5A7QA

Crystal structure of human jmjd2a in complex with compound 30
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
351
structure length
351
Chain Sequence
SESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title Docking and Linking of Fragments to Discover Jumonji Histone Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 109
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a7qA01
5FZ3A 3PU8A 2OQ7A 5FXWA 5FPLA 5FYSA 4Y33A 5A3WA 5IVBA 5A7QA 4CCNA 2PXJA 5IVJA 5IVVA 5A1LA 5FBJA 5FY0A 5A7WB 3ZLIA 4IGOA 2GP5A 3OPTA 4LITA 3N9MA 3KV6A 5F3CA 5A1FA 5FY5A 5FZIA 4NUBA 3KV4A 5ISLA 3N9QA 3LDBA 4QXCA 5FXZA 4EYUA 5FXVA 3DXUA 3K3NA 3KVBA 3PUQA 4BXFA 4LIVA 4C8DA 4QXBA 4CSWA 5FZ7A 3KV5A 3ZPOA 5FYHA 4QU1A 5IWFA 5A7OA 4DIQA 4GD4A 5A7SA 5FZ4A 2YBKA 4EZ4A 5FWJA 5F3IA 4CCMA 5A3TA 5F5AA 3U4SA 3K2OA 3N9NA 3DXTA 5F39A 5FZHA 5A3NA 5IVFA 5FYVA 5FP9A 3LD8A 5FYBA 3KVAA 2XXZA 5FP8A 4CCLA 3AL5A 4CCOA 5LY1A 5FP3A 3PURA 5FZDA 5FZBA 4BISA 5FUPA 2OQ6A 4V2WA 5F2WA 4D6SA 2YPDA 2YU1A 5FYCA 3PU3A 3PUAA 4UF0B 5FP7A 2Q8DA 2WWUA 4ASKA 4DO0A 4EZHA 5IVCA 5CEHA 5LWBA 5FZ8A 2OX0A 4QX7A 3RVHA 4CCKA 5FZMA 5FZLA 5FWEA 5FV3A 5FYIA 3UYJA 5FPAA 2GP3A 2XDVA 4IGPA 4LIUA 4D6QA 1VRBA 2YBSA 5FZOB 5IVYA 4E4HA 5F5CA 3KV9A 5FUNA 5FYYA 5FJKA 3PDQA 5FY7A 5FZFA 4CUGA 5FY8A 5A7WA 3PTRB 5F2SA 5FZGA 3K3OA 5FXXA 5K4LA 4Y3OA 5A7NA 5F5IA 5FZ1A 5FZ9A 5FZKA 5LY2A 4BU2A 2YBPA 5ANQA 4CCJA 5F3GA 4GJZA 4XDOA 3N9PA 5F3EA 3AVRA 5A3PA 5FPBA 5FZAA 5FZ0A 5FYUA 2WWJA 3U78A 5FY9A 5FZEA 2YU2A 4GJYA 4D6RA 5IVEA 5F37A 5FZ6A 3PUSA 5FYZA 5F32A 5A80A 3OPWA 5FYMA 2XUEA 4AAPA 5FJHA 5FY1A 5FZOA 4AI9A 4HONA 2W2IA 4HOOA 3N9LA 2Q8CA 3AL6A 5FYTA 4QXHA 2OT7A 4TN7A 4GAZA 4LXLA 4Y4RA 2P5BA 4IGQA 4QX8A 5E6HA 2XMLA 2OS2A 4QWNA 5A7PA 5IW0A 4URAA 5FY4A 5KR7A 4V2VA 3AVSA 2Q8EA 5FPUA 3NJYA 3N9OA 5FPVA 5FP4A 2VD7A 4XDPA 4UF0A 5FZCA 5LW9A
chains in the Genus database with same CATH superfamily
2RJKA 5A33A 4I0BA 3RZGA 2ZJCA 3KHCA 3K4AA 2RE9A 4N9IA 3WQ1A 1C8NA 4WV8A 2JDKA 2OUHA 1JUHA 2QQWA 3ZYFA 4PLNA 3TOJA 3FE5A 2VCBA 4QKBA 5JWPA 2C9AA 3D8CA 4M3CE 1UYYA 4QT6A 5J96B 1B09A 1TMF2 4AVSA 1F5FA 2E51A 2W39A 1Z78A 1X82A 5JIUA 1WLTA 3Q8FA 1V6IA 4IEZA 4IDZA 4Q0PA 4B1MA 2ADEA 1W2TA 2RMU1 3JUUA 4AGGA 4YW5A 4NIIA 1EV13 2OPKA 3JD72 1DZQA 3WSOA 1ZM1A 2XWJB 4BMEA 4XACA 4HZFA 2B46X 5FTTC 3GHMA 2Z5WA 4JGZB 5JI7A 4Z1VA 1RUJ3 3S30A 3F95A 5DUWA 1IQAA 3T0BA 1KD7A 2ARXA 2EAKA 4FAGA 1PK6A 1TG7A 2ENRA 4Q1RA 4NWWA 2YBKA 4XUQA 2E9QA 2VUAA 5LB6A 4AK3A 2V09A 2SLIA 3VBHA 1W8NA 2QQKA 1OI6A 2C9KA 5EYXA 1PMIA 1GSLA 4LNVA 4DZGA 3OUHA 3BIEA 2YG0A 3NV3A 2W47A 5FP9A 1ZZ6A 4K9SA 2AEYA 2YHJA 3GBGA 4P9LA 4RGGA 4XF1A 4AGRA 1F35A 4FFHA 4CCOA 3HT1A 3FUOA 2LTNA 2XVGA 4IV3A 4QD2A 5FP3A 4XILA 1OH4A 1QJY1 2A73B 3WX5A 4F8AA 1WW6A 3OYWB 2ZX2A 4FI9A 3RI9A 3V65A 4DUVA 4BLIA 1J3QA 1LESA 4EWEA 2Z4FA 1CAWA 2YU1A 1D0HA 1QJU1 2AZ5A 2B45X 4FCAA 5AC93 1PIV1 3BIWE 2E63A 4HLTA 3QD6A 3RZMA 3RJ2X 5AFBA 5EXOA 2TUNA 3OSDA 2NYYA 4LLOA 1GNYA 1TME2 1UQXA 4CDXA 4CCKA 1RUNA 4R9CA 1C5HA 1HB2A 1WLDA 5J36A 1ENRA 4XF9A 1G9DA 4LA2A 5C9AB 4CEWC 4UFHA 2CU5A 4WZFA 1BMV2 1J1TA 3CJIC 1YCIA 4UW5A 1Y9GA 1JHJA 5ANQA 3AP9A 1W9WA 4LBNA 1G8WA 4XDOA 4MVTA 5FZAA 5H9QA 5C5TA 4CDQB 3M3IA 4AR2A 2ZX4A 1B35C 3KF5A 1HRV3 2XR4A 4DEQA 1LHUA 2EVXA 4MGKE 3WDUA 4Q4V3 3U10A 4WVMB 5F37A 4X8PA 2PLV1 1S1AA 4PI0A 5BNOC 2OZ6A 4A7KA 2YGLA 1AR71 1EAH2 4YZ1A 4XFFA 4MH0E 4EJRA 3WV6A 1RUD1 1HQWA 4JGYA 3MO4A 2Y6FA 3H42B 3ZSEA 3VL8A 1OHFA 2JB8A 4TN7A 3WNXA 5D8AC 4QX8A 4NPLA 3ZFGC 2X8KA 5J09A 4LLFA 4YFZA 2ET7A 3ZSMA 2BUKA 4QWNA 5K0UB 4A4AA 5KWRA 2UWCA 1E5IA 5JSPA 1BEV2 3ZPYA 1R092 1ODNA 2UWAA 1MVEA 1AX1A 1ASJ1 1FI2A 2XH6A 4FFIA 4XQ4A 4XXAA 5FPLA 1ZRIA 2ZHNA 2B42B 5JCTA 1V9U2 2OPWA 1DG6A 3WW3A 1POV0 1PZ7A 1GR3A 1QF3A 5FK7A 5A7QA 1U5ZA 5L9BA 4BIOA 4YVSA 4FQZA 1JZ7A 1SLTA 3PIJA 4XMIA 5C9AA 3OPTA 3MDPA 4LITA 3MZHA 3H9AA 5DABA 1UZWA 5JMOA 4BJ0A 2ZTNA 4R4XA 1X36A 4FQ4A 2PAEA 4QPWA 5FXVA 4LO7A 3I59B 5C71A 1UXZA 4IUGA 2GC1A 4UXAA 2Y38A 4CPBD 3A0KA 4ATEA 4CDQA 5JPNB 2NLRA 3OD4A 4S2DA 3D6EA 4A41A 1VBC3 3H3UA 4AEDB 2FDIA 1SDDB 1HB4A 2JE9A 2C0ZA 1VLNA 2A70A 2EIEA 1E5SA 4WVMA 3ACFA 5F3IA 3Q9OA 3FHIB 2JD4A 4G9SB 2C1FA 3K2OA 1UAIA 2ZZQA 3MLLA 3Q8CA 3POIA 1LHWA 4NAMA 3UKTA 1YFXA 5BNPC 2VTXJ 3VHOA 2WDBA 1DGWX 3CF6E 3VBOC 2P4EA 4IEPA 2VNVA 4COZA 2BPA2 1NQJA 2LROA 5IK8A 1CD3G 3VHPA 4B4QA 5FLIA 1CPMA 1ZA4A 2E6VA 1HV0A 4QB2A 2ZMNA 5T50A 3I49A 3KZ4C 2HWB2 3C7EA 2FQPA 3ACHA 1BJQA 3MV11 2HLEA 3PU3A 5K0UA 4AI1A 4Q4Y1 2WWUA 4OMDA 3UNPA 2BP6A 3LOBA 1XNTA 2VZ3A 5FZ8A 2VVFA 5L9VA 4I3GA 3OGVA 2YY1A 2JIGA 2ZHLA 3R4UA 1GICA 3V56A 2Y34A 4CU7A 1FYUA 2P2KA 2YBSA 2ZABA 3I7DA 5CKMA 5HCFA 5JI9A 4XJ8A 4UOJA 2V73A 4QQPA 4B7KA 3VHNA 4LE3A 2QDRA 2IVJA 1U0AA 1X33A 5F6KA 1YFUA 4CCJA 1G86A 4HL0A 1UMZA 1PMHX 4M0NA 4DXRA 2JKBA 4AZZA 3VD7A 4QPIB 4L2NA 1Q5OA 1AYN3 4P02B 1QH7A 2VTXA 4JKLA 3ZVXA 4Z92B 3ZYJB 4Q26A 2Y6GA 5LRRA 3RG0A 5E89A 1XPWA 1MQTC 1OQEA 5IYYA 2IXIA 1R64A 1NKGA 3AMNA 5LA2A 3RSJA 1AR61 3W5NA 4AEDA 2JX9A 2WS92 4RS5B 5JSOA 3CL1A 5LRSA 1GZTA 1C8M3 1RXGA 3JBG1 1JZ8A 2ARBA 1AVBA 4OMCA 5FJHA 5FY1A 4UW3A 4HONA 3N9LA 1VAMA 1OFSA 5CIRA 3AL6A 3ABZA 4IEQA 4OFGA 4D8MA 2HWF3 1HJGA 1AZDA 5HV0A 2A71A 4E27A 4LBOA 1H1MA 1HQLA 2XMLA 1SFPA 4RQPA 5FMOS 3CHXA 1SFNA 4IQPA 3ZDSA 2JWPA 3INAA 1FX5A 3CZUA 4G4FA 2XVKA 4BZ4A 2WZR3 4Q4W2 1Z0HA 1VBD1 1EYBA 2JDUA 4XDPA 2D44A 1OXCA 2WO2A 4GMP1 4PI2A 2RVAA 4XDQA 1F4AA 2GN7A 1QJX3 2P37A 3NRUA 1PVC1 4YSFA 3HT2A 3ZLIA 5T5JA 4H55A 2WLPA 3M7AA 3OBZA 5APAA 3VKNA 3J8F1 4YLZA 1IZ3A 1A3KA 5DUXA 2GH2A 2DYCA 1UWWA 2ZGNA 5BUVA 3KV4A 3C8XA 1CN1A 1PVXA 4AG4A 3PUQA 1PGW1 4E2SA 1WMFA 4A7ZA 1JBCA 4CSWA 4QPIA 3IZOA 4Y1ZA 4J25A 3ZR6A 1UX6A 2WKKA 3MEPA 2PAMA 2BWAA 4QB1A 1VBB3 3EMRA 3K48A 3LA7A 4XABA 1FOD1 1S0CA 1XRUA 3ES1A 3J9SA 2W1UA 4RS5A 1RJ7A 2MEV3 5F5AA 5IATA 1R081 3HQRA 5K9YA 1H6XA 1F4HA 1COV3 2D98A 5FYVA 1J3RA 2RR12 4MADA 1Z7S3 2JECA 3NNMA 4UBGA 5L9RA 2XHKA 2HEVF 3K51A 2XXZA 2FMDA 5CU1A 4BISA 4FTBA 1SHWB 4Q0UA 5JMCA 1OUSA 2D40A 3N36A 2FZ2A 4TLFA 4YW7A 2W92A 5IFTA 4IE5A 5E1RA 3TN91 3POGA 2JG8B 3IPVB 5JR2A 4UF0B 2AUYA 2RS12 4PBOA 4XJAA 3N35A 4RSUA 3B00A 1WBLA 2D3SA 2PHDA 4LBKA 3C3VA 5DAQA 3VDAA 4IV1B 3U4XA 1LOEA 1GUIA 3BOWA 4NIAA 2GN3A 3ZYPA 1OPOA 3M3EA 1JODA 3QH6A 1VRH3 3THDA 2ZGLA 4LEJA 5FYYA 4FO9A 1XNAA 3PDQA 4F83A 1AR81 2RMU3 5FZGA 2QNKA 1S2EA 3SEEA 3J7MA 4Y3OA 5A7NA 3M3QA 3WDWA 3NW4A 1YQ8A 1W90A 3BB6A 4F3JA 3O5SA 1BYHA 4RFT0 3W21A 3AVRA 2WN2A 4CDUC 3VBSC 1GYKA 4LKDA 5FPZA 2R49A 5BNNA 3BUCA 5DN2A 5CZKA 2JDMA 3DF0A 5IVEA 2WA3A 4NHLA 1OQDA 3M2MA 1SCSA 2FHRA 1FPN1 4Y22B 2XUEA 2RG4A 2JJ6A 1AUYA 4QPGB 1JYIA 2WNOA 3DPRB 1CZTA 5GLTA 1KDKA 2HWD1 3AK0A 1AR91 3PUIA 1NQDA 3JXSA 1GFF2 4XF0A 1QJY3 3VKFC 4DRVA 3FLTA 1GWMA 4GAZA 4GALA 2A6XA 5E6HA 2GSYA 5A3OA 4WVZA 3FWEA 1YLLA 2LS6A 1NLQA 1QJU3 3MI8A 4META 4PHZA 2BOIA 3K4DA 2A3XA 1PIV3 3KT1A 2G9GA 4IETA 1DQ6A 3WT3A 2AACA 2RDQA 3IPVA 2VD7A 4UF0A 1CVNA 4B8EA 1TMF1 3BODA 1JYTA 1WMXA 4X6RB 3TB0A 3WINE 2CWMA 4IV1A 2WWSA 2ZAHA 1G9AA 5FUIA 4AQTA 3JD71 4XFCA 2X53S 3IKWA 3ZKUA 1OSGA 5A7WB 2PHXA 4RR3B 4QB6A 4K1YA 5L7OB 2IFWA 1HIXA 4FOYA 2Q0AA 4HBNA 1WWYA 1SLAA 4FPKA 5B4XA 3DL3A 1LEDA 1RUG2 2XUMA 3LE0A 4HETA 4I01A 4I02A 4YW3A 5GLUA 4BXFA 2QQOA 2D6OX 4ZU7A 5K8SA 3O1SA 4LKEA 1LR5A 3KV5A 3UK9A 3G7DA 4UT5A 4Y1XA 2WZPP 2PLV3 4DUXA 2Z69A 4I30A 2BVVA 4GD4A 1V6MA 1PO12 1AR73 2MNGA 5A7SA 2GC0A 4RHV2 1RVF2 1RUD3 1PHMA 1RUOA 2BW8A 1HV1A 2O8QA 4O7XA 2X09A 5BYNA 3N7KA 2WQ4A 2HJIA 3P3NA 3RDIA 4QPGA 1J83A 3DPRA 2D6PA 3N4MA 2E7TA 2GU9A 5FP8A 3VLBB 1I6XA 5C3SA 1UYPA 2B39A 1TME1 1QGLA 3P5BA 5F2WA 3KLSA 4NPMA 2BRTA 5JZGC 2VZ1A 4XJZA 1D0GA 2A75A 3DV8A 2D43A 1ASJ3 4BQYA 3NV4A 3VBRB 1BMV1 1PNFA 1OOPB 1W05A 2CAVA 4FVVA 2Z79A 2JE7A 1XNDA 1VP6A 2YFZA 4YRDA 2VCAA 4K40A 4XHXA 4AYUA 2WL1A 3D82A 3R4DB 4UAPA 4E4HA 2JD9A 3NAPB 2NMOA 1NXD1 4NWVA 1RUI2 2CWSA 1JUIA 4QX0A 5FY7A 5FZFA 5A7WA 3IDAA 2UY9A 4RR3A 5LBBA 2F4PA 4Y26A 3VD3A 1YWKA 4LPLA 5L7OA 5KXDA 1DU3D 2DUQA 4MYEA 1ULEA 4IEUA 3WF4A 4N7IA 1IKPA 1HQNA 4OYUA 3U78A 4NE9A 1PZ9A 1I5ZA 3UV9A 3RYPA 4AHYA 2ADDA 2VNGA 4P9YA 4D7SA 4NHXA 3T30A 2Y33A 4L97A 1YJLA 4WBBA 1ZX5A 4QM8A 1POV1 2BWCA 3ZSKA 5F32A 2DVFA 2ZGUA 4GIQA 1XBFA 3LDKA 1DZRA 2Y6JA 5JAXA 5JOYA 1CAXA 1ZRFA 2PAKA 3A22A 3N3HA 1OURA 4N90A 4I0WB 3DCQA 1JTZX 2X29A 1C28A 1HJFA 1D4M3 1UY2A 3J26N 1BEV1 1US3A 1R091 3JCIA 2B7YA 3ZN6A 4IGQA 4BM8A 2ZGTA 5FOJB 3DKWA 2OS2A 1V9U1 3KQRA 4XUOA 4RD7A 3MFAA 3AKPA 4Q4Y3 4AFBA 3S0MA 1PX3A 1S0JA 1ULGA 4W4ZA 3B94A 3I2DA 3DKQA 2HKXA 2ORXA 1QDCA 2WO7A 4IE7A 2Q1ZB 3VBRA 3NKTA 3KS7A 1MZEA 3GGLA 4Y33A 3HVDA 5I91A 3R05A 1XNCA 2XQXA 2Z42A 3LEGA 4H7LA 3VGIA 4AW7A 4BLJA 5IVBA 1R1A2 1W8HA 5IVVA 1QY4A 4Q0SA 2OW4A 3LPGA 3NAPA 4ZY9A 2XHNA 4LUMA 4MLOA 4QGMA 1OA3A 1IS5A 1K12A 2ZGQA 5ISLA 3VDDB 3VV1A 4CXXA 4KU8A 3DXUA 2QBXA 4NN0A 1YC61 1F15A 1L7RA 2F4LA 3BOPA 3GALA 3WW2A 4LHKA 1M06G 2WYFA 4QU1A 2QQIA 5FLHA 3R0RA 3FJSA 4ZU4A 4V1PA 4XTPA 1CESA 2WT2A 3KSCA 2VXRA 3O0XA 1DDLA 5KHKA 1S2KA 1LGNA 3ON7A 5T54A 3ZYHA 3JBG3 4IEVA 1NX9A 4H14A 3WP3A 3T2PA 4A6OA 1N1VA 4BHPA 4WM7C 3VBUB 3KM5A 2HWB1 2YC0A 4YWAA 3OBAA 4P9IA 3LD8A 4UFJA 1K42A 2J22A 4GB32 3B93A 4DMIA 2DFBA 1PZ8A 4E2GA 2Y6LA 5JLVA 4P9WA 4CUAA 4D6SA 5EJ1B 4CP2A 4UFIA 1VBD3 1Y3TA 2L9LA 3E6CC 3GYDA 4LO8A 1RUH2 4OZXA 3T3YA 5T52A 2F17A 1V0AA 2O14A 4GMP3 4AQSA 1X8EA 2OX0A 2W87A 2YYOA 4NRPA 2EIDA 1NUKA 1YEWA 3HMYA 1PVC3 2IXKA 3LPFA 1LOFA 3Q8EA 4IESA 5FZLA 2ETEA 3CU7A 4TLGA 1OLQA 3WDVA 3ZFFC 4COWA 1NZCA 3J8F3 3KV9A 3FMGA 3MFCA 3T0AA 5FJKA 4P9JA 3RZKA 2VBPA 1Q8SA 1S4CA 3L2YA 2DCYA 1ULDA 2D6NA 4YGEA 1JI6A 3FHAA 4LT5A 3PNAA 3WHTA 1H8TC 2WS91 3OGRA 1UZ0A 4CCDA 3VDDA 4DNYA 2Q1FA 1PMJX 1QHDA 2ID4A 5LATA 3FHQA 1H4HA 4L9BA 3SCFA 2DTWA 3LFMA 2IVIB 4FTEA 2G1MA 2H6BA 2XVLA 2JKXA 4XBNA 1N3OA 5FO9B 2BFUS 2RDNA 5HV4A 2BTVC 1FOD3 2J1RA 2O1QA 4QQHA 4CP1A 2H0BA 1AL0G 1REEA 3B3QE 1R083 4C0BA 2J1TA 3MLJA 4BB3A 1GP5A 4OZOA 2E7QA 2LRPA 2WAOA 4LBMA 5FZOA 3VZNA 1W8OA 3U14A 5FREA 1FXZA 4FXGB 2WNEA 3HBZA 4FPEA 1AYM2 2P3JA 4Q4W1 4BQ4A 4Y4RA 5DAWA 1K5MB 2P5BA 2ZZJA 3TN93 2YDEA 1KGYA 1UO9A 4XUPA 2ZHMA 3H8RA 4MXWB 2R1BA 4BQ5A 4WZCA 3O1RA 4QM9A 3G6JB 2RS52 4V2VA 4DXZA 4Q8LA 1MS8A 5D2AA 4WM8C 5JOWA 2VJXA 1CIYA 2VUJA 2YUEA 2BNMA 2V5DA 3Q8BA 2VOKA 3MF6A 3SC7X 3T0DA 3POSA 5DZFA 4K8RB 3VBFC 3GHNA 4EN0A 1W39A 2LUWA 3GBWA 2OYZA 1VBA2 5C4WC 4FPJA 1AR83 2ZOEB 1UOBA 3HR9A 4QQLA 1YFYA 2BNNA 2IXHA 3AMMA 3CJIB 2WSVA 3N9MA 4IEXA 3J7LA 1W28A 4HFSA 3U07A 1NA1C 4PIZA 3KT4A 4N43C 5H9PA 4ASLA 1Z7S1 3LDBA 4KMQA 4C1WA 3HNBM 5SV5A 1SLBA 4W65A 4AWDA 3KVBA 2VCCA 1AJKA 4LIVA 4NHKA 5C3QA 4NRMA 5FZ7A 2GMPA 4N53C 1LB2A 2A5ZA 3SQOA 3ZXKA 2RR11 5BNOB 4L99A 3GDBA 5CVRA 1FPN3 4YVWC 4CDXB 2XLFA 2VY0A 3I3QA 4XHBA 1D7PM 4IW3A 2HWD3 3I2OA 1AR93 1WLCA 4YGDA 4YFWA 4IE6A 1NOVA 2RS11 1V6NA 1QOSA 3D5OA 3LIGA 1CPNA 1UKGA 1LU2A 1QXJA 1VRH1 2JB4A 3CLPA 3M3CA 4QHBA 5D8AB 5FIXA 5FZBA 2VE1A 3H8UA 2R0HA 3DN7A 1GQPA 3MIBA 3HNMA 1NCQC 2G9FA 4J1WA 1HB3A 4TWTA 1K5MA 5DDJ2 3SXWA 5CFDC 4GWIA 4M0HA 3AP4A 3IIAA 3KT7A 4MXWA 4JV4A 1KDMA 1TMF3 3SCGA 1NCRC 2LM3A 5IK7A 5IVCA 3ME2A 5LWBA 2XJVA 4ISRA 2WYSA 3JD73 5FPAA 3PTYA 1AJOA 3WF1A 3S7EA 3GZEA 2KXLA 1RUE2 1MS9A 3I4IA 4JGYB 4CEWA 2MHFA 2BDRA 2V4AA 4LORA 4Z2WA 2DWRA 1ST8A 1BK1A 4QPYA 3CJIA 1GOFA 2NM1A 3X29B 2B8MA 3I2IA 4Q29A 3TEWA 1JN2P 4BU2A 4X6QB 3THPA 4KWJA 2XONA 5C3RA 2VBBA 4BDVB 5LBEA 5F3GA 2GZWA 2EXHA 1XYNA 3ZYRA 2DF7A 2VQAA 1B35A 4DXSA 4YZ4A 3I2KA 1WD4A 2VG9A 1JHNA 5FZEA 2P3KA 1HX6A 1MS1A 1SLCA 1ZZ8A 1I1EA 4JTNA 3AKQA 4BWOA 5BNOA 2ZAAA 3H1YA 1GBGA 5FK8A 2KA3A 4HK8A 4AXOA 1ENSA 1QU0A 3M3OA 4Q0VA 4A45A 3ENRA 4KGQA 4AVAA 4CE8A 4N9HA 4YVSB 4DY3A 5I0TA 1IKQA 2PHTA 2XWBB 2PQQA 1WUVA 1WMEA 3B9IA 1TME3 3FL7A 4UFKA 4XUNA 2XJQA 5D8AA 1FMD2 1DYOA 3ZFGA 3BU0A 3OF1A 3IDEA 5H9SA 1LECA 5FLJA 4BCUA 1NG0A 5T3NA 5IHRA 1UX7A 5A7PA 5FY4A 3RZZA 1BBT2 3I2JA 2X05A 1W9YA 3LA3A 4Y4YA 2HWC2 3RMYA 1GZWB 1RITA 1JZ2A 2QE3A 1LGCA 4O9GA 3WNMA 4HPKB 1UZVA 1LU1A 1C4RA 4YNIA 3LDRA 4D3WA 2JDNA 1UIKA 1RUG1 3ZMNA 1GMMA 3K75B 2KD7A 2FMYA 4FFGA 1IHMA 4IGOA 3RYKA 4AEKA 2H6CA 1XB9A 3N7JA 1VBE1 3JB4C 5KC5A 1WA4A 3A4UA 3WCRA 4ASMB 1PO11 5F6LB 1PX4A 4RHV1 2BVBA 4MGSA 3VKLA 1ZREA 1RVF1 4R52A 4NR1A 5FOBB 2ZS6B 1MQTB 2CAUA 1NY72 2PTMA 3A23A 3GZUC 4K20A 1POV3 1N47A 2R30A 2W91A 5F5QA 5FZ4A 4AL9A 2PHWA 1PGL2 3U4SA 1SACA 5BNPA 3AYEA 1AF9A 2VVEA 1BEV3 3DXTA 4PLOA 1R093 4OHYA 1V00A 4P00B 3GM8A 4NROA 4R9DA 4QMAA 3AZXA 1S0DA 3ACGA 3SH4A 3FX3A 1V9U3 1POQA 2VZSA 4LMFA 4A2UA 3DECA 3NKGA 4UW6A 2OQ6A 2OXBA 2PFWA 3LEMA 3SHRA 3UGGA 2VMCA 3RI8A 3JQWA 4NMIA 2R072 3HNYM 1RUI1 3PJYA 4JGZC 5DG1A 3CIHA 5IK5A 3ZR5A 3WG4A 1GZWA 3VDBA 3OG2A 4OULA 5KHIA 4HPKA 4JTOA 4XEZA 5G05L 2P3IA 4LIUA 3IMNA 2VGDA 4AHWA 1XQNA 3BTYA 1FATA 1SDWA 4QKNA 3ALQA 4MV2A 1XC6A 3AYCA 4BK5A 5FZ1A 2ZGMA 4QX2A 5A70A 2WO1A 1NAEA 1D4M1 1TZOA 4RQPB 1F31A 2ET1A 5FMDA 5BNPB 4LULA 3GNEA 5FYUA 1I9RA 1DGWA 5ANNA 3GXUA 1GZCA 1PGSA 2QUOA 1MQTA 5EYYA 5GJ6A 4CEYC 2VZRA 1DQ0A 3SH3A 1DGRA 3UKVA 2HWB3 1OFNA 3OPWA 4P5HA 2V5YA 5C33A 4XQWA 4OQ9A 3ZSLA 4AAPA 1X50A 5DQ0A 1UZYA 1ZBE2 3AP7A 3EYPA 4AI9A 1CAVB 5DZGA 2D93A 3EJKA 2ORZA 4XFBA 1EY2A 1Y9MA 4C91A 1DBNA 3D3AA 3VD4A 1ZBA2 3RWKX 3WDYA 2KM2A 2PN5A 4O9EA 2JDYA 2YV8A 4Q27A 4XFIA 2P17A 1IG0A 1RHI2 1F9KA 3AJZA 3HQUA 2W1WA 5DXDA 3BCWA 4URAA 4LHNA 2HWE2 3ILNA 4JRLA 1R1A1 5LZ6A 2R062 1GLHA 1W6OB 1O6UA 1SLLA 2VC9A 1OKQA 3N9OA 1NXMA 2Y64A 3AP6A 2NZ9A 5FP4A 4A6SA 4EE2A 2QZ2A 5T55A 1X7NA 1O3QA 1W3VA 4EN7B 1W04A 2HBUA 5A1AA 3AFKA 2RM22 1OLRA 1A8DA 1EPWA 1UY4A 1LHNA 4P5YA 5G04L 3ZXLA 3WQBA 4ARXA 4R9BA 5FMCA 5EIYB 5IVJA 5KXEA 5CG9A 1G7YA 4BYYA 4C1XA 4UFMA 2ILMA 4JCKA 2WS93 3LA2A 1W9TA 3HOBA 1I5PA 4MGZE 3OB8A 4CDUB 3PHMA 2EXKA 2AEZA 1OA4A 3SISA 2HEYF 5T5LA 2RS32 2Y6HA 1QOOA 4XETA 3WNLA 1UN1A 2ZKNA 4YGCA 4PIXA 3DEMA 3PL0A 5IWFA 5J3UA 2W52A 4AFMA 3ASIA 4YM3A 1W8ZA 2AREA 1WW4A 1YI9A 1QMJA 3ORJA 2W0XA 4GB31 1U5IA 4H2AA 3ZKYA 5A6YA 2J1VA 3WEZA 4BOWA 3A7QA 2CDPA 1GNZA 1ZRDA 4BQWA 4Q4W3 3IIIA 2CY6A 5FZHA 1JZ5A 4JAAA 4MZUA 5FYBA 1CAVA 5BV6A 1OH3A 5LY1A 3T4HB 3E5XA 3PURA 5F9TA 2C24A 4N7UA 1SLIA 2I07B 2P3YA 3VUOA 4LO4B 1GKBA 2SBAA 3I3MA 1BKZA 2Q5TA 2XB6C 1ZVFA 5BNNB 5EV7A 2Q8DA 1WCDJ 1V6LA 1W6OA 2RV9A 2ZXQA 3POFA 4EROA 2J42A 5CEHA 1OPMA 1UPSA 3B69A 2IXJA 4L8QA 1V6KA 3IB3A 5FV3A 4LBJA 3TEXA 1DYKA 2AENA 4KH9A 1WD3A 4K1ZA 3M8LA 4B3NA 4KWKA 4U2AA 4DQAA 2VPVA 1BXHA 5LBCA 2Y0OA 5HCBA 2FCUA 3SH5A 1UOJA 2ARCA 2ZPXA 1ULCA 3M4FA 4YZ2A 3OGJA 1U5YA 2QQJA 1ZA7A 1VB4A 3LAGA 4GJZA 1TEIA 2BGPA 3VBSA 4CDUA 4CU8A 3J7HA 4OI0A 2RR13 1RUC2 5I8YA 2EXJA 4KG8A 4D94A 4GJYA 1ZYBA 4FPCA 1JOJA 2C6SA 4GWJA 1A78A 4HN1A 4P08A 4YYOA 4LOTA 4JVAA 1VJ2A 3P1IA 3RS6A 2RHPA 1AYM1 3HPNA 2VMFA 5GZEA 1OUXA 3FBMA 4B7EA 2ZKLA 2Z2SB 1TNRA 3PVBB 2Q30A 3AMHA 3E1F1 4P9XA 2RS13 1MVQA 2W2IA 2YC2A 2RS51 5IFPA 3MF9A 4ISQA 5CKNA 4UWDA 3ZXGA 2TBVA 4LA3A 3MLKA 4Z07A 3AKTA 2BJSA 5JZGB 4DS0A 1OC1A 1XOYA 1IS4A 1CZVA 3GZAA 3WXPA 1WCUA 1VBA1 5M0TA 2QVSB 3WHUA 1JYVA 3KCCA 3WD5A 2JENA 2WT1A 3CJXA 4P9GA 2PA7A 3BN6A 4NJ4A 2ZEXA 5DUUA 3ZYBA 4B4RA 1DF0A 4ZKTB 3GJAA 2AH2A 4JC1A 2X5IC 3PLQA 1Q8VA 3PU8A 3FUQA 4XIKA 3T4VA 4GZ9A 4BA6A 3LFIA 2D7FA 3MIDA 4PQQA 5A3WA 3T1LA 1OQ1A 3ZYIB 4DINB 5J1XA 5FMOL 3GBFA 3P6BA 3CEWA 4QKDA 5I0SA 1YUDA 2W9XA 1LGBA 1PO22 5FDBA 4Q2FA 4SBVA 1T6GC 1LHOA 1WCSA 1YIFA 2BERA 3GCWA 3N9QA 4NUBA 4FSJA 3RWNA 4EYUA 3EO6A 2WFF2 2PELA 4BIFA 4QXBA 4ORFA 5LA0A 4LK7A 3ZPOA 1W3XA 1KS4A 5L19A 2IFRA 3ILRA 2Y8KA 3TEZA 2TNFA 4Q1PA 1ULFA 4OVEA 1LTEA 3DUIA 4JRAA 1CX4A 4PJYA 4YW2A 4X8NA 4CU9A 5C3OA 5L73A 4XJWA 3FLRA 2D6LX 4MO3M 5DAVA 2QJVA 2ZHKA 2C26A 2W94A 5FWJA 2FDFA 4Y1YA 5DDJ1 1JYCA 5GZGA 2CSGA 5JXHA 1BCXA 2R042 1YQ6A 4KBZA 3RFRA 4RFRB 4FOWA 4AI8A 1RB8G 1G9CA 1C1LA 5JXJA 2BYVE 5KHJA 1HXS2 3OGSA 3AM2A 1AL22 1SZBA 1DP0A 2KR2A 4YM0A 4AVCA 5J48A 1CONA 3I97A 1GZ9A 2D6MA 1MACA 1ZZ9A 3AKRA 4V2WA 3VZMA 3KF3A 1UPIA 1O5UA 3AXEA 3HIFA 3VN4A 5CFCC 5JOXA 5JZGA 1RUE1 5FYCA 1G9BA 3VZKA 1JOBA 3BTXA 3MGUA 5FP7A 4GKYA 4HANA 1RMU2 5EWSA 5B4NA 4EV0A 2P34A 4QX7A 3WDXA 4KNCA 5C70A 1IQDC 2IUWA 2XLGA 4PBPA 1RUG3 3B9CA 1ND2C 3ETPA 2LALA 1MS5A 1BVVA 4S2FA 1CAXB 4ZS3A 1JZ6A 1VRBA 4HKWA 2OA2A 3SMHA 4D0QA 5F5CA 3ZDVA 1GNHA 1VBE3 1O4ZA 3MIEA 4XQDA 5GLWA 3OBRA 2DUPA 5I8SA 3T2OA 5ACA2 1PO13 1RJ8A 1FV2A 3AZYA 3RPQA 3NL1A 3IAQA 2B5HA 4FOQA 4RHV3 1RVF3 1YQCA 3ZN6B 5LY2A 1H2LA 1ZZCA 2YBPA 1XU2A 4LBLA 4LKSA 5JOZA 3ATGA 2MPFA 2JG9C 4XZUG 4L0PA 5A3PA 4KG0A 2A3WA 3VD9A 1HB1A 2WWJA 3WUDA 2JG8C 4GQ7A 4CCCA 4ES9A 1BLZA 3FLPA 2GALA 1ACCA 1LENA 5KXBA 3FBYA 5DPNA 3PMSA 1HDKA 3UESA 2JEMA 3BPSA 5FZ6A 5GALA 2CL2A 1FMD1 1RIRA 3H0OA 4WM7B 3UGHA 3H1MA 2VZTA 4LKFA 3HAGA 3O1PA 1TQ5A 1HW5A 3I3BA 3PMEA 3T08A 1W0OA 1BBT1 1LEMA 2WUHA 3BYWA 1W99A 5FYTA 2HWC1 1DQ5A 2OT7A 3K77A 3HJRA 3MW4A 3QCWA 4AI3A 5FO8B 4P14A 2JDPA 2A6WA 3M1HA 1REDA 2QTWB 2GC2A 4HT1T 4M4RA 4NAOA 3HN3A 4NHMA 1N3QA 2CGPA 1MZ5A 1RUI3 4LR4A 1EAH1 2VOVA 5KR7A 2ZGPA 1W6QB 3QLQA 4AFCA 4JQRA 2FDJA 2DVBA 4CVUA 4CRQA 1OD5A 3B5LB 3NNGA 5IT6A 3RNSA 2QCSB 4IL7A 2CV6A 1SBEA 3O7OA 1US2A 1QJEA 3TAYA 1JH5A 3RRDA 4YW1A 1WCKA 3O1TA 4XFHA 1UZZA 2BQPA 4LK6A 2VQ0A 1XJAA 3KV6A 3MYXA 1ZZ7A 1YXWA 2DURA 1IOAA 1O91A 3OEBA 4W8JA 3SKVA 4R8HA 2BZDA 3A0NA 3PVOA 3ZMOA 3S7IA 3URFA 4IEOA 3NJXA 5LASA 2XBO2 3PJQA 2EICA 2VL4A 4HKLA 1KRIA 2ZBJA 3ZN4A 1PGL1 1EPZA 3WG3A 2B4KA 1MS4A 2PHRA 4XFGA 4AVVA 3C7FA 2VH9A 3AJYA 2WNVC 1OKOA 2DFCA 2VQTA 3NVCA 1WMDA 3IN9A 4FFFA 4WM7A 3O1VA 5K7PA 1GQHA 2R7EB 4QX3A 4PF5A 1UU6A 5DAXA 5F39A 1JYXA 5EJ3A 3BALA 2R071 2VUCA 4FPGA 4AEJA 3S5AA 1E57A 4B4PA 3ZXEA 3J7NA 1XSRA 3JB8A 2VULA 3LEIA 4GULA 4XOGA 3D0JA 5FMBA 4BXSV 1R1A3 2J7MA 3U0ZA 3LKJA 3ELNA 5SV8A 4WM8B 4HVOA 2VZQA 2TEPA 4OUSA 2VNOA 1LJ7A 1LHVA 1W6QA 4DO0A 4EZHA 3VBFB 2ZGSA 1W0PA 2G4IA 2JXAA 4LE4A 3RVHA 5C4WB 1N1TA 1K5JA 2J1SA 1X9PA 4XJUA 3ZFFA 4GWMA 5FZOB 3FZ3A 2VAUA 1KITA 2JDZA 1H2MA 1AR62 2FBEA 3CDZB 4N43B 2VMDA 4MHRA 1GWLA 5GZFA 2YGMA 1H8TA 1RXFA 2VZUA 4HMZA 1S0BA 4KGGA 2GMMA 1UYZA 4JDMA 4N53B 5F3EA 3S6PA 3AXDA 4C0HA 2RJLA 3MBWA 3QBQA 1ZBE1 1O8PA 1WW5A 4ES8A 1Y9QA 4GB33 1H1IA 2D6KA 4ZONA 3VHRA 4AF9A 1OOPC 3KMHA 1ZBA1 2EF6A 1QKQA 4Q4X2 2CTVA 1LCLA 3IBMA 2R0FA 1QXPA 2DU1A 3KGLA 3SITA 1L3JA 5AFEA 1RHI1 1JU4A 4YG0A 4IE4A 4DEVA 5FRAA 1OLMA 2HWE1 1UCXA 3AMQA 1GOGA 4W6YA 4EN8B 1MZ6A 2R061 3NV2A 4JX0A 4QX1A 1TVGA 4QXHA 1SPPA 1NCQB 3M70A 3NNJA 1O3TA 1G6NA 2RDSA 4Z8BA 1J59A 1IG3A 4D7YA 1Y43B 1KXGA 2RM21 4FPLA 4XIOA 2DTYA 1N1SA 3NNFA 1NCRB 5C8CC 4UYBA 2K2SA 1VMJA 3O0WA 2Q8EA 1HRI2 3NJYA 3IM0A 2QKDA 4NHYA 4WM8A 5JDBA 5LBFA 1CGPA 4RGAA 4D69A 5LCWL 4I2OA 4EWAA 3KHBA 1VALA 3VBFA 3CZJA 4AEMA 1L7LA 5C4WA 4CXYA 3H3LA 1RGSA 1UY3A 4TYSA 3VZLA 4CCNA 5DUVA 3UKNA 2RS31 2VW0A 2J1AA 1NLRA 2BOJA 3FN9A 1LULA 2A3YA 4MGQA 2OVUA 1D4VB 5EPAA 1S0GA 1NA1A 4COUA 4N43A 1JZ4A 1QQP2 2WA4A 3O1OA 3VZJA 2DV9A 3U11A 4XJ9A 2ZGKA 2CNAA 3SLIA 1MR5A 1V6OA 4C8DA 4N53A 5KC6A 1DQ2A 2ZEWA 2G9ZA 4TTGA 2EXIA 1AYM3 3OY8B 3WP6A 2WNUC 1E5HA 2BBAA 2BGCA 3ZFEC 4YVWA 2FDGA 2AR6A 2OZJA 4PQ9A 4PDWC 2O8OA 2XJTA 1W8FA 5JR7B 3WUCA 4BH9A 4DXTA 1JYWA 4COYA 2VQUA 3WF2A 2RS53 4CEWB 4C90A 5A3TA 5ABJC 1UXXX 1GV9A 1GQGA 2YB7A 1OF3A 3I2HA 1MEC2 2H0VA 2YPJA 1XU1A 1C3HA 1F5JA 1OD3A 3KVAA 3VD5A 3WLUA 3NV1A 1VBA3 1NCQA 5CFDA 3WNNA 4FPHA 4Y20B 1LRHA 3N7MA 3SEPA 5EQUA 3L9JT 1CJDA 1B35B 3ZYGA 4YG6A 4FBFA 4XZPA 1NCRA 3V0BB 3Q8AA 2IC1A 4XAAA 1RUF2 3A21A 4ITCA 3NJVA 4L92A 4XBLA 4AI2A 5CB7A 3KCXA 5FWEA 1JW6A 4OUMA 1OVPA 3PIGA 4IGPA 1CAUB 3NJZA 3CMGA 3KB5A 4FT8A 3VBUC 1YNAA 2UYBA 4QGLA 1CQ9A 1OVSA 1RUC1 3K46A 1MZFA 4AI0A 3PTRB 4ATFA 2BGOA 4EQVA 1FT9A 2VR4A 4QHOA 5FZ9A 3UT0A 4CDWC 3OCPA 5CYYA 1ODMA 5CKQA 3MICA 1SCRA 2P1BA 3H8XA 3ZOIA 4WVWA 1N1YA 3ZIWA 2ZGOA 2R1DA 3WW4A 2N7GA 3AYDA 3R4SA 4GH4C 2ATFA 5DAPA 3OY8A 1KFUL 5EP9A 5DDJ3 1T2XA 1YIPA 2HH9A 5JXGA 4FTSA 3D4KA 2CHHA 4E4ZA 5L36A 1XXNA 5ERLA 1ENQA 1EV12 4E4SA 4BPZA 2Q8CA 2R32A 3LZZA 1ZRCA 3CKHA 4S2GA 3LSEA 1RUJ2 1APNA 4LXLA 2QQNA 1IGOA 2BFUL 4LUKA 4Z2AA 1IS6A 2CGNA 1RUE3 1UD1A 3HQXA 2HYKA 2WBKA 4H3WA 4YW4A 1UKRA 1WGPA 1D2QA 3ACIA 4Y20A 1KFXL 4Y5SA 5IW0A 1A34A 2YROA 2K46A 1C1FA 3V0BA 2EIBA 5GLVA 5DMYA 4NPRA 1ND3C 2JDHA 4QQ2A 2OQ7A 1PO21 3QACA 5FYSA 1OF4A 3ZO0B 5HBAA 2VOWA 1ZNPA 4YW6A 2WFF1 5CBLA 3O1MA 1CAUA 5FY0A 1YO8A 3WW1A 3WG1A 3ZN5A 3VBOB 1OA2A 2GP5A 2P6CA 5AC92 5CAZA 5F3CA 2XJRA 1A8MA 3MIGA 4XXPA 5FZIA 5LA9A 3HN1A 4ONUA 3W58A 1H2NA 2DVAA 2FD8A 4QXCA 1K5MC 1W6PB 4M4PA 3AX4A 4MGYE 2XGXA 5C3PA 2XQRA 5C7GA 1KS5A 2D5HA 5JIAA 5BNQA 4CEYB 4BK4A 1AX0A 2R041 3QOPA 1U5XA 2QDNA 3K4ZA 4OHZA 2DVDA 1FMD3 1HXS1 1LNSA 3KCYA 1PK6C 4ZU5A 2EIGA 1AL21 3MUZ1 4CCMA 4DB5A 4ZZ8A 1QXRA 3VBHC 4OCTA 3EB7A 1BBT3 1UU4A 3WP5A 4FPOB 2D3RA 3UGFA 3U37A 2HWC3 3WY6A 4KWLA 2J1EA 1HRV2 2VOTA 2VVDA 2DBNA 4Q4V2 1RMU1 4IV3C 2GNMA 2W5FA 2WT0A 2VCMA 1EAH3 4COVA 1FNYA 3LWCA 3AFGA 2P6HA 4XYXA 2XKPA 2E26A 3WG2A 3ZXAC 4AQ6A 2VBDA 4BQXA 4Z82A 1AX2A 1RL3A 1W6NB 4JGZA 5ACA1 1J84A 4JZRA 2XKOA 3OEAA 3OPZA 3AYAA 5J98B 4LTAA 2UU8A 5FZMA 4CDXC 1DIWA 4R4ZA 5FYIA 4YPJA 3SCHA 4A3XA 2GP3A 3KWVA 1S55A 4WVVA 1XYOA 1SMVA 5AVPA 1UOGA 3AZWA 4OI4A 3TWIA 2BEOA 4LHSA 4NO4A 4AE2A 4K8FA 1OBNA 2NN8A 2VMHA 5K4LA 3LF7A 3VBOA 4CUBA 1URXA 3AB0A 2CYFA 3EHKA 1BVP1 2Q4SA 5JXIA 2WINB 3MPBA 4QGNA 5FZKA 4AVBA 5LK7B 1ZZBA 3UJOA 4JDNA 1JYNA 5GLZA 4ET7A 1QDOA 3OYWA 4J6GA 1YFWA 1W6PA 3BPZA 4Y24A 3T1MA 3W20A 1ENXA 5LA1A 5A6XA 1ULPA 4CEYA 5I0DA 4K3UA 4D6RA 4NRQA 1IS3A 2XJSA 3IDCB 4Q0QA 1VAKA 2PQSA 5FBZA 4DFSA 3RYRA 2DUOA 3PUSA 1O4YA 5FYZA 4A42A 1VPHA 3PVNA 3KQ4B 2CDOA 4SLIA 1AXZA 3R6SA 1Y7BA 2A1XA 2NMNA 2R073 4IEYA 4JGYC 2AYHA 3WVJA 4B1LA 4LOSA 3THTA 2VNRA 4LHLA 2GMEA 1VBC2 1DQ4A 3ZIXA 4HG6B 4YARA 4YZ5A 5KHGA 2VECA 4MGTA 1YQ5A 3ROUA 4B29A 4RL7A 1QEXA 4AGVA 5TSWA 1AHSA 2GH8A 3WNOA 5F8PA 3EQEA 1Q8PA 1W6NA 3WQ0A 2W1SA 5JSRA 4UI9L 3AZZA 2F6BA 4QHZA 2W95A 3I8TA 1H1AA 5C5UA 4QDSA 2IXCA 2XBO1 5HPOA 4MXVA 4AOCA 2PXJA 4H7MA 5CA6A 5FBJA 4YVSC 1S0EA 3CO2A 3AZVA 4KWUA 4CU6A 5C9AC 5GM0A 1T6BX 2YZ4A 3RZHA 5HCAA 4HXCA 5FPXA 1W8UA 3S57A 1ZBE3 5LEJA 1BK0A 3VB9A 1O3SA 2W1QA 3V0AB 3H1WA 2VOXA 3OJBA 1ZBA3 2WO3A 4CDQC 1XYPA 4OLLA 2BBVA 2HBTA 2WIIB 2ES3A 2Y60A 4MX3A 1RHI3 2JIJA 4RYDA 5I93A 4K7JA 2HWE3 4CXWA 4NIDA 2R063 4E4DX 1NE6A 3RMXA 1AYN2 1W8WA 5A3LA 1S0FA 3RGBA 5HXMA 1NLSA 2VMEA 3AL5A 3ZSJA 3BTZA 3UL2A 2RM23 2WR9A 1W03A 3WNPA 4RN5A 3WZ1A 4EN6B 5FAXA 2WQ8A 3VBSB 3I59A 1LOAA 1C8M2 1V6JA 4URTA 1HKDA 4Y1UA 5JPMB 4JKMA 1UYXA 3O12A 4DPNA 2HYXA 5H9RA 1UOFA 5A3MA 1UW8A 2X5IB 1W2NA 5K0UC 4DY5A 1LOCA 1YHFA 4AVTA 1CX1A 2DCZA 5BY5A 2HWF2 2WLQA 2DVGA 3JZVA 1CJPA 3UYJA 4KBBA 4O61A 4GXLA 2RS33 1BHGA 1H4GA 1DGLA 3MUY1 4D6QA 1LOGA 2G19A 3LCPA 2B9VA 2PHLA 2XG3A 3POWA 4CUGA 3H8OA 5FY8A 1J58A 1WKYA 3PUHA 5F2SA 4AHXA 1RUH1 2WZR2 3U1XA 5F5IA 5KHHA 3SKJE 3USUB 1DYPA 2I74A 1VMHA 3TYJA 2R6QA 3B01A 3WQ7A 2K0GA 1EUTA 4M3CB 1MS3A 4Q4X1 1DFQA 5D1IA 1QJX2 3V64A 1JS9A 4JDOA 3TNPB 1N3PA 2C4XA 3T09A 2YU2A 1IPKA 3V0AA 1OLME 1J3PA 1RTVA 1HN1A 2ZEYA 1QWRA 3OUJA 4AEDC 5A80A 5FYMA 2HEWF 2JDAA 3POBA 3RZJA 1JU3A 3BGAA 5I0RA 3DYMA 3I3DA 3KGZA 4XFAA 2C5DA 3HWJA 2VW1A 2O0OA 4K6BA 1W9FA 4CP9B 5KBFA 4HOOA 5F7UA 1W6MB 2VM9A 4FP3A 1HRI1 2EA7A 4OUEA 4RGKA 1W2AX 3E6DA 1UF2C 2WC2A 1VBB2 4S2HA 1YQ2A 3DGTA 5CFCB 2CGOA 4KQ7A 4AQ2A 3S5QA 4RQPC 4EN9B 2X10A 2MEV2 5IAVA 3AVSA 4QXKA 5FPUA 4MSVA 4Q5OA 2AGSA 2WJSA 1ALYA 1COV2 2UY8A 5GKAC 2I2SA 3H7JA 4OI1A 3ZFGB 1Z7S2 2QZ3A 2V4VA 2X5IA 4YM2A 1ND2B 5FO7B 1Q56A 1YRZA 3OBTA 1DCSA 1QQP1 2GDFA 5CISA 2ERFA 4M01A 3I2FA 3TNQA 1RUC3 4CYDA 1UL9A 2YMZA 1QH6A 2ZMKA 1FAYA 2YC4A 2D5FA 3J4UH 2QQPA 3LB9A 5FY5A 2JG9B 4OI2A 5AVAA 2Y0IA 5A32B 3USUA 3O1UA 5FXZA 4LJHA 4GKXA 4M3CA 3AC0A 1D2SA 1WA6X 2WN3A 4DOUA 1VRH2 4QPIC 1SEFA 2ZGRA 3APBA 1U12A 3H3ZA 2WABA 1MEC1 2W3JA 2E31A 4AAXA 1LODA 2RMU2 4JKKA 1H0BA 2WZEA 2WRAA 4K21A 4EZ4A 1QIQA 2W68A 4LBQB 3CNAA 4QX5A 3OUIA 5EZWA 1SG3A 3NQHA 1A6CA 1KJRA 2B9UA 3IWZA 4I09A 4QU2A 3MPPG 1PM4A 4HSLA 4G3YC 4RS5C 3USSA 1VB2A 4Y5Z0 4CP9A 4XURA 1GWKA 1W6MA 3F2ZA 3MIFA 5J37A 4BQ1A 3GF6A 4HVQA 5FZDA 5E88A 1RUF1 4BQ2A 4YZ3A 2QQVA 1H9WA 2Y6KA 4NIHA 2ZX3A 3RZLA 4XF4A 5FQ0B 4PF1A 5CFCA 2WFPA 2J1UA 3WR0A 1BQPA 1MPXA 3L2HA 5LW9A 3BTAA 3OTFA 1PO23 3T2TA 4ASKA 1C5IA 1QJY2 1VIWB 4OHVA 4QQOA 4CA9A 1F8VA 1REFA 2NP0A 4OHWA 2VXJA 1ND2A 2JE8A 2WFF3 4Y1VA 1HN0A 1S2BA 2XDVA 5BXXA 1SBFA 3IT8A 1QJU2 1V70A 2WZ8A 1ONAA 3DYOA 1PIV2 3E6BA 1LOBA 1CWPA 2VZPA 2E33A 4HK9A 3MW3A 5T5OA 3WNKA 1GP4A 1DQ1A 3EBRA 3ST7A 1Q3EA 1UY0A 4D7TA 2I45A 4OHXA 1KQRA 2JG9A 5A32A 1DLCA 1XE7A 1XSQA 2R043 3THCA 2BNOA 5FZ0A 3ILFA 1EV11 2JG8A 1YJKA 3ETQA 1HXS3 4Y5TA 4CZSA 2WNVB 3CBNA 5A6ZA 5BNNC 1AL23 1O8SA 1XNKA 1RUJ1 2PHUA 4XW3A 4ZPIA 4ZHNA 3P3PA 4LBQA 1QJFA 1O7FA 5EFUA 2A7AA 1RMU3 2FZ1A 5FKCA 1EUUA 4PLMA 4Q8KA 2JICA 2PLV2 1MS0A 3I54A 4XAEA 3TEYA 5IJRA 1Y4WA 4E8DA 1AR72 1WLWA 4ARYA 1BZWA 4IE0A 1K45A 1RUD2 1OMIA 5FQ0A 3UETA 3MHZA 3E97A 3MW2A 5ACA3 3OD0A 1O4TA 1VBE2 2DBIA 1W2UA 1DLLA 3QH7A 5FZCA 2QQUA 4AHZA 2VMIA 5FZ3A 5AC91 1R1ZA 2DCKA 1NZIA 2WQZC 3C2UA 5FXWA 4A3ZA 1F2NA 3MIHA 4KU7A 4IV1C 2W08A 3BI3A 2XL9A 2FDHA 4Y22A 2ZEZA 4IXLA 5DZEA 4XPVA 2BU9A 4LO6B 1WZXA 2VZVA 4IEWA 3LIHA 3WF0A 1QOTA 4XCAA 1ASJ2 1WW7A 4FXKB 2A6YA 1P8JA 2PMWB 4BMBA 1PM7A 1UMHA 1K3IA 2UURA 4AFDA 4CP0A 4PCRA 4FAHA 5B2GB 2A6VA 5LEKA 1O3RA 3K3NA 4CUCA 5CG8A 2QFEA 3H7YA 3H50A 1XE0A 5E8AA 4E9KA 4MHUA 4DIQA 2WNVA 1HRV1 3FC0A 3KD4A 1H30A 1ULOA 2GAUA 4Q4V1 4PIYA 1Q8OA 4YM1A 3T2QA 5I8TA 5DG2A 2FCTA 1RYYA 3ZFFB 5HI0A 3VZOA 4U36A 1JZ3A 4MUVA 1W8TA 3N9NA 2E53A 5EHDA 4YGBA 3N7LA 4QPGC 3DPRC 1NY71 3HEIA 4MOAA 4XTMA 2A6ZA 5T5PA 3HD8B 4CCLA 1AXYA 1H8TB 3C7GA 5D21A 1DZTA 1UNBA 5C8CB 4NOTA 1E5RA 2D97A 2YPDA 1H8VA 1XNBA 2ZCWA 5A6QA 1W0NA 4MGIE 3IMMA 3U75A 1Q8QA 1L7QA 4XVHA 1D4M2 2W46A 2XBO3 3NSTA 4LO5B 2K9ZA 1STMA 2VU9A 2DCJA 2IXLA 4XCBA 1NYWA 3C7HA 1WBFA 1OT5A 1GP6A 2DDUA 4QDQA 4UFLA 1M4WA 3UJQA 4Q4Y2 2FCVA 5FUNA 1VMFA 2NPIA 3W59A 4OQ8A 5LK5A 1H2KA 3VKMA 2VTFA 1SPPB 4RR3C 5JVVA 5L7OC 1C57A 5J7MA 1JXNA 2AC1A 3I3EA 4M00A 1X9TA 4XF3A 4L11A 3SNMA 5FPBA 3FFZA 2GNBA 3LOIA 2IZWA 3MV01 4LQRA 2WNUB 1Q43A 2BV4A 3BU7A 5FY9A 3ZFEB 2XPJA 4TZDA 2XJUA 1J1LA 5FFOC 3ACLA 1RINA 1W9SA 1OOPA 2VO5A 4JHTA 4PDWB 3GJBA 4INDA 5ABJB 1VBC1 2VUDA 2Y26A 1O59A 4M3CF 2DU0A 2RDRA 2GC3A 1SQ4A 3JU9A 4JHZA 3AMPA 3OGGA 1H6YA 1TNFA 3NMBA 4KL1A 3O14A 4DUWA 2LW8A 3DYPA 4E8CA 5BPXA 4ZZ5A 3EXUA 1NA1B 4RA0A 1I3HA 1VAVA 2FDKA 2YFUA 4TXWA 2WAAA 3JBG2 2YXSA 5EJZB 2Q8OA 2ARAA 4A7YA 5C8CA 1QNWA 4NVPA 5IAXA 1GANA 2VMGA 1SBDA 1AR63 2PHFA 5JUVA 5FPVA 3VDCA 3OOXA 4I3PA 4YVWB 1VR3A 1LAJA 2D3PA 2XL7A 3BVCA 3VBRC 3ITQA 3WCSA 4GWNA 3WP4A 4MG2A 4GA9A 4QKFA 5A3UA 4NIGA 1QJZA 1YYNA 4O65A 3BKZA 1W06A 5I0UA 5A1LA 4XMAA 4HKOA 5CADA 1RUH3 1VBD2 1JMUB 3W9AA 1UU5A 3NAPC 1G9FA 4CDWB 5A1FA 2NQYA 3I2GA 4Q4X3 1KJLA 4N8MA 5CFDB 4QDRA 4TSVA 1NT0A 1DGRN 4PT6A 1PVC2 3RQ0A 3ZXJA 1GOHA 4GH4B 5HCHA 4W6WA 1AXKA 2E32A 2ZX0A 2ZX1A 5FYHA 2IWGB 1RC6A 3J8F2 4J1XA 4KI5M 1AYN1 2WNUA 3ZFEA 3W5MA 5A7OA 5F1RA 4ZXEA 3PVEA 2QQLA 3LGRA 4PDWA 3POJA 2R16A 2UWBA 2XLAA 2DCTA 1PGW2 4GMP0 4F7ZA 4XUTA 1UIJA 3GCXA 5ABJA 1CR7A 1PNGA 4HSJA 1HRI3 2RJ2A 1NE4A 4W50A 1C8M1 3E5UA 5A3NA 1IPSA 5IVFA 4HVRA 3ZXDA 1IPJA 1UMIA 2OUJA 4CPBA 3TRSB 2XOMA 2OKXA 5FCCA 3O0VA 1FOD2 3GZTB 1X8MA 1KEXA 2HWF1 4R9AA 5FUPA 3FFQA 1R082 1WCQA 2V72A 1EP0A 5FKBA 2WSUA 3PUAA 4UW4A 1XE8A 1FNZA 4DRRA 1ND3B 5GZCA 3TBDA 5A33B 3ZX7A 1QQP3 2UYAA 3C7OA 2WZR1 1VE0A 2VZOA 3RJRA 4ZXKA 1LOFC 2VW2A 4QAWA 4FP2A 4FPFA 3IAPA 4W6XA 3TN92 3POYA 2OIIA 4IERA 5IVYA 3VBUA 2QQMA 1GU3A 1W2OA 1QJX1 2XJPA 3B7MA 5GZDA 1LKNA 4I0AA 1SFYA 3NNLA 2ZA9A 4XE9A 3K3OA 5FXXA 5C6CA 4CDWA 1UY1A 4LBQD 4EWDA 3HBKA 4A44A 3AKSA 3ECQA 4UBHA 3N9PA 3VKOA 3VDDC 3E5QA 3AP5A 1H9PA 3LEKA 3WOGA 3ZM8A 1MEC3 4GH4A 1AR82 3D0SA 2ZMLA 3CQOA 1QNYA 4BQ3A 4E2QA 1PK6B 4FPYA 2EALA 1ZRRA 4JQTA 3VBHB 3B02A 3LQCA 1CZSA 4AFAA 1S0IA 1VBB1 3NO8A 5IUQA 5C8WA 1FV3A 4XBQA 5FR3A 4BE3A 3VL9A 5E16A 3NWKA 1JOPA 2MEV1 1YI7A 4CCEA 1RUF3 3ES4A 4IV3B 4XC9A 2Q1MA 2GNDA 3LSDA 1O5LA 1COV1 1DHKB 2ZACA 1FPN2 4HN0A 3JQXA 5CNAA 4YG3A 2E7AA 3IDBB 3WDTA 1CAWB 3POEA 5IK4A 1TE1B 2GNTA 4CTEA 2HWD2 1CIWA 1AR92 2PYTA 3ZXFA 3WF3A 2EAAA 4ZS2A 4FOVA 5HXVA 1HLCA 1ND3A 5KXCA
chains in the Genus database with same CATH topology
5FZ3A 3PU8A 2OQ7A 5FXWA 5FPLA 5FYSA 4Y33A 5A3WA 5IVBA 5A7QA 4CCNA 2PXJA 5IVJA 5IVVA 5A1LA 5FBJA 5FY0A 5A7WB 3ZLIA 4IGOA 2GP5A 3OPTA 4LITA 3N9MA 3KV6A 5F3CA 5A1FA 5FY5A 5FZIA 4NUBA 3KV4A 5ISLA 3N9QA 3LDBA 4QXCA 5FXZA 4EYUA 5FXVA 3DXUA 3K3NA 3KVBA 3PUQA 4BXFA 4LIVA 4C8DA 4QXBA 4CSWA 5FZ7A 3KV5A 3ZPOA 5FYHA 4QU1A 5IWFA 5A7OA 4DIQA 4GD4A 5A7SA 5FZ4A 2YBKA 4EZ4A 5FWJA 5F3IA 4CCMA 5A3TA 5F5AA 3U4SA 3K2OA 3N9NA 3DXTA 5F39A 5FZHA 5A3NA 5IVFA 5FYVA 5FP9A 3LD8A 5FYBA 3KVAA 2XXZA 5FP8A 4CCLA 3AL5A 4CCOA 5LY1A 5FP3A 3PURA 5FZDA 5FZBA 4BISA 5FUPA 2OQ6A 4V2WA 5F2WA 4D6SA 2YPDA 2YU1A 5FYCA 3PU3A 3PUAA 4UF0B 5FP7A 2Q8DA 2WWUA 4ASKA 4DO0A 4EZHA 5IVCA 5CEHA 5LWBA 5FZ8A 2OX0A 4QX7A 3RVHA 4CCKA 5FZMA 5FZLA 5FWEA 5FV3A 5FYIA 3UYJA 5FPAA 2GP3A 2XDVA 4IGPA 4LIUA 4D6QA 1VRBA 2YBSA 5FZOB 5IVYA 4E4HA 5F5CA 3KV9A 5FUNA 5FYYA 5FJKA 3PDQA 5FY7A 5FZFA 4CUGA 5FY8A 5A7WA 3PTRB 5F2SA 5FZGA 3K3OA 5FXXA 5K4LA 4Y3OA 5A7NA 5F5IA 5FZ1A 5FZ9A 5FZKA 5LY2A 4BU2A 2YBPA 5ANQA 4CCJA 5F3GA 4GJZA 4XDOA 3N9PA 5F3EA 3AVRA 5A3PA 5FPBA 5FZAA 5FZ0A 5FYUA 2WWJA 3U78A 5FY9A 5FZEA 2YU2A 4GJYA 4D6RA 5IVEA 5F37A 5FZ6A 3PUSA 5FYZA 5F32A 5A80A 3OPWA 5FYMA 2XUEA 4AAPA 5FJHA 5FY1A 5FZOA 4AI9A 4HONA 2W2IA 4HOOA 3N9LA 2Q8CA 3AL6A 5FYTA 4QXHA 2OT7A 4TN7A 4GAZA 4LXLA 4Y4RA 2P5BA 4IGQA 4QX8A 5E6HA 2XMLA 2OS2A 4QWNA 5A7PA 5IW0A 4URAA 5FY4A 5KR7A 4V2VA 3AVSA 2Q8EA 5FPUA 3NJYA 3N9OA 5FPVA 5FP4A 2VD7A 4XDPA 4UF0A 5FZCA 5LW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FZ3 A;  3PU8 A;  2OQ7 A;  5FXW A;  5FPL A;  5FYS A;  4Y33 A;  5A3W A;  5IVB A;  5A7Q A;  4CCN A;  2PXJ A;  5IVJ A;  5IVV A;  5A1L A;  5FBJ A;  5FY0 A;  5A7W B;  3ZLI A;  4IGO A;  2GP5 A;  3OPT A;  4LIT A;  3N9M A;  3KV6 A;  5F3C A;  5A1F A;  5FY5 A;  5FZI A;  4NUB A;  3KV4 A;  5ISL A;  3N9Q A;  3LDB A;  4QXC A;  5FXZ A;  4EYU A;  5FXV A;  3DXU A;  3K3N A;  3KVB A;  3PUQ A;  4BXF A;  4LIV A;  4C8D A;  4QXB A;  4CSW A;  5FZ7 A;  3KV5 A;  3ZPO A;  5FYH A;  4QU1 A;  5IWF A;  5A7O A;  4DIQ A;  4GD4 A;  5A7S A;  5FZ4 A;  2YBK A;  4EZ4 A;  5FWJ A;  5F3I A;  4CCM A;  5A3T A;  5F5A A;  3U4S A;  3K2O A;  3N9N A;  3DXT A;  5F39 A;  5FZH A;  5A3N A;  5IVF A;  5FYV A;  5FP9 A;  3LD8 A;  5FYB A;  3KVA A;  2XXZ A;  5FP8 A;  4CCL A;  3AL5 A;  4CCO A;  5LY1 A;  5FP3 A;  3PUR A;  5FZD A;  5FZB A;  4BIS A;  5FUP A;  2OQ6 A;  4V2W A;  5F2W A;  4D6S A;  2YPD A;  2YU1 A;  5FYC A;  3PU3 A;  3PUA A;  4UF0 B;  5FP7 A;  2Q8D A;  2WWU A;  4ASK A;  4DO0 A;  4EZH A;  5IVC A;  5CEH A;  5LWB A;  5FZ8 A;  2OX0 A;  4QX7 A;  3RVH A;  4CCK A;  5FZM A;  5FZL A;  5FWE A;  5FV3 A;  5FYI A;  3UYJ A;  5FPA A;  2GP3 A;  2XDV A;  4IGP A;  4LIU A;  4D6Q A;  1VRB A;  2YBS A;  5FZO B;  5IVY A;  4E4H A;  5F5C A;  3KV9 A;  5FUN A;  5FYY A;  5FJK A;  3PDQ A;  5FY7 A;  5FZF A;  4CUG A;  5FY8 A;  5A7W A;  3PTR B;  5F2S A;  5FZG A;  3K3O A;  5FXX A;  5K4L A;  4Y3O A;  5A7N A;  5F5I A;  5FZ1 A;  5FZ9 A;  5FZK A;  5LY2 A;  4BU2 A;  2YBP A;  5ANQ A;  4CCJ A;  5F3G A;  4GJZ A;  4XDO A;  3N9P A;  5F3E A;  3AVR A;  5A3P A;  5FPB A;  5FZA A;  5FZ0 A;  5FYU A;  2WWJ A;  3U78 A;  5FY9 A;  5FZE A;  2YU2 A;  4GJY A;  4D6R A;  5IVE A;  5F37 A;  5FZ6 A;  3PUS A;  5FYZ A;  5F32 A;  5A80 A;  3OPW A;  5FYM A;  2XUE A;  4AAP A;  5FJH A;  5FY1 A;  5FZO A;  4AI9 A;  4HON A;  2W2I A;  4HOO A;  3N9L A;  2Q8C A;  3AL6 A;  5FYT A;  4QXH A;  2OT7 A;  4TN7 A;  4GAZ A;  4LXL A;  4Y4R A;  2P5B A;  4IGQ A;  4QX8 A;  5E6H A;  2XML A;  2OS2 A;  4QWN A;  5A7P A;  5IW0 A;  4URA A;  5FY4 A;  5KR7 A;  4V2V A;  3AVS A;  2Q8E A;  5FPU A;  3NJY A;  3N9O A;  5FPV A;  5FP4 A;  2VD7 A;  4XDP A;  4UF0 A;  5FZC A;  5LW9 A; 
#chains in the Genus database with same CATH topology
 2RJK A;  5A33 A;  4I0B A;  3RZG A;  2ZJC A;  3KHC A;  3K4A A;  2RE9 A;  4N9I A;  3WQ1 A;  1C8N A;  4WV8 A;  2JDK A;  2OUH A;  1JUH A;  2QQW A;  3ZYF A;  4PLN A;  3TOJ A;  3FE5 A;  2VCB A;  4QKB A;  5JWP A;  2C9A A;  3D8C A;  4M3C E;  1UYY A;  4QT6 A;  5J96 B;  1B09 A;  1TMF 2;  4AVS A;  1F5F A;  2E51 A;  2W39 A;  1Z78 A;  1X82 A;  5JIU A;  1WLT A;  3Q8F A;  1V6I A;  4IEZ A;  4IDZ A;  4Q0P A;  4B1M A;  2ADE A;  1W2T A;  2RMU 1;  3JUU A;  4AGG A;  4YW5 A;  4NII A;  1EV1 3;  2OPK A;  3JD7 2;  1DZQ A;  3WSO A;  1ZM1 A;  2XWJ B;  4BME A;  4XAC A;  4HZF A;  2B46 X;  5FTT C;  3GHM A;  2Z5W A;  4JGZ B;  5JI7 A;  4Z1V A;  1RUJ 3;  3S30 A;  3F95 A;  5DUW A;  1IQA A;  3T0B A;  1KD7 A;  2ARX A;  2EAK A;  4FAG A;  1PK6 A;  1TG7 A;  2ENR A;  4Q1R A;  4NWW A;  2YBK A;  4XUQ A;  2E9Q A;  2VUA A;  5LB6 A;  4AK3 A;  2V09 A;  2SLI A;  3VBH A;  1W8N A;  2QQK A;  1OI6 A;  2C9K A;  5EYX A;  1PMI A;  1GSL A;  4LNV A;  4DZG A;  3OUH A;  3BIE A;  2YG0 A;  3NV3 A;  2W47 A;  5FP9 A;  1ZZ6 A;  4K9S A;  2AEY A;  2YHJ A;  3GBG A;  4P9L A;  4RGG A;  4XF1 A;  4AGR A;  1F35 A;  4FFH A;  4CCO A;  3HT1 A;  3FUO A;  2LTN A;  2XVG A;  4IV3 A;  4QD2 A;  5FP3 A;  4XIL A;  1OH4 A;  1QJY 1;  2A73 B;  3WX5 A;  4F8A A;  1WW6 A;  3OYW B;  2ZX2 A;  4FI9 A;  3RI9 A;  3V65 A;  4DUV A;  4BLI A;  1J3Q A;  1LES A;  4EWE A;  2Z4F A;  1CAW A;  2YU1 A;  1D0H A;  1QJU 1;  2AZ5 A;  2B45 X;  4FCA A;  5AC9 3;  1PIV 1;  3BIW E;  2E63 A;  4HLT A;  3QD6 A;  3RZM A;  3RJ2 X;  5AFB A;  5EXO A;  2TUN A;  3OSD A;  2NYY A;  4LLO A;  1GNY A;  1TME 2;  1UQX A;  4CDX A;  4CCK A;  1RUN A;  4R9C A;  1C5H A;  1HB2 A;  1WLD A;  5J36 A;  1ENR A;  4XF9 A;  1G9D A;  4LA2 A;  5C9A B;  4CEW C;  4UFH A;  2CU5 A;  4WZF A;  1BMV 2;  1J1T A;  3CJI C;  1YCI A;  4UW5 A;  1Y9G A;  1JHJ A;  5ANQ A;  3AP9 A;  1W9W A;  4LBN A;  1G8W A;  4XDO A;  4MVT A;  5FZA A;  5H9Q A;  5C5T A;  4CDQ B;  3M3I A;  4AR2 A;  2ZX4 A;  1B35 C;  3KF5 A;  1HRV 3;  2XR4 A;  4DEQ A;  1LHU A;  2EVX A;  4MGK E;  3WDU A;  4Q4V 3;  3U10 A;  4WVM B;  5F37 A;  4X8P A;  2PLV 1;  1S1A A;  4PI0 A;  5BNO C;  2OZ6 A;  4A7K A;  2YGL A;  1AR7 1;  1EAH 2;  4YZ1 A;  4XFF A;  4MH0 E;  4EJR A;  3WV6 A;  1RUD 1;  1HQW A;  4JGY A;  3MO4 A;  2Y6F A;  3H42 B;  3ZSE A;  3VL8 A;  1OHF A;  2JB8 A;  4TN7 A;  3WNX A;  5D8A C;  4QX8 A;  4NPL A;  3ZFG C;  2X8K A;  5J09 A;  4LLF A;  4YFZ A;  2ET7 A;  3ZSM A;  2BUK A;  4QWN A;  5K0U B;  4A4A A;  5KWR A;  2UWC A;  1E5I A;  5JSP A;  1BEV 2;  3ZPY A;  1R09 2;  1ODN A;  2UWA A;  1MVE A;  1AX1 A;  1ASJ 1;  1FI2 A;  2XH6 A;  4FFI A;  4XQ4 A;  4XXA A;  5FPL A;  1ZRI A;  2ZHN A;  2B42 B;  5JCT A;  1V9U 2;  2OPW A;  1DG6 A;  3WW3 A;  1POV 0;  1PZ7 A;  1GR3 A;  1QF3 A;  5FK7 A;  5A7Q A;  1U5Z A;  5L9B A;  4BIO A;  4YVS A;  4FQZ A;  1JZ7 A;  1SLT A;  3PIJ A;  4XMI A;  5C9A A;  3OPT A;  3MDP A;  4LIT A;  3MZH A;  3H9A A;  5DAB A;  1UZW A;  5JMO A;  4BJ0 A;  2ZTN A;  4R4X A;  1X36 A;  4FQ4 A;  2PAE A;  4QPW A;  5FXV A;  4LO7 A;  3I59 B;  5C71 A;  1UXZ A;  4IUG A;  2GC1 A;  4UXA A;  2Y38 A;  4CPB D;  3A0K A;  4ATE A;  4CDQ A;  5JPN B;  2NLR A;  3OD4 A;  4S2D A;  3D6E A;  4A41 A;  1VBC 3;  3H3U A;  4AED B;  2FDI A;  1SDD B;  1HB4 A;  2JE9 A;  2C0Z A;  1VLN A;  2A70 A;  2EIE A;  1E5S A;  4WVM A;  3ACF A;  5F3I A;  3Q9O A;  3FHI B;  2JD4 A;  4G9S B;  2C1F A;  3K2O A;  1UAI A;  2ZZQ A;  3MLL A;  3Q8C A;  3POI A;  1LHW A;  4NAM A;  3UKT A;  1YFX A;  5BNP C;  2VTX J;  3VHO A;  2WDB A;  1DGW X;  3CF6 E;  3VBO C;  2P4E A;  4IEP A;  2VNV A;  4COZ A;  2BPA 2;  1NQJ A;  2LRO A;  5IK8 A;  1CD3 G;  3VHP A;  4B4Q A;  5FLI A;  1CPM A;  1ZA4 A;  2E6V A;  1HV0 A;  4QB2 A;  2ZMN A;  5T50 A;  3I49 A;  3KZ4 C;  2HWB 2;  3C7E A;  2FQP A;  3ACH A;  1BJQ A;  3MV1 1;  2HLE A;  3PU3 A;  5K0U A;  4AI1 A;  4Q4Y 1;  2WWU A;  4OMD A;  3UNP A;  2BP6 A;  3LOB A;  1XNT A;  2VZ3 A;  5FZ8 A;  2VVF A;  5L9V A;  4I3G A;  3OGV A;  2YY1 A;  2JIG A;  2ZHL A;  3R4U A;  1GIC A;  3V56 A;  2Y34 A;  4CU7 A;  1FYU A;  2P2K A;  2YBS A;  2ZAB A;  3I7D A;  5CKM A;  5HCF A;  5JI9 A;  4XJ8 A;  4UOJ A;  2V73 A;  4QQP A;  4B7K A;  3VHN A;  4LE3 A;  2QDR A;  2IVJ A;  1U0A A;  1X33 A;  5F6K A;  1YFU A;  4CCJ A;  1G86 A;  4HL0 A;  1UMZ A;  1PMH X;  4M0N A;  4DXR A;  2JKB A;  4AZZ A;  3VD7 A;  4QPI B;  4L2N A;  1Q5O A;  1AYN 3;  4P02 B;  1QH7 A;  2VTX A;  4JKL A;  3ZVX A;  4Z92 B;  3ZYJ B;  4Q26 A;  2Y6G A;  5LRR A;  3RG0 A;  5E89 A;  1XPW A;  1MQT C;  1OQE A;  5IYY A;  2IXI A;  1R64 A;  1NKG A;  3AMN A;  5LA2 A;  3RSJ A;  1AR6 1;  3W5N A;  4AED A;  2JX9 A;  2WS9 2;  4RS5 B;  5JSO A;  3CL1 A;  5LRS A;  1GZT A;  1C8M 3;  1RXG A;  3JBG 1;  1JZ8 A;  2ARB A;  1AVB A;  4OMC A;  5FJH A;  5FY1 A;  4UW3 A;  4HON A;  3N9L A;  1VAM A;  1OFS A;  5CIR A;  3AL6 A;  3ABZ A;  4IEQ A;  4OFG A;  4D8M A;  2HWF 3;  1HJG A;  1AZD A;  5HV0 A;  2A71 A;  4E27 A;  4LBO A;  1H1M A;  1HQL A;  2XML A;  1SFP A;  4RQP A;  5FMO S;  3CHX A;  1SFN A;  4IQP A;  3ZDS A;  2JWP A;  3INA A;  1FX5 A;  3CZU A;  4G4F A;  2XVK A;  4BZ4 A;  2WZR 3;  4Q4W 2;  1Z0H A;  1VBD 1;  1EYB A;  2JDU A;  4XDP A;  2D44 A;  1OXC A;  2WO2 A;  4GMP 1;  4PI2 A;  2RVA A;  4XDQ A;  1F4A A;  2GN7 A;  1QJX 3;  2P37 A;  3NRU A;  1PVC 1;  4YSF A;  3HT2 A;  3ZLI A;  5T5J A;  4H55 A;  2WLP A;  3M7A A;  3OBZ A;  5APA A;  3VKN A;  3J8F 1;  4YLZ A;  1IZ3 A;  1A3K A;  5DUX A;  2GH2 A;  2DYC A;  1UWW A;  2ZGN A;  5BUV A;  3KV4 A;  3C8X A;  1CN1 A;  1PVX A;  4AG4 A;  3PUQ A;  1PGW 1;  4E2S A;  1WMF A;  4A7Z A;  1JBC A;  4CSW A;  4QPI A;  3IZO A;  4Y1Z A;  4J25 A;  3ZR6 A;  1UX6 A;  2WKK A;  3MEP A;  2PAM A;  2BWA A;  4QB1 A;  1VBB 3;  3EMR A;  3K48 A;  3LA7 A;  4XAB A;  1FOD 1;  1S0C A;  1XRU A;  3ES1 A;  3J9S A;  2W1U A;  4RS5 A;  1RJ7 A;  2MEV 3;  5F5A A;  5IAT A;  1R08 1;  3HQR A;  5K9Y A;  1H6X A;  1F4H A;  1COV 3;  2D98 A;  5FYV A;  1J3R A;  2RR1 2;  4MAD A;  1Z7S 3;  2JEC A;  3NNM A;  4UBG A;  5L9R A;  2XHK A;  2HEV F;  3K51 A;  2XXZ A;  2FMD A;  5CU1 A;  4BIS A;  4FTB A;  1SHW B;  4Q0U A;  5JMC A;  1OUS A;  2D40 A;  3N36 A;  2FZ2 A;  4TLF A;  4YW7 A;  2W92 A;  5IFT A;  4IE5 A;  5E1R A;  3TN9 1;  3POG A;  2JG8 B;  3IPV B;  5JR2 A;  4UF0 B;  2AUY A;  2RS1 2;  4PBO A;  4XJA A;  3N35 A;  4RSU A;  3B00 A;  1WBL A;  2D3S A;  2PHD A;  4LBK A;  3C3V A;  5DAQ A;  3VDA A;  4IV1 B;  3U4X A;  1LOE A;  1GUI A;  3BOW A;  4NIA A;  2GN3 A;  3ZYP A;  1OPO A;  3M3E A;  1JOD A;  3QH6 A;  1VRH 3;  3THD A;  2ZGL A;  4LEJ A;  5FYY A;  4FO9 A;  1XNA A;  3PDQ A;  4F83 A;  1AR8 1;  2RMU 3;  5FZG A;  2QNK A;  1S2E A;  3SEE A;  3J7M A;  4Y3O A;  5A7N A;  3M3Q A;  3WDW A;  3NW4 A;  1YQ8 A;  1W90 A;  3BB6 A;  4F3J A;  3O5S A;  1BYH A;  4RFT 0;  3W21 A;  3AVR A;  2WN2 A;  4CDU C;  3VBS C;  1GYK A;  4LKD A;  5FPZ A;  2R49 A;  5BNN A;  3BUC A;  5DN2 A;  5CZK A;  2JDM A;  3DF0 A;  5IVE A;  2WA3 A;  4NHL A;  1OQD A;  3M2M A;  1SCS A;  2FHR A;  1FPN 1;  4Y22 B;  2XUE A;  2RG4 A;  2JJ6 A;  1AUY A;  4QPG B;  1JYI A;  2WNO A;  3DPR B;  1CZT A;  5GLT A;  1KDK A;  2HWD 1;  3AK0 A;  1AR9 1;  3PUI A;  1NQD A;  3JXS A;  1GFF 2;  4XF0 A;  1QJY 3;  3VKF C;  4DRV A;  3FLT A;  1GWM A;  4GAZ A;  4GAL A;  2A6X A;  5E6H A;  2GSY A;  5A3O A;  4WVZ A;  3FWE A;  1YLL A;  2LS6 A;  1NLQ A;  1QJU 3;  3MI8 A;  4MET A;  4PHZ A;  2BOI A;  3K4D A;  2A3X A;  1PIV 3;  3KT1 A;  2G9G A;  4IET A;  1DQ6 A;  3WT3 A;  2AAC A;  2RDQ A;  3IPV A;  2VD7 A;  4UF0 A;  1CVN A;  4B8E A;  1TMF 1;  3BOD A;  1JYT A;  1WMX A;  4X6R B;  3TB0 A;  3WIN E;  2CWM A;  4IV1 A;  2WWS A;  2ZAH A;  1G9A A;  5FUI A;  4AQT A;  3JD7 1;  4XFC A;  2X53 S;  3IKW A;  3ZKU A;  1OSG A;  5A7W B;  2PHX A;  4RR3 B;  4QB6 A;  4K1Y A;  5L7O B;  2IFW A;  1HIX A;  4FOY A;  2Q0A A;  4HBN A;  1WWY A;  1SLA A;  4FPK A;  5B4X A;  3DL3 A;  1LED A;  1RUG 2;  2XUM A;  3LE0 A;  4HET A;  4I01 A;  4I02 A;  4YW3 A;  5GLU A;  4BXF A;  2QQO A;  2D6O X;  4ZU7 A;  5K8S A;  3O1S A;  4LKE A;  1LR5 A;  3KV5 A;  3UK9 A;  3G7D A;  4UT5 A;  4Y1X A;  2WZP P;  2PLV 3;  4DUX A;  2Z69 A;  4I30 A;  2BVV A;  4GD4 A;  1V6M A;  1PO1 2;  1AR7 3;  2MNG A;  5A7S A;  2GC0 A;  4RHV 2;  1RVF 2;  1RUD 3;  1PHM A;  1RUO A;  2BW8 A;  1HV1 A;  2O8Q A;  4O7X A;  2X09 A;  5BYN A;  3N7K A;  2WQ4 A;  2HJI A;  3P3N A;  3RDI A;  4QPG A;  1J83 A;  3DPR A;  2D6P A;  3N4M A;  2E7T A;  2GU9 A;  5FP8 A;  3VLB B;  1I6X A;  5C3S A;  1UYP A;  2B39 A;  1TME 1;  1QGL A;  3P5B A;  5F2W A;  3KLS A;  4NPM A;  2BRT A;  5JZG C;  2VZ1 A;  4XJZ A;  1D0G A;  2A75 A;  3DV8 A;  2D43 A;  1ASJ 3;  4BQY A;  3NV4 A;  3VBR B;  1BMV 1;  1PNF A;  1OOP B;  1W05 A;  2CAV A;  4FVV A;  2Z79 A;  2JE7 A;  1XND A;  1VP6 A;  2YFZ A;  4YRD A;  2VCA A;  4K40 A;  4XHX A;  4AYU A;  2WL1 A;  3D82 A;  3R4D B;  4UAP A;  4E4H A;  2JD9 A;  3NAP B;  2NMO A;  1NXD 1;  4NWV A;  1RUI 2;  2CWS A;  1JUI A;  4QX0 A;  5FY7 A;  5FZF A;  5A7W A;  3IDA A;  2UY9 A;  4RR3 A;  5LBB A;  2F4P A;  4Y26 A;  3VD3 A;  1YWK A;  4LPL A;  5L7O A;  5KXD A;  1DU3 D;  2DUQ A;  4MYE A;  1ULE A;  4IEU A;  3WF4 A;  4N7I A;  1IKP A;  1HQN A;  4OYU A;  3U78 A;  4NE9 A;  1PZ9 A;  1I5Z A;  3UV9 A;  3RYP A;  4AHY A;  2ADD A;  2VNG A;  4P9Y A;  4D7S A;  4NHX A;  3T30 A;  2Y33 A;  4L97 A;  1YJL A;  4WBB A;  1ZX5 A;  4QM8 A;  1POV 1;  2BWC A;  3ZSK A;  5F32 A;  2DVF A;  2ZGU A;  4GIQ A;  1XBF A;  3LDK A;  1DZR A;  2Y6J A;  5JAX A;  5JOY A;  1CAX A;  1ZRF A;  2PAK A;  3A22 A;  3N3H A;  1OUR A;  4N90 A;  4I0W B;  3DCQ A;  1JTZ X;  2X29 A;  1C28 A;  1HJF A;  1D4M 3;  1UY2 A;  3J26 N;  1BEV 1;  1US3 A;  1R09 1;  3JCI A;  2B7Y A;  3ZN6 A;  4IGQ A;  4BM8 A;  2ZGT A;  5FOJ B;  3DKW A;  2OS2 A;  1V9U 1;  3KQR A;  4XUO A;  4RD7 A;  3MFA A;  3AKP A;  4Q4Y 3;  4AFB A;  3S0M A;  1PX3 A;  1S0J A;  1ULG A;  4W4Z A;  3B94 A;  3I2D A;  3DKQ A;  2HKX A;  2ORX A;  1QDC A;  2WO7 A;  4IE7 A;  2Q1Z B;  3VBR A;  3NKT A;  3KS7 A;  1MZE A;  3GGL A;  4Y33 A;  3HVD A;  5I91 A;  3R05 A;  1XNC A;  2XQX A;  2Z42 A;  3LEG A;  4H7L A;  3VGI A;  4AW7 A;  4BLJ A;  5IVB A;  1R1A 2;  1W8H A;  5IVV A;  1QY4 A;  4Q0S A;  2OW4 A;  3LPG A;  3NAP A;  4ZY9 A;  2XHN A;  4LUM A;  4MLO A;  4QGM A;  1OA3 A;  1IS5 A;  1K12 A;  2ZGQ A;  5ISL A;  3VDD B;  3VV1 A;  4CXX A;  4KU8 A;  3DXU A;  2QBX A;  4NN0 A;  1YC6 1;  1F15 A;  1L7R A;  2F4L A;  3BOP A;  3GAL A;  3WW2 A;  4LHK A;  1M06 G;  2WYF A;  4QU1 A;  2QQI A;  5FLH A;  3R0R A;  3FJS A;  4ZU4 A;  4V1P A;  4XTP A;  1CES A;  2WT2 A;  3KSC A;  2VXR A;  3O0X A;  1DDL A;  5KHK A;  1S2K A;  1LGN A;  3ON7 A;  5T54 A;  3ZYH A;  3JBG 3;  4IEV A;  1NX9 A;  4H14 A;  3WP3 A;  3T2P A;  4A6O A;  1N1V A;  4BHP A;  4WM7 C;  3VBU B;  3KM5 A;  2HWB 1;  2YC0 A;  4YWA A;  3OBA A;  4P9I A;  3LD8 A;  4UFJ A;  1K42 A;  2J22 A;  4GB3 2;  3B93 A;  4DMI A;  2DFB A;  1PZ8 A;  4E2G A;  2Y6L A;  5JLV A;  4P9W A;  4CUA A;  4D6S A;  5EJ1 B;  4CP2 A;  4UFI A;  1VBD 3;  1Y3T A;  2L9L A;  3E6C C;  3GYD A;  4LO8 A;  1RUH 2;  4OZX A;  3T3Y A;  5T52 A;  2F17 A;  1V0A A;  2O14 A;  4GMP 3;  4AQS A;  1X8E A;  2OX0 A;  2W87 A;  2YYO A;  4NRP A;  2EID A;  1NUK A;  1YEW A;  3HMY A;  1PVC 3;  2IXK A;  3LPF A;  1LOF A;  3Q8E A;  4IES A;  5FZL A;  2ETE A;  3CU7 A;  4TLG A;  1OLQ A;  3WDV A;  3ZFF C;  4COW A;  1NZC A;  3J8F 3;  3KV9 A;  3FMG A;  3MFC A;  3T0A A;  5FJK A;  4P9J A;  3RZK A;  2VBP A;  1Q8S A;  1S4C A;  3L2Y A;  2DCY A;  1ULD A;  2D6N A;  4YGE A;  1JI6 A;  3FHA A;  4LT5 A;  3PNA A;  3WHT A;  1H8T C;  2WS9 1;  3OGR A;  1UZ0 A;  4CCD A;  3VDD A;  4DNY A;  2Q1F A;  1PMJ X;  1QHD A;  2ID4 A;  5LAT A;  3FHQ A;  1H4H A;  4L9B A;  3SCF A;  2DTW A;  3LFM A;  2IVI B;  4FTE A;  2G1M A;  2H6B A;  2XVL A;  2JKX A;  4XBN A;  1N3O A;  5FO9 B;  2BFU S;  2RDN A;  5HV4 A;  2BTV C;  1FOD 3;  2J1R A;  2O1Q A;  4QQH A;  4CP1 A;  2H0B A;  1AL0 G;  1REE A;  3B3Q E;  1R08 3;  4C0B A;  2J1T A;  3MLJ A;  4BB3 A;  1GP5 A;  4OZO A;  2E7Q A;  2LRP A;  2WAO A;  4LBM A;  5FZO A;  3VZN A;  1W8O A;  3U14 A;  5FRE A;  1FXZ A;  4FXG B;  2WNE A;  3HBZ A;  4FPE A;  1AYM 2;  2P3J A;  4Q4W 1;  4BQ4 A;  4Y4R A;  5DAW A;  1K5M B;  2P5B A;  2ZZJ A;  3TN9 3;  2YDE A;  1KGY A;  1UO9 A;  4XUP A;  2ZHM A;  3H8R A;  4MXW B;  2R1B A;  4BQ5 A;  4WZC A;  3O1R A;  4QM9 A;  3G6J B;  2RS5 2;  4V2V A;  4DXZ A;  4Q8L A;  1MS8 A;  5D2A A;  4WM8 C;  5JOW A;  2VJX A;  1CIY A;  2VUJ A;  2YUE A;  2BNM A;  2V5D A;  3Q8B A;  2VOK A;  3MF6 A;  3SC7 X;  3T0D A;  3POS A;  5DZF A;  4K8R B;  3VBF C;  3GHN A;  4EN0 A;  1W39 A;  2LUW A;  3GBW A;  2OYZ A;  1VBA 2;  5C4W C;  4FPJ A;  1AR8 3;  2ZOE B;  1UOB A;  3HR9 A;  4QQL A;  1YFY A;  2BNN A;  2IXH A;  3AMM A;  3CJI B;  2WSV A;  3N9M A;  4IEX A;  3J7L A;  1W28 A;  4HFS A;  3U07 A;  1NA1 C;  4PIZ A;  3KT4 A;  4N43 C;  5H9P A;  4ASL A;  1Z7S 1;  3LDB A;  4KMQ A;  4C1W A;  3HNB M;  5SV5 A;  1SLB A;  4W65 A;  4AWD A;  3KVB A;  2VCC A;  1AJK A;  4LIV A;  4NHK A;  5C3Q A;  4NRM A;  5FZ7 A;  2GMP A;  4N53 C;  1LB2 A;  2A5Z A;  3SQO A;  3ZXK A;  2RR1 1;  5BNO B;  4L99 A;  3GDB A;  5CVR A;  1FPN 3;  4YVW C;  4CDX B;  2XLF A;  2VY0 A;  3I3Q A;  4XHB A;  1D7P M;  4IW3 A;  2HWD 3;  3I2O A;  1AR9 3;  1WLC A;  4YGD A;  4YFW A;  4IE6 A;  1NOV A;  2RS1 1;  1V6N A;  1QOS A;  3D5O A;  3LIG A;  1CPN A;  1UKG A;  1LU2 A;  1QXJ A;  1VRH 1;  2JB4 A;  3CLP A;  3M3C A;  4QHB A;  5D8A B;  5FIX A;  5FZB A;  2VE1 A;  3H8U A;  2R0H A;  3DN7 A;  1GQP A;  3MIB A;  3HNM A;  1NCQ C;  2G9F A;  4J1W A;  1HB3 A;  4TWT A;  1K5M A;  5DDJ 2;  3SXW A;  5CFD C;  4GWI A;  4M0H A;  3AP4 A;  3IIA A;  3KT7 A;  4MXW A;  4JV4 A;  1KDM A;  1TMF 3;  3SCG A;  1NCR C;  2LM3 A;  5IK7 A;  5IVC A;  3ME2 A;  5LWB A;  2XJV A;  4ISR A;  2WYS A;  3JD7 3;  5FPA A;  3PTY A;  1AJO A;  3WF1 A;  3S7E A;  3GZE A;  2KXL A;  1RUE 2;  1MS9 A;  3I4I A;  4JGY B;  4CEW A;  2MHF A;  2BDR A;  2V4A A;  4LOR A;  4Z2W A;  2DWR A;  1ST8 A;  1BK1 A;  4QPY A;  3CJI A;  1GOF A;  2NM1 A;  3X29 B;  2B8M A;  3I2I A;  4Q29 A;  3TEW A;  1JN2 P;  4BU2 A;  4X6Q B;  3THP A;  4KWJ A;  2XON A;  5C3R A;  2VBB A;  4BDV B;  5LBE A;  5F3G A;  2GZW A;  2EXH A;  1XYN A;  3ZYR A;  2DF7 A;  2VQA A;  1B35 A;  4DXS A;  4YZ4 A;  3I2K A;  1WD4 A;  2VG9 A;  1JHN A;  5FZE A;  2P3K A;  1HX6 A;  1MS1 A;  1SLC A;  1ZZ8 A;  1I1E A;  4JTN A;  3AKQ A;  4BWO A;  5BNO A;  2ZAA A;  3H1Y A;  1GBG A;  5FK8 A;  2KA3 A;  4HK8 A;  4AXO A;  1ENS A;  1QU0 A;  3M3O A;  4Q0V A;  4A45 A;  3ENR A;  4KGQ A;  4AVA A;  4CE8 A;  4N9H A;  4YVS B;  4DY3 A;  5I0T A;  1IKQ A;  2PHT A;  2XWB B;  2PQQ A;  1WUV A;  1WME A;  3B9I A;  1TME 3;  3FL7 A;  4UFK A;  4XUN A;  2XJQ A;  5D8A A;  1FMD 2;  1DYO A;  3ZFG A;  3BU0 A;  3OF1 A;  3IDE A;  5H9S A;  1LEC A;  5FLJ A;  4BCU A;  1NG0 A;  5T3N A;  5IHR A;  1UX7 A;  5A7P A;  5FY4 A;  3RZZ A;  1BBT 2;  3I2J A;  2X05 A;  1W9Y A;  3LA3 A;  4Y4Y A;  2HWC 2;  3RMY A;  1GZW B;  1RIT A;  1JZ2 A;  2QE3 A;  1LGC A;  4O9G A;  3WNM A;  4HPK B;  1UZV A;  1LU1 A;  1C4R A;  4YNI A;  3LDR A;  4D3W A;  2JDN A;  1UIK A;  1RUG 1;  3ZMN A;  1GMM A;  3K75 B;  2KD7 A;  2FMY A;  4FFG A;  1IHM A;  4IGO A;  3RYK A;  4AEK A;  2H6C A;  1XB9 A;  3N7J A;  1VBE 1;  3JB4 C;  5KC5 A;  1WA4 A;  3A4U A;  3WCR A;  4ASM B;  1PO1 1;  5F6L B;  1PX4 A;  4RHV 1;  2BVB A;  4MGS A;  3VKL A;  1ZRE A;  1RVF 1;  4R52 A;  4NR1 A;  5FOB B;  2ZS6 B;  1MQT B;  2CAU A;  1NY7 2;  2PTM A;  3A23 A;  3GZU C;  4K20 A;  1POV 3;  1N47 A;  2R30 A;  2W91 A;  5F5Q A;  5FZ4 A;  4AL9 A;  2PHW A;  1PGL 2;  3U4S A;  1SAC A;  5BNP A;  3AYE A;  1AF9 A;  2VVE A;  1BEV 3;  3DXT A;  4PLO A;  1R09 3;  4OHY A;  1V00 A;  4P00 B;  3GM8 A;  4NRO A;  4R9D A;  4QMA A;  3AZX A;  1S0D A;  3ACG A;  3SH4 A;  3FX3 A;  1V9U 3;  1POQ A;  2VZS A;  4LMF A;  4A2U A;  3DEC A;  3NKG A;  4UW6 A;  2OQ6 A;  2OXB A;  2PFW A;  3LEM A;  3SHR A;  3UGG A;  2VMC A;  3RI8 A;  3JQW A;  4NMI A;  2R07 2;  3HNY M;  1RUI 1;  3PJY A;  4JGZ C;  5DG1 A;  3CIH A;  5IK5 A;  3ZR5 A;  3WG4 A;  1GZW A;  3VDB A;  3OG2 A;  4OUL A;  5KHI A;  4HPK A;  4JTO A;  4XEZ A;  5G05 L;  2P3I A;  4LIU A;  3IMN A;  2VGD A;  4AHW A;  1XQN A;  3BTY A;  1FAT A;  1SDW A;  4QKN A;  3ALQ A;  4MV2 A;  1XC6 A;  3AYC A;  4BK5 A;  5FZ1 A;  2ZGM A;  4QX2 A;  5A70 A;  2WO1 A;  1NAE A;  1D4M 1;  1TZO A;  4RQP B;  1F31 A;  2ET1 A;  5FMD A;  5BNP B;  4LUL A;  3GNE A;  5FYU A;  1I9R A;  1DGW A;  5ANN A;  3GXU A;  1GZC A;  1PGS A;  2QUO A;  1MQT A;  5EYY A;  5GJ6 A;  4CEY C;  2VZR A;  1DQ0 A;  3SH3 A;  1DGR A;  3UKV A;  2HWB 3;  1OFN A;  3OPW A;  4P5H A;  2V5Y A;  5C33 A;  4XQW A;  4OQ9 A;  3ZSL A;  4AAP A;  1X50 A;  5DQ0 A;  1UZY A;  1ZBE 2;  3AP7 A;  3EYP A;  4AI9 A;  1CAV B;  5DZG A;  2D93 A;  3EJK A;  2ORZ A;  4XFB A;  1EY2 A;  1Y9M A;  4C91 A;  1DBN A;  3D3A A;  3VD4 A;  1ZBA 2;  3RWK X;  3WDY A;  2KM2 A;  2PN5 A;  4O9E A;  2JDY A;  2YV8 A;  4Q27 A;  4XFI A;  2P17 A;  1IG0 A;  1RHI 2;  1F9K A;  3AJZ A;  3HQU A;  2W1W A;  5DXD A;  3BCW A;  4URA A;  4LHN A;  2HWE 2;  3ILN A;  4JRL A;  1R1A 1;  5LZ6 A;  2R06 2;  1GLH A;  1W6O B;  1O6U A;  1SLL A;  2VC9 A;  1OKQ A;  3N9O A;  1NXM A;  2Y64 A;  3AP6 A;  2NZ9 A;  5FP4 A;  4A6S A;  4EE2 A;  2QZ2 A;  5T55 A;  1X7N A;  1O3Q A;  1W3V A;  4EN7 B;  1W04 A;  2HBU A;  5A1A A;  3AFK A;  2RM2 2;  1OLR A;  1A8D A;  1EPW A;  1UY4 A;  1LHN A;  4P5Y A;  5G04 L;  3ZXL A;  3WQB A;  4ARX A;  4R9B A;  5FMC A;  5EIY B;  5IVJ A;  5KXE A;  5CG9 A;  1G7Y A;  4BYY A;  4C1X A;  4UFM A;  2ILM A;  4JCK A;  2WS9 3;  3LA2 A;  1W9T A;  3HOB A;  1I5P A;  4MGZ E;  3OB8 A;  4CDU B;  3PHM A;  2EXK A;  2AEZ A;  1OA4 A;  3SIS A;  2HEY F;  5T5L A;  2RS3 2;  2Y6H A;  1QOO A;  4XET A;  3WNL A;  1UN1 A;  2ZKN A;  4YGC A;  4PIX A;  3DEM A;  3PL0 A;  5IWF A;  5J3U A;  2W52 A;  4AFM A;  3ASI A;  4YM3 A;  1W8Z A;  2ARE A;  1WW4 A;  1YI9 A;  1QMJ A;  3ORJ A;  2W0X A;  4GB3 1;  1U5I A;  4H2A A;  3ZKY A;  5A6Y A;  2J1V A;  3WEZ A;  4BOW A;  3A7Q A;  2CDP A;  1GNZ A;  1ZRD A;  4BQW A;  4Q4W 3;  3III A;  2CY6 A;  5FZH A;  1JZ5 A;  4JAA A;  4MZU A;  5FYB A;  1CAV A;  5BV6 A;  1OH3 A;  5LY1 A;  3T4H B;  3E5X A;  3PUR A;  5F9T A;  2C24 A;  4N7U A;  1SLI A;  2I07 B;  2P3Y A;  3VUO A;  4LO4 B;  1GKB A;  2SBA A;  3I3M A;  1BKZ A;  2Q5T A;  2XB6 C;  1ZVF A;  5BNN B;  5EV7 A;  2Q8D A;  1WCD J;  1V6L A;  1W6O A;  2RV9 A;  2ZXQ A;  3POF A;  4ERO A;  2J42 A;  5CEH A;  1OPM A;  1UPS A;  3B69 A;  2IXJ A;  4L8Q A;  1V6K A;  3IB3 A;  5FV3 A;  4LBJ A;  3TEX A;  1DYK A;  2AEN A;  4KH9 A;  1WD3 A;  4K1Z A;  3M8L A;  4B3N A;  4KWK A;  4U2A A;  4DQA A;  2VPV A;  1BXH A;  5LBC A;  2Y0O A;  5HCB A;  2FCU A;  3SH5 A;  1UOJ A;  2ARC A;  2ZPX A;  1ULC A;  3M4F A;  4YZ2 A;  3OGJ A;  1U5Y A;  2QQJ A;  1ZA7 A;  1VB4 A;  3LAG A;  4GJZ A;  1TEI A;  2BGP A;  3VBS A;  4CDU A;  4CU8 A;  3J7H A;  4OI0 A;  2RR1 3;  1RUC 2;  5I8Y A;  2EXJ A;  4KG8 A;  4D94 A;  4GJY A;  1ZYB A;  4FPC A;  1JOJ A;  2C6S A;  4GWJ A;  1A78 A;  4HN1 A;  4P08 A;  4YYO A;  4LOT A;  4JVA A;  1VJ2 A;  3P1I A;  3RS6 A;  2RHP A;  1AYM 1;  3HPN A;  2VMF A;  5GZE A;  1OUX A;  3FBM A;  4B7E A;  2ZKL A;  2Z2S B;  1TNR A;  3PVB B;  2Q30 A;  3AMH A;  3E1F 1;  4P9X A;  2RS1 3;  1MVQ A;  2W2I A;  2YC2 A;  2RS5 1;  5IFP A;  3MF9 A;  4ISQ A;  5CKN A;  4UWD A;  3ZXG A;  2TBV A;  4LA3 A;  3MLK A;  4Z07 A;  3AKT A;  2BJS A;  5JZG B;  4DS0 A;  1OC1 A;  1XOY A;  1IS4 A;  1CZV A;  3GZA A;  3WXP A;  1WCU A;  1VBA 1;  5M0T A;  2QVS B;  3WHU A;  1JYV A;  3KCC A;  3WD5 A;  2JEN A;  2WT1 A;  3CJX A;  4P9G A;  2PA7 A;  3BN6 A;  4NJ4 A;  2ZEX A;  5DUU A;  3ZYB A;  4B4R A;  1DF0 A;  4ZKT B;  3GJA A;  2AH2 A;  4JC1 A;  2X5I C;  3PLQ A;  1Q8V A;  3PU8 A;  3FUQ A;  4XIK A;  3T4V A;  4GZ9 A;  4BA6 A;  3LFI A;  2D7F A;  3MID A;  4PQQ A;  5A3W A;  3T1L A;  1OQ1 A;  3ZYI B;  4DIN B;  5J1X A;  5FMO L;  3GBF A;  3P6B A;  3CEW A;  4QKD A;  5I0S A;  1YUD A;  2W9X A;  1LGB A;  1PO2 2;  5FDB A;  4Q2F A;  4SBV A;  1T6G C;  1LHO A;  1WCS A;  1YIF A;  2BER A;  3GCW A;  3N9Q A;  4NUB A;  4FSJ A;  3RWN A;  4EYU A;  3EO6 A;  2WFF 2;  2PEL A;  4BIF A;  4QXB A;  4ORF A;  5LA0 A;  4LK7 A;  3ZPO A;  1W3X A;  1KS4 A;  5L19 A;  2IFR A;  3ILR A;  2Y8K A;  3TEZ A;  2TNF A;  4Q1P A;  1ULF A;  4OVE A;  1LTE A;  3DUI A;  4JRA A;  1CX4 A;  4PJY A;  4YW2 A;  4X8N A;  4CU9 A;  5C3O A;  5L73 A;  4XJW A;  3FLR A;  2D6L X;  4MO3 M;  5DAV A;  2QJV A;  2ZHK A;  2C26 A;  2W94 A;  5FWJ A;  2FDF A;  4Y1Y A;  5DDJ 1;  1JYC A;  5GZG A;  2CSG A;  5JXH A;  1BCX A;  2R04 2;  1YQ6 A;  4KBZ A;  3RFR A;  4RFR B;  4FOW A;  4AI8 A;  1RB8 G;  1G9C A;  1C1L A;  5JXJ A;  2BYV E;  5KHJ A;  1HXS 2;  3OGS A;  3AM2 A;  1AL2 2;  1SZB A;  1DP0 A;  2KR2 A;  4YM0 A;  4AVC A;  5J48 A;  1CON A;  3I97 A;  1GZ9 A;  2D6M A;  1MAC A;  1ZZ9 A;  3AKR A;  4V2W A;  3VZM A;  3KF3 A;  1UPI A;  1O5U A;  3AXE A;  3HIF A;  3VN4 A;  5CFC C;  5JOX A;  5JZG A;  1RUE 1;  5FYC A;  1G9B A;  3VZK A;  1JOB A;  3BTX A;  3MGU A;  5FP7 A;  4GKY A;  4HAN A;  1RMU 2;  5EWS A;  5B4N A;  4EV0 A;  2P34 A;  4QX7 A;  3WDX A;  4KNC A;  5C70 A;  1IQD C;  2IUW A;  2XLG A;  4PBP A;  1RUG 3;  3B9C A;  1ND2 C;  3ETP A;  2LAL A;  1MS5 A;  1BVV A;  4S2F A;  1CAX B;  4ZS3 A;  1JZ6 A;  1VRB A;  4HKW A;  2OA2 A;  3SMH A;  4D0Q A;  5F5C A;  3ZDV A;  1GNH A;  1VBE 3;  1O4Z A;  3MIE A;  4XQD A;  5GLW A;  3OBR A;  2DUP A;  5I8S A;  3T2O A;  5ACA 2;  1PO1 3;  1RJ8 A;  1FV2 A;  3AZY A;  3RPQ A;  3NL1 A;  3IAQ A;  2B5H A;  4FOQ A;  4RHV 3;  1RVF 3;  1YQC A;  3ZN6 B;  5LY2 A;  1H2L A;  1ZZC A;  2YBP A;  1XU2 A;  4LBL A;  4LKS A;  5JOZ A;  3ATG A;  2MPF A;  2JG9 C;  4XZU G;  4L0P A;  5A3P A;  4KG0 A;  2A3W A;  3VD9 A;  1HB1 A;  2WWJ A;  3WUD A;  2JG8 C;  4GQ7 A;  4CCC A;  4ES9 A;  1BLZ A;  3FLP A;  2GAL A;  1ACC A;  1LEN A;  5KXB A;  3FBY A;  5DPN A;  3PMS A;  1HDK A;  3UES A;  2JEM A;  3BPS A;  5FZ6 A;  5GAL A;  2CL2 A;  1FMD 1;  1RIR A;  3H0O A;  4WM7 B;  3UGH A;  3H1M A;  2VZT A;  4LKF A;  3HAG A;  3O1P A;  1TQ5 A;  1HW5 A;  3I3B A;  3PME A;  3T08 A;  1W0O A;  1BBT 1;  1LEM A;  2WUH A;  3BYW A;  1W99 A;  5FYT A;  2HWC 1;  1DQ5 A;  2OT7 A;  3K77 A;  3HJR A;  3MW4 A;  3QCW A;  4AI3 A;  5FO8 B;  4P14 A;  2JDP A;  2A6W A;  3M1H A;  1RED A;  2QTW B;  2GC2 A;  4HT1 T;  4M4R A;  4NAO A;  3HN3 A;  4NHM A;  1N3Q A;  2CGP A;  1MZ5 A;  1RUI 3;  4LR4 A;  1EAH 1;  2VOV A;  5KR7 A;  2ZGP A;  1W6Q B;  3QLQ A;  4AFC A;  4JQR A;  2FDJ A;  2DVB A;  4CVU A;  4CRQ A;  1OD5 A;  3B5L B;  3NNG A;  5IT6 A;  3RNS A;  2QCS B;  4IL7 A;  2CV6 A;  1SBE A;  3O7O A;  1US2 A;  1QJE A;  3TAY A;  1JH5 A;  3RRD A;  4YW1 A;  1WCK A;  3O1T A;  4XFH A;  1UZZ A;  2BQP A;  4LK6 A;  2VQ0 A;  1XJA A;  3KV6 A;  3MYX A;  1ZZ7 A;  1YXW A;  2DUR A;  1IOA A;  1O91 A;  3OEB A;  4W8J A;  3SKV A;  4R8H A;  2BZD A;  3A0N A;  3PVO A;  3ZMO A;  3S7I A;  3URF A;  4IEO A;  3NJX A;  5LAS A;  2XBO 2;  3PJQ A;  2EIC A;  2VL4 A;  4HKL A;  1KRI A;  2ZBJ A;  3ZN4 A;  1PGL 1;  1EPZ A;  3WG3 A;  2B4K A;  1MS4 A;  2PHR A;  4XFG A;  4AVV A;  3C7F A;  2VH9 A;  3AJY A;  2WNV C;  1OKO A;  2DFC A;  2VQT A;  3NVC A;  1WMD A;  3IN9 A;  4FFF A;  4WM7 A;  3O1V A;  5K7P A;  1GQH A;  2R7E B;  4QX3 A;  4PF5 A;  1UU6 A;  5DAX A;  5F39 A;  1JYX A;  5EJ3 A;  3BAL A;  2R07 1;  2VUC A;  4FPG A;  4AEJ A;  3S5A A;  1E57 A;  4B4P A;  3ZXE A;  3J7N A;  1XSR A;  3JB8 A;  2VUL A;  3LEI A;  4GUL A;  4XOG A;  3D0J A;  5FMB A;  4BXS V;  1R1A 3;  2J7M A;  3U0Z A;  3LKJ A;  3ELN A;  5SV8 A;  4WM8 B;  4HVO A;  2VZQ A;  2TEP A;  4OUS A;  2VNO A;  1LJ7 A;  1LHV A;  1W6Q A;  4DO0 A;  4EZH A;  3VBF B;  2ZGS A;  1W0P A;  2G4I A;  2JXA A;  4LE4 A;  3RVH A;  5C4W B;  1N1T A;  1K5J A;  2J1S A;  1X9P A;  4XJU A;  3ZFF A;  4GWM A;  5FZO B;  3FZ3 A;  2VAU A;  1KIT A;  2JDZ A;  1H2M A;  1AR6 2;  2FBE A;  3CDZ B;  4N43 B;  2VMD A;  4MHR A;  1GWL A;  5GZF A;  2YGM A;  1H8T A;  1RXF A;  2VZU A;  4HMZ A;  1S0B A;  4KGG A;  2GMM A;  1UYZ A;  4JDM A;  4N53 B;  5F3E A;  3S6P A;  3AXD A;  4C0H A;  2RJL A;  3MBW A;  3QBQ A;  1ZBE 1;  1O8P A;  1WW5 A;  4ES8 A;  1Y9Q A;  4GB3 3;  1H1I A;  2D6K A;  4ZON A;  3VHR A;  4AF9 A;  1OOP C;  3KMH A;  1ZBA 1;  2EF6 A;  1QKQ A;  4Q4X 2;  2CTV A;  1LCL A;  3IBM A;  2R0F A;  1QXP A;  2DU1 A;  3KGL A;  3SIT A;  1L3J A;  5AFE A;  1RHI 1;  1JU4 A;  4YG0 A;  4IE4 A;  4DEV A;  5FRA A;  1OLM A;  2HWE 1;  1UCX A;  3AMQ A;  1GOG A;  4W6Y A;  4EN8 B;  1MZ6 A;  2R06 1;  3NV2 A;  4JX0 A;  4QX1 A;  1TVG A;  4QXH A;  1SPP A;  1NCQ B;  3M70 A;  3NNJ A;  1O3T A;  1G6N A;  2RDS A;  4Z8B A;  1J59 A;  1IG3 A;  4D7Y A;  1Y43 B;  1KXG A;  2RM2 1;  4FPL A;  4XIO A;  2DTY A;  1N1S A;  3NNF A;  1NCR B;  5C8C C;  4UYB A;  2K2S A;  1VMJ A;  3O0W A;  2Q8E A;  1HRI 2;  3NJY A;  3IM0 A;  2QKD A;  4NHY A;  4WM8 A;  5JDB A;  5LBF A;  1CGP A;  4RGA A;  4D69 A;  5LCW L;  4I2O A;  4EWA A;  3KHB A;  1VAL A;  3VBF A;  3CZJ A;  4AEM A;  1L7L A;  5C4W A;  4CXY A;  3H3L A;  1RGS A;  1UY3 A;  4TYS A;  3VZL A;  4CCN A;  5DUV A;  3UKN A;  2RS3 1;  2VW0 A;  2J1A A;  1NLR A;  2BOJ A;  3FN9 A;  1LUL A;  2A3Y A;  4MGQ A;  2OVU A;  1D4V B;  5EPA A;  1S0G A;  1NA1 A;  4COU A;  4N43 A;  1JZ4 A;  1QQP 2;  2WA4 A;  3O1O A;  3VZJ A;  2DV9 A;  3U11 A;  4XJ9 A;  2ZGK A;  2CNA A;  3SLI A;  1MR5 A;  1V6O A;  4C8D A;  4N53 A;  5KC6 A;  1DQ2 A;  2ZEW A;  2G9Z A;  4TTG A;  2EXI A;  1AYM 3;  3OY8 B;  3WP6 A;  2WNU C;  1E5H A;  2BBA A;  2BGC A;  3ZFE C;  4YVW A;  2FDG A;  2AR6 A;  2OZJ A;  4PQ9 A;  4PDW C;  2O8O A;  2XJT A;  1W8F A;  5JR7 B;  3WUC A;  4BH9 A;  4DXT A;  1JYW A;  4COY A;  2VQU A;  3WF2 A;  2RS5 3;  4CEW B;  4C90 A;  5A3T A;  5ABJ C;  1UXX X;  1GV9 A;  1GQG A;  2YB7 A;  1OF3 A;  3I2H A;  1MEC 2;  2H0V A;  2YPJ A;  1XU1 A;  1C3H A;  1F5J A;  1OD3 A;  3KVA A;  3VD5 A;  3WLU A;  3NV1 A;  1VBA 3;  1NCQ A;  5CFD A;  3WNN A;  4FPH A;  4Y20 B;  1LRH A;  3N7M A;  3SEP A;  5EQU A;  3L9J T;  1CJD A;  1B35 B;  3ZYG A;  4YG6 A;  4FBF A;  4XZP A;  1NCR A;  3V0B B;  3Q8A A;  2IC1 A;  4XAA A;  1RUF 2;  3A21 A;  4ITC A;  3NJV A;  4L92 A;  4XBL A;  4AI2 A;  5CB7 A;  3KCX A;  5FWE A;  1JW6 A;  4OUM A;  1OVP A;  3PIG A;  4IGP A;  1CAU B;  3NJZ A;  3CMG A;  3KB5 A;  4FT8 A;  3VBU C;  1YNA A;  2UYB A;  4QGL A;  1CQ9 A;  1OVS A;  1RUC 1;  3K46 A;  1MZF A;  4AI0 A;  3PTR B;  4ATF A;  2BGO A;  4EQV A;  1FT9 A;  2VR4 A;  4QHO A;  5FZ9 A;  3UT0 A;  4CDW C;  3OCP A;  5CYY A;  1ODM A;  5CKQ A;  3MIC A;  1SCR A;  2P1B A;  3H8X A;  3ZOI A;  4WVW A;  1N1Y A;  3ZIW A;  2ZGO A;  2R1D A;  3WW4 A;  2N7G A;  3AYD A;  3R4S A;  4GH4 C;  2ATF A;  5DAP A;  3OY8 A;  1KFU L;  5EP9 A;  5DDJ 3;  1T2X A;  1YIP A;  2HH9 A;  5JXG A;  4FTS A;  3D4K A;  2CHH A;  4E4Z A;  5L36 A;  1XXN A;  5ERL A;  1ENQ A;  1EV1 2;  4E4S A;  4BPZ A;  2Q8C A;  2R32 A;  3LZZ A;  1ZRC A;  3CKH A;  4S2G A;  3LSE A;  1RUJ 2;  1APN A;  4LXL A;  2QQN A;  1IGO A;  2BFU L;  4LUK A;  4Z2A A;  1IS6 A;  2CGN A;  1RUE 3;  1UD1 A;  3HQX A;  2HYK A;  2WBK A;  4H3W A;  4YW4 A;  1UKR A;  1WGP A;  1D2Q A;  3ACI A;  4Y20 A;  1KFX L;  4Y5S A;  5IW0 A;  1A34 A;  2YRO A;  2K46 A;  1C1F A;  3V0B A;  2EIB A;  5GLV A;  5DMY A;  4NPR A;  1ND3 C;  2JDH A;  4QQ2 A;  2OQ7 A;  1PO2 1;  3QAC A;  5FYS A;  1OF4 A;  3ZO0 B;  5HBA A;  2VOW A;  1ZNP A;  4YW6 A;  2WFF 1;  5CBL A;  3O1M A;  1CAU A;  5FY0 A;  1YO8 A;  3WW1 A;  3WG1 A;  3ZN5 A;  3VBO B;  1OA2 A;  2GP5 A;  2P6C A;  5AC9 2;  5CAZ A;  5F3C A;  2XJR A;  1A8M A;  3MIG A;  4XXP A;  5FZI A;  5LA9 A;  3HN1 A;  4ONU A;  3W58 A;  1H2N A;  2DVA A;  2FD8 A;  4QXC A;  1K5M C;  1W6P B;  4M4P A;  3AX4 A;  4MGY E;  2XGX A;  5C3P A;  2XQR A;  5C7G A;  1KS5 A;  2D5H A;  5JIA A;  5BNQ A;  4CEY B;  4BK4 A;  1AX0 A;  2R04 1;  3QOP A;  1U5X A;  2QDN A;  3K4Z A;  4OHZ A;  2DVD A;  1FMD 3;  1HXS 1;  1LNS A;  3KCY A;  1PK6 C;  4ZU5 A;  2EIG A;  1AL2 1;  3MUZ 1;  4CCM A;  4DB5 A;  4ZZ8 A;  1QXR A;  3VBH C;  4OCT A;  3EB7 A;  1BBT 3;  1UU4 A;  3WP5 A;  4FPO B;  2D3R A;  3UGF A;  3U37 A;  2HWC 3;  3WY6 A;  4KWL A;  2J1E A;  1HRV 2;  2VOT A;  2VVD A;  2DBN A;  4Q4V 2;  1RMU 1;  4IV3 C;  2GNM A;  2W5F A;  2WT0 A;  2VCM A;  1EAH 3;  4COV A;  1FNY A;  3LWC A;  3AFG A;  2P6H A;  4XYX A;  2XKP A;  2E26 A;  3WG2 A;  3ZXA C;  4AQ6 A;  2VBD A;  4BQX A;  4Z82 A;  1AX2 A;  1RL3 A;  1W6N B;  4JGZ A;  5ACA 1;  1J84 A;  4JZR A;  2XKO A;  3OEA A;  3OPZ A;  3AYA A;  5J98 B;  4LTA A;  2UU8 A;  5FZM A;  4CDX C;  1DIW A;  4R4Z A;  5FYI A;  4YPJ A;  3SCH A;  4A3X A;  2GP3 A;  3KWV A;  1S55 A;  4WVV A;  1XYO A;  1SMV A;  5AVP A;  1UOG A;  3AZW A;  4OI4 A;  3TWI A;  2BEO A;  4LHS A;  4NO4 A;  4AE2 A;  4K8F A;  1OBN A;  2NN8 A;  2VMH A;  5K4L A;  3LF7 A;  3VBO A;  4CUB A;  1URX A;  3AB0 A;  2CYF A;  3EHK A;  1BVP 1;  2Q4S A;  5JXI A;  2WIN B;  3MPB A;  4QGN A;  5FZK A;  4AVB A;  5LK7 B;  1ZZB A;  3UJO A;  4JDN A;  1JYN A;  5GLZ A;  4ET7 A;  1QDO A;  3OYW A;  4J6G A;  1YFW A;  1W6P A;  3BPZ A;  4Y24 A;  3T1M A;  3W20 A;  1ENX A;  5LA1 A;  5A6X A;  1ULP A;  4CEY A;  5I0D A;  4K3U A;  4D6R A;  4NRQ A;  1IS3 A;  2XJS A;  3IDC B;  4Q0Q A;  1VAK A;  2PQS A;  5FBZ A;  4DFS A;  3RYR A;  2DUO A;  3PUS A;  1O4Y A;  5FYZ A;  4A42 A;  1VPH A;  3PVN A;  3KQ4 B;  2CDO A;  4SLI A;  1AXZ A;  3R6S A;  1Y7B A;  2A1X A;  2NMN A;  2R07 3;  4IEY A;  4JGY C;  2AYH A;  3WVJ A;  4B1L A;  4LOS A;  3THT A;  2VNR A;  4LHL A;  2GME A;  1VBC 2;  1DQ4 A;  3ZIX A;  4HG6 B;  4YAR A;  4YZ5 A;  5KHG A;  2VEC A;  4MGT A;  1YQ5 A;  3ROU A;  4B29 A;  4RL7 A;  1QEX A;  4AGV A;  5TSW A;  1AHS A;  2GH8 A;  3WNO A;  5F8P A;  3EQE A;  1Q8P A;  1W6N A;  3WQ0 A;  2W1S A;  5JSR A;  4UI9 L;  3AZZ A;  2F6B A;  4QHZ A;  2W95 A;  3I8T A;  1H1A A;  5C5U A;  4QDS A;  2IXC A;  2XBO 1;  5HPO A;  4MXV A;  4AOC A;  2PXJ A;  4H7M A;  5CA6 A;  5FBJ A;  4YVS C;  1S0E A;  3CO2 A;  3AZV A;  4KWU A;  4CU6 A;  5C9A C;  5GM0 A;  1T6B X;  2YZ4 A;  3RZH A;  5HCA A;  4HXC A;  5FPX A;  1W8U A;  3S57 A;  1ZBE 3;  5LEJ A;  1BK0 A;  3VB9 A;  1O3S A;  2W1Q A;  3V0A B;  3H1W A;  2VOX A;  3OJB A;  1ZBA 3;  2WO3 A;  4CDQ C;  1XYP A;  4OLL A;  2BBV A;  2HBT A;  2WII B;  2ES3 A;  2Y60 A;  4MX3 A;  1RHI 3;  2JIJ A;  4RYD A;  5I93 A;  4K7J A;  2HWE 3;  4CXW A;  4NID A;  2R06 3;  4E4D X;  1NE6 A;  3RMX A;  1AYN 2;  1W8W A;  5A3L A;  1S0F A;  3RGB A;  5HXM A;  1NLS A;  2VME A;  3AL5 A;  3ZSJ A;  3BTZ A;  3UL2 A;  2RM2 3;  2WR9 A;  1W03 A;  3WNP A;  4RN5 A;  3WZ1 A;  4EN6 B;  5FAX A;  2WQ8 A;  3VBS B;  3I59 A;  1LOA A;  1C8M 2;  1V6J A;  4URT A;  1HKD A;  4Y1U A;  5JPM B;  4JKM A;  1UYX A;  3O12 A;  4DPN A;  2HYX A;  5H9R A;  1UOF A;  5A3M A;  1UW8 A;  2X5I B;  1W2N A;  5K0U C;  4DY5 A;  1LOC A;  1YHF A;  4AVT A;  1CX1 A;  2DCZ A;  5BY5 A;  2HWF 2;  2WLQ A;  2DVG A;  3JZV A;  1CJP A;  3UYJ A;  4KBB A;  4O61 A;  4GXL A;  2RS3 3;  1BHG A;  1H4G A;  1DGL A;  3MUY 1;  4D6Q A;  1LOG A;  2G19 A;  3LCP A;  2B9V A;  2PHL A;  2XG3 A;  3POW A;  4CUG A;  3H8O A;  5FY8 A;  1J58 A;  1WKY A;  3PUH A;  5F2S A;  4AHX A;  1RUH 1;  2WZR 2;  3U1X A;  5F5I A;  5KHH A;  3SKJ E;  3USU B;  1DYP A;  2I74 A;  1VMH A;  3TYJ A;  2R6Q A;  3B01 A;  3WQ7 A;  2K0G A;  1EUT A;  4M3C B;  1MS3 A;  4Q4X 1;  1DFQ A;  5D1I A;  1QJX 2;  3V64 A;  1JS9 A;  4JDO A;  3TNP B;  1N3P A;  2C4X A;  3T09 A;  2YU2 A;  1IPK A;  3V0A A;  1OLM E;  1J3P A;  1RTV A;  1HN1 A;  2ZEY A;  1QWR A;  3OUJ A;  4AED C;  5A80 A;  5FYM A;  2HEW F;  2JDA A;  3POB A;  3RZJ A;  1JU3 A;  3BGA A;  5I0R A;  3DYM A;  3I3D A;  3KGZ A;  4XFA A;  2C5D A;  3HWJ A;  2VW1 A;  2O0O A;  4K6B A;  1W9F A;  4CP9 B;  5KBF A;  4HOO A;  5F7U A;  1W6M B;  2VM9 A;  4FP3 A;  1HRI 1;  2EA7 A;  4OUE A;  4RGK A;  1W2A X;  3E6D A;  1UF2 C;  2WC2 A;  1VBB 2;  4S2H A;  1YQ2 A;  3DGT A;  5CFC B;  2CGO A;  4KQ7 A;  4AQ2 A;  3S5Q A;  4RQP C;  4EN9 B;  2X10 A;  2MEV 2;  5IAV A;  3AVS A;  4QXK A;  5FPU A;  4MSV A;  4Q5O A;  2AGS A;  2WJS A;  1ALY A;  1COV 2;  2UY8 A;  5GKA C;  2I2S A;  3H7J A;  4OI1 A;  3ZFG B;  1Z7S 2;  2QZ3 A;  2V4V A;  2X5I A;  4YM2 A;  1ND2 B;  5FO7 B;  1Q56 A;  1YRZ A;  3OBT A;  1DCS A;  1QQP 1;  2GDF A;  5CIS A;  2ERF A;  4M01 A;  3I2F A;  3TNQ A;  1RUC 3;  4CYD A;  1UL9 A;  2YMZ A;  1QH6 A;  2ZMK A;  1FAY A;  2YC4 A;  2D5F A;  3J4U H;  2QQP A;  3LB9 A;  5FY5 A;  2JG9 B;  4OI2 A;  5AVA A;  2Y0I A;  5A32 B;  3USU A;  3O1U A;  5FXZ A;  4LJH A;  4GKX A;  4M3C A;  3AC0 A;  1D2S A;  1WA6 X;  2WN3 A;  4DOU A;  1VRH 2;  4QPI C;  1SEF A;  2ZGR A;  3APB A;  1U12 A;  3H3Z A;  2WAB A;  1MEC 1;  2W3J A;  2E31 A;  4AAX A;  1LOD A;  2RMU 2;  4JKK A;  1H0B A;  2WZE A;  2WRA A;  4K21 A;  4EZ4 A;  1QIQ A;  2W68 A;  4LBQ B;  3CNA A;  4QX5 A;  3OUI A;  5EZW A;  1SG3 A;  3NQH A;  1A6C A;  1KJR A;  2B9U A;  3IWZ A;  4I09 A;  4QU2 A;  3MPP G;  1PM4 A;  4HSL A;  4G3Y C;  4RS5 C;  3USS A;  1VB2 A;  4Y5Z 0;  4CP9 A;  4XUR A;  1GWK A;  1W6M A;  3F2Z A;  3MIF A;  5J37 A;  4BQ1 A;  3GF6 A;  4HVQ A;  5FZD A;  5E88 A;  1RUF 1;  4BQ2 A;  4YZ3 A;  2QQV A;  1H9W A;  2Y6K A;  4NIH A;  2ZX3 A;  3RZL A;  4XF4 A;  5FQ0 B;  4PF1 A;  5CFC A;  2WFP A;  2J1U A;  3WR0 A;  1BQP A;  1MPX A;  3L2H A;  5LW9 A;  3BTA A;  3OTF A;  1PO2 3;  3T2T A;  4ASK A;  1C5I A;  1QJY 2;  1VIW B;  4OHV A;  4QQO A;  4CA9 A;  1F8V A;  1REF A;  2NP0 A;  4OHW A;  2VXJ A;  1ND2 A;  2JE8 A;  2WFF 3;  4Y1V A;  1HN0 A;  1S2B A;  2XDV A;  5BXX A;  1SBF A;  3IT8 A;  1QJU 2;  1V70 A;  2WZ8 A;  1ONA A;  3DYO A;  1PIV 2;  3E6B A;  1LOB A;  1CWP A;  2VZP A;  2E33 A;  4HK9 A;  3MW3 A;  5T5O A;  3WNK A;  1GP4 A;  1DQ1 A;  3EBR A;  3ST7 A;  1Q3E A;  1UY0 A;  4D7T A;  2I45 A;  4OHX A;  1KQR A;  2JG9 A;  5A32 A;  1DLC A;  1XE7 A;  1XSQ A;  2R04 3;  3THC A;  2BNO A;  5FZ0 A;  3ILF A;  1EV1 1;  2JG8 A;  1YJK A;  3ETQ A;  1HXS 3;  4Y5T A;  4CZS A;  2WNV B;  3CBN A;  5A6Z A;  5BNN C;  1AL2 3;  1O8S A;  1XNK A;  1RUJ 1;  2PHU A;  4XW3 A;  4ZPI A;  4ZHN A;  3P3P A;  4LBQ A;  1QJF A;  1O7F A;  5EFU A;  2A7A A;  1RMU 3;  2FZ1 A;  5FKC A;  1EUU A;  4PLM A;  4Q8K A;  2JIC A;  2PLV 2;  1MS0 A;  3I54 A;  4XAE A;  3TEY A;  5IJR A;  1Y4W A;  4E8D A;  1AR7 2;  1WLW A;  4ARY A;  1BZW A;  4IE0 A;  1K45 A;  1RUD 2;  1OMI A;  5FQ0 A;  3UET A;  3MHZ A;  3E97 A;  3MW2 A;  5ACA 3;  3OD0 A;  1O4T A;  1VBE 2;  2DBI A;  1W2U A;  1DLL A;  3QH7 A;  5FZC A;  2QQU A;  4AHZ A;  2VMI A;  5FZ3 A;  5AC9 1;  1R1Z A;  2DCK A;  1NZI A;  2WQZ C;  3C2U A;  5FXW A;  4A3Z A;  1F2N A;  3MIH A;  4KU7 A;  4IV1 C;  2W08 A;  3BI3 A;  2XL9 A;  2FDH A;  4Y22 A;  2ZEZ A;  4IXL A;  5DZE A;  4XPV A;  2BU9 A;  4LO6 B;  1WZX A;  2VZV A;  4IEW A;  3LIH A;  3WF0 A;  1QOT A;  4XCA A;  1ASJ 2;  1WW7 A;  4FXK B;  2A6Y A;  1P8J A;  2PMW B;  4BMB A;  1PM7 A;  1UMH A;  1K3I A;  2UUR A;  4AFD A;  4CP0 A;  4PCR A;  4FAH A;  5B2G B;  2A6V A;  5LEK A;  1O3R A;  3K3N A;  4CUC A;  5CG8 A;  2QFE A;  3H7Y A;  3H50 A;  1XE0 A;  5E8A A;  4E9K A;  4MHU A;  4DIQ A;  2WNV A;  1HRV 1;  3FC0 A;  3KD4 A;  1H30 A;  1ULO A;  2GAU A;  4Q4V 1;  4PIY A;  1Q8O A;  4YM1 A;  3T2Q A;  5I8T A;  5DG2 A;  2FCT A;  1RYY A;  3ZFF B;  5HI0 A;  3VZO A;  4U36 A;  1JZ3 A;  4MUV A;  1W8T A;  3N9N A;  2E53 A;  5EHD A;  4YGB A;  3N7L A;  4QPG C;  3DPR C;  1NY7 1;  3HEI A;  4MOA A;  4XTM A;  2A6Z A;  5T5P A;  3HD8 B;  4CCL A;  1AXY A;  1H8T B;  3C7G A;  5D21 A;  1DZT A;  1UNB A;  5C8C B;  4NOT A;  1E5R A;  2D97 A;  2YPD A;  1H8V A;  1XNB A;  2ZCW A;  5A6Q A;  1W0N A;  4MGI E;  3IMM A;  3U75 A;  1Q8Q A;  1L7Q A;  4XVH A;  1D4M 2;  2W46 A;  2XBO 3;  3NST A;  4LO5 B;  2K9Z A;  1STM A;  2VU9 A;  2DCJ A;  2IXL A;  4XCB A;  1NYW A;  3C7H A;  1WBF A;  1OT5 A;  1GP6 A;  2DDU A;  4QDQ A;  4UFL A;  1M4W A;  3UJQ A;  4Q4Y 2;  2FCV A;  5FUN A;  1VMF A;  2NPI A;  3W59 A;  4OQ8 A;  5LK5 A;  1H2K A;  3VKM A;  2VTF A;  1SPP B;  4RR3 C;  5JVV A;  5L7O C;  1C57 A;  5J7M A;  1JXN A;  2AC1 A;  3I3E A;  4M00 A;  1X9T A;  4XF3 A;  4L11 A;  3SNM A;  5FPB A;  3FFZ A;  2GNB A;  3LOI A;  2IZW A;  3MV0 1;  4LQR A;  2WNU B;  1Q43 A;  2BV4 A;  3BU7 A;  5FY9 A;  3ZFE B;  2XPJ A;  4TZD A;  2XJU A;  1J1L A;  5FFO C;  3ACL A;  1RIN A;  1W9S A;  1OOP A;  2VO5 A;  4JHT A;  4PDW B;  3GJB A;  4IND A;  5ABJ B;  1VBC 1;  2VUD A;  2Y26 A;  1O59 A;  4M3C F;  2DU0 A;  2RDR A;  2GC3 A;  1SQ4 A;  3JU9 A;  4JHZ A;  3AMP A;  3OGG A;  1H6Y A;  1TNF A;  3NMB A;  4KL1 A;  3O14 A;  4DUW A;  2LW8 A;  3DYP A;  4E8C A;  5BPX A;  4ZZ5 A;  3EXU A;  1NA1 B;  4RA0 A;  1I3H A;  1VAV A;  2FDK A;  2YFU A;  4TXW A;  2WAA A;  3JBG 2;  2YXS A;  5EJZ B;  2Q8O A;  2ARA A;  4A7Y A;  5C8C A;  1QNW A;  4NVP A;  5IAX A;  1GAN A;  2VMG A;  1SBD A;  1AR6 3;  2PHF A;  5JUV A;  5FPV A;  3VDC A;  3OOX A;  4I3P A;  4YVW B;  1VR3 A;  1LAJ A;  2D3P A;  2XL7 A;  3BVC A;  3VBR C;  3ITQ A;  3WCS A;  4GWN A;  3WP4 A;  4MG2 A;  4GA9 A;  4QKF A;  5A3U A;  4NIG A;  1QJZ A;  1YYN A;  4O65 A;  3BKZ A;  1W06 A;  5I0U A;  5A1L A;  4XMA A;  4HKO A;  5CAD A;  1RUH 3;  1VBD 2;  1JMU B;  3W9A A;  1UU5 A;  3NAP C;  1G9F A;  4CDW B;  5A1F A;  2NQY A;  3I2G A;  4Q4X 3;  1KJL A;  4N8M A;  5CFD B;  4QDR A;  4TSV A;  1NT0 A;  1DGR N;  4PT6 A;  1PVC 2;  3RQ0 A;  3ZXJ A;  1GOH A;  4GH4 B;  5HCH A;  4W6W A;  1AXK A;  2E32 A;  2ZX0 A;  2ZX1 A;  5FYH A;  2IWG B;  1RC6 A;  3J8F 2;  4J1X A;  4KI5 M;  1AYN 1;  2WNU A;  3ZFE A;  3W5M A;  5A7O A;  5F1R A;  4ZXE A;  3PVE A;  2QQL A;  3LGR A;  4PDW A;  3POJ A;  2R16 A;  2UWB A;  2XLA A;  2DCT A;  1PGW 2;  4GMP 0;  4F7Z A;  4XUT A;  1UIJ A;  3GCX A;  5ABJ A;  1CR7 A;  1PNG A;  4HSJ A;  1HRI 3;  2RJ2 A;  1NE4 A;  4W50 A;  1C8M 1;  3E5U A;  5A3N A;  1IPS A;  5IVF A;  4HVR A;  3ZXD A;  1IPJ A;  1UMI A;  2OUJ A;  4CPB A;  3TRS B;  2XOM A;  2OKX A;  5FCC A;  3O0V A;  1FOD 2;  3GZT B;  1X8M A;  1KEX A;  2HWF 1;  4R9A A;  5FUP A;  3FFQ A;  1R08 2;  1WCQ A;  2V72 A;  1EP0 A;  5FKB A;  2WSU A;  3PUA A;  4UW4 A;  1XE8 A;  1FNZ A;  4DRR A;  1ND3 B;  5GZC A;  3TBD A;  5A33 B;  3ZX7 A;  1QQP 3;  2UYA A;  3C7O A;  2WZR 1;  1VE0 A;  2VZO A;  3RJR A;  4ZXK A;  1LOF C;  2VW2 A;  4QAW A;  4FP2 A;  4FPF A;  3IAP A;  4W6X A;  3TN9 2;  3POY A;  2OII A;  4IER A;  5IVY A;  3VBU A;  2QQM A;  1GU3 A;  1W2O A;  1QJX 1;  2XJP A;  3B7M A;  5GZD A;  1LKN A;  4I0A A;  1SFY A;  3NNL A;  2ZA9 A;  4XE9 A;  3K3O A;  5FXX A;  5C6C A;  4CDW A;  1UY1 A;  4LBQ D;  4EWD A;  3HBK A;  4A44 A;  3AKS A;  3ECQ A;  4UBH A;  3N9P A;  3VKO A;  3VDD C;  3E5Q A;  3AP5 A;  1H9P A;  3LEK A;  3WOG A;  3ZM8 A;  1MEC 3;  4GH4 A;  1AR8 2;  3D0S A;  2ZML A;  3CQO A;  1QNY A;  4BQ3 A;  4E2Q A;  1PK6 B;  4FPY A;  2EAL A;  1ZRR A;  4JQT A;  3VBH B;  3B02 A;  3LQC A;  1CZS A;  4AFA A;  1S0I A;  1VBB 1;  3NO8 A;  5IUQ A;  5C8W A;  1FV3 A;  4XBQ A;  5FR3 A;  4BE3 A;  3VL9 A;  5E16 A;  3NWK A;  1JOP A;  2MEV 1;  1YI7 A;  4CCE A;  1RUF 3;  3ES4 A;  4IV3 B;  4XC9 A;  2Q1M A;  2GND A;  3LSD A;  1O5L A;  1COV 1;  1DHK B;  2ZAC A;  1FPN 2;  4HN0 A;  3JQX A;  5CNA A;  4YG3 A;  2E7A A;  3IDB B;  3WDT A;  1CAW B;  3POE A;  5IK4 A;  1TE1 B;  2GNT A;  4CTE A;  2HWD 2;  1CIW A;  1AR9 2;  2PYT A;  3ZXF A;  3WF3 A;  2EAA A;  4ZS2 A;  4FOV A;  5HXV A;  1HLC A;  1ND3 A;  5KXC A; 
#chains in the Genus database with same CATH homology
 5FZ3 A;  3PU8 A;  2OQ7 A;  5FXW A;  5FPL A;  5FYS A;  4Y33 A;  5A3W A;  5IVB A;  5A7Q A;  4CCN A;  2PXJ A;  5IVJ A;  5IVV A;  5A1L A;  5FBJ A;  5FY0 A;  5A7W B;  3ZLI A;  4IGO A;  2GP5 A;  3OPT A;  4LIT A;  3N9M A;  3KV6 A;  5F3C A;  5A1F A;  5FY5 A;  5FZI A;  4NUB A;  3KV4 A;  5ISL A;  3N9Q A;  3LDB A;  4QXC A;  5FXZ A;  4EYU A;  5FXV A;  3DXU A;  3K3N A;  3KVB A;  3PUQ A;  4BXF A;  4LIV A;  4C8D A;  4QXB A;  4CSW A;  5FZ7 A;  3KV5 A;  3ZPO A;  5FYH A;  4QU1 A;  5IWF A;  5A7O A;  4DIQ A;  4GD4 A;  5A7S A;  5FZ4 A;  2YBK A;  4EZ4 A;  5FWJ A;  5F3I A;  4CCM A;  5A3T A;  5F5A A;  3U4S A;  3K2O A;  3N9N A;  3DXT A;  5F39 A;  5FZH A;  5A3N A;  5IVF A;  5FYV A;  5FP9 A;  3LD8 A;  5FYB A;  3KVA A;  2XXZ A;  5FP8 A;  4CCL A;  3AL5 A;  4CCO A;  5LY1 A;  5FP3 A;  3PUR A;  5FZD A;  5FZB A;  4BIS A;  5FUP A;  2OQ6 A;  4V2W A;  5F2W A;  4D6S A;  2YPD A;  2YU1 A;  5FYC A;  3PU3 A;  3PUA A;  4UF0 B;  5FP7 A;  2Q8D A;  2WWU A;  4ASK A;  4DO0 A;  4EZH A;  5IVC A;  5CEH A;  5LWB A;  5FZ8 A;  2OX0 A;  4QX7 A;  3RVH A;  4CCK A;  5FZM A;  5FZL A;  5FWE A;  5FV3 A;  5FYI A;  3UYJ A;  5FPA A;  2GP3 A;  2XDV A;  4IGP A;  4LIU A;  4D6Q A;  1VRB A;  2YBS A;  5FZO B;  5IVY A;  4E4H A;  5F5C A;  3KV9 A;  5FUN A;  5FYY A;  5FJK A;  3PDQ A;  5FY7 A;  5FZF A;  4CUG A;  5FY8 A;  5A7W A;  3PTR B;  5F2S A;  5FZG A;  3K3O A;  5FXX A;  5K4L A;  4Y3O A;  5A7N A;  5F5I A;  5FZ1 A;  5FZ9 A;  5FZK A;  5LY2 A;  4BU2 A;  2YBP A;  5ANQ A;  4CCJ A;  5F3G A;  4GJZ A;  4XDO A;  3N9P A;  5F3E A;  3AVR A;  5A3P A;  5FPB A;  5FZA A;  5FZ0 A;  5FYU A;  2WWJ A;  3U78 A;  5FY9 A;  5FZE A;  2YU2 A;  4GJY A;  4D6R A;  5IVE A;  5F37 A;  5FZ6 A;  3PUS A;  5FYZ A;  5F32 A;  5A80 A;  3OPW A;  5FYM A;  2XUE A;  4AAP A;  5FJH A;  5FY1 A;  5FZO A;  4AI9 A;  4HON A;  2W2I A;  4HOO A;  3N9L A;  2Q8C A;  3AL6 A;  5FYT A;  4QXH A;  2OT7 A;  4TN7 A;  4GAZ A;  4LXL A;  4Y4R A;  2P5B A;  4IGQ A;  4QX8 A;  5E6H A;  2XML A;  2OS2 A;  4QWN A;  5A7P A;  5IW0 A;  4URA A;  5FY4 A;  5KR7 A;  4V2V A;  3AVS A;  2Q8E A;  5FPU A;  3NJY A;  3N9O A;  5FPV A;  5FP4 A;  2VD7 A;  4XDP A;  4UF0 A;  5FZC A;  5LW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...