5A7QA

Crystal structure of human jmjd2a in complex with compound 30
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
351
structure length
351
Chain Sequence
b'SESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Docking and Linking of Fragments to Discover Jumonji Histone Demethylase Inhibitors.
pubmed doi rcsb
total genus 109
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a7qA01
3PDQA 5IWFA 3OPWA 4CCLA 5FWJA 5FYBA 5FZ9A 5FZGA 5FZBA 5FV3A 2OQ7A 5FYZA 5FP9A 5LW9A 5A80A 4D6RA 4LIVA 4V2WA 3N9PA 5FPLA 4EZHA 4IGQA 5FBJA 5FZ7A 3LDBA 3AVRA 4Y4RA 2XXZA 5FP3A 4BU2A 4E4HA 5IVYA 5FZEA 4NUBA 5FJHA 5FUNA 5A7NA 3UYJA 2W2IA 5FPVA 5FY0A 5A7QA 5FZKA 4QXHA 5FP4A 5A1LA 5A1FA 5FY9A 5F3GA 5A7PA 5LY1A 3N9QA 4LIUA 5FZ0A 2YBPA 5A3PA 4URAA 3U4SA 5A7SA 4C8DA 4QXCA 3DXTA 2VD7A 3N9OA 4EZ4A 4HONA 5FZMA 4CCJA 3PURA 5FZCA 3ZLIA 2Q8CA 5F3CA 5FZ1A 2WWUA 3PUAA 2Q8EA 2OS2A 3N9LA 3AL6A 2XDVA 3PUQA 5FY1A 5FPUA 5FYVA 3OPTA 5FZ8A 3PU8A 5F3IA 4XDOA 3PTRB 5A7WA 5F32A 4QXBA 4IGPA 2OX0A 4QU1A 5F5AA 5F37A 5F5IA 4BXFA 5IVJA 5FYTA 5FXXA 4GJYA 5FP7A 5FPBA 3KV4A 5IVFA 3N9MA 4QX8A 3AL5A 2YU1A 5FZ4A 5FPAA 5FXZA 5A7OA 5FYSA 4UF0A 3NJYA 2YU2A 3K3OA 3KVBA 5FWEA 4QWNA 5IVCA 5F2WA 5A7WB 3ZPOA 4EYUA 5FZ3A 3RVHA 4GAZA 5FUPA 5FZOA 3LD8A 4AAPA 5FYCA 4D6QA 2WWJA 2XMLA 4Y33A 2OT7A 5LY2A 2YBSA 3AVSA 5FZOB 3K3NA 5FZDA 2P5BA 5FYUA 3PUSA 5FZFA 4AI9A 5FYHA 5CEHA 3DXUA 3PU3A 4CCNA 1VRBA 4LXLA 5F3EA 4LITA 3N9NA 5IVBA 2Q8DA 5FJKA 4IGOA 4UF0B 5FZLA 4HOOA 5FY5A 4CCMA 5F2SA 4GD4A 5IVVA 3K2OA 3KVAA 4ASKA 4TN7A 5F5CA 5F39A 5ANQA 5FXVA 5FZIA 2GP3A 2OQ6A 3KV5A 3KV9A 3KV6A 5FXWA 5IW0A 3U78A 5FY4A 2PXJA 2GP5A 5FYYA 5ISLA 4CSWA 5FZAA 4DIQA 4Y3OA 2YBKA 4QX7A 4CCOA 5A3TA 4GJZA 5KR7A 5A3NA 4DO0A 5LWBA 5A3WA 4D6SA 4CUGA 5E6HA 4BISA 2XUEA 5FYIA 5FP8A 5FZHA 5FY8A 5FYMA 5K4LA 4XDPA 2YPDA 5FZ6A 5FY7A 4CCKA 5IVEA 4V2VA
chains in the Genus database with same CATH superfamily
1B35A 1XNDA 2PLV2 4C1WA 1N47A 3OEBA 4HPKA 1DU3D 4Z92B 1NA1C 3AKTA 5C33A 4NE9A 4AHWA 2VCCA 1K12A 4WV8A 4CP9A 1MS3A 2PHFA 1OQEA 3H3ZA 3RJ2X 1ZBA1 3AVRA 1POV3 5JI9A 4UFLA 3VBFC 1FPN3 1MEC3 1X9PA 3ZMNA 1KD7A 4GULA 5C4WA 3KCYA 1RUG2 2BYVE 1VBE3 4M00A 1K5JA 3WNLA 3POBA 4CDXA 2YHJA 3RNSA 3KT7A 5IATA 1BBT1 2WNVA 4QHZA 1F4HA 2V4VA 2ZKNA 3CKHA 5F3GA 4AGVA 4BQYA 5DMYA 3LEKA 5LY1A 5JXHA 4P9XA 4ZU4A 2BU9A 4CA9A 4WZCA 1HRI2 4BMBA 2CYFA 2HLEA 3ACGA 1LGNA 4YGBA 4LBNA 4KG0A 4O65A 1PNGA 5A32B 1KDKA 1JXNA 1JTZX 5TSWA 2IFWA 4YVSA 3X29B 1G9DA 4L92A 4B4RA 2JJ6A 5A3MA 5FAXA 5F8PA 3I8TA 4ASMB 2DFCA 1W2OA 3MI8A 4CEWA 2DUQA 2EIGA 2VZSA 2E7TA 3GYDA 2YFUA 4Q4X2 2VMDA 4UFKA 5FZ8A 4K8FA 3LAGA 5F3IA 3ZN4A 4YW7A 3VDDB 2A6YA 4Z1VA 3KCCA 3TEZA 4IL7A 4UFMA 3WXPA 2V09A 5AC92 1CGPA 2E31A 3UKVA 4BLJA 3VHPA 1PO11 3J8F1 1UXZA 1S2EA 2I07B 2DVAA 3WW3A 1ZZ7A 2CV6A 2HWF3 1E57A 1TEIA 3ENRA 3OG2A 5DXDA 3WDUA 5C9AA 4FOWA 2WIIB 1GU3A 1VJ2A 3EBRA 4XJ8A 5FO9B 3DKQA 4DOUA 1QKQA 3CIHA 5C8CC 1UOGA 5IVCA 2WO3A 3IDAA 4LQRA 1V6NA 4R9DA 4XFHA 3EHKA 5JOYA 3VGIA 1QJX2 2HYXA 2PYTA 2RV9A 3K48A 5SV5A 4Y22B 4XQWA 1VLNA 2G4IA 4AAPA 1H9WA 3CJIC 2OT7A 5C6CA 3NJXA 1Q3EA 3A7QA 3JB4C 4IXLA 4R8HA 4FAHA 3FFQA 2WA4A 3G7DA 1PVC1 1SQ4A 4JX0A 3FX3A 2HBUA 3DXUA 1JU3A 4PDWA 5D21A 4EE2A 4UW5A 3MLJA 1NA1A 1R1A1 2QQWA 1NOVA 3ON7A 4BK5A 1V9U3 2ZGMA 2D3PA 3K2OA 1NCRA 3OUHA 3D82A 4E27A 1UZ0A 4L2NA 2WNUA 1RTVA 2FMDA 4XUTA 4MHUA 2ARBA 2H6CA 5HCAA 2ZHKA 3DL3A 5LZ6A 4QHOA 2DV9A 2WZPP 1PM4A 2QQJA 5SV8A 1DGWX 2C1FA 2ORZA 2CNAA 1WA6X 3AYCA 1VRH3 3SCGA 4AVAA 1CX4A 1UD1A 5CFDA 4CUGA 4GWJA 5E6HA 4BA6A 4CCCA 1TMF3 3MIHA 3S6PA 4DEVA 3AJZA 4LLFA 4WVWA 2ZHLA 3WQBA 2VMGA 4CE8A 3WNMA 4RHV3 5FYBA 5FZ9A 1NE4A 1MS5A 1CD3G 1GQPA 1RVF1 2X29A 3A21A 3I54A 1TVGA 4NPLA 4UYBA 5D8AB 4Y22A 5KWRA 3CMGA 3ES4A 5BUVA 5BNOA 2WC2A 1DG6A 1H2KA 3B5LB 1FATA 4IGQA 3LDBA 4IERA 1SZBA 4Q1PA 3DV8A 2R0HA 2VTXA 2VCAA 5FUNA 3UGHA 3WW1A 4OHWA 3WDXA 5K9YA 2QUOA 3AP9A 4LMFA 4DUXA 4KGGA 1HRV1 2NPIA 1G9BA 4IE4A 5J36A 4MGTA 1KXGA 1LR5A 4CEYA 2Y38A 4OFGA 4Q4X1 1NCQA 3HJRA 3MBWA 3NMBA 4M4PA 1V6IA 2JDNA 5C8CA 3DXTA 2VD7A 2VMHA 2P37A 2WFF3 4IEQA 2SLIA 3N7MA 2Q8CA 1OQDA 4HLTA 1AL23 1QJFA 4FPJA 3CJIA 4JKLA 4QAWA 4RR3B 4BQWA 1UMZA 2AR6A 3OGRA 3FUQA 5K0UC 3WEZA 5FKCA 1Q8PA 1R083 2ZOEB 5C71A 4PDWC 3AFKA 4G9SB 2EXIA 3MGUA 2UY8A 3EO6A 3FHAA 4DXRA 1DBNA 4RR3C 3OCPA 3FJSA 1J3RA 2O8QA 3SHRA 5LATA 4C1XA 1HXS1 1SMVA 2BGPA 1PK6A 4FQZA 3FBMA 3EMRA 3VDAA 1DQ0A 5FQ0A 5KC6A 4FPFA 4XCAA 1JZ5A 4IEOA 1OXCA 2ZMKA 2JKBA 1PK6B 1EY2A 2FDJA 5E16A 5ACA1 1DHKB 1HRI1 2LALA 1GNYA 3NQHA 4FPOB 5FREA 5K8SA 1XYNA 5GLWA 4O9EA 5EJZB 1UPSA 3ACIA 3MUZ1 1VRH2 2DUOA 5C5TA 1STMA 3LGRA 4P00B 4AFDA 4CDUB 1YWKA 1UL9A 4DS0A 1LNSA 4PLMA 3OF1A 4M3CF 4E4SA 4EN7B 2UWBA 4RSUA 3CO2A 5JSOA 1YC61 3GZEA 1FMD3 4D8MA 5FZLA 2BERA 2JE8A 1H6YA 1H0BA 3HT1A 2VOKA 1NX9A 1G86A 1RMU3 1OOPA 4AHYA 4W6XA 1IPSA 3OD4A 4CSWA 4HK9A 2Y6JA 3AP5A 2QVSB 4I3GA 4HVQA 4Q0PA 4U36A 2A6ZA 4L99A 1JYIA 1OHFA 5FUIA 2D5FA 4S2GA 3ZR6A 3RZMA 1GZWA 1H2NA 2ZEYA 1EPZA 1U5XA 3NO8A 2R0FA 1UU6A 1UWWA 4IEXA 4NR1A 4PIZA 5FY8A 3S30A 3WCSA 4BH9A 4EWAA 1IOAA 5BNNC 3N36A 5HCHA 2BGOA 3AJYA 1MS4A 5IUQA 2YG0A 1S0BA 4XE9A 4ZU7A 2PHDA 3AC0A 1UOFA 5EV7A 1RUE3 4CUBA 5HV4A 2GH2A 3H42B 3AP7A 1HN0A 5FYZA 5IFPA 2R061 1QJU2 2DBNA 3ATGA 4BOWA 4FPYA 1FV2A 1ULDA 1YFUA 3N4MA 1RUD1 2EXJA 4LBMA 5FBJA 1A34A 1OC1A 3SQOA 4AI8A 1AYN2 1VPHA 2YC0A 2X5IA 2ID4A 3IIAA 3QOPA 4JHTA 4RR3A 4LKEA 4AEJA 5HCBA 4GQ7A 4WM8B 2GNBA 1A78A 1H2LA 2NQYA 4XQDA 1AX1A 5BPXA 4XHBA 1WA4A 3WVJA 1W8FA 2PLV3 1AUYA 1UY1A 1X33A 4AK3A 2YXSA 4HONA 4BB3A 1UPIA 2VBBA 2ET1A 4DXZA 3OUIA 3GXUA 1CESA 3SITA 4AHXA 1UX6A 3WG2A 3FLPA 4Q2FA 4CCDA 4JTNA 1Q56A 4Q4Y3 3WR0A 1ENXA 4LBOA 3TAYA 4BE3A 1HB4A 4E2SA 1CAWB 1V6LA 5DN2A 3BIWE 3ZFEA 2JDUA 3ALQA 4ZU5A 5G04L 1BZWA 3BKZA 1PGW1 1HDKA 2VMEA 4HVOA 2VO5A 2W1QA 1E5HA 2WO1A 1MEC1 1WCDJ 1RIRA 3N7JA 4GJYA 3T4HB 1LGBA 1ASJ2 1AYN1 2YU1A 1K45A 4H2AA 1NLQA 4NRPA 1WCKA 2ZHNA 4QWNA 3VBRB 1X8MA 1TME3 2J1RA 1H1IA 4QT6A 2Y64A 1V70A 1RC6A 2X09A 3LD8A 4Y26A 2BBVA 1R64A 2RMU2 5FLIA 2UY9A 4OHYA 4DFSA 5LY2A 1Z78A 4YFZA 2Q1ZB 4IV1A 4CUCA 5FZOB 4AI2A 1DQ1A 1AR61 4JKKA 3OUJA 5FYUA 5HPOA 4XF0A 1UY3A 4PBPA 1GZCA 1O6UA 1S0JA 5FMBA 5JXIA 3M2MA 5CU1A 5GZDA 4MVTA 1UIJA 4YSFA 2DURA 4OULA 3HR9A 4LHKA 2XVLA 2ZEZA 2XPJA 3K4DA 3LZZA 4YZ3A 1IPKA 4GXLA 4Y1YA 2Z69A 4WVMA 5BNPB 3WHTA 2XB6C 3KV5A 2GC3A 3V65A 3U78A 3FLTA 1X8EA 5LBEA 2DDUA 3AXEA 3V0BA 1QJY1 2XJSA 3CHXA 4LLOA 3VKLA 3VL8A 1OLQA 3J7HA 5BXXA 2V5YA 1T2XA 1W2NA 3AYDA 4LE4A 1Y9GA 1V00A 4RYDA 3U37A 4AVSA 4Q4W3 4CXYA 5LBCA 4D6SA 4BXSV 1OBNA 5FZHA 4A45A 3UETA 3KT4A 5DZGA 3H7YA 1OKOA 1W6OB 3ILRA 4XBLA 2K9ZA 4LORA 2Y33A 2NM1A 5FY7A 2A5ZA 3HVDA 4JDMA 3PDQA 1AVBA 4DPNA 1SLIA 1V0AA 4LKFA 2GMMA 1EAH1 1J3QA 5D8AC 5AFEA 1W6QA 2JDMA 1ACCA 2OQ7A 3V0AB 1JZ2A 1AR71 5GM0A 3RMYA 2JX9A 1HN1A 3T0DA 1JBCA 2JD4A 5EPAA 3ZXGA 2HWC1 3I97A 5CNAA 1JU4A 1RUC1 1QMJA 2BNOA 3J8F3 4O61A 5IK8A 1H9PA 1HRV2 1U5ZA 4ZY9A 3VDCA 4NUBA 1K3IA 4PBOA 3FLRA 4QQHA 3T2OA 4AW7A 4YPJA 1GWMA 1LEMA 1LOCA 2GNDA 3FUOA 4YVWC 4A2UA 4ARYA 1LJ7A 2ZX1A 3T2TA 4FPKA 3U14A 3OTFA 3MHZA 5FMCA 4W6YA 4HFSA 1OLME 4LIUA 3ETPA 2ZX2A 3E5UA 1Z7S2 5FZ0A 3CU7A 5JPNB 2R073 3DUIA 5JOXA 1YQ2A 4XZPA 1PO23 2LS6A 1BHGA 3NRUA 4D7TA 2FCVA 2BFUL 1TE1B 2XHKA 5I0SA 2FDKA 2VOXA 5C4WC 1A8DA 2GU9A 4OYUA 5CZKA 5GKAC 2X5IB 3MFCA 1UX7A 3HN1A 2C0ZA 1OLRA 3H3LA 5CYYA 4NPRA 4XFCA 2I45A 3JB8A 2B7YA 2RM21 1VBA3 2PHXA 2XDVA 1RVF2 3C7FA 3N9LA 1CJPA 1OKQA 2F4PA 1S2BA 3Q9OA 4ZPIA 3WNPA 4Z2AA 3VDBA 2Q0AA 4I30A 2BBAA 3PTRB 3M3OA 1Q43A 4IEZA 4NIGA 1WUVA 5H9RA 1EAH2 5E88A 4EWDA 2B39A 4QKDA 5F5AA 3POEA 2D6NA 2NLRA 1IQDC 4RGKA 1HQNA 4SBVA 5IHRA 1TQ5A 1H2MA 5GLVA 1W6MB 2ET7A 1QH6A 3AKSA 4ATFA 5JLVA 5FPBA 2A7AA 2YMZA 4K6BA 4MGYE 1S2KA 2DTWA 4NN0A 4O7XA 3RYKA 2W9XA 3EXUA 1RUG1 4XBNA 5EQUA 4HANA 1LAJA 3W21A 3LDKA 1US2A 1MQTA 1DQ6A 2W47A 3R4UA 3GBGA 4HPKB 4FTSA 4H7MA 4QPGA 4FTBA 5JMOA 1DYKA 1DGRA 4LUKA 3IIIA 2LW8A 5LA9A 4QX1A 4JGYA 2KR2A 1V9U1 1Y9MA 1H6XA 2VMFA 5FZFA 3RGBA 1KFUL 1ZZ8A 2NP0A 2JENA 4L97A 4AG4A 4D3WA 5C4WB 1DF0A 2E7AA 1CONA 2IFRA 1VBE1 1VBD1 2P6CA 4LHNA 1EV12 4R9AA 5L73A 2BQPA 3ZSJA 1SLAA 1OA3A 4KWUA 2Y60A 3ZKUA 4C0BA 5L9BA 3DEMA 5FPXA 2C4XA 3ABZA 1SLCA 3IDEA 4D69A 3NSTA 3POYA 1O5UA 4N43C 2RJLA 3DYPA 4CDWA 3KV9A 2B42B 4LA3A 4YYOA 4KI5M 4UW6A 1J1LA 1QOSA 1MVQA 2J7MA 2VZUA 1UMHA 3HMYA 1VBC2 4Y3OA 4QX7A 3NV3A 3Q8CA 5A6XA 3WQ1A 2PA7A 1R1A2 1ULPA 1PO12 5FRAA 4AAXA 2XKOA 4LA2A 1ODNA 2W3JA 1QY4A 1O5LA 4CXWA 3ZN6B 1O8PA 4Q4Y1 4HG6B 2XBO1 4XURA 1X36A 5FZ6A 3SH4A 2W92A 1VRH1 4WVMB 4BQ5A 2ZZJA 3ZR5A 1JUHA 1H1AA 5DUWA 3VBSC 1QJX1 2VQTA 2PAEA 4NOTA 1WCQA 1R082 2ZGTA 4YG0A 3VD9A 4V2WA 3S0MA 5FPLA 3ELNA 2R32A 4X6QB 2CDPA 3AFGA 4W8JA 2UWAA 2QZ3A 4FAGA 5C8WA 1O4ZA 2Y8KA 5CISA 2OW4A 4I3PA 1GANA 3OD0A 4Q4Y2 5JR2A 2J42A 2WNVB 3RZLA 4XVHA 2XG3A 3PHMA 2YUEA 5EYXA 1WGPA 1E5IA 1MZ6A 2GN7A 2B46X 2WABA 3SKJE 4MG2A 2VBPA 4COVA 2RS12 3LEGA 4XCBA 1DGWA 5I8YA 4DMIA 5LA2A 2VZVA 4GWNA 3MDPA 4Q0SA 3D3AA 1OA4A 3N9OA 2W1SA 4YVSB 5EJ1B 5M0TA 1OVPA 3TYJA 1MS1A 4LK6A 1COV1 1YXWA 3ZLIA 1AHSA 4QPGC 2WYSA 4HT1T 5JSRA 2UURA 4OHZA 2Q8EA 2WO2A 2HWF1 3NNMA 5DZFA 5FPUA 3ZYBA 4HN1A 1XU2A 1VE0A 3CNAA 4F8AA 3HQUA 2WDBA 5JMCA 3HBKA 4V1PA 1AYM3 1C28A 2R043 4P5HA 1B09A 4HXCA 4CEWB 1PZ9A 4QPIC 2BP6A 2D98A 4MYEA 2N7GA 4QU1A 2XKPA 3PLQA 4JQTA 2JB8A 2VE1A 2XJTA 1G8WA 3B3QE 4PLNA 1D4M1 1FOD2 3GNEA 1Q8VA 2MEV1 4N43A 1EYBA 3POGA 4CDUA 2RJKA 1QF3A 4J6GA 3KSCA 3OGJA 2MNGA 1UYPA 2Z79A 4H55A 3D0SA 5IK4A 5FXZA 3RZKA 1CAVB 3FMGA 4N7UA 1JOPA 2XQXA 4QHBA 4P9IA 1Z7S1 2D7FA 3NJYA 3K3OA 5JWPA 4E8DA 1XSQA 1VMFA 3KGLA 4DRVA 2B9UA 3LIHA 2BNNA 5DUXA 3P3PA 1UZZA 1JODA 1VR3A 1LECA 4QKNA 4TYSA 5DAPA 3FZ3A 1MS8A 3RSJA 2YBSA 4KGQA 3ZSEA 1L7LA 3VZJA 3K3NA 2VVFA 5B4NA 3AP6A 3OBTA 1RL3A 5F6LB 5JXGA 1QNWA 1BVVA 2D6KA 4NJ4A 4WVZA 1RXGA 2VC9A 2FDIA 4UF0B 1RB8G 3E5XA 4XBQA 4GD4A 1MQTB 3J7NA 4UW3A 1DQ2A 1GLHA 2A3XA 4CVUA 1ENQA 2VY0A 1I6XA 5IW0A 2ERFA 2Q1FA 3MIBA 2J22A 4NROA 1ULEA 3ZSKA 2D93A 2AEYA 1KRIA 1W3XA 4J1XA 1UF2C 1WZXA 2E63A 2WQ8A 5KR7A 2VMCA 2A6VA 4AWDA 2IUWA 3D5OA 2F6BA 4ITCA 1ZRCA 5GZGA 5D2AA 1W8ZA 3WNNA 3I49A 2WRAA 3GCWA 2QQMA 1OOPC 3MZHA 2X10A 1COV2 3VL9A 1QDCA 3KS7A 3AKPA 1W6NB 4YW4A 3OPWA 3ZMOA 3ZKYA 1RUC2 1C1FA 1C8M3 5BNOB 3DCQA 3VZNA 4FO9A 3VD7A 2X53S 1DIWA 1PX4A 3AZWA 4KQ7A 3Q8AA 4LE3A 2JXAA 4OZOA 3OBZA 3HNMA 4P9YA 1C5IA 3VBHA 3THPA 2P3JA 1GYKA 5FFOC 2B5HA 2VNGA 5CFDB 3SMHA 2JG9C 3B9CA 4RL7A 1ZBE1 3TNQA 5ABJB 4BJ0A 3IKWA 5T3NA 3PIGA 4CDUC 3M3CA 1LCLA 2IZWA 4F7ZA 4AFCA 5BV6A 2RS32 2FBEA 2CAVA 1Q8SA 2YBPA 4PF1A 4C8DA 2IVIB 2OZJA 5LBBA 1BLZA 2X5IC 4ES8A 1N3QA 1IS6A 4QB2A 5EZWA 2ENRA 1QJZA 1GBGA 4NHMA 1ND2B 1N1TA 3A22A 2RJ2A 5G05L 2OS2A 4A4AA 2D43A 3JU9A 5KC5A 5FLHA 1C57A 3S5AA 2DWRA 3I2DA 3ZOIA 2ARAA 4WM8A 1VMHA 3GZAA 1GP4A 5DUVA 4AGRA 2AZ5A 3O14A 4XILA 4FI9A 2WWSA 5LK7B 2R7EB 3DYOA 3RS6A 4NRQA 5JXJA 2HEWF 2O1QA 2OX0A 3UESA 2ZTNA 5CA6A 4JGZB 1JN2P 4AZZA 5FYTA 1SBDA 3K4AA 4DZGA 1VAVA 3PUHA 4NIDA 4Y1XA 1SEFA 3VZLA 1WMXA 3TBDA 3T30A 3AL5A 1UZWA 2GC1A 2BWCA 3IB3A 1XBFA 4RS5A 5I8SA 3I2OA 1W8UA 4KWJA 3SNMA 3GGLA 2PAMA 3I59A 5A7WB 3JXSA 1C4RA 3H0OA 3HBZA 3SISA 5ABJA 4PQQA 1UYXA 4CU9A 4JHZA 2XBO2 1JW6A 1PIV3 4YW3A 1QXRA 3NKGA 3W5MA 4IEWA 4COWA 1QIQA 2RM23 1IS5A 1BYHA 1J58A 1HKDA 1VBA2 4Q4V2 5DAVA 5I91A 1XNCA 2PMWB 5IVBA 1IG3A 1YQ8A 3P5BA 2PQSA 2R062 3U1XA 4BQXA 3L9JT 3UNPA 1GWKA 2QE3A 2GDFA 2VOTA 1D4VB 1PGSA 4CDXC 1PVC2 3AZZA 2RVAA 4KBBA 5ANQA 5FXVA 4ET7A 3GBWA 1ND2C 3VBHC 2VZQA 3D4KA 3GHNA 3OEAA 3WUDA 3GALA 1LODA 5T5JA 1XPWA 1RUE1 4YNIA 5T52A 4XUOA 3QLQA 4YW2A 3TOJA 1KGYA 5L9VA 4IEVA 1POQA 2B9VA 4BMEA 3MYXA 2A6XA 1C5HA 2R072 1QHDA 4JGZA 1HRI3 3JZVA 4K3UA 1DYOA 4YVSC 1RUNA 2GC2A 4RHV1 1POV1 3WF0A 4HETA 3T09A 5H9PA 3U0ZA 2L9LA 2YPDA 1JYNA 3E97A 4CCKA 5CADA 4A6SA 5KHGA 3H1MA 3K77A 1XE7A 4JQRA 4BQ2A 2ZEXA 1YUDA 2YY1A 3LFMA 1NQDA 2CWSA 5FCCA 2RE9A 3H8XA 4K21A 1CPNA 1FT9A 5DG2A 1W9YA 4K1YA 4XTMA 3WUCA 4JDNA 3H1YA 2DCZA 5CFCA 4RA0A 1PNFA 4BZ4A 2RDQA 1ASJ3 4RFT0 4BU2A 4Y4RA 3QBQA 4XDQA 2QZ2A 5FZEA 1DFQA 1ZVFA 4O9GA 2W2IA 3J26N 3WV6A 2QKDA 2NZ9A 1SPPA 2ARCA 2YFZA 4QXHA 4IE6A 4B3NA 1NXD1 5KXDA 2E32A 1ZA7A 2JB4A 1OA2A 4CP0A 5A3PA 2YROA 1ZBA3 3DKWA 5A70A 1UQXA 3NWKA 3IMNA 3I3QA 4X8NA 4YZ4A 4Y20A 1DP0A 4IDZA 1PZ7A 3JQXA 2XVGA 2WINB 3KHCA 2OXBA 2ADDA 3O12A 2WQ4A 5JPMB 5ABJC 1BCXA 1WW7A 3MW2A 1AX2A 4DXTA 1GKBA 4XACA 5I0DA 1H1MA 1BMV1 2D40A 1ONAA 5DABA 4ZXEA 4RHV2 4OHXA 2P2KA 2A70A 4RS5B 1TZOA 4CEYB 2XGXA 3OPTA 2WYFA 4AFAA 2A1XA 1RUD3 4XAAA 5E1RA 5KXCA 1NY71 1K42A 1TME1 2P4EA 4J25A 5I8TA 2WT2A 3N7KA 2W87A 3SC7X 2OYZA 2G9ZA 1QWRA 5T5PA 1CX1A 1ND2A 2X05A 1J59A 4QM9A 2O14A 2QDNA 5EXOA 5CKQA 5BNQA 2WT1A 2VMIA 5FWEA 1XU1A 1OH3A 1HXS2 4E8CA 3VUOA 1BEV3 1W6QB 3GZUC 2FQPA 1JYVA 1OOPB 3N3HA 3RG0A 1Z0HA 5FZOA 4GIQA 1XC6A 5A6ZA 1A8MA 4FCAA 5GZEA 5BNOC 1VBB2 2AGSA 4FP2A 1GZTA 1QOOA 4XF3A 2EA7A 2YPJA 3LIGA 1TG7A 5CEHA 1EP0A 4B4QA 1LOGA 2VZTA 1KS5A 3ME2A 4EWEA 1F8VA 1OQ1A 1I5ZA 2OUHA 1MQTC 4LBKA 5DPNA 1WLDA 3RDIA 4HOOA 2XVKA 5GLZA 1W04A 2OA2A 3RZGA 4TN7A 1W8NA 2RS13 3L2YA 3ZDVA 1DGRN 3KB5A 3OGSA 1DLCA 1F15A 1KS4A 4XFFA 3UJQA 3WF1A 1LULA 4CEYC 1JOBA 3FN9A 1UY0A 2C26A 1VBB1 2HWE1 3C7GA 1NY72 2ZGQA 5FO7B 1WD3A 2PN5A 3H7JA 3ZFGC 4DIQA 1G6NA 1ULCA 5A33B 2V72A 1LOBA 4OVEA 4AR2A 4TZDA 1NZCA 3VKOA 4AYUA 1QJEA 4K40A 5JDBA 4XF9A 4PQ9A 1PHMA 1W05A 5APAA 1UY4A 4AGGA 1QJX3 5K4LA 1W3VA 1FNYA 2DVBA 4URTA 3VKNA 1SCRA 2Y6KA 4FOVA 3UGFA 1GWLA 1UIKA 1QGLA 4HSJA 4LO4B 5FWJA 2HWE2 1XOYA 2A71A 1CVNA 2Z42A 3UJOA 4YM3A 3VV1A 4Q4W1 1NAEA 3I2HA 4GH4A 2KD7A 5F1RA 1BEV2 3MIFA 1DLLA 3N9PA 4XAEA 3USUB 1IS3A 1S4CA 4P14A 3ST7A 4LPLA 1W8HA 3MW3A 4R52A 4GMP1 4QDSA 3OOXA 5A3OA 2R49A 4XYXA 4COYA 2BDRA 3RMXA 1YNAA 5A7QA 1DZRA 4TXWA 1K5MA 5FZKA 4GB31 4QPGB 1UY2A 2VZ3A 1COV3 1POV0 2P3IA 5A7PA 3ZFEB 4QGLA 3RI8A 5BNPA 1JYWA 1RUC3 2J1TA 2VXRA 4CP9B 1EV13 1WBFA 2YDEA 3RRDA 1BK1A 2LTNA 2QQIA 2BFUS 1IKPA 4OUSA 1S0FA 4N43B 3RFRA 5K0UB 1CWPA 3H50A 4QXKA 3ZYFA 1VALA 3JD72 4NHYA 1LU2A 2HWB1 1YCIA 1ZRIA 3WDVA 4XJAA 1KFXL 1PO13 5LBFA 3VD3A 2JDHA 2PHRA 2BJSA 2VOVA 4H14A 4XDOA 3TN91 4L0PA 5EYYA 2IXIA 1QQP1 2O8OA 2MPFA 4NMIA 4QKBA 4FFFA 5DAXA 1YYNA 2VJXA 2Q8OA 4FFIA 3VLBB 1R091 1W2UA 3BODA 4BHPA 3AZYA 2A3WA 2HYKA 5CVRA 5JZGC 4BCUA 1F4AA 1H30A 4WVVA 1DZQA 1WMEA 5J96B 3E6BA 4DEQA 3AMHA 4D7SA 1J84A 2HBTA 2TUNA 1YQ5A 2RR11 3ZFGA 3KF3A 3O1MA 4TSVA 4YFWA 3TEXA 2E33A 4HKLA 1A6CA 3W20A 3VZMA 1LHWA 2VCBA 5FZ3A 4JGYB 2VPVA 3ACLA 4CU6A 2QQVA 1MZEA 3S7EA 1LENA 2EICA 2ZX4A 2VZPA 4Y33A 3NNLA 1KEXA 1RINA 4GKYA 1C8M2 5C70A 1T6GC 1F2NA 3HT2A 4B4PA 2P5BA 2Y26A 1ZREA 4Y1VA 1CAXB 4W50A 3E6DA 4EJRA 5BYNA 4K20A 4LITA 1ULFA 3DPRA 5KXEA 1H8TB 5AFBA 4CCMA 1AR81 4FOQA 4GH4C 4NVPA 2FZ1A 5IVVA 4QGNA 1RUE2 3WQ0A 4QPYA 1JHNA 4RGAA 4NIHA 3IN9A 4TWTA 2H6BA 3KWVA 3LF7A 4JZRA 1W06A 3BGAA 3RZZA 5L19A 5FMDA 3R4SA 5IAXA 2W0XA 3D0JA 3V0AA 4QQLA 4QX0A 2CSGA 3NNGA 5FZAA 2BOIA 4CDWB 1K5MC 4ARXA 5F5QA 1X7NA 1JZ6A 2WZ8A 3A0KA 2XL9A 1ST8A 2G9GA 1SCSA 4LBQD 1AR73 4Q4V3 3UK9A 3FL7A 3WF4A 4QPIB 4A3ZA 1MR5A 1YRZA 5I0RA 4B8EA 2PAKA 1ODMA 2WO7A 2W08A 3BTAA 5IWFA 3NKTA 4WM7A 2YZ4A 1PO22 3RZJA 3DGTA 3KT1A 5AC91 2P1BA 5CFDC 3ZYGA 1AXYA 1GOFA 5CB7A 3TEWA 3J4UH 5A33A 5A80A 5A3LA 2RS53 1GZ9A 2JKXA 4E9KA 2PLV1 4UAPA 4EZHA 5FZ7A 4Y5SA 4E4HA 3PVOA 3B93A 1UXXX 2E6VA 2WJSA 1ZYBA 2C9AA 4LBQB 4XC9A 4YWAA 3WOGA 1VB2A 4ES9A 3HD8B 3MO4A 5H9SA 4PT6A 3B00A 3MLKA 2EIEA 2GC0A 3WT3A 5A1LA 2BTVC 4LO6B 1HLCA 4EROA 2I74A 3RYPA 2WNVC 1OF3A 3EYPA 1MVEA 1QQP2 1IG0A 1ZBE3 3K51A 2W95A 4XIOA 3HQXA 3USUA 1HW5A 4BK4A 4CP2A 4DQAA 5JZGB 1C3HA 1RHI2 3C7HA 2XBO3 4A41A 1PGL2 1FMD2 2ZX3A 3CDZB 1UU4A 4CEWC 5FZ1A 2D5HA 4MUVA 3THDA 1L7RA 3M1HA 1O7FA 2ADEA 1OUSA 2BRTA 3AL6A 3Q8EA 1AR72 3THTA 3R4DB 3TRSB 4E2QA 2WZR3 2WLPA 1REFA 3ASIA 4AQTA 4FPLA 1LTEA 4PLOA 3EQEA 1W28A 1YQ6A 2VVEA 4XABA 5I0UA 4BIOA 2JIJA 2RS33 1IS4A 3C8XA 4OMDA 4Q26A 5DAQA 4KMQA 2FD8A 5FXXA 4Q5OA 4UBGA 2PQQA 5T5LA 4CP1A 3RPQA 1UMIA 1QJY3 1BMV2 5B4XA 1WD4A 1G9FA 4CDQC 3WP6A 2O0OA 3NAPA 2ZGKA 5AVPA 2Q30A 2HWD3 4P08A 2E51A 3KVBA 1FI2A 3HQRA 3IBMA 4XUPA 2DF7A 1GOHA 5L7OB 1DDLA 2BWAA 4PCRA 3FFZA 4QDRA 3RVHA 3JQWA 4RD7A 1DCSA 1IHMA 1OD3A 1A3KA 1VBC3 2XJRA 4MZUA 3ECQA 1CIYA 2E26A 4PDWB 5CG9A 2XJQA 3DN7A 4M3CB 1WMFA 3PUSA 4WM7C 3SLIA 4AI9A 1RGSA 1XE8A 4IE0A 2ZGLA 5L7OC 1LHOA 1NCRC 1JYCA 3U75A 1IZ3A 1JZ4A 5F2SA 4C0HA 1PIV1 3LOBA 3WG1A 1UZVA 5F39A 2WT0A 2ZXQA 3NV4A 4Z07A 1JZ8A 4UW4A 5FR3A 2QQLA 1U0AA 3MLLA 4GB32 2IC1A 1RUH3 2R6QA 3EJKA 4ISRA 4W6WA 1F9KA 3ZYPA 2ES3A 4OLLA 3SEEA 2HWC3 2EVXA 3SCFA 2V5DA 3R0RA 1W03A 1ZZ6A 4FP3A 4XIKA 1C1LA 2RM22 1HX6A 3CEWA 5FYMA 1FX5A 1XNTA 4AFBA 2D3SA 2W52A 2GALA 1CAVA 1N1YA 2ZMNA 1O59A 4XZUG 2H0VA 2KA3A 1MZFA 3WF3A 2K46A 2D3RA 2XLFA 2OUJA 1QQP3 1ULOA 2VVDA 2XONA 4F3JA 5CKMA 1AYM1 2ETEA 1PGW2 2R041 4LO8A 3FWEA 5I93A 5DG1A 2JDAA 2WNOA 4OUEA 5JVVA 4RQPC 1NKGA 5FP9A 1HQWA 3TNPB 5GALA 2JDKA 3KZ4C 2CTVA 2Y34A 4LO5B 4Z82A 5KHIA 4JV4A 1REEA 1RUI1 4JDOA 3UYJA 1GP6A 2BGCA 3HOBA 3VBSB 3MV11 4ZONA 1NCQC 4QQOA 4XEZA 4CTEA 2LROA 2R16A 3H3UA 4JTOA 1W8OA 1XJAA 5ERLA 3VDDC 3WP5A 1FPN1 5T55A 4CCEA 3NAPC 2LRPA 3VKMA 1WLWA 5ACA2 3H1WA 4JGYC 1QEXA 2HWF2 3M8LA 3Q8FA 3OPZA 3F2ZA 3P3NA 4OCTA 2FDHA 2BEOA 4RN5A 4Q27A 4ISQA 2HWD2 4OI0A 1Y4WA 1J83A 1W9FA 2WWUA 3GCXA 3NAPB 2VUJA 4IW3A 4Y5TA 1C8M1 5IAVA 4NRMA 2XOMA 1REDA 2VW0A 2ZBJA 4META 2XUMA 4G4FA 1FYUA 4QDQA 5AVAA 5FYVA 3T0AA 3PJQA 3AXDA 2D6LX 1SBFA 2NYYA 1W6NA 2C5DA 5L7OA 4MH0E 4QU2A 4EQVA 3O1RA 3LEMA 1AL0G 2VNRA 3LA7A 1URXA 1LOFC 1MS0A 2QQKA 4QQPA 4MGZE 2CHHA 1NYWA 1WBLA 2JDZA 4OI4A 1RUI3 3N35A 2W91A 2TNFA 3B94A 5CKNA 1AR92 2C6SA 2QJVA 3THCA 3BVCA 4QX8A 3SH3A 3ILNA 1F5JA 3WP4A 1US3A 4OQ8A 1XNBA 2WSVA 3BUCA 1HV0A 4UT5A 1MACA 3ZPOA 1CAWA 1OFSA 1YFXA 4AFMA 3MF9A 3NJVA 4CXXA 4W65A 2OKXA 1DYPA 1NCQB 1F31A 2WL1A 4YM2A 4B7KA 3T08A 3LPGA 2AC1A 1BQPA 2ORXA 2AYHA 4QB6A 4P9GA 3ETQA 2QDRA 4NWVA 3TEYA 2WFF2 3KD4A 4LXLA 3GJAA 4P02B 4Q0UA 4U2AA 1APNA 3BU7A 3DF0A 5HXMA 1WCSA 4MXWB 1SFNA 1HV1A 3VBRA 1R092 2W46A 4GKXA 5GZFA 1IKQA 4OI2A 5FXWA 1PMIA 3KV6A 1CR7A 4BIFA 5LCWL 4IQPA 2KXLA 3VB9A 4MGQA 1KJLA 1Q5OA 5FYYA 2DTYA 2JE9A 3USSA 3M3IA 1D4M3 2YBKA 1RUJ3 4CCOA 1WW5A 2EIDA 2G19A 4KNCA 1VBE2 1JI6A 3BTXA 1VAMA 3CZUA 3M70A 2XUEA 2K2SA 5JIAA 2AENA 3RYRA 2G9FA 2XLAA 4IV3A 5CBLA 1RUI2 1W0PA 5T54A 1O4YA 3WNXA 2IXKA 4FPGA 3VD4A 1QJU1 2IXJA 4ZXKA 4IEYA 5J98B 2Y6GA 3SCHA 3WG4A 3ZM8A 2FDFA 5JSPA 2TBVA 3P6BA 5A3UA 4FPHA 5J7MA 1OSGA 5IFTA 5IK5A 2TEPA 5DDJ3 1AR82 1FXZA 4H7LA 2XR4A 4LHLA 5CFCB 3UV9A 4BQ3A 1FOD3 2WN2A 2HWD1 2WZR2 2DCYA 2RR13 4XMAA 2DVGA 3AMNA 4R4ZA 1NE6A 1RUH2 1L3JA 3KCXA 2DBIA 1PMJX 2WBKA 3C7EA 2ZCWA 1GICA 2ZGNA 3D6EA 1LEDA 1GFF2 1V6JA 1UCXA 3VHRA 1JS9A 2Z4FA 4UWDA 2CY6A 4N9IA 1SDWA 3QH7A 3O5SA 2AREA 4QPWA 2VUDA 4YARA 2D44A 1RITA 3HEIA 2V4AA 2Y6LA 2JG8A 5JIUA 1OFNA 3PUQA 5FY1A 2JEMA 2WA3A 2G1MA 3ACFA 3CF6E 5BNPC 3ZFGB 2QFEA 3MUY1 3W59A 5JOZA 4ZS3A 4QXBA 3M4FA 3WF2A 2Z5WA 2DYCA 2RDRA 4LJHA 5F37A 3ZFEC 1DQ4A 1D0GA 5LK5A 3VBRC 1KDMA 3IDBB 1O8SA 1ZBE2 2VZOA 2PHUA 5IVFA 3OY8B 1CAXA 4XXAA 3JD71 2Y6FA 5IYYA 3O0XA 1VB4A 5FYSA 1CZVA 3MIGA 3J8F2 1QDOA 3QD6A 3VBUB 2VG9A 3I2JA 4OMCA 1LB2A 5JR7B 3MPBA 5JI7A 4AHZA 4GAZA 1ND3B 1VBD3 3IMMA 3IPVA 4IV3C 1UAIA 2RS11 3JUUA 4PI2A 1NQJA 1WKYA 1YJLA 4HSLA 3OYWB 4XFGA 4R9CA 3GM8A 4IE5A 2QQPA 1ULGA 3GDBA 4AVTA 2HEYF 1GQHA 1RUF3 1UU5A 5ACA3 2DFBA 5FYHA 1J3PA 1Z7S3 3V56A 2FMYA 4LTAA 4S2HA 4INDA 4YVWB 5FIXA 3FBYA 4IV3B 4DUWA 5LEJA 1L7QA 3VZKA 2P34A 2Y0OA 1VMJA 4ATEA 2WSUA 5KHKA 3VHNA 4P9JA 5F5CA 2WS91 1BBT3 1ZZ9A 2RDSA 1UW8A 4YGCA 2Q4SA 3SH5A 4I0WB 4FPEA 5FY4A 3LQCA 3VBOA 3O1PA 1AR83 2ZX0A 5IT6A 3KGZA 3M3QA 1VAKA 1VIWB 3DPRC 4OUMA 5HCFA 1W0NA 3JD73 3OBRA 2K0GA 4FVVA 4WZFA 3V0BB 3TB0A 5FYIA 4LKSA 3T0BA 2DVDA 1JOJA 4KWKA 1CIWA 3BB6A 1RXFA 3R05A 4KH9A 2NMOA 5JAXA 2VULA 4E2GA 5A6QA 5IVEA 4XF1A 4WM8C 1G7YA 4MO3M 1I3HA 1NZIA 1OMIA 1RUH1 2W94A 2NN8A 1X50A 3POFA 5FV3A 4K7JA 3IAPA 4CU7A 3ZXKA 4NO4A 3ITQA 2JECA 4AXOA 4D6RA 4IE7A 1QXPA 3AMMA 1AF9A 2RDNA 3H8UA 3PUIA 4A6OA 2JDPA 2RMU3 5GJ6A 1CAUB 2DU1A 1R093 3H9AA 1Y3TA 1NLSA 2HWC2 3ACHA 5FPVA 5KBFA 5HXVA 4XUQA 2DCJA 1PM7A 4HL0A 4YW1A 5FDBA 5FP4A 5A1FA 4CPBD 3I2IA 2LM3A 3ZYIB 1TMF2 5FOJB 1W6PA 3BCWA 3N9QA 2EF6A 5FPZA 1LESA 2VOWA 2XWBB 3GJBA 5F6KA 5A7SA 3JCIA 4MV2A 1W9TA 1YFWA 1OLMA 5FZMA 3BPZA 2WN3A 3PURA 4AL9A 3IZOA 4GZ9A 3AM2A 1D4M2 3QH6A 3MIEA 4N53B 4Q8KA 4XFBA 4XJ9A 2ZAAA 3ZXLA 4YGEA 2SBAA 2HEVF 4M01A 4X8PA 3QACA 4Z8BA 1H8VA 2MEV3 4AQ6A 5LRRA 2C9KA 1LRHA 2NMNA 1OT5A 3JBG3 3M3EA 2VW1A 2VQAA 3NW4A 5F32A 2W1UA 2EALA 2IXCA 4LBJA 3HAGA 4AE2A 1RUJ1 4KL1A 4I0AA 1GUIA 4BQ4A 2WZR1 1S0DA 4R9BA 3RQ0A 4L11A 2ZABA 2GH8A 4DB5A 4HKOA 4JGZC 2HWB3 2H0BA 2JG8B 4YG6A 2JD9A 4XFIA 4Q29A 3KQ4B 1ALYA 3AB0A 4UF0A 2VBDA 3TN93 3QCWA 3WCRA 1CZTA 2WZEA 1AXKA 1NCRB 1HB1A 1VP6A 3C3VA 2FCUA 4LR4A 1RUJ2 4MLOA 1GQGA 1UYZA 4KU7A 3AVSA 4CDQA 5EIYB 2B45X 5FZDA 1I9RA 3CZJA 3J9SA 4Y1ZA 4FQ4A 2ZA9A 1VRBA 4M0NA 1WLCA 3AZXA 4NHKA 2Q8DA 1NG0A 3U4XA 1LU1A 2XJPA 3N7LA 1MZ5A 5K0UA 2ZKLA 1RHI3 1JH5A 3MIDA 4CDWC 5FMOL 3KVAA 3PNAA 1N3OA 5FO8B 1D7PM 5I0TA 4BYYA 2GP3A 2OQ6A 3PIJA 2OVUA 2FHRA 2ZEWA 3T2QA 1UKGA 2DCKA 1XE0A 1YLLA 5AC93 2CAUA 1YQCA 4KBZA 4LT5A 3ZIWA 3O1SA 1G9CA 1W39A 5E8AA 5A3NA 2E53A 4DO0A 3Q8BA 2CU5A 5A3WA 4FSJA 1E5RA 2ZACA 3GF6A 4LOTA 4SLIA 4BLIA 5BNNB 2AACA 3POIA 1YFYA 3JBG2 3WD5A 4MSVA 1O3SA 3VBSA 1HQLA 3P1IA 1M06G 2WNUB 1BEV1 4AF9A 3GBFA 1V9U2 3UKTA 3VBOB 1XYPA 2WR9A 1SACA 3I4IA 5FZGA 1TME2 2P6HA 2E9QA 2RS31 2HWB2 1AX0A 3AKRA 2UWCA 1VBD2 4KWLA 2QQNA 2GN3A 1FV3A 4LIVA 4AI1A 3WSOA 4G3YC 2Q5TA 2LUWA 2VNVA 2PHWA 4LO7A 3W58A 4DY5A 1JYXA 1HJFA 3ZIXA 1RHI1 4N53C 5KHHA 4FXGB 5FJHA 2VR4A 5C3OA 2PELA 2Q1MA 3T3YA 5J48A 2BPA2 3ZN5A 1H8TA 1WMDA 1Y7BA 3FHQA 4YM1A 4AOCA 4LBQA 3H8RA 5EWSA 4Y4YA 1YI7A 4M3CE 1W99A 4AI3A 4UFIA 2RMU1 3I2KA 5C7GA 1W2TA 3PMSA 2PFWA 4L9BA 1RJ8A 4GH4B 3ORJA 4URAA 5DDJ1 3O1UA 4JC1A 1RUF1 1U5YA 4LHSA 3C7OA 1V6KA 4MADA 4N90A 3VD5A 3B7MA 4N8MA 3PVBB 2WAOA 3KMHA 1F5FA 2UYBA 3M7AA 4JRLA 2D6OX 4YGDA 5FZCA 3NJZA 3VN4A 4Y1UA 3WX5A 2EAAA 3AMQA 2W5FA 3PTYA 3PUAA 3WG3A 4QKFA 5BNNA 3H8OA 3A4UA 3VDDA 3FC0A 3WY6A 4QPIA 5J1XA 3I3DA 1HIXA 1UKRA 5EFUA 2JICA 2BVBA 1LGCA 1QH7A 1OI6A 1YIFA 2WUHA 3I59B 5DDJ2 5A7WA 3ZYHA 5GZCA 5HBAA 3S5QA 1UOBA 2D6MA 3S7IA 5L9RA 3AK0A 1SDDB 5EJ3A 2P17A 2MHFA 3RWKX 4IUGA 1UZYA 4OQ9A 1AJKA 3MW4A 4X6RB 3N9MA 3ZSMA 1SBEA 1AXZA 1NT0A 1YJKA 5A7OA 4D0QA 3LDRA 1V6MA 2PTMA 3O1TA 3LKJA 3OSDA 2YGLA 1AJOA 1AL22 1S0EA 5F2WA 1LOFA 2RHPA 2GNTA 4BDVB 1D2QA 4HZFA 4MXVA 2VECA 1OD5A 2V73A 3OB8A 5FUPA 5B2GB 1GNZA 1FPN2 2J1EA 2XMLA 3PVEA 3LA2A 3W9AA 2W1WA 3BOWA 3AYEA 4K8RB 4XETA 1XSRA 1W6MA 2F17A 4AVCA 4FPCA 3RWNA 3VBHB 3OBAA 1FAYA 4QB1A 4DUVA 2JIGA 3PU3A 3RZHA 3ZX7A 4LUMA 1FNZA 4IGOA 4HKWA 5FQ0B 1YIPA 5C3PA 5FY5A 4OI1A 4IEPA 1AR62 1HRV3 4C90A 3ZFFC 1D2SA 4ZHNA 1NA1B 3URFA 1DQ5A 2ATFA 1SG3A 2EIBA 1VBC1 2QTWB 4WM7B 4ASLA 1ZNPA 3C2UA 2F4LA 4YZ2A 4Q0QA 2ZGPA 2IXLA 1Y43B 3AX4A 1JYTA 3DYMA 4ORFA 4Q0VA 1AYM2 2R042 2QCSB 2VZRA 1SFPA 5ISLA 1EAH3 4TTGA 4GJZA 5HI0A 3B9IA 4B7EA 2PHLA 5F9TA 1RMU1 2CDOA 5C5UA 4XOGA 5FP8A 1OH4A 1KITA 1XYOA 2VH9A 1XXNA 1GV9A 2YGMA 3VBFA 2Y6HA 1R081 4HMZA 4DY3A 2RS51 3E6CC 1AR93 2XH6A 5GLTA 1HB2A 3TN92 3LSEA 2BV4A 4A7YA 1AL21 3ILFA 3WDWA 5FZBA 3WLUA 4PF5A 4UFJA 3ZXDA 1OPOA 1V6OA 5HV0A 4E4DX 4QX2A 2E7QA 5JZGA 1WW4A 3BYWA 3I3MA 5EHDA 2ZPXA 4Y20B 4PHZA 4AEDC 2XXZA 5FP3A 2UU8A 5DQ0A 3AYAA 4P9WA 2HH9A 2FCTA 3KF5A 3GHMA 3U11A 4I0BA 3WHUA 5A7NA 2VXJA 2WFF1 2VNOA 3NV2A 2ZS6B 3LWCA 1Q8QA 4YG3A 1OUXA 3NV1A 2OIIA 3E5QA 4CYDA 5FY9A 2GSYA 4FBFA 4AI0A 3ZXEA 4EN8B 2JG9A 5J09A 3B69A 1PGL1 2ILMA 1ZA4A 2BOJA 2XLGA 3U4SA 3INAA 1N1VA 2DUPA 1BJQA 1LHNA 3I2FA 3IDCB 1RUOA 2VTXJ 4AQSA 4XFAA 2VQUA 4I01A 4MHRA 1AR63 2WNEA 1PVC3 2GAUA 3MICA 4GB33 3A0NA 2GNMA 1RMU2 1AR91 4ZZ8A 3OY8A 4FT8A 3UGGA 1W9WA 2ZZQA 4AQ2A 5KXBA 2XJVA 4I02A 5C9AC 3O7OA 4GMP0 4BM8A 3KM5A 3LEIA 5GLUA 4LEJA 3VBUA 1CJDA 4Z2WA 1S1AA 4AEKA 4C91A 4GALA 3ZSLA 3KHBA 1SLTA 1BXHA 1LOEA 3O0VA 4M3CA 5FP7A 1LHVA 1F35A 4P5YA 2EXKA 4YZ1A 1IGOA 1SHWB 3KV4A 1EUTA 1ZZBA 4JVAA 5FPAA 4YVWA 1MEC2 2DCTA 4ZKTB 1I5PA 3SKVA 2R071 3R6SA 3F95A 2ZMLA 4M0HA 4QGMA 3O0WA 4S2DA 5E89A 4DXSA 4RS5C 3VZOA 2QNKA 3ZDSA 3GZTB 5JCTA 2WLQA 2WNUC 4D6QA 2JG9B 1LHUA 1AZDA 1S55A 3I3BA 1GOGA 2C24A 1NUKA 2EXHA 1XB9A 5C8CB 4QMAA 1ENRA 3E1F1 3RI9A 2WS93 5FK7A 5F3EA 2RR12 3LCPA 2I2SA 4EN6B 2YYOA 2ZGOA 2J1AA 5H9QA 3VHOA 1DGLA 3WZ1A 3AZVA 3VBFB 1ZBA2 4Q4V1 3CJIB 2VGDA 1JHJA 4AEDA 1KQRA 4WBBA 1YEWA 2XQRA 3PMEA 2X8KA 3ZXFA 4NPMA 2PXJA 1OVSA 4I09A 3U07A 5LA1A 1GR3A 1GMMA 2KM2A 4XJUA 3WDYA 3I7DA 4XPVA 2JWPA 1O91A 2CWMA 4MX3A 4N9HA 5FLJA 5J37A 3OGVA 3ZYJB 2FDGA 4NAMA 4CRQA 2ARXA 2D97A 4A3XA 1RVF3 1SLLA 4FXKB 1CAUA 3S57A 4XDPA 1Y9QA 2R1BA 2CL2A 3T4VA 2B4KA 3VBOC 3D8CA 1PZ8A 4IETA 4CCLA 5CFCC 3WW4A 1W9SA 3PL0A 4Q8LA 5ANNA 4JAAA 1OURA 1W8WA 4NHLA 2A3YA 5T50A 4S2FA 3WNKA 4DINB 3O1VA 1PIV2 3VBUC 5J3UA 4MOAA 2WAAA 3DECA 5FBZA 1S0IA 2WQZC 2XJUA 3CL1A 1WWYA 2R1DA 4UI9L 2HJIA 5FY0A 1EV11 3NVCA 4YW5A 2ZGSA 1QJY2 1OF4A 3CJXA 2YC2A 5FTTC 1O4TA 4XF4A 1H4GA 2R063 4QX3A 1JUIA 5LB6A 4NIIA 3WNOA 4COUA 3T2PA 2A6WA 4AEDB 3CLPA 5CAZA 1HB3A 2XHNA 2EAKA 3LFIA 4OHVA 4BQ1A 2CGPA 1UNBA 1MS9A 1BBT2 3HNBM 5CIRA 1W2AX 2AUYA 3IT8A 3WQ7A 3ROUA 1XQNA 2VM9A 1QU0A 5F3CA 4XMIA 4B1MA 3BPSA 3J7MA 1T6BX 4AVBA 4EN9B 2R30A 3HPNA 1JMUB 4AEMA 2AH2A 2XL7A 4NHXA 2BNMA 4Y24A 4A7KA 4UXAA 1XRUA 1PK6C 1QXJA 4JCKA 1BVP1 4I2OA 1N3PA 1ZZCA 1QOTA 5DAWA 1JZ7A 1NXMA 5LASA 1W6PB 3WDTA 3UL2A 5DUUA 5T5OA 2VL4A 1P8JA 4XUNA 5DZEA 4A42A 2ZHMA 2WS92 4Q4W2 4E4ZA 1G9AA 1RUG3 3LB9A 1X9TA 5IVJA 2HWE3 4Y5Z0 3UT0A 1SFYA 3CBNA 2D6PA 5FK8A 1W6OA 3JBG1 3T1MA 2UYAA 5FZ4A 3ZPYA 4NAOA 1ZRFA 2YU2A 4MXWA 2RG4A 4HBNA 4NWWA 3SXWA 2IWGB 3PVNA 1UYYA 4HK8A 3B02A 3WINE 4EYUA 4YZ5A 3A23A 5LRSA 3APBA 3FHIB 3WP3A 4BWOA 1TMF1 3LE0A 3AP4A 4FOYA 4IEUA 1HJGA 4UOJA 3BTZA 3BI3A 4QD2A 4RQPA 5C3RA 1W90A 1XNKA 2BUKA 2GMPA 1ND3A 2PHTA 2QBXA 3IPVB 4AVVA 4ONUA 2Z2SB 1W8TA 4CCNA 4IV1B 2YB7A 2VZ1A 5FJKA 3TWIA 3MFAA 4N7IA 3K46A 1YHFA 4RGGA 1O3RA 4FTEA 4PI0A 1PX3A 1IQAA 4XXPA 3J7LA 4XHXA 5FZIA 4KU8A 4QQ2A 1S0CA 3IM0A 2Y0IA 2ZGRA 2A75A 2ZJCA 1B35B 4LK7A 4RFRB 2ZAHA 5FMOS 1YO8A 3HNYM 5A1AA 1R1ZA 3K75B 1S0GA 4D94A 1IPJA 2VUCA 2WFPA 2IXHA 4D7YA 5LWBA 2JDYA 2VU9A 4QM8A 2ZGUA 2MEV2 4BISA 1XNAA 3V64A 3ZXAC 4HVRA 1CQ9A 4HN0A 1SPPB 3CQOA 4B1LA 2J1VA 3POWA 4V2VA 2J1SA 4YLZA 1RJ7A 2GMEA 4BPZA 3KQRA 1M4WA 2OPKA 1Q8OA 2OZ6A 3RJRA 4CPBA 2OPWA 3SEPA 4Q4X3 4JKMA 4P9LA 5LW9A 2AEZA 4XQ4A 4UBHA 4JRAA 4RQPB 1GZWB 5A6YA 1PO21 4XJZA 3KLSA 3L2HA 4FFHA 1W0OA 5FOBB 5IVYA 3BIEA 5A32A 1K5MB 2XWJB 4XJWA 2VUAA 1FMD1 3POSA 4M4RA 4NIAA 1MPXA 1QNYA 2QQUA 1R1A3 2JE7A 4ZS2A 4B29A 1N1SA 1LKNA 3W5NA 4PIXA 5C3SA 3POJA 2CGNA 1VBB3 3HIFA 4K1ZA 5IK7A 1ZRRA 4PJYA 3FE5A 3MPPG 2DU0A 3U10A 4PIYA 4OZXA 4QXCA 4COZA 4N53A 1SLBA 4EZ4A 1LOAA 5KHJA 3G6JB 2CGOA 4MGSA 4A7ZA 2IVJA 4LNVA 3HN3A 1J1TA 3NNFA 1U12A 4CCJA 5C3QA 1BKZA 3DPRB 1B35C 5L36A 1CPMA 2RS52 3AKQA 3MF6A 1H8TC 2VAUA 1EUUA 4J1WA 2B8MA 1CN1A 5C9AB 3ZYRA 1ND3C 5JOWA 3NNJA 5CG8A 4QX5A 1KJRA 3BN6A 3LSDA 4UFHA 5JUVA 1TNRA 3UKNA 3IAQA 3K4ZA 3PU8A 3BALA 4CZSA 1U5IA 4TLFA 4LBLA 1RUF2 1C8NA 1E5SA 1AYN3 4IGPA 2FZ2A 4W4ZA 5F5IA 3BOPA 3HWJA 1PMHX 4GMP3 1WW6A 4BXFA 4R4XA 3NL1A 2WKKA 2BW8A 1TNFA 3LOIA 1CZSA 1GNHA 1I1EA 1ZRDA 3LA3A 4IV1C 1VBA1 3I3EA 5EP9A 1UN1A 4EV0A 3I2GA 2P3YA 3MV01 3BU0A 4GWIA 3ZO0B 3ZVXA 3B01A 4GA9A 2DVFA 5K7PA 4DNYA 1DZTA 2YV8A 4CUAA 3PJYA 1X82A 1UOJA 4K9SA 4XW3A 5FYCA 2VQ0A 4Q1RA 1OPMA 2WWJA 1RYYA 2J1UA 4GWMA 1PVXA 2W68A 3EB7A 4YM0A 4LOSA 1JZ3A 3O1OA 1GSLA 2A73B 2VTFA 1WCUA 1ZX5A 1BK0A 4CDQB 3N9NA 3T1LA 4CDXB 4CU8A 4H3WA 1RUD2 1EPWA 3OGGA 5D1IA 1NLRA 3LPFA 4LULA 3AMPA 4KG8A 4ASKA 3ZXJA 4L8QA 1FOD1 3IWZA 2VW2A 1QJU3 2P3KA 2YC4A 4MGKE 4XTPA 4IESA 3VKFC 4DRRA 1ZM1A 2VCMA 5LA0A 2GP5A 1UO9A 3OYWA 1D0HA 3MEPA 4YW6A 5LEKA 2HKXA 4TLGA 5D8AA 5A3TA 2W39A 4F83A 2GZWA 5FKBA 3ZN6A 4MGIE 4LKDA 4A44A 5BY5A 2BVVA 2QQOA 2BZDA 1YI9A 1HXS3 3WW2A 3ZFFA 5F7UA 1O3QA 1O3TA 3OJBA 1GP5A 4FFGA 1ASJ1 1WLTA 2JG8C 4ZZ5A 3BTYA 1ENSA 5IJRA 3ZFFB 1H4HA 3ES1A 4YRDA 4EN0A
chains in the Genus database with same CATH topology
3PDQA 5IWFA 3OPWA 4CCLA 5FWJA 5FYBA 5FZ9A 5FZGA 5FZBA 5FV3A 2OQ7A 5FYZA 5FP9A 5LW9A 5A80A 4D6RA 4LIVA 4V2WA 3N9PA 5FPLA 4EZHA 4IGQA 5FBJA 5FZ7A 3LDBA 3AVRA 4Y4RA 2XXZA 5FP3A 4BU2A 4E4HA 5IVYA 5FZEA 4NUBA 5FJHA 5FUNA 5A7NA 3UYJA 2W2IA 5FPVA 5FY0A 5A7QA 5FZKA 4QXHA 5FP4A 5A1LA 5A1FA 5FY9A 5F3GA 5A7PA 5LY1A 3N9QA 4LIUA 5FZ0A 2YBPA 5A3PA 4URAA 3U4SA 5A7SA 4C8DA 4QXCA 3DXTA 2VD7A 3N9OA 4EZ4A 4HONA 5FZMA 4CCJA 3PURA 5FZCA 3ZLIA 2Q8CA 5F3CA 5FZ1A 2WWUA 3PUAA 2Q8EA 2OS2A 3N9LA 3AL6A 2XDVA 3PUQA 5FY1A 5FPUA 5FYVA 3OPTA 5FZ8A 3PU8A 5F3IA 4XDOA 3PTRB 5A7WA 5F32A 4QXBA 4IGPA 2OX0A 4QU1A 5F5AA 5F37A 5F5IA 4BXFA 5IVJA 5FYTA 5FXXA 4GJYA 5FP7A 5FPBA 3KV4A 5IVFA 3N9MA 4QX8A 3AL5A 2YU1A 5FZ4A 5FPAA 5FXZA 5A7OA 5FYSA 4UF0A 3NJYA 2YU2A 3K3OA 3KVBA 5FWEA 4QWNA 5IVCA 5F2WA 5A7WB 3ZPOA 4EYUA 5FZ3A 3RVHA 4GAZA 5FUPA 5FZOA 3LD8A 4AAPA 5FYCA 4D6QA 2WWJA 2XMLA 4Y33A 2OT7A 5LY2A 2YBSA 3AVSA 5FZOB 3K3NA 5FZDA 2P5BA 5FYUA 3PUSA 5FZFA 4AI9A 5FYHA 5CEHA 3DXUA 3PU3A 4CCNA 1VRBA 4LXLA 5F3EA 4LITA 3N9NA 5IVBA 2Q8DA 5FJKA 4IGOA 4UF0B 5FZLA 4HOOA 5FY5A 4CCMA 5F2SA 4GD4A 5IVVA 3K2OA 3KVAA 4ASKA 4TN7A 5F5CA 5F39A 5ANQA 5FXVA 5FZIA 2GP3A 2OQ6A 3KV5A 3KV9A 3KV6A 5FXWA 5IW0A 3U78A 5FY4A 2PXJA 2GP5A 5FYYA 5ISLA 4CSWA 5FZAA 4DIQA 4Y3OA 2YBKA 4QX7A 4CCOA 5A3TA 4GJZA 5KR7A 5A3NA 4DO0A 5LWBA 5A3WA 4D6SA 4CUGA 5E6HA 4BISA 2XUEA 5FYIA 5FP8A 5FZHA 5FY8A 5FYMA 5K4LA 4XDPA 2YPDA 5FZ6A 5FY7A 4CCKA 5IVEA 4V2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PDQ A;  5IWF A;  3OPW A;  4CCL A;  5FWJ A;  5FYB A;  5FZ9 A;  5FZG A;  5FZB A;  5FV3 A;  2OQ7 A;  5FYZ A;  5FP9 A;  5LW9 A;  5A80 A;  4D6R A;  4LIV A;  4V2W A;  3N9P A;  5FPL A;  4EZH A;  4IGQ A;  5FBJ A;  5FZ7 A;  3LDB A;  3AVR A;  4Y4R A;  2XXZ A;  5FP3 A;  4BU2 A;  4E4H A;  5IVY A;  5FZE A;  4NUB A;  5FJH A;  5FUN A;  5A7N A;  3UYJ A;  2W2I A;  5FPV A;  5FY0 A;  5A7Q A;  5FZK A;  4QXH A;  5FP4 A;  5A1L A;  5A1F A;  5FY9 A;  5F3G A;  5A7P A;  5LY1 A;  3N9Q A;  4LIU A;  5FZ0 A;  2YBP A;  5A3P A;  4URA A;  3U4S A;  5A7S A;  4C8D A;  4QXC A;  3DXT A;  2VD7 A;  3N9O A;  4EZ4 A;  4HON A;  5FZM A;  4CCJ A;  3PUR A;  5FZC A;  3ZLI A;  2Q8C A;  5F3C A;  5FZ1 A;  2WWU A;  3PUA A;  2Q8E A;  2OS2 A;  3N9L A;  3AL6 A;  2XDV A;  3PUQ A;  5FY1 A;  5FPU A;  5FYV A;  3OPT A;  5FZ8 A;  3PU8 A;  5F3I A;  4XDO A;  3PTR B;  5A7W A;  5F32 A;  4QXB A;  4IGP A;  2OX0 A;  4QU1 A;  5F5A A;  5F37 A;  5F5I A;  4BXF A;  5IVJ A;  5FYT A;  5FXX A;  4GJY A;  5FP7 A;  5FPB A;  3KV4 A;  5IVF A;  3N9M A;  4QX8 A;  3AL5 A;  2YU1 A;  5FZ4 A;  5FPA A;  5FXZ A;  5A7O A;  5FYS A;  4UF0 A;  3NJY A;  2YU2 A;  3K3O A;  3KVB A;  5FWE A;  4QWN A;  5IVC A;  5F2W A;  5A7W B;  3ZPO A;  4EYU A;  5FZ3 A;  3RVH A;  4GAZ A;  5FUP A;  5FZO A;  3LD8 A;  4AAP A;  5FYC A;  4D6Q A;  2WWJ A;  2XML A;  4Y33 A;  2OT7 A;  5LY2 A;  2YBS A;  3AVS A;  5FZO B;  3K3N A;  5FZD A;  2P5B A;  5FYU A;  3PUS A;  5FZF A;  4AI9 A;  5FYH A;  5CEH A;  3DXU A;  3PU3 A;  4CCN A;  1VRB A;  4LXL A;  5F3E A;  4LIT A;  3N9N A;  5IVB A;  2Q8D A;  5FJK A;  4IGO A;  4UF0 B;  5FZL A;  4HOO A;  5FY5 A;  4CCM A;  5F2S A;  4GD4 A;  5IVV A;  3K2O A;  3KVA A;  4ASK A;  4TN7 A;  5F5C A;  5F39 A;  5ANQ A;  5FXV A;  5FZI A;  2GP3 A;  2OQ6 A;  3KV5 A;  3KV9 A;  3KV6 A;  5FXW A;  5IW0 A;  3U78 A;  5FY4 A;  2PXJ A;  2GP5 A;  5FYY A;  5ISL A;  4CSW A;  5FZA A;  4DIQ A;  4Y3O A;  2YBK A;  4QX7 A;  4CCO A;  5A3T A;  4GJZ A;  5KR7 A;  5A3N A;  4DO0 A;  5LWB A;  5A3W A;  4D6S A;  4CUG A;  5E6H A;  4BIS A;  2XUE A;  5FYI A;  5FP8 A;  5FZH A;  5FY8 A;  5FYM A;  5K4L A;  4XDP A;  2YPD A;  5FZ6 A;  5FY7 A;  4CCK A;  5IVE A;  4V2V A; 
#chains in the Genus database with same CATH topology
 1B35 A;  1XND A;  2PLV 2;  4C1W A;  1N47 A;  3OEB A;  4HPK A;  1DU3 D;  4Z92 B;  1NA1 C;  3AKT A;  5C33 A;  4NE9 A;  4AHW A;  2VCC A;  1K12 A;  4WV8 A;  4CP9 A;  1MS3 A;  2PHF A;  1OQE A;  3H3Z A;  3RJ2 X;  1ZBA 1;  3AVR A;  1POV 3;  5JI9 A;  4UFL A;  3VBF C;  1FPN 3;  1MEC 3;  1X9P A;  3ZMN A;  1KD7 A;  4GUL A;  5C4W A;  3KCY A;  1RUG 2;  2BYV E;  1VBE 3;  4M00 A;  1K5J A;  3WNL A;  3POB A;  4CDX A;  2YHJ A;  3RNS A;  3KT7 A;  5IAT A;  1BBT 1;  2WNV A;  4QHZ A;  1F4H A;  2V4V A;  2ZKN A;  3CKH A;  5F3G A;  4AGV A;  4BQY A;  5DMY A;  3LEK A;  5LY1 A;  5JXH A;  4P9X A;  4ZU4 A;  2BU9 A;  4CA9 A;  4WZC A;  1HRI 2;  4BMB A;  2CYF A;  2HLE A;  3ACG A;  1LGN A;  4YGB A;  4LBN A;  4KG0 A;  4O65 A;  1PNG A;  5A32 B;  1KDK A;  1JXN A;  1JTZ X;  5TSW A;  2IFW A;  4YVS A;  3X29 B;  1G9D A;  4L92 A;  4B4R A;  2JJ6 A;  5A3M A;  5FAX A;  5F8P A;  3I8T A;  4ASM B;  2DFC A;  1W2O A;  3MI8 A;  4CEW A;  2DUQ A;  2EIG A;  2VZS A;  2E7T A;  3GYD A;  2YFU A;  4Q4X 2;  2VMD A;  4UFK A;  5FZ8 A;  4K8F A;  3LAG A;  5F3I A;  3ZN4 A;  4YW7 A;  3VDD B;  2A6Y A;  4Z1V A;  3KCC A;  3TEZ A;  4IL7 A;  4UFM A;  3WXP A;  2V09 A;  5AC9 2;  1CGP A;  2E31 A;  3UKV A;  4BLJ A;  3VHP A;  1PO1 1;  3J8F 1;  1UXZ A;  1S2E A;  2I07 B;  2DVA A;  3WW3 A;  1ZZ7 A;  2CV6 A;  2HWF 3;  1E57 A;  1TEI A;  3ENR A;  3OG2 A;  5DXD A;  3WDU A;  5C9A A;  4FOW A;  2WII B;  1GU3 A;  1VJ2 A;  3EBR A;  4XJ8 A;  5FO9 B;  3DKQ A;  4DOU A;  1QKQ A;  3CIH A;  5C8C C;  1UOG A;  5IVC A;  2WO3 A;  3IDA A;  4LQR A;  1V6N A;  4R9D A;  4XFH A;  3EHK A;  5JOY A;  3VGI A;  1QJX 2;  2HYX A;  2PYT A;  2RV9 A;  3K48 A;  5SV5 A;  4Y22 B;  4XQW A;  1VLN A;  2G4I A;  4AAP A;  1H9W A;  3CJI C;  2OT7 A;  5C6C A;  3NJX A;  1Q3E A;  3A7Q A;  3JB4 C;  4IXL A;  4R8H A;  4FAH A;  3FFQ A;  2WA4 A;  3G7D A;  1PVC 1;  1SQ4 A;  4JX0 A;  3FX3 A;  2HBU A;  3DXU A;  1JU3 A;  4PDW A;  5D21 A;  4EE2 A;  4UW5 A;  3MLJ A;  1NA1 A;  1R1A 1;  2QQW A;  1NOV A;  3ON7 A;  4BK5 A;  1V9U 3;  2ZGM A;  2D3P A;  3K2O A;  1NCR A;  3OUH A;  3D82 A;  4E27 A;  1UZ0 A;  4L2N A;  2WNU A;  1RTV A;  2FMD A;  4XUT A;  4MHU A;  2ARB A;  2H6C A;  5HCA A;  2ZHK A;  3DL3 A;  5LZ6 A;  4QHO A;  2DV9 A;  2WZP P;  1PM4 A;  2QQJ A;  5SV8 A;  1DGW X;  2C1F A;  2ORZ A;  2CNA A;  1WA6 X;  3AYC A;  1VRH 3;  3SCG A;  4AVA A;  1CX4 A;  1UD1 A;  5CFD A;  4CUG A;  4GWJ A;  5E6H A;  4BA6 A;  4CCC A;  1TMF 3;  3MIH A;  3S6P A;  4DEV A;  3AJZ A;  4LLF A;  4WVW A;  2ZHL A;  3WQB A;  2VMG A;  4CE8 A;  3WNM A;  4RHV 3;  5FYB A;  5FZ9 A;  1NE4 A;  1MS5 A;  1CD3 G;  1GQP A;  1RVF 1;  2X29 A;  3A21 A;  3I54 A;  1TVG A;  4NPL A;  4UYB A;  5D8A B;  4Y22 A;  5KWR A;  3CMG A;  3ES4 A;  5BUV A;  5BNO A;  2WC2 A;  1DG6 A;  1H2K A;  3B5L B;  1FAT A;  4IGQ A;  3LDB A;  4IER A;  1SZB A;  4Q1P A;  3DV8 A;  2R0H A;  2VTX A;  2VCA A;  5FUN A;  3UGH A;  3WW1 A;  4OHW A;  3WDX A;  5K9Y A;  2QUO A;  3AP9 A;  4LMF A;  4DUX A;  4KGG A;  1HRV 1;  2NPI A;  1G9B A;  4IE4 A;  5J36 A;  4MGT A;  1KXG A;  1LR5 A;  4CEY A;  2Y38 A;  4OFG A;  4Q4X 1;  1NCQ A;  3HJR A;  3MBW A;  3NMB A;  4M4P A;  1V6I A;  2JDN A;  5C8C A;  3DXT A;  2VD7 A;  2VMH A;  2P37 A;  2WFF 3;  4IEQ A;  2SLI A;  3N7M A;  2Q8C A;  1OQD A;  4HLT A;  1AL2 3;  1QJF A;  4FPJ A;  3CJI A;  4JKL A;  4QAW A;  4RR3 B;  4BQW A;  1UMZ A;  2AR6 A;  3OGR A;  3FUQ A;  5K0U C;  3WEZ A;  5FKC A;  1Q8P A;  1R08 3;  2ZOE B;  5C71 A;  4PDW C;  3AFK A;  4G9S B;  2EXI A;  3MGU A;  2UY8 A;  3EO6 A;  3FHA A;  4DXR A;  1DBN A;  4RR3 C;  3OCP A;  3FJS A;  1J3R A;  2O8Q A;  3SHR A;  5LAT A;  4C1X A;  1HXS 1;  1SMV A;  2BGP A;  1PK6 A;  4FQZ A;  3FBM A;  3EMR A;  3VDA A;  1DQ0 A;  5FQ0 A;  5KC6 A;  4FPF A;  4XCA A;  1JZ5 A;  4IEO A;  1OXC A;  2ZMK A;  2JKB A;  1PK6 B;  1EY2 A;  2FDJ A;  5E16 A;  5ACA 1;  1DHK B;  1HRI 1;  2LAL A;  1GNY A;  3NQH A;  4FPO B;  5FRE A;  5K8S A;  1XYN A;  5GLW A;  4O9E A;  5EJZ B;  1UPS A;  3ACI A;  3MUZ 1;  1VRH 2;  2DUO A;  5C5T A;  1STM A;  3LGR A;  4P00 B;  4AFD A;  4CDU B;  1YWK A;  1UL9 A;  4DS0 A;  1LNS A;  4PLM A;  3OF1 A;  4M3C F;  4E4S A;  4EN7 B;  2UWB A;  4RSU A;  3CO2 A;  5JSO A;  1YC6 1;  3GZE A;  1FMD 3;  4D8M A;  5FZL A;  2BER A;  2JE8 A;  1H6Y A;  1H0B A;  3HT1 A;  2VOK A;  1NX9 A;  1G86 A;  1RMU 3;  1OOP A;  4AHY A;  4W6X A;  1IPS A;  3OD4 A;  4CSW A;  4HK9 A;  2Y6J A;  3AP5 A;  2QVS B;  4I3G A;  4HVQ A;  4Q0P A;  4U36 A;  2A6Z A;  4L99 A;  1JYI A;  1OHF A;  5FUI A;  2D5F A;  4S2G A;  3ZR6 A;  3RZM A;  1GZW A;  1H2N A;  2ZEY A;  1EPZ A;  1U5X A;  3NO8 A;  2R0F A;  1UU6 A;  1UWW A;  4IEX A;  4NR1 A;  4PIZ A;  5FY8 A;  3S30 A;  3WCS A;  4BH9 A;  4EWA A;  1IOA A;  5BNN C;  3N36 A;  5HCH A;  2BGO A;  3AJY A;  1MS4 A;  5IUQ A;  2YG0 A;  1S0B A;  4XE9 A;  4ZU7 A;  2PHD A;  3AC0 A;  1UOF A;  5EV7 A;  1RUE 3;  4CUB A;  5HV4 A;  2GH2 A;  3H42 B;  3AP7 A;  1HN0 A;  5FYZ A;  5IFP A;  2R06 1;  1QJU 2;  2DBN A;  3ATG A;  4BOW A;  4FPY A;  1FV2 A;  1ULD A;  1YFU A;  3N4M A;  1RUD 1;  2EXJ A;  4LBM A;  5FBJ A;  1A34 A;  1OC1 A;  3SQO A;  4AI8 A;  1AYN 2;  1VPH A;  2YC0 A;  2X5I A;  2ID4 A;  3IIA A;  3QOP A;  4JHT A;  4RR3 A;  4LKE A;  4AEJ A;  5HCB A;  4GQ7 A;  4WM8 B;  2GNB A;  1A78 A;  1H2L A;  2NQY A;  4XQD A;  1AX1 A;  5BPX A;  4XHB A;  1WA4 A;  3WVJ A;  1W8F A;  2PLV 3;  1AUY A;  1UY1 A;  1X33 A;  4AK3 A;  2YXS A;  4HON A;  4BB3 A;  1UPI A;  2VBB A;  2ET1 A;  4DXZ A;  3OUI A;  3GXU A;  1CES A;  3SIT A;  4AHX A;  1UX6 A;  3WG2 A;  3FLP A;  4Q2F A;  4CCD A;  4JTN A;  1Q56 A;  4Q4Y 3;  3WR0 A;  1ENX A;  4LBO A;  3TAY A;  4BE3 A;  1HB4 A;  4E2S A;  1CAW B;  1V6L A;  5DN2 A;  3BIW E;  3ZFE A;  2JDU A;  3ALQ A;  4ZU5 A;  5G04 L;  1BZW A;  3BKZ A;  1PGW 1;  1HDK A;  2VME A;  4HVO A;  2VO5 A;  2W1Q A;  1E5H A;  2WO1 A;  1MEC 1;  1WCD J;  1RIR A;  3N7J A;  4GJY A;  3T4H B;  1LGB A;  1ASJ 2;  1AYN 1;  2YU1 A;  1K45 A;  4H2A A;  1NLQ A;  4NRP A;  1WCK A;  2ZHN A;  4QWN A;  3VBR B;  1X8M A;  1TME 3;  2J1R A;  1H1I A;  4QT6 A;  2Y64 A;  1V70 A;  1RC6 A;  2X09 A;  3LD8 A;  4Y26 A;  2BBV A;  1R64 A;  2RMU 2;  5FLI A;  2UY9 A;  4OHY A;  4DFS A;  5LY2 A;  1Z78 A;  4YFZ A;  2Q1Z B;  4IV1 A;  4CUC A;  5FZO B;  4AI2 A;  1DQ1 A;  1AR6 1;  4JKK A;  3OUJ A;  5FYU A;  5HPO A;  4XF0 A;  1UY3 A;  4PBP A;  1GZC A;  1O6U A;  1S0J A;  5FMB A;  5JXI A;  3M2M A;  5CU1 A;  5GZD A;  4MVT A;  1UIJ A;  4YSF A;  2DUR A;  4OUL A;  3HR9 A;  4LHK A;  2XVL A;  2ZEZ A;  2XPJ A;  3K4D A;  3LZZ A;  4YZ3 A;  1IPK A;  4GXL A;  4Y1Y A;  2Z69 A;  4WVM A;  5BNP B;  3WHT A;  2XB6 C;  3KV5 A;  2GC3 A;  3V65 A;  3U78 A;  3FLT A;  1X8E A;  5LBE A;  2DDU A;  3AXE A;  3V0B A;  1QJY 1;  2XJS A;  3CHX A;  4LLO A;  3VKL A;  3VL8 A;  1OLQ A;  3J7H A;  5BXX A;  2V5Y A;  1T2X A;  1W2N A;  3AYD A;  4LE4 A;  1Y9G A;  1V00 A;  4RYD A;  3U37 A;  4AVS A;  4Q4W 3;  4CXY A;  5LBC A;  4D6S A;  4BXS V;  1OBN A;  5FZH A;  4A45 A;  3UET A;  3KT4 A;  5DZG A;  3H7Y A;  1OKO A;  1W6O B;  3ILR A;  4XBL A;  2K9Z A;  4LOR A;  2Y33 A;  2NM1 A;  5FY7 A;  2A5Z A;  3HVD A;  4JDM A;  3PDQ A;  1AVB A;  4DPN A;  1SLI A;  1V0A A;  4LKF A;  2GMM A;  1EAH 1;  1J3Q A;  5D8A C;  5AFE A;  1W6Q A;  2JDM A;  1ACC A;  2OQ7 A;  3V0A B;  1JZ2 A;  1AR7 1;  5GM0 A;  3RMY A;  2JX9 A;  1HN1 A;  3T0D A;  1JBC A;  2JD4 A;  5EPA A;  3ZXG A;  2HWC 1;  3I97 A;  5CNA A;  1JU4 A;  1RUC 1;  1QMJ A;  2BNO A;  3J8F 3;  4O61 A;  5IK8 A;  1H9P A;  1HRV 2;  1U5Z A;  4ZY9 A;  3VDC A;  4NUB A;  1K3I A;  4PBO A;  3FLR A;  4QQH A;  3T2O A;  4AW7 A;  4YPJ A;  1GWM A;  1LEM A;  1LOC A;  2GND A;  3FUO A;  4YVW C;  4A2U A;  4ARY A;  1LJ7 A;  2ZX1 A;  3T2T A;  4FPK A;  3U14 A;  3OTF A;  3MHZ A;  5FMC A;  4W6Y A;  4HFS A;  1OLM E;  4LIU A;  3ETP A;  2ZX2 A;  3E5U A;  1Z7S 2;  5FZ0 A;  3CU7 A;  5JPN B;  2R07 3;  3DUI A;  5JOX A;  1YQ2 A;  4XZP A;  1PO2 3;  2LS6 A;  1BHG A;  3NRU A;  4D7T A;  2FCV A;  2BFU L;  1TE1 B;  2XHK A;  5I0S A;  2FDK A;  2VOX A;  5C4W C;  1A8D A;  2GU9 A;  4OYU A;  5CZK A;  5GKA C;  2X5I B;  3MFC A;  1UX7 A;  3HN1 A;  2C0Z A;  1OLR A;  3H3L A;  5CYY A;  4NPR A;  4XFC A;  2I45 A;  3JB8 A;  2B7Y A;  2RM2 1;  1VBA 3;  2PHX A;  2XDV A;  1RVF 2;  3C7F A;  3N9L A;  1CJP A;  1OKQ A;  2F4P A;  1S2B A;  3Q9O A;  4ZPI A;  3WNP A;  4Z2A A;  3VDB A;  2Q0A A;  4I30 A;  2BBA A;  3PTR B;  3M3O A;  1Q43 A;  4IEZ A;  4NIG A;  1WUV A;  5H9R A;  1EAH 2;  5E88 A;  4EWD A;  2B39 A;  4QKD A;  5F5A A;  3POE A;  2D6N A;  2NLR A;  1IQD C;  4RGK A;  1HQN A;  4SBV A;  5IHR A;  1TQ5 A;  1H2M A;  5GLV A;  1W6M B;  2ET7 A;  1QH6 A;  3AKS A;  4ATF A;  5JLV A;  5FPB A;  2A7A A;  2YMZ A;  4K6B A;  4MGY E;  1S2K A;  2DTW A;  4NN0 A;  4O7X A;  3RYK A;  2W9X A;  3EXU A;  1RUG 1;  4XBN A;  5EQU A;  4HAN A;  1LAJ A;  3W21 A;  3LDK A;  1US2 A;  1MQT A;  1DQ6 A;  2W47 A;  3R4U A;  3GBG A;  4HPK B;  4FTS A;  4H7M A;  4QPG A;  4FTB A;  5JMO A;  1DYK A;  1DGR A;  4LUK A;  3III A;  2LW8 A;  5LA9 A;  4QX1 A;  4JGY A;  2KR2 A;  1V9U 1;  1Y9M A;  1H6X A;  2VMF A;  5FZF A;  3RGB A;  1KFU L;  1ZZ8 A;  2NP0 A;  2JEN A;  4L97 A;  4AG4 A;  4D3W A;  5C4W B;  1DF0 A;  2E7A A;  1CON A;  2IFR A;  1VBE 1;  1VBD 1;  2P6C A;  4LHN A;  1EV1 2;  4R9A A;  5L73 A;  2BQP A;  3ZSJ A;  1SLA A;  1OA3 A;  4KWU A;  2Y60 A;  3ZKU A;  4C0B A;  5L9B A;  3DEM A;  5FPX A;  2C4X A;  3ABZ A;  1SLC A;  3IDE A;  4D69 A;  3NST A;  3POY A;  1O5U A;  4N43 C;  2RJL A;  3DYP A;  4CDW A;  3KV9 A;  2B42 B;  4LA3 A;  4YYO A;  4KI5 M;  4UW6 A;  1J1L A;  1QOS A;  1MVQ A;  2J7M A;  2VZU A;  1UMH A;  3HMY A;  1VBC 2;  4Y3O A;  4QX7 A;  3NV3 A;  3Q8C A;  5A6X A;  3WQ1 A;  2PA7 A;  1R1A 2;  1ULP A;  1PO1 2;  5FRA A;  4AAX A;  2XKO A;  4LA2 A;  1ODN A;  2W3J A;  1QY4 A;  1O5L A;  4CXW A;  3ZN6 B;  1O8P A;  4Q4Y 1;  4HG6 B;  2XBO 1;  4XUR A;  1X36 A;  5FZ6 A;  3SH4 A;  2W92 A;  1VRH 1;  4WVM B;  4BQ5 A;  2ZZJ A;  3ZR5 A;  1JUH A;  1H1A A;  5DUW A;  3VBS C;  1QJX 1;  2VQT A;  2PAE A;  4NOT A;  1WCQ A;  1R08 2;  2ZGT A;  4YG0 A;  3VD9 A;  4V2W A;  3S0M A;  5FPL A;  3ELN A;  2R32 A;  4X6Q B;  2CDP A;  3AFG A;  4W8J A;  2UWA A;  2QZ3 A;  4FAG A;  5C8W A;  1O4Z A;  2Y8K A;  5CIS A;  2OW4 A;  4I3P A;  1GAN A;  3OD0 A;  4Q4Y 2;  5JR2 A;  2J42 A;  2WNV B;  3RZL A;  4XVH A;  2XG3 A;  3PHM A;  2YUE A;  5EYX A;  1WGP A;  1E5I A;  1MZ6 A;  2GN7 A;  2B46 X;  2WAB A;  3SKJ E;  4MG2 A;  2VBP A;  4COV A;  2RS1 2;  3LEG A;  4XCB A;  1DGW A;  5I8Y A;  4DMI A;  5LA2 A;  2VZV A;  4GWN A;  3MDP A;  4Q0S A;  3D3A A;  1OA4 A;  3N9O A;  2W1S A;  4YVS B;  5EJ1 B;  5M0T A;  1OVP A;  3TYJ A;  1MS1 A;  4LK6 A;  1COV 1;  1YXW A;  3ZLI A;  1AHS A;  4QPG C;  2WYS A;  4HT1 T;  5JSR A;  2UUR A;  4OHZ A;  2Q8E A;  2WO2 A;  2HWF 1;  3NNM A;  5DZF A;  5FPU A;  3ZYB A;  4HN1 A;  1XU2 A;  1VE0 A;  3CNA A;  4F8A A;  3HQU A;  2WDB A;  5JMC A;  3HBK A;  4V1P A;  1AYM 3;  1C28 A;  2R04 3;  4P5H A;  1B09 A;  4HXC A;  4CEW B;  1PZ9 A;  4QPI C;  2BP6 A;  2D98 A;  4MYE A;  2N7G A;  4QU1 A;  2XKP A;  3PLQ A;  4JQT A;  2JB8 A;  2VE1 A;  2XJT A;  1G8W A;  3B3Q E;  4PLN A;  1D4M 1;  1FOD 2;  3GNE A;  1Q8V A;  2MEV 1;  4N43 A;  1EYB A;  3POG A;  4CDU A;  2RJK A;  1QF3 A;  4J6G A;  3KSC A;  3OGJ A;  2MNG A;  1UYP A;  2Z79 A;  4H55 A;  3D0S A;  5IK4 A;  5FXZ A;  3RZK A;  1CAV B;  3FMG A;  4N7U A;  1JOP A;  2XQX A;  4QHB A;  4P9I A;  1Z7S 1;  2D7F A;  3NJY A;  3K3O A;  5JWP A;  4E8D A;  1XSQ A;  1VMF A;  3KGL A;  4DRV A;  2B9U A;  3LIH A;  2BNN A;  5DUX A;  3P3P A;  1UZZ A;  1JOD A;  1VR3 A;  1LEC A;  4QKN A;  4TYS A;  5DAP A;  3FZ3 A;  1MS8 A;  3RSJ A;  2YBS A;  4KGQ A;  3ZSE A;  1L7L A;  3VZJ A;  3K3N A;  2VVF A;  5B4N A;  3AP6 A;  3OBT A;  1RL3 A;  5F6L B;  5JXG A;  1QNW A;  1BVV A;  2D6K A;  4NJ4 A;  4WVZ A;  1RXG A;  2VC9 A;  2FDI A;  4UF0 B;  1RB8 G;  3E5X A;  4XBQ A;  4GD4 A;  1MQT B;  3J7N A;  4UW3 A;  1DQ2 A;  1GLH A;  2A3X A;  4CVU A;  1ENQ A;  2VY0 A;  1I6X A;  5IW0 A;  2ERF A;  2Q1F A;  3MIB A;  2J22 A;  4NRO A;  1ULE A;  3ZSK A;  2D93 A;  2AEY A;  1KRI A;  1W3X A;  4J1X A;  1UF2 C;  1WZX A;  2E63 A;  2WQ8 A;  5KR7 A;  2VMC A;  2A6V A;  4AWD A;  2IUW A;  3D5O A;  2F6B A;  4ITC A;  1ZRC A;  5GZG A;  5D2A A;  1W8Z A;  3WNN A;  3I49 A;  2WRA A;  3GCW A;  2QQM A;  1OOP C;  3MZH A;  2X10 A;  1COV 2;  3VL9 A;  1QDC A;  3KS7 A;  3AKP A;  1W6N B;  4YW4 A;  3OPW A;  3ZMO A;  3ZKY A;  1RUC 2;  1C1F A;  1C8M 3;  5BNO B;  3DCQ A;  3VZN A;  4FO9 A;  3VD7 A;  2X53 S;  1DIW A;  1PX4 A;  3AZW A;  4KQ7 A;  3Q8A A;  4LE3 A;  2JXA A;  4OZO A;  3OBZ A;  3HNM A;  4P9Y A;  1C5I A;  3VBH A;  3THP A;  2P3J A;  1GYK A;  5FFO C;  2B5H A;  2VNG A;  5CFD B;  3SMH A;  2JG9 C;  3B9C A;  4RL7 A;  1ZBE 1;  3TNQ A;  5ABJ B;  4BJ0 A;  3IKW A;  5T3N A;  3PIG A;  4CDU C;  3M3C A;  1LCL A;  2IZW A;  4F7Z A;  4AFC A;  5BV6 A;  2RS3 2;  2FBE A;  2CAV A;  1Q8S A;  2YBP A;  4PF1 A;  4C8D A;  2IVI B;  2OZJ A;  5LBB A;  1BLZ A;  2X5I C;  4ES8 A;  1N3Q A;  1IS6 A;  4QB2 A;  5EZW A;  2ENR A;  1QJZ A;  1GBG A;  4NHM A;  1ND2 B;  1N1T A;  3A22 A;  2RJ2 A;  5G05 L;  2OS2 A;  4A4A A;  2D43 A;  3JU9 A;  5KC5 A;  5FLH A;  1C57 A;  3S5A A;  2DWR A;  3I2D A;  3ZOI A;  2ARA A;  4WM8 A;  1VMH A;  3GZA A;  1GP4 A;  5DUV A;  4AGR A;  2AZ5 A;  3O14 A;  4XIL A;  4FI9 A;  2WWS A;  5LK7 B;  2R7E B;  3DYO A;  3RS6 A;  4NRQ A;  5JXJ A;  2HEW F;  2O1Q A;  2OX0 A;  3UES A;  2ZTN A;  5CA6 A;  4JGZ B;  1JN2 P;  4AZZ A;  5FYT A;  1SBD A;  3K4A A;  4DZG A;  1VAV A;  3PUH A;  4NID A;  4Y1X A;  1SEF A;  3VZL A;  1WMX A;  3TBD A;  3T30 A;  3AL5 A;  1UZW A;  2GC1 A;  2BWC A;  3IB3 A;  1XBF A;  4RS5 A;  5I8S A;  3I2O A;  1W8U A;  4KWJ A;  3SNM A;  3GGL A;  2PAM A;  3I59 A;  5A7W B;  3JXS A;  1C4R A;  3H0O A;  3HBZ A;  3SIS A;  5ABJ A;  4PQQ A;  1UYX A;  4CU9 A;  4JHZ A;  2XBO 2;  1JW6 A;  1PIV 3;  4YW3 A;  1QXR A;  3NKG A;  3W5M A;  4IEW A;  4COW A;  1QIQ A;  2RM2 3;  1IS5 A;  1BYH A;  1J58 A;  1HKD A;  1VBA 2;  4Q4V 2;  5DAV A;  5I91 A;  1XNC A;  2PMW B;  5IVB A;  1IG3 A;  1YQ8 A;  3P5B A;  2PQS A;  2R06 2;  3U1X A;  4BQX A;  3L9J T;  3UNP A;  1GWK A;  2QE3 A;  2GDF A;  2VOT A;  1D4V B;  1PGS A;  4CDX C;  1PVC 2;  3AZZ A;  2RVA A;  4KBB A;  5ANQ A;  5FXV A;  4ET7 A;  3GBW A;  1ND2 C;  3VBH C;  2VZQ A;  3D4K A;  3GHN A;  3OEA A;  3WUD A;  3GAL A;  1LOD A;  5T5J A;  1XPW A;  1RUE 1;  4YNI A;  5T52 A;  4XUO A;  3QLQ A;  4YW2 A;  3TOJ A;  1KGY A;  5L9V A;  4IEV A;  1POQ A;  2B9V A;  4BME A;  3MYX A;  2A6X A;  1C5H A;  2R07 2;  1QHD A;  4JGZ A;  1HRI 3;  3JZV A;  4K3U A;  1DYO A;  4YVS C;  1RUN A;  2GC2 A;  4RHV 1;  1POV 1;  3WF0 A;  4HET A;  3T09 A;  5H9P A;  3U0Z A;  2L9L A;  2YPD A;  1JYN A;  3E97 A;  4CCK A;  5CAD A;  4A6S A;  5KHG A;  3H1M A;  3K77 A;  1XE7 A;  4JQR A;  4BQ2 A;  2ZEX A;  1YUD A;  2YY1 A;  3LFM A;  1NQD A;  2CWS A;  5FCC A;  2RE9 A;  3H8X A;  4K21 A;  1CPN A;  1FT9 A;  5DG2 A;  1W9Y A;  4K1Y A;  4XTM A;  3WUC A;  4JDN A;  3H1Y A;  2DCZ A;  5CFC A;  4RA0 A;  1PNF A;  4BZ4 A;  2RDQ A;  1ASJ 3;  4RFT 0;  4BU2 A;  4Y4R A;  3QBQ A;  4XDQ A;  2QZ2 A;  5FZE A;  1DFQ A;  1ZVF A;  4O9G A;  2W2I A;  3J26 N;  3WV6 A;  2QKD A;  2NZ9 A;  1SPP A;  2ARC A;  2YFZ A;  4QXH A;  4IE6 A;  4B3N A;  1NXD 1;  5KXD A;  2E32 A;  1ZA7 A;  2JB4 A;  1OA2 A;  4CP0 A;  5A3P A;  2YRO A;  1ZBA 3;  3DKW A;  5A70 A;  1UQX A;  3NWK A;  3IMN A;  3I3Q A;  4X8N A;  4YZ4 A;  4Y20 A;  1DP0 A;  4IDZ A;  1PZ7 A;  3JQX A;  2XVG A;  2WIN B;  3KHC A;  2OXB A;  2ADD A;  3O12 A;  2WQ4 A;  5JPM B;  5ABJ C;  1BCX A;  1WW7 A;  3MW2 A;  1AX2 A;  4DXT A;  1GKB A;  4XAC A;  5I0D A;  1H1M A;  1BMV 1;  2D40 A;  1ONA A;  5DAB A;  4ZXE A;  4RHV 2;  4OHX A;  2P2K A;  2A70 A;  4RS5 B;  1TZO A;  4CEY B;  2XGX A;  3OPT A;  2WYF A;  4AFA A;  2A1X A;  1RUD 3;  4XAA A;  5E1R A;  5KXC A;  1NY7 1;  1K42 A;  1TME 1;  2P4E A;  4J25 A;  5I8T A;  2WT2 A;  3N7K A;  2W87 A;  3SC7 X;  2OYZ A;  2G9Z A;  1QWR A;  5T5P A;  1CX1 A;  1ND2 A;  2X05 A;  1J59 A;  4QM9 A;  2O14 A;  2QDN A;  5EXO A;  5CKQ A;  5BNQ A;  2WT1 A;  2VMI A;  5FWE A;  1XU1 A;  1OH3 A;  1HXS 2;  4E8C A;  3VUO A;  1BEV 3;  1W6Q B;  3GZU C;  2FQP A;  1JYV A;  1OOP B;  3N3H A;  3RG0 A;  1Z0H A;  5FZO A;  4GIQ A;  1XC6 A;  5A6Z A;  1A8M A;  4FCA A;  5GZE A;  5BNO C;  1VBB 2;  2AGS A;  4FP2 A;  1GZT A;  1QOO A;  4XF3 A;  2EA7 A;  2YPJ A;  3LIG A;  1TG7 A;  5CEH A;  1EP0 A;  4B4Q A;  1LOG A;  2VZT A;  1KS5 A;  3ME2 A;  4EWE A;  1F8V A;  1OQ1 A;  1I5Z A;  2OUH A;  1MQT C;  4LBK A;  5DPN A;  1WLD A;  3RDI A;  4HOO A;  2XVK A;  5GLZ A;  1W04 A;  2OA2 A;  3RZG A;  4TN7 A;  1W8N A;  2RS1 3;  3L2Y A;  3ZDV A;  1DGR N;  3KB5 A;  3OGS A;  1DLC A;  1F15 A;  1KS4 A;  4XFF A;  3UJQ A;  3WF1 A;  1LUL A;  4CEY C;  1JOB A;  3FN9 A;  1UY0 A;  2C26 A;  1VBB 1;  2HWE 1;  3C7G A;  1NY7 2;  2ZGQ A;  5FO7 B;  1WD3 A;  2PN5 A;  3H7J A;  3ZFG C;  4DIQ A;  1G6N A;  1ULC A;  5A33 B;  2V72 A;  1LOB A;  4OVE A;  4AR2 A;  4TZD A;  1NZC A;  3VKO A;  4AYU A;  1QJE A;  4K40 A;  5JDB A;  4XF9 A;  4PQ9 A;  1PHM A;  1W05 A;  5APA A;  1UY4 A;  4AGG A;  1QJX 3;  5K4L A;  1W3V A;  1FNY A;  2DVB A;  4URT A;  3VKN A;  1SCR A;  2Y6K A;  4FOV A;  3UGF A;  1GWL A;  1UIK A;  1QGL A;  4HSJ A;  4LO4 B;  5FWJ A;  2HWE 2;  1XOY A;  2A71 A;  1CVN A;  2Z42 A;  3UJO A;  4YM3 A;  3VV1 A;  4Q4W 1;  1NAE A;  3I2H A;  4GH4 A;  2KD7 A;  5F1R A;  1BEV 2;  3MIF A;  1DLL A;  3N9P A;  4XAE A;  3USU B;  1IS3 A;  1S4C A;  4P14 A;  3ST7 A;  4LPL A;  1W8H A;  3MW3 A;  4R52 A;  4GMP 1;  4QDS A;  3OOX A;  5A3O A;  2R49 A;  4XYX A;  4COY A;  2BDR A;  3RMX A;  1YNA A;  5A7Q A;  1DZR A;  4TXW A;  1K5M A;  5FZK A;  4GB3 1;  4QPG B;  1UY2 A;  2VZ3 A;  1COV 3;  1POV 0;  2P3I A;  5A7P A;  3ZFE B;  4QGL A;  3RI8 A;  5BNP A;  1JYW A;  1RUC 3;  2J1T A;  2VXR A;  4CP9 B;  1EV1 3;  1WBF A;  2YDE A;  3RRD A;  1BK1 A;  2LTN A;  2QQI A;  2BFU S;  1IKP A;  4OUS A;  1S0F A;  4N43 B;  3RFR A;  5K0U B;  1CWP A;  3H50 A;  4QXK A;  3ZYF A;  1VAL A;  3JD7 2;  4NHY A;  1LU2 A;  2HWB 1;  1YCI A;  1ZRI A;  3WDV A;  4XJA A;  1KFX L;  1PO1 3;  5LBF A;  3VD3 A;  2JDH A;  2PHR A;  2BJS A;  2VOV A;  4H14 A;  4XDO A;  3TN9 1;  4L0P A;  5EYY A;  2IXI A;  1QQP 1;  2O8O A;  2MPF A;  4NMI A;  4QKB A;  4FFF A;  5DAX A;  1YYN A;  2VJX A;  2Q8O A;  4FFI A;  3VLB B;  1R09 1;  1W2U A;  3BOD A;  4BHP A;  3AZY A;  2A3W A;  2HYK A;  5CVR A;  5JZG C;  4BCU A;  1F4A A;  1H30 A;  4WVV A;  1DZQ A;  1WME A;  5J96 B;  3E6B A;  4DEQ A;  3AMH A;  4D7S A;  1J84 A;  2HBT A;  2TUN A;  1YQ5 A;  2RR1 1;  3ZFG A;  3KF3 A;  3O1M A;  4TSV A;  4YFW A;  3TEX A;  2E33 A;  4HKL A;  1A6C A;  3W20 A;  3VZM A;  1LHW A;  2VCB A;  5FZ3 A;  4JGY B;  2VPV A;  3ACL A;  4CU6 A;  2QQV A;  1MZE A;  3S7E A;  1LEN A;  2EIC A;  2ZX4 A;  2VZP A;  4Y33 A;  3NNL A;  1KEX A;  1RIN A;  4GKY A;  1C8M 2;  5C70 A;  1T6G C;  1F2N A;  3HT2 A;  4B4P A;  2P5B A;  2Y26 A;  1ZRE A;  4Y1V A;  1CAX B;  4W50 A;  3E6D A;  4EJR A;  5BYN A;  4K20 A;  4LIT A;  1ULF A;  3DPR A;  5KXE A;  1H8T B;  5AFB A;  4CCM A;  1AR8 1;  4FOQ A;  4GH4 C;  4NVP A;  2FZ1 A;  5IVV A;  4QGN A;  1RUE 2;  3WQ0 A;  4QPY A;  1JHN A;  4RGA A;  4NIH A;  3IN9 A;  4TWT A;  2H6B A;  3KWV A;  3LF7 A;  4JZR A;  1W06 A;  3BGA A;  3RZZ A;  5L19 A;  5FMD A;  3R4S A;  5IAX A;  2W0X A;  3D0J A;  3V0A A;  4QQL A;  4QX0 A;  2CSG A;  3NNG A;  5FZA A;  2BOI A;  4CDW B;  1K5M C;  4ARX A;  5F5Q A;  1X7N A;  1JZ6 A;  2WZ8 A;  3A0K A;  2XL9 A;  1ST8 A;  2G9G A;  1SCS A;  4LBQ D;  1AR7 3;  4Q4V 3;  3UK9 A;  3FL7 A;  3WF4 A;  4QPI B;  4A3Z A;  1MR5 A;  1YRZ A;  5I0R A;  4B8E A;  2PAK A;  1ODM A;  2WO7 A;  2W08 A;  3BTA A;  5IWF A;  3NKT A;  4WM7 A;  2YZ4 A;  1PO2 2;  3RZJ A;  3DGT A;  3KT1 A;  5AC9 1;  2P1B A;  5CFD C;  3ZYG A;  1AXY A;  1GOF A;  5CB7 A;  3TEW A;  3J4U H;  5A33 A;  5A80 A;  5A3L A;  2RS5 3;  1GZ9 A;  2JKX A;  4E9K A;  2PLV 1;  4UAP A;  4EZH A;  5FZ7 A;  4Y5S A;  4E4H A;  3PVO A;  3B93 A;  1UXX X;  2E6V A;  2WJS A;  1ZYB A;  2C9A A;  4LBQ B;  4XC9 A;  4YWA A;  3WOG A;  1VB2 A;  4ES9 A;  3HD8 B;  3MO4 A;  5H9S A;  4PT6 A;  3B00 A;  3MLK A;  2EIE A;  2GC0 A;  3WT3 A;  5A1L A;  2BTV C;  4LO6 B;  1HLC A;  4ERO A;  2I74 A;  3RYP A;  2WNV C;  1OF3 A;  3EYP A;  1MVE A;  1QQP 2;  1IG0 A;  1ZBE 3;  3K51 A;  2W95 A;  4XIO A;  3HQX A;  3USU A;  1HW5 A;  4BK4 A;  4CP2 A;  4DQA A;  5JZG B;  1C3H A;  1RHI 2;  3C7H A;  2XBO 3;  4A41 A;  1PGL 2;  1FMD 2;  2ZX3 A;  3CDZ B;  1UU4 A;  4CEW C;  5FZ1 A;  2D5H A;  4MUV A;  3THD A;  1L7R A;  3M1H A;  1O7F A;  2ADE A;  1OUS A;  2BRT A;  3AL6 A;  3Q8E A;  1AR7 2;  3THT A;  3R4D B;  3TRS B;  4E2Q A;  2WZR 3;  2WLP A;  1REF A;  3ASI A;  4AQT A;  4FPL A;  1LTE A;  4PLO A;  3EQE A;  1W28 A;  1YQ6 A;  2VVE A;  4XAB A;  5I0U A;  4BIO A;  2JIJ A;  2RS3 3;  1IS4 A;  3C8X A;  4OMD A;  4Q26 A;  5DAQ A;  4KMQ A;  2FD8 A;  5FXX A;  4Q5O A;  4UBG A;  2PQQ A;  5T5L A;  4CP1 A;  3RPQ A;  1UMI A;  1QJY 3;  1BMV 2;  5B4X A;  1WD4 A;  1G9F A;  4CDQ C;  3WP6 A;  2O0O A;  3NAP A;  2ZGK A;  5AVP A;  2Q30 A;  2HWD 3;  4P08 A;  2E51 A;  3KVB A;  1FI2 A;  3HQR A;  3IBM A;  4XUP A;  2DF7 A;  1GOH A;  5L7O B;  1DDL A;  2BWA A;  4PCR A;  3FFZ A;  4QDR A;  3RVH A;  3JQW A;  4RD7 A;  1DCS A;  1IHM A;  1OD3 A;  1A3K A;  1VBC 3;  2XJR A;  4MZU A;  3ECQ A;  1CIY A;  2E26 A;  4PDW B;  5CG9 A;  2XJQ A;  3DN7 A;  4M3C B;  1WMF A;  3PUS A;  4WM7 C;  3SLI A;  4AI9 A;  1RGS A;  1XE8 A;  4IE0 A;  2ZGL A;  5L7O C;  1LHO A;  1NCR C;  1JYC A;  3U75 A;  1IZ3 A;  1JZ4 A;  5F2S A;  4C0H A;  1PIV 1;  3LOB A;  3WG1 A;  1UZV A;  5F39 A;  2WT0 A;  2ZXQ A;  3NV4 A;  4Z07 A;  1JZ8 A;  4UW4 A;  5FR3 A;  2QQL A;  1U0A A;  3MLL A;  4GB3 2;  2IC1 A;  1RUH 3;  2R6Q A;  3EJK A;  4ISR A;  4W6W A;  1F9K A;  3ZYP A;  2ES3 A;  4OLL A;  3SEE A;  2HWC 3;  2EVX A;  3SCF A;  2V5D A;  3R0R A;  1W03 A;  1ZZ6 A;  4FP3 A;  4XIK A;  1C1L A;  2RM2 2;  1HX6 A;  3CEW A;  5FYM A;  1FX5 A;  1XNT A;  4AFB A;  2D3S A;  2W52 A;  2GAL A;  1CAV A;  1N1Y A;  2ZMN A;  1O59 A;  4XZU G;  2H0V A;  2KA3 A;  1MZF A;  3WF3 A;  2K46 A;  2D3R A;  2XLF A;  2OUJ A;  1QQP 3;  1ULO A;  2VVD A;  2XON A;  4F3J A;  5CKM A;  1AYM 1;  2ETE A;  1PGW 2;  2R04 1;  4LO8 A;  3FWE A;  5I93 A;  5DG1 A;  2JDA A;  2WNO A;  4OUE A;  5JVV A;  4RQP C;  1NKG A;  5FP9 A;  1HQW A;  3TNP B;  5GAL A;  2JDK A;  3KZ4 C;  2CTV A;  2Y34 A;  4LO5 B;  4Z82 A;  5KHI A;  4JV4 A;  1REE A;  1RUI 1;  4JDO A;  3UYJ A;  1GP6 A;  2BGC A;  3HOB A;  3VBS B;  3MV1 1;  4ZON A;  1NCQ C;  4QQO A;  4XEZ A;  4CTE A;  2LRO A;  2R16 A;  3H3U A;  4JTO A;  1W8O A;  1XJA A;  5ERL A;  3VDD C;  3WP5 A;  1FPN 1;  5T55 A;  4CCE A;  3NAP C;  2LRP A;  3VKM A;  1WLW A;  5ACA 2;  3H1W A;  4JGY C;  1QEX A;  2HWF 2;  3M8L A;  3Q8F A;  3OPZ A;  3F2Z A;  3P3N A;  4OCT A;  2FDH A;  2BEO A;  4RN5 A;  4Q27 A;  4ISQ A;  2HWD 2;  4OI0 A;  1Y4W A;  1J83 A;  1W9F A;  2WWU A;  3GCX A;  3NAP B;  2VUJ A;  4IW3 A;  4Y5T A;  1C8M 1;  5IAV A;  4NRM A;  2XOM A;  1RED A;  2VW0 A;  2ZBJ A;  4MET A;  2XUM A;  4G4F A;  1FYU A;  4QDQ A;  5AVA A;  5FYV A;  3T0A A;  3PJQ A;  3AXD A;  2D6L X;  1SBF A;  2NYY A;  1W6N A;  2C5D A;  5L7O A;  4MH0 E;  4QU2 A;  4EQV A;  3O1R A;  3LEM A;  1AL0 G;  2VNR A;  3LA7 A;  1URX A;  1LOF C;  1MS0 A;  2QQK A;  4QQP A;  4MGZ E;  2CHH A;  1NYW A;  1WBL A;  2JDZ A;  4OI4 A;  1RUI 3;  3N35 A;  2W91 A;  2TNF A;  3B94 A;  5CKN A;  1AR9 2;  2C6S A;  2QJV A;  3THC A;  3BVC A;  4QX8 A;  3SH3 A;  3ILN A;  1F5J A;  3WP4 A;  1US3 A;  4OQ8 A;  1XNB A;  2WSV A;  3BUC A;  1HV0 A;  4UT5 A;  1MAC A;  3ZPO A;  1CAW A;  1OFS A;  1YFX A;  4AFM A;  3MF9 A;  3NJV A;  4CXX A;  4W65 A;  2OKX A;  1DYP A;  1NCQ B;  1F31 A;  2WL1 A;  4YM2 A;  4B7K A;  3T08 A;  3LPG A;  2AC1 A;  1BQP A;  2ORX A;  2AYH A;  4QB6 A;  4P9G A;  3ETQ A;  2QDR A;  4NWV A;  3TEY A;  2WFF 2;  3KD4 A;  4LXL A;  3GJA A;  4P02 B;  4Q0U A;  4U2A A;  1APN A;  3BU7 A;  3DF0 A;  5HXM A;  1WCS A;  4MXW B;  1SFN A;  1HV1 A;  3VBR A;  1R09 2;  2W46 A;  4GKX A;  5GZF A;  1IKQ A;  4OI2 A;  5FXW A;  1PMI A;  3KV6 A;  1CR7 A;  4BIF A;  5LCW L;  4IQP A;  2KXL A;  3VB9 A;  4MGQ A;  1KJL A;  1Q5O A;  5FYY A;  2DTY A;  2JE9 A;  3USS A;  3M3I A;  1D4M 3;  2YBK A;  1RUJ 3;  4CCO A;  1WW5 A;  2EID A;  2G19 A;  4KNC A;  1VBE 2;  1JI6 A;  3BTX A;  1VAM A;  3CZU A;  3M70 A;  2XUE A;  2K2S A;  5JIA A;  2AEN A;  3RYR A;  2G9F A;  2XLA A;  4IV3 A;  5CBL A;  1RUI 2;  1W0P A;  5T54 A;  1O4Y A;  3WNX A;  2IXK A;  4FPG A;  3VD4 A;  1QJU 1;  2IXJ A;  4ZXK A;  4IEY A;  5J98 B;  2Y6G A;  3SCH A;  3WG4 A;  3ZM8 A;  2FDF A;  5JSP A;  2TBV A;  3P6B A;  5A3U A;  4FPH A;  5J7M A;  1OSG A;  5IFT A;  5IK5 A;  2TEP A;  5DDJ 3;  1AR8 2;  1FXZ A;  4H7L A;  2XR4 A;  4LHL A;  5CFC B;  3UV9 A;  4BQ3 A;  1FOD 3;  2WN2 A;  2HWD 1;  2WZR 2;  2DCY A;  2RR1 3;  4XMA A;  2DVG A;  3AMN A;  4R4Z A;  1NE6 A;  1RUH 2;  1L3J A;  3KCX A;  2DBI A;  1PMJ X;  2WBK A;  3C7E A;  2ZCW A;  1GIC A;  2ZGN A;  3D6E A;  1LED A;  1GFF 2;  1V6J A;  1UCX A;  3VHR A;  1JS9 A;  2Z4F A;  4UWD A;  2CY6 A;  4N9I A;  1SDW A;  3QH7 A;  3O5S A;  2ARE A;  4QPW A;  2VUD A;  4YAR A;  2D44 A;  1RIT A;  3HEI A;  2V4A A;  2Y6L A;  2JG8 A;  5JIU A;  1OFN A;  3PUQ A;  5FY1 A;  2JEM A;  2WA3 A;  2G1M A;  3ACF A;  3CF6 E;  5BNP C;  3ZFG B;  2QFE A;  3MUY 1;  3W59 A;  5JOZ A;  4ZS3 A;  4QXB A;  3M4F A;  3WF2 A;  2Z5W A;  2DYC A;  2RDR A;  4LJH A;  5F37 A;  3ZFE C;  1DQ4 A;  1D0G A;  5LK5 A;  3VBR C;  1KDM A;  3IDB B;  1O8S A;  1ZBE 2;  2VZO A;  2PHU A;  5IVF A;  3OY8 B;  1CAX A;  4XXA A;  3JD7 1;  2Y6F A;  5IYY A;  3O0X A;  1VB4 A;  5FYS A;  1CZV A;  3MIG A;  3J8F 2;  1QDO A;  3QD6 A;  3VBU B;  2VG9 A;  3I2J A;  4OMC A;  1LB2 A;  5JR7 B;  3MPB A;  5JI7 A;  4AHZ A;  4GAZ A;  1ND3 B;  1VBD 3;  3IMM A;  3IPV A;  4IV3 C;  1UAI A;  2RS1 1;  3JUU A;  4PI2 A;  1NQJ A;  1WKY A;  1YJL A;  4HSL A;  3OYW B;  4XFG A;  4R9C A;  3GM8 A;  4IE5 A;  2QQP A;  1ULG A;  3GDB A;  4AVT A;  2HEY F;  1GQH A;  1RUF 3;  1UU5 A;  5ACA 3;  2DFB A;  5FYH A;  1J3P A;  1Z7S 3;  3V56 A;  2FMY A;  4LTA A;  4S2H A;  4IND A;  4YVW B;  5FIX A;  3FBY A;  4IV3 B;  4DUW A;  5LEJ A;  1L7Q A;  3VZK A;  2P34 A;  2Y0O A;  1VMJ A;  4ATE A;  2WSU A;  5KHK A;  3VHN A;  4P9J A;  5F5C A;  2WS9 1;  1BBT 3;  1ZZ9 A;  2RDS A;  1UW8 A;  4YGC A;  2Q4S A;  3SH5 A;  4I0W B;  4FPE A;  5FY4 A;  3LQC A;  3VBO A;  3O1P A;  1AR8 3;  2ZX0 A;  5IT6 A;  3KGZ A;  3M3Q A;  1VAK A;  1VIW B;  3DPR C;  4OUM A;  5HCF A;  1W0N A;  3JD7 3;  3OBR A;  2K0G A;  4FVV A;  4WZF A;  3V0B B;  3TB0 A;  5FYI A;  4LKS A;  3T0B A;  2DVD A;  1JOJ A;  4KWK A;  1CIW A;  3BB6 A;  1RXF A;  3R05 A;  4KH9 A;  2NMO A;  5JAX A;  2VUL A;  4E2G A;  5A6Q A;  5IVE A;  4XF1 A;  4WM8 C;  1G7Y A;  4MO3 M;  1I3H A;  1NZI A;  1OMI A;  1RUH 1;  2W94 A;  2NN8 A;  1X50 A;  3POF A;  5FV3 A;  4K7J A;  3IAP A;  4CU7 A;  3ZXK A;  4NO4 A;  3ITQ A;  2JEC A;  4AXO A;  4D6R A;  4IE7 A;  1QXP A;  3AMM A;  1AF9 A;  2RDN A;  3H8U A;  3PUI A;  4A6O A;  2JDP A;  2RMU 3;  5GJ6 A;  1CAU B;  2DU1 A;  1R09 3;  3H9A A;  1Y3T A;  1NLS A;  2HWC 2;  3ACH A;  5FPV A;  5KBF A;  5HXV A;  4XUQ A;  2DCJ A;  1PM7 A;  4HL0 A;  4YW1 A;  5FDB A;  5FP4 A;  5A1F A;  4CPB D;  3I2I A;  2LM3 A;  3ZYI B;  1TMF 2;  5FOJ B;  1W6P A;  3BCW A;  3N9Q A;  2EF6 A;  5FPZ A;  1LES A;  2VOW A;  2XWB B;  3GJB A;  5F6K A;  5A7S A;  3JCI A;  4MV2 A;  1W9T A;  1YFW A;  1OLM A;  5FZM A;  3BPZ A;  2WN3 A;  3PUR A;  4AL9 A;  3IZO A;  4GZ9 A;  3AM2 A;  1D4M 2;  3QH6 A;  3MIE A;  4N53 B;  4Q8K A;  4XFB A;  4XJ9 A;  2ZAA A;  3ZXL A;  4YGE A;  2SBA A;  2HEV F;  4M01 A;  4X8P A;  3QAC A;  4Z8B A;  1H8V A;  2MEV 3;  4AQ6 A;  5LRR A;  2C9K A;  1LRH A;  2NMN A;  1OT5 A;  3JBG 3;  3M3E A;  2VW1 A;  2VQA A;  3NW4 A;  5F32 A;  2W1U A;  2EAL A;  2IXC A;  4LBJ A;  3HAG A;  4AE2 A;  1RUJ 1;  4KL1 A;  4I0A A;  1GUI A;  4BQ4 A;  2WZR 1;  1S0D A;  4R9B A;  3RQ0 A;  4L11 A;  2ZAB A;  2GH8 A;  4DB5 A;  4HKO A;  4JGZ C;  2HWB 3;  2H0B A;  2JG8 B;  4YG6 A;  2JD9 A;  4XFI A;  4Q29 A;  3KQ4 B;  1ALY A;  3AB0 A;  4UF0 A;  2VBD A;  3TN9 3;  3QCW A;  3WCR A;  1CZT A;  2WZE A;  1AXK A;  1NCR B;  1HB1 A;  1VP6 A;  3C3V A;  2FCU A;  4LR4 A;  1RUJ 2;  4MLO A;  1GQG A;  1UYZ A;  4KU7 A;  3AVS A;  4CDQ A;  5EIY B;  2B45 X;  5FZD A;  1I9R A;  3CZJ A;  3J9S A;  4Y1Z A;  4FQ4 A;  2ZA9 A;  1VRB A;  4M0N A;  1WLC A;  3AZX A;  4NHK A;  2Q8D A;  1NG0 A;  3U4X A;  1LU1 A;  2XJP A;  3N7L A;  1MZ5 A;  5K0U A;  2ZKL A;  1RHI 3;  1JH5 A;  3MID A;  4CDW C;  5FMO L;  3KVA A;  3PNA A;  1N3O A;  5FO8 B;  1D7P M;  5I0T A;  4BYY A;  2GP3 A;  2OQ6 A;  3PIJ A;  2OVU A;  2FHR A;  2ZEW A;  3T2Q A;  1UKG A;  2DCK A;  1XE0 A;  1YLL A;  5AC9 3;  2CAU A;  1YQC A;  4KBZ A;  4LT5 A;  3ZIW A;  3O1S A;  1G9C A;  1W39 A;  5E8A A;  5A3N A;  2E53 A;  4DO0 A;  3Q8B A;  2CU5 A;  5A3W A;  4FSJ A;  1E5R A;  2ZAC A;  3GF6 A;  4LOT A;  4SLI A;  4BLI A;  5BNN B;  2AAC A;  3POI A;  1YFY A;  3JBG 2;  3WD5 A;  4MSV A;  1O3S A;  3VBS A;  1HQL A;  3P1I A;  1M06 G;  2WNU B;  1BEV 1;  4AF9 A;  3GBF A;  1V9U 2;  3UKT A;  3VBO B;  1XYP A;  2WR9 A;  1SAC A;  3I4I A;  5FZG A;  1TME 2;  2P6H A;  2E9Q A;  2RS3 1;  2HWB 2;  1AX0 A;  3AKR A;  2UWC A;  1VBD 2;  4KWL A;  2QQN A;  2GN3 A;  1FV3 A;  4LIV A;  4AI1 A;  3WSO A;  4G3Y C;  2Q5T A;  2LUW A;  2VNV A;  2PHW A;  4LO7 A;  3W58 A;  4DY5 A;  1JYX A;  1HJF A;  3ZIX A;  1RHI 1;  4N53 C;  5KHH A;  4FXG B;  5FJH A;  2VR4 A;  5C3O A;  2PEL A;  2Q1M A;  3T3Y A;  5J48 A;  2BPA 2;  3ZN5 A;  1H8T A;  1WMD A;  1Y7B A;  3FHQ A;  4YM1 A;  4AOC A;  4LBQ A;  3H8R A;  5EWS A;  4Y4Y A;  1YI7 A;  4M3C E;  1W99 A;  4AI3 A;  4UFI A;  2RMU 1;  3I2K A;  5C7G A;  1W2T A;  3PMS A;  2PFW A;  4L9B A;  1RJ8 A;  4GH4 B;  3ORJ A;  4URA A;  5DDJ 1;  3O1U A;  4JC1 A;  1RUF 1;  1U5Y A;  4LHS A;  3C7O A;  1V6K A;  4MAD A;  4N90 A;  3VD5 A;  3B7M A;  4N8M A;  3PVB B;  2WAO A;  3KMH A;  1F5F A;  2UYB A;  3M7A A;  4JRL A;  2D6O X;  4YGD A;  5FZC A;  3NJZ A;  3VN4 A;  4Y1U A;  3WX5 A;  2EAA A;  3AMQ A;  2W5F A;  3PTY A;  3PUA A;  3WG3 A;  4QKF A;  5BNN A;  3H8O A;  3A4U A;  3VDD A;  3FC0 A;  3WY6 A;  4QPI A;  5J1X A;  3I3D A;  1HIX A;  1UKR A;  5EFU A;  2JIC A;  2BVB A;  1LGC A;  1QH7 A;  1OI6 A;  1YIF A;  2WUH A;  3I59 B;  5DDJ 2;  5A7W A;  3ZYH A;  5GZC A;  5HBA A;  3S5Q A;  1UOB A;  2D6M A;  3S7I A;  5L9R A;  3AK0 A;  1SDD B;  5EJ3 A;  2P17 A;  2MHF A;  3RWK X;  4IUG A;  1UZY A;  4OQ9 A;  1AJK A;  3MW4 A;  4X6R B;  3N9M A;  3ZSM A;  1SBE A;  1AXZ A;  1NT0 A;  1YJK A;  5A7O A;  4D0Q A;  3LDR A;  1V6M A;  2PTM A;  3O1T A;  3LKJ A;  3OSD A;  2YGL A;  1AJO A;  1AL2 2;  1S0E A;  5F2W A;  1LOF A;  2RHP A;  2GNT A;  4BDV B;  1D2Q A;  4HZF A;  4MXV A;  2VEC A;  1OD5 A;  2V73 A;  3OB8 A;  5FUP A;  5B2G B;  1GNZ A;  1FPN 2;  2J1E A;  2XML A;  3PVE A;  3LA2 A;  3W9A A;  2W1W A;  3BOW A;  3AYE A;  4K8R B;  4XET A;  1XSR A;  1W6M A;  2F17 A;  4AVC A;  4FPC A;  3RWN A;  3VBH B;  3OBA A;  1FAY A;  4QB1 A;  4DUV A;  2JIG A;  3PU3 A;  3RZH A;  3ZX7 A;  4LUM A;  1FNZ A;  4IGO A;  4HKW A;  5FQ0 B;  1YIP A;  5C3P A;  5FY5 A;  4OI1 A;  4IEP A;  1AR6 2;  1HRV 3;  4C90 A;  3ZFF C;  1D2S A;  4ZHN A;  1NA1 B;  3URF A;  1DQ5 A;  2ATF A;  1SG3 A;  2EIB A;  1VBC 1;  2QTW B;  4WM7 B;  4ASL A;  1ZNP A;  3C2U A;  2F4L A;  4YZ2 A;  4Q0Q A;  2ZGP A;  2IXL A;  1Y43 B;  3AX4 A;  1JYT A;  3DYM A;  4ORF A;  4Q0V A;  1AYM 2;  2R04 2;  2QCS B;  2VZR A;  1SFP A;  5ISL A;  1EAH 3;  4TTG A;  4GJZ A;  5HI0 A;  3B9I A;  4B7E A;  2PHL A;  5F9T A;  1RMU 1;  2CDO A;  5C5U A;  4XOG A;  5FP8 A;  1OH4 A;  1KIT A;  1XYO A;  2VH9 A;  1XXN A;  1GV9 A;  2YGM A;  3VBF A;  2Y6H A;  1R08 1;  4HMZ A;  4DY3 A;  2RS5 1;  3E6C C;  1AR9 3;  2XH6 A;  5GLT A;  1HB2 A;  3TN9 2;  3LSE A;  2BV4 A;  4A7Y A;  1AL2 1;  3ILF A;  3WDW A;  5FZB A;  3WLU A;  4PF5 A;  4UFJ A;  3ZXD A;  1OPO A;  1V6O A;  5HV0 A;  4E4D X;  4QX2 A;  2E7Q A;  5JZG A;  1WW4 A;  3BYW A;  3I3M A;  5EHD A;  2ZPX A;  4Y20 B;  4PHZ A;  4AED C;  2XXZ A;  5FP3 A;  2UU8 A;  5DQ0 A;  3AYA A;  4P9W A;  2HH9 A;  2FCT A;  3KF5 A;  3GHM A;  3U11 A;  4I0B A;  3WHU A;  5A7N A;  2VXJ A;  2WFF 1;  2VNO A;  3NV2 A;  2ZS6 B;  3LWC A;  1Q8Q A;  4YG3 A;  1OUX A;  3NV1 A;  2OII A;  3E5Q A;  4CYD A;  5FY9 A;  2GSY A;  4FBF A;  4AI0 A;  3ZXE A;  4EN8 B;  2JG9 A;  5J09 A;  3B69 A;  1PGL 1;  2ILM A;  1ZA4 A;  2BOJ A;  2XLG A;  3U4S A;  3INA A;  1N1V A;  2DUP A;  1BJQ A;  1LHN A;  3I2F A;  3IDC B;  1RUO A;  2VTX J;  4AQS A;  4XFA A;  2VQU A;  4I01 A;  4MHR A;  1AR6 3;  2WNE A;  1PVC 3;  2GAU A;  3MIC A;  4GB3 3;  3A0N A;  2GNM A;  1RMU 2;  1AR9 1;  4ZZ8 A;  3OY8 A;  4FT8 A;  3UGG A;  1W9W A;  2ZZQ A;  4AQ2 A;  5KXB A;  2XJV A;  4I02 A;  5C9A C;  3O7O A;  4GMP 0;  4BM8 A;  3KM5 A;  3LEI A;  5GLU A;  4LEJ A;  3VBU A;  1CJD A;  4Z2W A;  1S1A A;  4AEK A;  4C91 A;  4GAL A;  3ZSL A;  3KHB A;  1SLT A;  1BXH A;  1LOE A;  3O0V A;  4M3C A;  5FP7 A;  1LHV A;  1F35 A;  4P5Y A;  2EXK A;  4YZ1 A;  1IGO A;  1SHW B;  3KV4 A;  1EUT A;  1ZZB A;  4JVA A;  5FPA A;  4YVW A;  1MEC 2;  2DCT A;  4ZKT B;  1I5P A;  3SKV A;  2R07 1;  3R6S A;  3F95 A;  2ZML A;  4M0H A;  4QGM A;  3O0W A;  4S2D A;  5E89 A;  4DXS A;  4RS5 C;  3VZO A;  2QNK A;  3ZDS A;  3GZT B;  5JCT A;  2WLQ A;  2WNU C;  4D6Q A;  2JG9 B;  1LHU A;  1AZD A;  1S55 A;  3I3B A;  1GOG A;  2C24 A;  1NUK A;  2EXH A;  1XB9 A;  5C8C B;  4QMA A;  1ENR A;  3E1F 1;  3RI9 A;  2WS9 3;  5FK7 A;  5F3E A;  2RR1 2;  3LCP A;  2I2S A;  4EN6 B;  2YYO A;  2ZGO A;  2J1A A;  5H9Q A;  3VHO A;  1DGL A;  3WZ1 A;  3AZV A;  3VBF B;  1ZBA 2;  4Q4V 1;  3CJI B;  2VGD A;  1JHJ A;  4AED A;  1KQR A;  4WBB A;  1YEW A;  2XQR A;  3PME A;  2X8K A;  3ZXF A;  4NPM A;  2PXJ A;  1OVS A;  4I09 A;  3U07 A;  5LA1 A;  1GR3 A;  1GMM A;  2KM2 A;  4XJU A;  3WDY A;  3I7D A;  4XPV A;  2JWP A;  1O91 A;  2CWM A;  4MX3 A;  4N9H A;  5FLJ A;  5J37 A;  3OGV A;  3ZYJ B;  2FDG A;  4NAM A;  4CRQ A;  2ARX A;  2D97 A;  4A3X A;  1RVF 3;  1SLL A;  4FXK B;  1CAU A;  3S57 A;  4XDP A;  1Y9Q A;  2R1B A;  2CL2 A;  3T4V A;  2B4K A;  3VBO C;  3D8C A;  1PZ8 A;  4IET A;  4CCL A;  5CFC C;  3WW4 A;  1W9S A;  3PL0 A;  4Q8L A;  5ANN A;  4JAA A;  1OUR A;  1W8W A;  4NHL A;  2A3Y A;  5T50 A;  4S2F A;  3WNK A;  4DIN B;  3O1V A;  1PIV 2;  3VBU C;  5J3U A;  4MOA A;  2WAA A;  3DEC A;  5FBZ A;  1S0I A;  2WQZ C;  2XJU A;  3CL1 A;  1WWY A;  2R1D A;  4UI9 L;  2HJI A;  5FY0 A;  1EV1 1;  3NVC A;  4YW5 A;  2ZGS A;  1QJY 2;  1OF4 A;  3CJX A;  2YC2 A;  5FTT C;  1O4T A;  4XF4 A;  1H4G A;  2R06 3;  4QX3 A;  1JUI A;  5LB6 A;  4NII A;  3WNO A;  4COU A;  3T2P A;  2A6W A;  4AED B;  3CLP A;  5CAZ A;  1HB3 A;  2XHN A;  2EAK A;  3LFI A;  4OHV A;  4BQ1 A;  2CGP A;  1UNB A;  1MS9 A;  1BBT 2;  3HNB M;  5CIR A;  1W2A X;  2AUY A;  3IT8 A;  3WQ7 A;  3ROU A;  1XQN A;  2VM9 A;  1QU0 A;  5F3C A;  4XMI A;  4B1M A;  3BPS A;  3J7M A;  1T6B X;  4AVB A;  4EN9 B;  2R30 A;  3HPN A;  1JMU B;  4AEM A;  2AH2 A;  2XL7 A;  4NHX A;  2BNM A;  4Y24 A;  4A7K A;  4UXA A;  1XRU A;  1PK6 C;  1QXJ A;  4JCK A;  1BVP 1;  4I2O A;  1N3P A;  1ZZC A;  1QOT A;  5DAW A;  1JZ7 A;  1NXM A;  5LAS A;  1W6P B;  3WDT A;  3UL2 A;  5DUU A;  5T5O A;  2VL4 A;  1P8J A;  4XUN A;  5DZE A;  4A42 A;  2ZHM A;  2WS9 2;  4Q4W 2;  4E4Z A;  1G9A A;  1RUG 3;  3LB9 A;  1X9T A;  5IVJ A;  2HWE 3;  4Y5Z 0;  3UT0 A;  1SFY A;  3CBN A;  2D6P A;  5FK8 A;  1W6O A;  3JBG 1;  3T1M A;  2UYA A;  5FZ4 A;  3ZPY A;  4NAO A;  1ZRF A;  2YU2 A;  4MXW A;  2RG4 A;  4HBN A;  4NWW A;  3SXW A;  2IWG B;  3PVN A;  1UYY A;  4HK8 A;  3B02 A;  3WIN E;  4EYU A;  4YZ5 A;  3A23 A;  5LRS A;  3APB A;  3FHI B;  3WP3 A;  4BWO A;  1TMF 1;  3LE0 A;  3AP4 A;  4FOY A;  4IEU A;  1HJG A;  4UOJ A;  3BTZ A;  3BI3 A;  4QD2 A;  4RQP A;  5C3R A;  1W90 A;  1XNK A;  2BUK A;  2GMP A;  1ND3 A;  2PHT A;  2QBX A;  3IPV B;  4AVV A;  4ONU A;  2Z2S B;  1W8T A;  4CCN A;  4IV1 B;  2YB7 A;  2VZ1 A;  5FJK A;  3TWI A;  3MFA A;  4N7I A;  3K46 A;  1YHF A;  4RGG A;  1O3R A;  4FTE A;  4PI0 A;  1PX3 A;  1IQA A;  4XXP A;  3J7L A;  4XHX A;  5FZI A;  4KU8 A;  4QQ2 A;  1S0C A;  3IM0 A;  2Y0I A;  2ZGR A;  2A75 A;  2ZJC A;  1B35 B;  4LK7 A;  4RFR B;  2ZAH A;  5FMO S;  1YO8 A;  3HNY M;  5A1A A;  1R1Z A;  3K75 B;  1S0G A;  4D94 A;  1IPJ A;  2VUC A;  2WFP A;  2IXH A;  4D7Y A;  5LWB A;  2JDY A;  2VU9 A;  4QM8 A;  2ZGU A;  2MEV 2;  4BIS A;  1XNA A;  3V64 A;  3ZXA C;  4HVR A;  1CQ9 A;  4HN0 A;  1SPP B;  3CQO A;  4B1L A;  2J1V A;  3POW A;  4V2V A;  2J1S A;  4YLZ A;  1RJ7 A;  2GME A;  4BPZ A;  3KQR A;  1M4W A;  2OPK A;  1Q8O A;  2OZ6 A;  3RJR A;  4CPB A;  2OPW A;  3SEP A;  4Q4X 3;  4JKM A;  4P9L A;  5LW9 A;  2AEZ A;  4XQ4 A;  4UBH A;  4JRA A;  4RQP B;  1GZW B;  5A6Y A;  1PO2 1;  4XJZ A;  3KLS A;  3L2H A;  4FFH A;  1W0O A;  5FOB B;  5IVY A;  3BIE A;  5A32 A;  1K5M B;  2XWJ B;  4XJW A;  2VUA A;  1FMD 1;  3POS A;  4M4R A;  4NIA A;  1MPX A;  1QNY A;  2QQU A;  1R1A 3;  2JE7 A;  4ZS2 A;  4B29 A;  1N1S A;  1LKN A;  3W5N A;  4PIX A;  5C3S A;  3POJ A;  2CGN A;  1VBB 3;  3HIF A;  4K1Z A;  5IK7 A;  1ZRR A;  4PJY A;  3FE5 A;  3MPP G;  2DU0 A;  3U10 A;  4PIY A;  4OZX A;  4QXC A;  4COZ A;  4N53 A;  1SLB A;  4EZ4 A;  1LOA A;  5KHJ A;  3G6J B;  2CGO A;  4MGS A;  4A7Z A;  2IVJ A;  4LNV A;  3HN3 A;  1J1T A;  3NNF A;  1U12 A;  4CCJ A;  5C3Q A;  1BKZ A;  3DPR B;  1B35 C;  5L36 A;  1CPM A;  2RS5 2;  3AKQ A;  3MF6 A;  1H8T C;  2VAU A;  1EUU A;  4J1W A;  2B8M A;  1CN1 A;  5C9A B;  3ZYR A;  1ND3 C;  5JOW A;  3NNJ A;  5CG8 A;  4QX5 A;  1KJR A;  3BN6 A;  3LSD A;  4UFH A;  5JUV A;  1TNR A;  3UKN A;  3IAQ A;  3K4Z A;  3PU8 A;  3BAL A;  4CZS A;  1U5I A;  4TLF A;  4LBL A;  1RUF 2;  1C8N A;  1E5S A;  1AYN 3;  4IGP A;  2FZ2 A;  4W4Z A;  5F5I A;  3BOP A;  3HWJ A;  1PMH X;  4GMP 3;  1WW6 A;  4BXF A;  4R4X A;  3NL1 A;  2WKK A;  2BW8 A;  1TNF A;  3LOI A;  1CZS A;  1GNH A;  1I1E A;  1ZRD A;  3LA3 A;  4IV1 C;  1VBA 1;  3I3E A;  5EP9 A;  1UN1 A;  4EV0 A;  3I2G A;  2P3Y A;  3MV0 1;  3BU0 A;  4GWI A;  3ZO0 B;  3ZVX A;  3B01 A;  4GA9 A;  2DVF A;  5K7P A;  4DNY A;  1DZT A;  2YV8 A;  4CUA A;  3PJY A;  1X82 A;  1UOJ A;  4K9S A;  4XW3 A;  5FYC A;  2VQ0 A;  4Q1R A;  1OPM A;  2WWJ A;  1RYY A;  2J1U A;  4GWM A;  1PVX A;  2W68 A;  3EB7 A;  4YM0 A;  4LOS A;  1JZ3 A;  3O1O A;  1GSL A;  2A73 B;  2VTF A;  1WCU A;  1ZX5 A;  1BK0 A;  4CDQ B;  3N9N A;  3T1L A;  4CDX B;  4CU8 A;  4H3W A;  1RUD 2;  1EPW A;  3OGG A;  5D1I A;  1NLR A;  3LPF A;  4LUL A;  3AMP A;  4KG8 A;  4ASK A;  3ZXJ A;  4L8Q A;  1FOD 1;  3IWZ A;  2VW2 A;  1QJU 3;  2P3K A;  2YC4 A;  4MGK E;  4XTP A;  4IES A;  3VKF C;  4DRR A;  1ZM1 A;  2VCM A;  5LA0 A;  2GP5 A;  1UO9 A;  3OYW A;  1D0H A;  3MEP A;  4YW6 A;  5LEK A;  2HKX A;  4TLG A;  5D8A A;  5A3T A;  2W39 A;  4F83 A;  2GZW A;  5FKB A;  3ZN6 A;  4MGI E;  4LKD A;  4A44 A;  5BY5 A;  2BVV A;  2QQO A;  2BZD A;  1YI9 A;  1HXS 3;  3WW2 A;  3ZFF A;  5F7U A;  1O3Q A;  1O3T A;  3OJB A;  1GP5 A;  4FFG A;  1ASJ 1;  1WLT A;  2JG8 C;  4ZZ5 A;  3BTY A;  1ENS A;  5IJR A;  3ZFF B;  1H4H A;  3ES1 A;  4YRD A;  4EN0 A; 
#chains in the Genus database with same CATH homology
 3PDQ A;  5IWF A;  3OPW A;  4CCL A;  5FWJ A;  5FYB A;  5FZ9 A;  5FZG A;  5FZB A;  5FV3 A;  2OQ7 A;  5FYZ A;  5FP9 A;  5LW9 A;  5A80 A;  4D6R A;  4LIV A;  4V2W A;  3N9P A;  5FPL A;  4EZH A;  4IGQ A;  5FBJ A;  5FZ7 A;  3LDB A;  3AVR A;  4Y4R A;  2XXZ A;  5FP3 A;  4BU2 A;  4E4H A;  5IVY A;  5FZE A;  4NUB A;  5FJH A;  5FUN A;  5A7N A;  3UYJ A;  2W2I A;  5FPV A;  5FY0 A;  5A7Q A;  5FZK A;  4QXH A;  5FP4 A;  5A1L A;  5A1F A;  5FY9 A;  5F3G A;  5A7P A;  5LY1 A;  3N9Q A;  4LIU A;  5FZ0 A;  2YBP A;  5A3P A;  4URA A;  3U4S A;  5A7S A;  4C8D A;  4QXC A;  3DXT A;  2VD7 A;  3N9O A;  4EZ4 A;  4HON A;  5FZM A;  4CCJ A;  3PUR A;  5FZC A;  3ZLI A;  2Q8C A;  5F3C A;  5FZ1 A;  2WWU A;  3PUA A;  2Q8E A;  2OS2 A;  3N9L A;  3AL6 A;  2XDV A;  3PUQ A;  5FY1 A;  5FPU A;  5FYV A;  3OPT A;  5FZ8 A;  3PU8 A;  5F3I A;  4XDO A;  3PTR B;  5A7W A;  5F32 A;  4QXB A;  4IGP A;  2OX0 A;  4QU1 A;  5F5A A;  5F37 A;  5F5I A;  4BXF A;  5IVJ A;  5FYT A;  5FXX A;  4GJY A;  5FP7 A;  5FPB A;  3KV4 A;  5IVF A;  3N9M A;  4QX8 A;  3AL5 A;  2YU1 A;  5FZ4 A;  5FPA A;  5FXZ A;  5A7O A;  5FYS A;  4UF0 A;  3NJY A;  2YU2 A;  3K3O A;  3KVB A;  5FWE A;  4QWN A;  5IVC A;  5F2W A;  5A7W B;  3ZPO A;  4EYU A;  5FZ3 A;  3RVH A;  4GAZ A;  5FUP A;  5FZO A;  3LD8 A;  4AAP A;  5FYC A;  4D6Q A;  2WWJ A;  2XML A;  4Y33 A;  2OT7 A;  5LY2 A;  2YBS A;  3AVS A;  5FZO B;  3K3N A;  5FZD A;  2P5B A;  5FYU A;  3PUS A;  5FZF A;  4AI9 A;  5FYH A;  5CEH A;  3DXU A;  3PU3 A;  4CCN A;  1VRB A;  4LXL A;  5F3E A;  4LIT A;  3N9N A;  5IVB A;  2Q8D A;  5FJK A;  4IGO A;  4UF0 B;  5FZL A;  4HOO A;  5FY5 A;  4CCM A;  5F2S A;  4GD4 A;  5IVV A;  3K2O A;  3KVA A;  4ASK A;  4TN7 A;  5F5C A;  5F39 A;  5ANQ A;  5FXV A;  5FZI A;  2GP3 A;  2OQ6 A;  3KV5 A;  3KV9 A;  3KV6 A;  5FXW A;  5IW0 A;  3U78 A;  5FY4 A;  2PXJ A;  2GP5 A;  5FYY A;  5ISL A;  4CSW A;  5FZA A;  4DIQ A;  4Y3O A;  2YBK A;  4QX7 A;  4CCO A;  5A3T A;  4GJZ A;  5KR7 A;  5A3N A;  4DO0 A;  5LWB A;  5A3W A;  4D6S A;  4CUG A;  5E6H A;  4BIS A;  2XUE A;  5FYI A;  5FP8 A;  5FZH A;  5FY8 A;  5FYM A;  5K4L A;  4XDP A;  2YPD A;  5FZ6 A;  5FY7 A;  4CCK A;  5IVE A;  4V2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...