A;  4CCE A;  4OI2 A;  2EIG A;  4PDW A;  1CGP A;  3WP5 A;  4BXF A;  2MEV 3;  3L9J T;  1J83 A;  4Z2A A;  4NPR A;  2WT1 A;  5L7O A;  2QQM A;  2WC2 A;  3USS A;  1VAL A;  5IK4 A;  4IE7 A;  4FFG A;  4N43 A;  1MEC 2;  3V56 A;  5KHJ A;  2G19 A;  2JE7 A;  4H7L A;  1HRI 3;  2NMO A;  1T6G C;  1DQ0 A;  1V9U 2;  2WSU A;  1QIQ A;  5JR7 B;  1IG0 A;  5IAT A;  3D0S A;  3U75 A;  1JI6 A;  1MR5 A;  1ND3 C;  1H8T A;  2D5F A;  1OQE A;  2Z42 A;  2QQU A;  4LA2 A;  1LNS A;  1PMH X;  5FPX A;  3VV1 A;  3FX3 A;  1UKG A;  4PI0 A;  1W6P A;  2DCK A;  2DUO A;  5C9A C;  5FV3 A;  2TNF A;  4AFB A;  5LRR A;  5B4N A;  2IXH A;  4PF1 A;  5C3Q A;  4G4F A;  2HWE 1;  3HN3 A;  3USU A;  4LPL A;  2XJR A;  4FPF A;  2GN7 A;  2XXZ A;  4XQW A;  1PVC 1;  2A3Y A;  4WBB A;  4N53 B;  1CN1 A;  3I7D A;  2XHK A;  4RHV 1;  1ONA A;  3U78 A;  2C6S A;  4XXA A;  1IPJ A;  1C8M 1;  5CIR A;  3MFA A;  1RUC 1;  3OGJ A;  4FOY A;  5BPX A;  3U4S A;  1KFX L;  1RYY A;  3H1W A;  1RTV A;  1NA1 C;  2R0H A;  4JVA A;  5IVJ A;  1RUJ 3;  2UY9 A;  4IV1 B;  2R07 3;  5CFD A;  3NJV A;  3TNQ A;  3WVJ A;  1GNY A;  1XNB A;  2VVF A;  2QCS B;  2ZEY A;  2BEO A;  2OZ6 A;  5GLW A;  5T5J A;  4DMI A;  3VD3 A;  5FYB A;  3TEX A;  3K3N A;  4C1W A;  1QOT A;  2PHF A;  3H3U A;  4XIL A;  4CE8 A;  4QPG A;  5KXD A;  1BCX A;  1ZBA 2;  5FZG A;  3I3Q A;  1UY0 A;  1FI2 A;  2JJ6 A;  1UZZ A;  2VZP A;  1PO2 1;  3CHX A;  1VAV A;  1U5Y A;  2VZO A;  3HOB A;  2WWS A;  4B7E A;  1LRH A;  2PXJ A;  3PUQ A;  1IS5 A;  3JBG 2;  1AR8 3;  5A3P A;  4IW3 A;  1N3Q A;  1O6U A;  4CRQ A;  5A1F A;  2QUO A;  4W4Z A;  1PZ7 A;  2BTV C;  3PNA A;  4NRQ A;  2B8M A;  1RUH 3;  4COZ A;  3B94 A;  4MLO A;  3VB9 A;  2QZ3 A;  1IQD C;  2DU1 A;  2X29 A;  3FLP A;  4PI2 A;  1EV1 3;  4TN7 A;  2WYS A;  2XJS A;  4H14 A;  4UOJ A;  5J09 A;  4KWL A;  4HPK A;  1K12 A;  3U4X A;  4HG6 B;  4MYE A;  4HBN A;  5KHI A;  1MS1 A;  3FUO A;  3I59 A;  2XBO 3;  2HWF 2;  4XF4 A;  1JHN A;  5IW0 A;  3JU9 A;  3Q9O A;  3H3L A;  3ZPY A;  5BNO A;  2IXL A;  4O9E A;  4YPJ A;  2WLQ A;  4RR3 A;  4W6Y A;  2E63 A;  1RGS A;  4X6R B;  2C1F A;  3J7M A;  4XBQ A;  3WDX A;  4AED C;  4Q8K A;  2IWG B;  5GLU A;  5J36 A;  5DXD A;  4CYD A;  2FDK A;  1N1T A;  3VL8 A;  1XNK A;  5IAV A;  1DHK B;  2JD9 A;  5FPA A;  4DXZ A;  5C71 A;  3O1O A;  1WME A;  2Y6L A;  5FZ9 A;  5GLT A;  2JDU A;  4UF0 B;  2GH2 A;  3E6B A;  3I4I A;  3D0J A;  4MG2 A;  5FUI A;  2DUR A;  2LM3 A;  1NE4 A;  2VNO A;  2Z79 A;  4DOU A;  1M06 G;  3GZA A;  1YWK A;  2XOM A;  4LHK A;  5FYZ A;  1LGN A;  2Y6J A;  5FY9 A;  2E53 A;  2XUM A;  1Y9M A;  3MLK A;  5FLH A;  3WDT A;  4R52 A;  5I8S A;  3VHP A;  3ZSE A;  2B45 X;  2A6Z A;  4BQ5 A;  2ZEW A;  3IDC B;  1PM7 A;  2D6K A;  3B01 A;  1Y9G A;  1CZT A;  1REF A;  3ST7 A;  1ASJ 1;  5LY2 A;  3T1L A;  4U2A A;  1BLZ A;  2F17 A;  4WZF A;  2DBI A;  3ZFF B;  3EQE A;  2P3I A;  3ZYJ B;  5GAL A;  2EID A;  1O3S A;  1DZR A;  2RS3 3;  1CX4 A;  1G86 A;  5IWF A;  2K2S A;  4LBL A;  3WNL A;  4AVC A;  1FX5 A;  5FRE A;  3UKV A;  2W9X A;  2WR9 A;  3KCX A;  1KIT A;  4BMB A;  1GKB A;  1LOG A;  1R09 3;  2YUE A;  3PUR A;  4UW4 A;  3LDR A;  1NXM A;  3IZO A;  1RUG 2;  4LOR A;  4BME A;  2JX9 A;  3ACI A;  3MW3 A;  3U07 A;  4LMF A;  1BK0 A;  2HWC 1;  1POQ A;  1QQP 3;  2P3Y A;  2XLA A;  4RQP A;  5FYS A;  1SLT A;  5E88 A;  4NIA A;  3VBR B;  4AHZ A;  4F83 A;  2XLG A;  2JIG A;  3IAQ A;  5FYM A;  3W58 A;  4AED B;  5FZB A;  2DTW A;  5FMB A;  4P02 B;  1VE0 A;  1QJF A;  3I2F A;  4EN6 B;  4CP9 B;  1S2B A;  5FZ3 A;  2ZX4 A;  4AHX A;  3HN1 A;  5F39 A;  3M7A A;  3J7L A;  1NLQ A;  4M3C B;  4QX5 A;  4XFG A;  4JC1 A;  1A6C A;  1OKO A;  3NRU A;  3AYD A;  1V6L A;  3JQX A;  1W0P A;  4YZ1 A;  4QD2 A;  1E57 A;  2WNO A;  3KCY A;  1W8O A;  3QBQ A;  4O61 A;  5GLV A;  5ACA 3;  1OQ1 A;  4RFR B;  4LUL A;  5HV4 A;  1W05 A;  3OF1 A;  4Y5S A;  2VOW A;  4P14 A;  4UI9 L;  4GKX A;  1B35 B;  1A8D A;  4R8H A;  1NA1 B;  5LK7 B;  4BWO A;  3RZZ A;  1DCS A;  4BJ0 A;  1AXK A;  1PO1 2;  2VBD A;  1NQD A;  4HOO A;  3KLS A;  4N7U A;  4DXS A;  3DYP A;  1OQD A;  1OPM A;  4LOT A;  2Y64 A;  3MIB A;  2DCZ A;  1RHI 3;  4AF9 A;  1ODN A;  4RHV 2;  5FZO A;  3M4F A;  1GYK A;  1SPP B;  4HVR A;  4JKL A;  4YVS A;  4Y26 A;  4CCL A;  1O4Z A;  4QM9 A;  5JZG C;  3SCH A;  3QH7 A;  3DUI A;  1AR9 3;  3B93 A;  4YVW C;  3N9O A;  4NPM A;  1IPS A;  1VP6 A;  2J1V A;  1HKD A;  4K21 A;  4MGZ E;  3AL5 A;  1V70 A;  1QDO A;  4NHM A;  3KF3 A;  4RGG A;  4YGC A;  4PHZ A;  2WNU C;  3KD4 A;  3T3Y A;  1YC6 1;  3S7I A;  2CGN A;  3PIJ A;  1RIT A;  2JB8 A;  2WO3 A;  2WNE A;  1W9F A;  3B9C A;  4FPO B;  3ABZ A;  1CES A;  3ZX7 A;  3VD7 A;  1AR8 2;  1UW8 A;  2WZ8 A;  3HNY M;  4A44 A;  5I0D A;  2FD8 A;  2JDM A;  2R30 A;  1V6J A;  2JG9 B;  4XTP A;  1PIV 3;  1W2T A;  3OUI A;  4CP1 A;  4LKS A;  4ES9 A;  3POW A;  5IYY A;  1L7R A;  1BEV 2;  1VRH 3;  3KB5 A;  2VMC A;  4KG0 A;  1POV 1;  2ZEZ A;  3ZKY A;  2ZHK A;  4LOS A;  4COU A;  1MS5 A;  2AH2 A;  2ERF A;  2W92 A;  3AYA A;  1UOB A;  4CEY A;  1DDL A;  1I1E A;  2I07 B;  3NJX A;  4W6X A;  2VCA A;  2JIJ A;  5EJ1 B;  3PHM A;  2XB6 C;  1GOF A;  4KG8 A;  4AR2 A;  4COY A;  1OSG A;  1NCR C;  4I0A A;  5FZ8 A;  4HON A;  4GJZ A;  2XJQ A;  4XBN A;  3UJQ A;  1RMU 3;  4IXL A;  1TNF A;  1BBT 1;  3J7H A;  4MGQ A;  3VBU B;  1RED A;  1CZV A;  5C33 A;  2RDS A;  4CDX A;  1VMJ A;  2DUP A;  2WKK A;  4GA9 A;  3V0A B;  1GUI A;  3EJK A;  2YC4 A;  3BTX A;  2RR1 2;  3N7M A;  1JUH A;  2E33 A;  5FLI A;  1ND2 A;  4YM3 A;  1MQT C;  5FPZ A;  2PHR A;  5JSO A;  1OUR A;  5K0U B;  5KC6 A;  2FDF A;  3UGF A;  1RXG A;  3ZXF A;  3M3E A;  1JZ4 A;  1FXZ A;  1V00 A;  1CAX A;  2VTX J;  3ZFF A;  1ENS A;  1JOB A;  1ODM A;  2QQN A;  5IVY A;  2WFP A;  4EYU A;  2JG8 C;  4YGE A;  3WW3 A;  1R1A 2;  3PME A;  2WJS A;  4GZ9 A;  3ZFE B;  2B9U A;  3JZV A;  4OYU A;  4CU9 A;  1QJY 2;  1LOC A;  1RUG 1;  2CSG A;  1RMU 2;  2DVD A;  2ZKN A;  3AXE A;  5DAW A;  2ZTN A;  5FMC A;  2QFE A;  5C7G A;  4GAZ A;  2ID4 A;  2ET1 A;  2WAA A;  4GWJ A;  4QGN A;  4RQP B;  4AI8 A;  5JR2 A;  4DQA A;  4C90 A;  3E6D A;  1N3P A;  4AED A;  3EO6 A;  4ORF A;  5CVR A;  1GP6 A;  4LO8 A;  2VMD A;  1W2N A;  5F3E A;  4AK3 A;  4HET A;  3HD8 B;  4TXW A;  4CDW C;  3WXP A;  4E27 A;  4ERO A;  3ZXL A;  4E2G A;  3FFZ A;  4CP9 A;  1MZF A;  2DTY A;  2CGP A;  4FP2 A;  1UN1 A;  3RMX A;  1OA3 A;  4Q4V 3;  4Z8B A;  5LWB A;  1URX A;  5JXJ A;  4JKK A;  5C4W A;  1HB1 A;  3AVS A;  5H9R A;  5A7Q A;  1CJD A;  3RQ0 A;  1JZ5 A;  3B69 A;  2VY0 A;  2ZML A;  3WNO A;  1NX9 A;  1HRV 2;  4XUT A;  4XYX A;  1RUI 2;  3OPW A;  3ZLI A;  1QHD A;  4OFG A;  4Q2F A;  3UV9 A;  1CAV B;  1HB4 A;  1OXC A;  4IGP A;  2A73 B;  1NG0 A;  1LHW A;  2D3S A;  2DFC A;  3AZV A;  5JOX A;  2B42 B;  1L7Q A;  1ULP A;  2EVX A;  2VMG A;  2W94 A;  3DKQ A;  5LBF A;  3MF9 A;  2NYY A;  1DQ5 A;  2XVK A;  4BZ4 A;  1PZ8 A;  1H0B A;  1KFU L;  2YG0 A;  4R4Z A;  3VGI A;  1O8S A;  3K2O A;  5CB7 A;  2LUW A;  2WZR 1;  2V5D A;  4XFF A;  2JG8 B;  1XC6 A;  3MUY 1;  3BCW A;  1HJG A;  5J3U A;  3ZPO A;  3NWK A;  3M70 A;  5EYX A;  3VDA A;  2YFU A;  4QB1 A;  1UF2 C;  5FYT A;  2IXJ A;  4NN0 A;  5L19 A;  1AR6 2;  3BN6 A;  2HWF 1;  1NA1 A;  4PLN A;  4R9C A;  5E89 A;  2F4P A;  5JAX A;  4AZZ A;  5L9B A;  1POV 3;  5C6C A;  1S0G A;  3FN9 A;  1PVX A;  3FHA A;  2HWD 3;  4JGZ A;  4M01 A;  4UFI A;  1BJQ A;  1C1F A;  1OD3 A;  3LA2 A;  3POY A;  3H8X A;  1XXN A;  3MLL A;  2YRO A;  1O3R A;  3I2I A;  4EN9 B;  2GC1 A;  5DQ0 A;  5FZM A;  3X29 B;  3B9I A;  1LED A;  1O59 A;  5APA A;  4JGY B;  1OC1 A;  3HWJ A;  1I9R A;  1OLM E;  2ORZ A;  2DCT A;  2EXI A;  3B5L B;  2FCT A;  5D2A A;  3S0M A;  1AF9 A;  2E7A A;  1CAW A;  3ZFG A;  5C8C C;  4Y1V A;  1XU1 A;  3W5N A;  4LBQ A;  1W8Z A;  2R04 3;  4B4R A;  4NE9 A;  5FZ6 A;  1VBA 2;  5FAX A;  3O0V A;  4P9Y A;  3CJI C;  1P8J A;  1MVE A;  2Q1Z B;  1C8N A;  2VQ0 A;  2RS5 2;  1W39 A;  4XVH A;  4C0H A;  2BFU S;  5F6K A;  4QQL A;  4X8N A;  2ARA A;  1LOF A;  4Q1R A;  2P6H A;  4UFM A;  5EQU A;  1UMI A;  5HCB A;  1GZW B;  3CU7 A;  1GWL A;  3PU8 A;  4X6Q B;  3O1P A;  4GWN A;  3DV8 A;  4NJ4 A;  2HJI A;  5LEK A;  5ABJ C;  1JS9 A;  2W08 A;  4MO3 M;  5FY4 A;  3WQ0 A;  4CDX B;  4JV4 A;  5GZC A;  2OW4 A;  3B02 A;  2ZGK A;  4XF3 A;  1OA2 A;  4E2Q A;  1JOD A;  1IGO A;  5FDB A;  4BQ1 A;  5C4W C;  4CUG A;  5FO7 B;  1H1I A;  1HQL A;  2MNG A;  1YFX A;  3M8L A;  3SEE A;  2WUH A;  2YXS A;  4CEY B;  4LHN A;  5AC9 2;  2G9G A;  2ZGT A;  4XFA A;  3N9Q A;  3CIH A;  4BK4 A;  4R9A A;  1XSQ A;  2NQY A;  2YBK A;  4XF0 A;  4ZU5 A;  4YZ5 A;  3NKG A;  4RYD A;  4DY5 A;  4CCK A;  3FE5 A;  2FMD A;  3O1V A;  1B35 C;  3O1T A;  5FZD A;  4XFB A;  4EZH A;  4XF1 A;  2BDR A;  2VEC A;  4QT6 A;  2RM2 2;  4XHB A;  4BHP A;  1BYH A;  5G05 L;  3BIE A;  2Y0O A;  2C0Z A;  3MF6 A;  3DF0 A;  1H1A A;  4PBP A;  1SCS A;  2BQP A;  2NMN A;  3EXU A;  1AL2 2;  1W9T A;  3LPG A;  3III A;  2VMH A;  4ZHN A;  1ND2 B;  1Y3T A;  2KA3 A;  3WNN A;  3WCS A;  1LGC A;  3NL1 A;  3RYP A;  4CDQ A;  3BU0 A;  3MV1 1;  3C8X A;  4JGZ C;  5JOY A;  1F8V A;  1C8M 2;  4IEU A;  3ZYP A;  2PQQ A;  4LO5 B;  1H2M A;  5C5T A;  1Q5O A;  4Q4Y 3;  4LBQ D;  4LO4 B;  4QX2 A;  5FOB B;  4IE0 A;  2WLP A;  4GWI A;  4QKN A;  2RHP A;  4HZF A;  4QU2 A;  5F3I A;  4L8Q A;  5CKM A;  5FXW A;  2ZKL A;  3KGZ A;  4LEJ A;  4YRD A;  3AZZ A;  2V73 A;  5FK7 A;  1GNZ A;  3ASI A;  2VL4 A;  4LLO A;  5DG2 A;  5A7P A;  3WQ7 A;  1YIF A;  4EQV A;  2C5D A;  3OBR A;  3CMG A;  3TAY A;  1VBE 3;  1SDW A;  1ASJ 3;  3THP A;  2W1S A;  1W8T A;  4TZD A;  2TEP A;  5F37 A;  4URT A;  3CQO A;  1VJ2 A;  5KXB A;  4CCD A;  3IAP A;  3BPS A;  1TME 1;  2X09 A;  1EPW A;  1Q8Q A;  4JKM A;  2ZBJ A;  2PHT A;  1YI9 A;  5T5L A;  5DAP A;  2JG9 C;  3CNA A;  3RDI A;  4FQZ A;  1FNY A;  4NMI A;  4AVA A;  3JBG 3;  3DPR A;  2WAB A;  3VZK A;  5FUN A;  1ASJ 2;  3AL6 A;  3A21 A;  2AYH A;  4CUC A;  2JG8 A;  3LAG A;  2K46 A;  3VD9 A;  1W8H A;  4MGK E;  2XJP A;  2BNM A;  4CVU A;  4PLM A;  4QQP A;  1DZQ A;  4UFJ A;  3ZDV A;  5FMO L;  1GP5 A;  2ZAB A;  3FL7 A;  5DAX A;  1XU2 A;  1ALY A;  3AP7 A;  1GV9 A;  4KH9 A;  5T5O A;  3KQ4 B;  4FTB A;  3DL3 A;  4LIU A;  3JD7 3;  4UWD A;  5FZ4 A;  4O7X A;  3VHR A;  4LUM A;  2J1S A;  3LEK A;  5LB6 A;  5FCC A;  3VBR A;  4ES8 A;  2VM9 A;  1NCQ C;  4HSL A;  5A80 A;  2QNK A;  1KXG A;  4ATE A;  2OQ7 A;  1ZZB A;  4G3Y C;  4HN1 A;  2A75 A;  4KWK A;  3SEP A;  1W90 A;  2D7F A;  2Q8C A;  1PIV 2;  1OD5 A;  2WO7 A;  3C7F A;  3I2G A;  2BER A;  4GXL A;  3BI3 A;  3MPP G;  3N35 A;  5CBL A;  2OT7 A;  3LE0 A;  4U36 A;  4FFF A;  5LA1 A;  2WDB A;  2V72 A;  3GZE A;  3BTA A;  4BIO A;  1HB2 A;  5F6L B;  4OQ8 A;  1ZRE A;  4OUL A;  3W5M A;  1W6N B;  2VTX A;  4XQD A;  2RVA A;  4XAE A;  1LU2 A;  4BPZ A;  2XKO A;  3ZSK A;  1K42 A;  3D3A A;  4YFW A;  1EUU A;  3WT3 A;  1UIK A;  3CZJ A;  2F4L A;  1SLC A;  4ISR A;  2JEN A;  2YC2 A;  1UOG A;  2PLV 3;  2CTV A;  1UL9 A;  1S2K A;  1N1Y A;  4QPG C;  1RUF 2;  4QMA A;  1AX2 A;  1A3K A;  1BMV 2;  1NCR A;  3AJZ A;  4EZ4 A;  1REE A;  2WQ8 A;  4AL9 A;  3FHI B;  3ZDS A;  4KNC A;  3D6E A;  2D6P A;  1A34 A;  4QDR A;  3WLU A;  4CEY C;  1BBT 2;  5KWR A;  1SPP A;  3ROU A;  4YGB A;  4A2U A;  2LS6 A;  1YUD A;  1Y43 B;  1EPZ A;  1UQX A;  1UU6 A;  2YC0 A;  3E1F 1;  4Q4Y 2;  4OZX A;  2RV9 A;  4DFS A;  3SIT A;  4XFH A;  2NLR A;  2QZ2 A;  1WLW A;  1QU0 A;  3VBF B;  4EN0 A;  1MVQ A;  4MHR A;  2VO5 A;  1DGL A;  1AUY A;  5JZG A;  2HWE 3;  2CNA A;  1FPN 1;  4QX1 A;  4COW A;  1V6K A;  2R06 3;  3MV0 1;  3R4U A;  1PGL 2;  2VUD A;  1ST8 A;  3NAP A;  1WBF A;  1X8E A;  5E16 A;  5IVF A;  5KR7 A;  4Q5O A;  3ON7 A;  3KM5 A;  1F9K A;  1NY7 2;  3TRS B;  1PGW 2;  2RS1 3;  3ZXK A;  2IZW A;  1LOA A;  1J1L A;  4OI4 A;  1XNA A;  4MSV A;  1HX6 A;  2FDI A;  2X8K A;  4OHY A;  4HAN A;  4AI9 A;  4B29 A;  3LQC A;  4F8A A;  4BH9 A;  2Y34 A;  4YG6 A;  3H1M A;  4YAR A;  4AI2 A;  5AVA A;  3AYC A;  3P3P A;  4QPI B;  5K9Y A;  1AYN 3;  4K1Z A;  5B4X A;  4CCJ A;  1JYX A;  2YY1 A;  4CTE A;  1AYM 3;  4FAH A;  2HWD 2;  1DP0 A;  4E8D A;  2IFR A;  4KBB A;  1RUD 2;  5LZ6 A;  4BA6 A;  2W68 A;  3HNB M;  1W6M A;  1Q43 A;  4ASK A;  1D4V B;  1OF3 A;  5LY1 A;  2VAU A;  3TEZ A;  5CIS A;  2A5Z A;  2TUN A;  4XE9 A;  1TNR A;  4A7K A;  3H8R A;  3TEY A;  2HLE A;  5KHH A;  1ND3 B;  5T3N A;  1CIW A;  3RWN A;  3ZR6 A;  1LR5 A;  2VOX A;  3VBU A;  1LGB A;  4K8R B;  1WW5 A;  1SMV A;  4LBK A;  1XYO A;  2NM1 A;  3LFM A;  4BLJ A;  3O5S A;  3OUJ A;  4WVM B;  4AHY A;  2UY8 A;  1W8U A;  2VCC A;  1ZNP A;  5ANN A;  4S2D A;  1PM4 A;  1EAH 2;  2YBS A;  1JYV A;  2VD7 A;  1TME 3;  3I3B A;  4XFI A;  1X8M A;  3T4V A;  1W0O A;  1RUN A;  3DEC A;  1COV 1;  1STM A;  3DPR B;  1CWP A;  3QOP A;  4LK6 A;  3ZIX A;  1D4M 3;  2TBV A;  1ULO A;  3VBO A;  3WUD A;  1TVG A;  3RSJ A;  4FSJ A;  4WV8 A;  2UWA A;  1S4C A;  1HQW A;  1UKR A;  1UYX A;  1W2O A;  1Y9Q A;  2PHX A;  5BNN A;  4UAP A;  1YFW A;  4N53 A;  1QGL A;  2B7Y A;  1AX1 A;  2HBU A;  4IEX A;  4QKB A;  2L9L A;  4QX8 A;  2LW8 A;  3WEZ A;  1MZ6 A;  4MXV A;  1VAK A;  2WWU A;  3A4U A;  4IV3 A;  4L2N A;  2GAL A;  4Q4X 3;  1U12 A;  3AXD A;  4PF5 A;  2BGO A;  2P1B A;  4P9G A;  3KHB A;  2ZAH A;  3AFK A;  4JX0 A;  2BBA A;  1US3 A;  4LO6 B;  1Q8P A;  1XND A;  1YFY A;  5ACA 2;  2Z2S B;  4XIK A;  2H6C A;  1VMH A;  4BIF A;  2DU0 A;  2VZV A;  2YYO A;  3M3I A;  3NVC A;  3H50 A;  3I3E A;  3WNP A;  1RUI 3;  4OMD A;  2AGS A;  5IK8 A;  4KWJ A;  3ZN6 B;  4CDW B;  2GAU A;  4RS5 A;  3P1I A;  1IS4 A;  1HRI 2;  4XMA A;  2OVU A;  1PNF A;  2HYK A;  5T50 A;  1LAJ A;  4FO9 A;  1MS4 A;  2RMU 1;  4TLG A;  5FR3 A;  2X10 A;  5JMO A;  1W0N A;  4NHL A;  4ZKT B;  2XL9 A;  4AQ2 A;  2VCM A;  3J4U H;  5F32 A;  2R1D A;  2YBP A;  3RJR A;  1CAV A;  2D43 A;  1D2S A;  5D8A A;  5JI9 A;  2QQL A;  3R0R A;  4P9L A;  1X36 A;  2VUL A;  5GKA C;  3KWV A;  4A3Z A;  1MZE A;  1FT9 A;  1VBC 2;  1KGY A;  4JGZ B;  3VZN A;  1TQ5 A;  1D0G A;  4N90 A;  2RS3 2;  5FKB A;  1FNZ A;  5ABJ A;  1SLB A;  4XUO A;  3H8U A;  3O14 A;  4D7S A;  1ZBA 1;  4QXB A;  4Q0Q A;  4FOW A;  1LOF C;  1W3X A;  3VHO A;  2QQV A;  2VW1 A;  3SH5 A;  1W2A X;  3K75 B;  3KT1 A;  2MHF A;  4N8M A;  4EE2 A;  2GH8 A;  1H8T C;  3OGS A;  2WZR 3;  4Y33 A;  3HQX A;  5A3U A;  2C24 A;  2AEN A;  2VXJ A;  3I2O A;  2KM2 A;  2XVG A;  1CZS A;  4LBQ B;  5IFP A;  4QGM A;  2G9Z A;  2R04 1;  1NZC A;  3ES1 A;  3E5U A;  4K7J A;  2Y6F A;  4D94 A;  1C5I A;  2WRA A;  3H42 B;  1VBA 3;  2D98 A;  2BNN A;  2R7E B;  4I02 A;  3HJR A;  3ECQ A;  4Y4Y A;  3LPF A;  4XJZ A;  1WWY A;  3IDE A;  1C1L A;  4QQO A;  3OBT A;  4IEP A;  3D4K A;  4CEW B;  4QB2 A;  1WW4 A;  5CKQ A;  2D6N A;  3GZT B;  2VGD A;  3GXU A;  4FP3 A;  1CIY A;  4ZXK A;  4P9J A;  4D8M A;  3HR9 A;  2XUE A;  2MPF A;  2RS1 2;  2PMW B;  3APB A;  3KV9 A;  1UU4 A;  3N9M A;  1GZT A;  3VDD B;  3ACL A;  2YFZ A;  3WDW A;  2HWD 1;  5HXV A;  4CCM A;  1HIX A;  3BOW A;  1DYK A;  1UMZ A;  4OUS A;  1A8M A;  4K20 A;  5KXC A;  4OI1 A;  1G7Y A;  2EAL A;  2HWF 3;  2JE8 A;  2P6C A;  2RS5 3;  3KVB A;  3N9L A;  4DO0 A;  5BNP C;  1AXY A;  4XCA A;  4CP2 A;  1WLD A;  2WII B;  3LDB A;  2I74 A;  1ND3 A;  3R6S A;  1UCX A;  1RHI 2;  1AYM 2;  4IE5 A;  2VR4 A;  5A33 A;  2R6Q A;  3HAG A;  4XAA A;  3LFI A;  3D82 A;  2Y33 A;  4D7Y A;  2ZZJ A;  1RUH 2;  3WP4 A;  4HMZ A;  1SBE A;  5L7O C;  2R0F A;  5A7W A;  1RXF A;  1WD3 A;  4L11 A;  3E5Q A;  2Q8E A;  5FJK A;  4QX0 A;  4M3C E;  1KEX A;  3U37 A;  2I2S A;  2WNV A;  1M4W A;  1J58 A;  2ARB A;  4S2H A;  1SZB A;  2Y0I A;  5JPM B;  2OX0 A;  4PQQ A;  1ZZC A;  4BDV B;  4GH4 B;  3RVH A;  4GJY A;  4Q4V 1;  1FOD 2;  2AR6 A;  1PMJ X;  3NKT A;  3VKN A;  4RA0 A;  1QEX A;  4CP0 A;  3VDC A;  1WA4 A;  2WN3 A;  3RZK A;  5A3T A;  1K5M B;  2WA4 A;  4ZXE A;  4N43 C;  3WW1 A;  1S0E A;  2HEV F;  2G9F A;  4G9S B;  3WZ1 A;  1SLI A;  4V1P A;  2W91 A;  2FDH A;  1JHJ A;  3BVC A;  5GZE A;  3MIH A;  4OMC A;  2HWC 2;  2ZGM A;  1RUG 3;  1B09 A;  3EBR A;  4XPV A;  1XRU A;  4YVS B;  5A32 A;  4CCO A;  4BQX A;  4GUL A;  3ZYF A;  4E8C A;  3ZFG B;  1GLH A;  1RUD 3;  1KJR A;  3GCX A;  2R04 2;  1AZD A;  1PIV 1;  4AXO A;  5GZG A;  1SG3 A;  1LHU A;  1S1A A;  1JMU B;  1Z78 A;  2VZ1 A;  1YIP A;  3WD5 A;  1YEW A;  5JVV A;  1R1A 3;  3GM8 A;  3T4H B;  1LCL A;  4CCN A;  5EPA A;  1L3J A;  1WGP A;  5JXI A;  1AJO A;  3KGL A;  2XL7 A;  4P5Y A;  1NUK A;  4XF9 A;  2CL2 A;  3LZZ A;  1JZ8 A;  2KXL A;  5K8S A;  1NOV A;  4E2S A;  1RUO A;  3MPB A;  2UUR A;  4QKF A;  4I2O A;  4LE3 A;  3DPR C;  5FZH A;  2LAL A;  4D69 A;  4B4Q A;  2RR1 3;  3N4M A;  1VB4 A;  4Y22 A;  3TYJ A;  1N1V A;  5IK5 A;  1LUL A;  1BBT 3;  2E51 A;  1EAH 1;  3T0B A;  3DYO A;  1VBC 1;  3M1H A;  3IM0 A;  1PHM A;  4YG0 A;  1F4H A;  5JXG A;  2A70 A;  3I54 A;  1MS9 A;  1ULF A;  3ETP A;  3OY8 B;  5IJR A;  4XJA A;  4ASM B;  1AYM 1;  5FZK A;  5DMY A;  2V09 A;  1QJE A;  2WAO A;  2AEY A;  3GJB A;  1H9W A;  1AYN 1;  3ZIW A;  2VZS A;  3ZOI A;  4ZZ8 A;  2CDP A;  1PMI A;  3C7G A;  2XHN A;  1W99 A;  2N7G A;  4J6G A;  4CU7 A;  4EN7 B;  4IEO A;  4CDQ B;  2PTM A;  2WZP P;  1E5S A;  4LBN A;  3IIA A;  2JD4 A;  5CG9 A;  5AC9 1;  1G6N A;  5FXV A;  3VBS B;  1NT0 A;  4NOT A;  2PHD A;  3O7O A;  2NPI A;  2YB7 A;  1BXH A;  3AKP A;  3TN9 1;  5ACA 1;  5I91 A;  2DFB A;  4PIY A;  2C26 A;  4TWT A;  4QPW A;  1PK6 C;  2UYA A;  3RRD A;  1GZ9 A;  4GH4 C;  2FCV A;  1VBE 2;  2ZGL A;  3SCG A;  1RUF 3;  4I30 A;  2QQK A;  4AFD A;  3LIG A;  1YQ5 A;  1AJK A;  1WKY A;  4KMQ A;  3THT A;  4AWD A;  4CUA A;  2BOJ A;  1YNA A;  2QDN A;  4JQT A;  4WVV A;  4QHZ A;  2CY6 A;  3G6J B;  4PDW B;  3A23 A;  1VRB A;  3MYX A;  4HK8 A;  1KD7 A;  2ZGQ A;  4YVS C;  4Y20 A;  3VKL A;  1DQ6 A;  1AXZ A;  3N36 A;  3NAP B;  3POJ A;  5A3M A;  3OD4 A;  3ZFG C;  5DUV A;  4N9I A;  1S0J A;  2ZZQ A;  4QAW A;  4FBF A;  2IFW A;  2DWR A;  5FKC A;  2BZD A;  3ZVX A;  4D6Q A;  1LES A;  3IPV B;  1OLQ A;  1FAY A;  3ILR A;  4LTA A;  5K0U C;  1LOD A;  1D4M 2;  1VBD 3;  2XWJ B;  4M3C F;  2W1U A;  4CDX C;  3CL1 A;  4UFK A;  3AMH A;  5LA9 A;  4CSW A;  3NNF A;  3OOX A;  5A6X A;  4HT1 T;  4OLL A;  4AEK A;  5C8C A;  1O5L A;  1S2E A;  1HQN A;  5LRS A;  2GN3 A;  2CYF A;  2VQT A;  2DCJ A;  4M4P A;  1APN A;  2JDP A;  1UY4 A;  3ME2 A;  3AKS A;  4RD7 A;  1AX0 A;  3T0D A;  1IHM A;  5A7W B;  3OSD A;  5FK8 A;  1RVF 3;  5JUV A;  1QMJ A;  1QOO A;  1R64 A;  3K4D A;  4OUM A;  4PBO A;  3K3O A;  5DUU A;  5HCF A;  4B4P A;  4XQ4 A;  4URA A;  2D3R A;  3BKZ A;  1E5R A;  2IXI A;  1W8W A;  5FY5 A;  5BNP A;  4FPK A;  1JXN A;  1HW5 A;  3J9S A;  4NIG A;  1OT5 A;  1ZRR A;  5A32 B;  1QJY 3;  1DFQ A;  2YU1 A;  1NCQ B;  2QE3 A;  2RE9 A;  3LGR A;  5SV5 A;  2GC2 A;  2VOT A;  3Q8B A;  4MXW B;  5A6Y A;  2WSV A;  1H1M A;  1WCD J;  3AZW A;  3IMN A;  1R08 1;  4UW5 A;  1W2U A;  2QBX A;  4Q1P A;  1KJL A;  1F2N A;  3K4Z A;  5KHG A;  4KU7 A;  3AP5 A;  4BQ2 A;  5FY0 A;  5CFC A;  1BZW A;  2JDK A;  3VBS C;  5F5Q A;  3WSO A;  1PK6 B;  2RS1 1;  1CON A;  2JXA A;  1AL2 3;  3GHN A;  2BGP A;  2ZHM A;  1LTE A;  3I8T A;  1EV1 1;  4B3N A;  5L36 A;  4HLT A;  1COV 2;  3IN9 A;  4I0B A;  1VBE 1;  3O1S A;  2R06 1;  1VBD 1;  3MID A;  4NHK A;  5FYC A;  2X53 S;  3DYM A;  1CAW B;  5CKN A;  1H4H A;  4NRO A;  1LHV A;  3ZSJ A;  2SBA A;  3AP4 A;  3TEW A;  5FZ1 A;  1O4T A;  4KL1 A;  4MH0 E;  2WO2 A;  2D44 A;  1NZI A;  2BV4 A;  3VBO B;  2QKD A;  4A6O A;  3ES4 A;  5L73 A;  2Y8K A;  2GU9 A;  3K4A A;  2WZR 2;  1QJY 1;  1UZ0 A;  1UY3 A;  4IEW A;  4LHS A;  2GNM A;  1OFS A;  5HCH A;  2VCB A;  5FBJ A;  2AAC A;  4B8E A;  4CDW A;  3UK9 A;  3QAC A;  2F6B A;  4B1L A;  4BXS V;  1X7N A;  1GQH A;  1JBC A;  5HPO A;  4V2W A;  5FP8 A;  2QTW B;  3ZXA C;  5J37 A;  3OUH A;  1G9F A;  2ET7 A;  3C7E A;  2C9K A;  4MUV A;  2FDG A;  4Y22 B;  3RZH A;  4DUW A;  3UKT A;  4RR3 C;  1TMF 3;  3GBW A;  4P5H A;  1SFY A;  4FPE A;  1RUC 3;  3BB6 A;  4Q0P A;  4YW4 A;  4AI1 A;  2DDU A;  2ZGP A;  4OHZ A;  1G9B A;  3VLB B;  4RN5 A;  3GDB A;  5FXZ A;  4Q26 A;  3UT0 A;  2VNV A;  3UL2 A;  4A6S A;  1YJK A;  3TBD A;  2YPD A;  2WO1 A;  3WF1 A;  4XJ9 A;  3RZG A;  3U10 A;  3UJO A;  3T0A A;  1ZBE 2;  2RJK A;  3NQH A;  2OZJ A;  3NNL A;  4GAL A;  1HXS 3;  1NY7 1;  1XNT A;  3AC0 A;  2RM2 1;  2W87 A;  3NST A;  3H0O A;  5T54 A;  2D40 A;  1SFN A;  1UU5 A;  2EXH A;  3SH4 A;  4P9X A;  1DF0 A;  1OH4 A;  3KT7 A;  1XYP A;  4UW6 A;  5FFO C;  5BNN C;  4YW7 A;  4GB3 2;  4XUP A;  2B46 X;  2VOV A;  5GJ6 A;  5FIX A;  3SXW A;  4IET A;  4L0P A;  1CPM A;  3JD7 1;  3WP6 A;  3HBK A;  4IV3 C;  4ASL A;  1SQ4 A;  2MEV 1;  2VNG A;  1LEC A;  3S6P A;  1CPN A;  2ADD A;  5CEH A;  1IKP A;  1RVF 2;  5AFE A;  3S5A A;  1RUJ 1;  2ARC A;  4HKL A;  4JQR A;  5FYV A;  1U0A A;  3KSC A;  4LLF A;  4XW3 A;  3J8F 2;  5EP9 A;  1EAH 3;  3FHQ A;  5KHK A;  2CGO A;  1C8M 3;  2B4K A;  1WCU A;  4XZU G;  4XOG A;  1RUF 1;  2ZX3 A;  3HEI A;  4YW3 A;  3T2Q A;  2RR1 1;  3UKN A;  2EIB A;  2XH6 A;  4R9D A;  1EV1 2;  3FBM A;  2P3J A;  5JDB A;  1AR7 2;  2AEZ A;  4J1W A;  5FY8 A;  5GZF A;  1KRI A;  3MW2 A;  2YPJ A;  5B2G B;  1J3R A;  1X33 A;  3ZM8 A;  3PMS A;  4OZO A;  2XBO 2;  5AC9 3;  3NNG A;  4DNY A;  5F3C A;  5IVC A;  1G9D A;  1W8F A;  4AGR A; 
#chains in the Genus database with same CATH homology
 5FPB A;  5A7N A;  2XML A;  5ISL A;  4Y33 A;  5FZH A;  5A7P A;  4AI9 A;  5A7S A;  3AL5 A;  4D6R A;  4V2V A;  5IW0 A;  5FPU A;  3K2O A;  5FPL A;  5E6H A;  5FY0 A;  4CCJ A;  5FZC A;  2GP5 A;  5FZI A;  5FZO B;  4D6S A;  5F37 A;  3ZPO A;  3PTR B;  4ASK A;  5FYT A;  5FZK A;  5IVB A;  5LY1 A;  4GD4 A;  2GP3 A;  4QXC A;  4QX7 A;  4XDP A;  5FY7 A;  5FPA A;  5FYC A;  5K4L A;  5FZ9 A;  4UF0 B;  5FUN A;  3AL6 A;  2XUE A;  5ANQ A;  4BIS A;  5FZ1 A;  3KV9 A;  3KV6 A;  3N9M A;  4C8D A;  4CCM A;  4Y3O A;  5FZM A;  5FZE A;  5FXV A;  5FYZ A;  5FY9 A;  2P5B A;  5FBJ A;  5F5C A;  4NUB A;  2YBS A;  3N9L A;  2VD7 A;  3KVB A;  5FXX A;  4DO0 A;  5FPV A;  4V2W A;  2WWJ A;  3KV4 A;  5FP8 A;  4BXF A;  4QU1 A;  3LDB A;  5FZ8 A;  4Y4R A;  4HON A;  4GJZ A;  4UF0 A;  4LIU A;  5FP3 A;  5FY1 A;  5FZ4 A;  3DXU A;  5FZ6 A;  5LY2 A;  4LIV A;  4BU2 A;  5A80 A;  5A7O A;  5FP9 A;  5FYY A;  5IWF A;  4DIQ A;  2OQ7 A;  5FXZ A;  5A7W A;  4QX8 A;  2YU2 A;  2OS2 A;  2Q8C A;  2Q8E A;  2YPD A;  3PUR A;  5FJK A;  5F5I A;  2WWU A;  1VRB A;  3AVR A;  3NJY A;  5FV3 A;  5F5A A;  3PU8 A;  3DXT A;  2OT7 A;  5IVV A;  5FYS A;  2Q8D A;  5FY4 A;  5A3N A;  5FYM A;  2OX0 A;  5IVE A;  5IVY A;  5FZB A;  4EYU A;  5F3G A;  2XXZ A;  3RVH A;  5FWE A;  4GJY A;  4QWN A;  4D6Q A;  4CUG A;  3U78 A;  5LW9 A;  3UYJ A;  4IGQ A;  5FZ3 A;  3U4S A;  5FWJ A;  5F39 A;  5FZ7 A;  5FUP A;  3N9N A;  3PU3 A;  5F2W A;  3N9Q A;  5A3T A;  5FP7 A;  5FZF A;  4GAZ A;  4XDO A;  3OPT A;  4CSW A;  5IVJ A;  2YBK A;  4QXH A;  4IGO A;  5A3W A;  4AAP A;  5CEH A;  4EZ4 A;  2OQ6 A;  5FYI A;  4CCK A;  5FYB A;  5F3E A;  3K3N A;  4LIT A;  5FYV A;  3LD8 A;  5F32 A;  5FZD A;  2YBP A;  4EZH A;  3KV5 A;  5FZG A;  3KVA A;  5FZA A;  4CCO A;  5A7W B;  3PUS A;  5FZ0 A;  5FYH A;  5LWB A;  5A1L A;  3PUQ A;  2PXJ A;  3K3O A;  5FP4 A;  4HOO A;  3AVS A;  5A7Q A;  4URA A;  5FY8 A;  5F2S A;  5A3P A;  2XDV A;  5A1F A;  5FJH A;  2W2I A;  5FY5 A;  3PUA A;  3PDQ A;  4LXL A;  4CCN A;  3OPW A;  4TN7 A;  3ZLI A;  5FZO A;  5IVF A;  5KR7 A;  2YU1 A;  3N9P A;  4IGP A;  5FYU A;  4CCL A;  4E4H A;  4QXB A;  5F3I A;  5F3C A;  5IVC A;  5FZL A;  3N9O A;  5FXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...