5A83A

Crystal structure of human atad2 bromodomain in complex with 4-((3r, 4r)-4-3-methyl-5-(5-methylpyridin-3-yl)-2-oxo-1,2-dihydroquinolin-8- yl-aminopiperidin-3-yloxymethyl)-1-thiane-1,1-dione
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-Based Optimization of Naphthyridones Into Potent Atad2 Bromodomain Inhibitors.
pubmed doi rcsb
molecule keywords ATPASE FAMILY AAA DOMAIN-CONTAINING PROTEIN 2
molecule tags Hydrolase
source organism Homo sapiens
total genus 55
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2015-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5a83A00
5DW1A 3D7CA 3P1DA 3O35A 4YATA 4PTBA 1ZS5A 4HXOA 5I86A 3MULA 3RCWA 3DWYA 5E73A 4N4HA 5FE4A 4YYHA 4X2IA 5D3RA 5E3GA 4YAXA 5L97A 3MQMA 5E9YA 4HBXA 4TT4A 5IGMA 5ENJA 5I88A 3P1CA 2RFJA 4CUQA 3P1FA 3Q2FA 5FE6A 5HJCA 2I8NA 4PS5A 5TCMA 4UYGA 5II1A 2NXBA 4NR7A 1WUMA 3HMEA 4IOOA 5EA1A 4C67A 5E74A 5L99A 5EP7A 5EM3A 5HEMA 5FG5A 5AMFA 5D0CA 5A5OA 5D7XA 2DVRA 4NR8A 4YK0A 5F62A 4WHUA 5FE2A 2F6JA 5A81A 5CS8A 4QSPA 4RVRA 4CFLA 2DVSA 4IR5A 5G4RA 5H85A 3SVGA 5CQ6A 4NR5A 4NR9A 5HLSA 2DWWA 4YYIA 5F61A 3O34A 4KV4A 4NYXA 4O7FA 4UIWA 4NRAA 5BT3A 5CU8A 5LKTA 4NUCA 4FLPA 2GRCA 4QNSA 4NYWA 4LYIA 4UIYA 5CQ3A 5A5NA 5ACYA 5I29A 5CRZA 2RNWA 4ZQLA 4UIVA 4NR4A 5ETDA 5F3AA 4YYGA 5IIDA 2RO1A 4UYEA 5FG6A 5DKDA 5A7CA 4TZ2A 3MUKA 4NQNA 5ENIA 4Z93A 3O33A 4QR5A 4Q0OA 3K2JA 4O72A 3IU5A 5LJ2A 2LSPB 5E0RA 4NRBA 4CUSA 5FE0A 4BHWA 4BW1A 5I40A 4QSVA 4C66A 3U5JA 4PCEA 4LDFA 4TU4A 5A5RA 5F36A 3UV5A 2YQDA 5IBNA 5CQTA 4YYMA 5ENBA 5EWWA 4Q0NA 5DBMA 2L84A 5EU1A 4TYLA 4NYVA 5HM0A 5HQ6A 2R10A 4LRGA 5FH6A 4J3IA 5FG4A 5EV9A 2E7NA 4NUEA 5HRWA 5CY9A 5D24A 4A9NA 5D3SA 5F60A 5IG6A 4YYJA 4XY8A 2D9EA 5F5ZA 5FH8A 3UVYA 4N4IA 5E9LA 4UIXA 2DVVA 5IGNA 4TT2A 4TZ8A 2YEKA 5E3DA 5ENCA 4Y03A 5CRMA 5F2PA 5DX4A 2YW5A 5KTWA 3ONIA 5DW2A 5EI4A 5I7XA 5C7NA 4TS8A 5HCLA 2WP1A 4A9HA 4UITA 4YBTA 4O7BA 5ETBA 4CLBA 4HBYA 5CGPA 4IOQA 4MR3A 1WUGA 4A9KA 5ENGA 3U5MA 5FDZA 5COIA 3JVLA 4QSQA 5HRVA 3AADA 4A9FA 4MEQA 5LKUA 2N9GA 5LKXA 4TTEA 4YH4A 4O7EA 5F1LA 5KU3A 3UVWA 4QSWA 4N4FA 5CUGA 3U5OA 4OGIA 5DY7A 2E3KA 4O74A 5EWHA 1F68A 3HMHA 4QSTA 2R0SA 4IR6A 4ALGA 3MB4A 2DATA 5CUDA 4BJXA 4QC1A 5F25A 5A5PA 4NRCA 5L98A 4Z6HA 3NXBA 5KO4A 5D3LA 4HXLA 3ZYUA 3QZSA 4O70A 4QB3A 5CUAA 5D26A 5BT5A 3LXJA 4HXRA 5D3PA 5BT4A 5DKHA 2L85A 1JM4B 4HXSA 4XYAA 3P5OA 2R0YA 4ALHA 4IR4A 2YDWA 4E96A 5DYXA 2YELA 5C4QA 5DKCA 5JWMA 5A5SA 1N72A 5KTXA 2I7KA 5IGKA 1EQFA 4MR6A 4O77A 5ENHA 4QR3A 5A82A 4BW3A 5FE3A 4MENA 3MXFA 5DLZA 5FE9A 3JVMA 5EPBA 5CFWA 4MEOA 5L8TA 4A9EA 4YYKA 5L8UA 4OGJA 2FSAA 1E6IA 4QUUA 4MR4A 4QR4A 4QUTA 5CQ8A 5FB0A 4A9JA 5EQ1A 4A9IA 4O71A 5HQ7A 5CQ7A 5AD2A 5CP5A 4XUAA 5EWVA 4QSSA 4NR6A 3DAIA 5EGUA 2E7OA 3MB3A 4LYSA 5CQAA 5F1HA 4CFKA 5FBXA 4QYLA 4YBSA 4PCIA 3FKMX 2OO1A 4TQNA 2YYNA 4NXJA 3AQAA 4Z1QA 5DLXA 5EISA 3G0LA 3O37A 4CUPA 4O7CA 4LZRA 3LQHA 5I83A 4IR3A 4LZSA 4O75A 4Z1SA 5CZGA 3SVFA 5LKZA 5AD3A 4HXKA 2H60A 4OUFA 3Q2EA 5D3TA 5CUCA 5A83A 4O76A 2DVQA 4KCXA 5LJ0A 4BW4A 2RS9B 4KV1A 3U5NA 4J0RA 3IU6A 4HXMA 4PKLA 4GPJA 3QZTA 5I1QA 4TT6A 3O36A 3UW9A 4QYDA 5FFWA 5KHMA 2L5EA 5E9MA 5E7DA 4HBWA 5A85A 5E9IA 2RI7A 5ENFA 5H1UA 4N3WA 4UYFB 5CUEA 4CL9A 5FE8A 5C8GA 4LYWA 3LJWA 5II2A 5C89A 2OSSA 5FE7A 2RNXA 5EK9A 4QSUA 4F3IA 4YY4A 5HFQA 5EWDA 4WHWA 4YC9A 2R0VA 5H1VA 2MJVB 4UIUA 3G0JA 5A5QA 5HQ5A 4QEUA 4UIZA 5K29A 4YADA 5E9VA 5LJ1A 4LC2A 5FFYA 4O7AA 4NS5A 3LQJA 2WP2A 4XUBA 5CPEA 5D3NA 3U5LA 5C85A 5I7YA 4YY6A 4QY4A 5DFDA 3LQIA 4O78A 4BW2A 5EICA 4NQMA 3SVHA 4WIVA 4QSXA 5DFBA 5IGLA 5CTLA 5DYAA 1JSPB 3P1EA 2D82A 5KTUA 3U5KA 4ZC9A 5EPRA 4HXNA 5I89A 3S92A 5G4SA 4QZSA 5CQ4A 5FB1A 4HXPA 3I3JA 4CURA 2F6NA 5L96A 5CUBA 5EWCA 4PY6A 3S91A 2DKWA 5FE1A 5DYCA 5I80A 4YABA 4J0SA 4DONA 5CQ5A 5D3JA 1X0JA 2G4AA 5AMEA 5HFRA 4CUTA 5LVRA 2OUOA 2RNYA 4QEVA 5LVQA 5LUUA 3UVDA 3TLPA 5EPSA 4YYDA 4J1PA 5HELA 5FH7A 5FFVA 4MR5A 4XY9A 5E9KA 5ENEA 3HMFA 4Z6IA 4ZW1A 5J0DA 2YEMA 5EVAA 4YBMA 3QZVA 4QC3A 4UYFA 3UV2A 4A9MA 3GG3A 4QBMA 4A9LA 5FE5A 4NUDA 3JVKA 3UVXA 5C87A 2KTBB 4QEWA 5TB6A 4QSRA 3U5PA 4LR6A 5HRXA 4A9OA 4UYHA 4YH3A 5D3HA 5H1TA 5JI8A 4N4GA 3UV4A 4YYNA 5HENA 5F63A 5D25A 5DYUA 4CUUA 3JVJA 4TU6A 4LZ2A 5DFCA 4IORA 4UYDA 4AKNA 4HBVA 4MEPA
chains in the Genus database with same CATH superfamily
5DW1A 3D7CA 3P1DA 3O35A 4YATA 4PTBA 1ZS5A 4HXOA 5I86A 3MULA 3RCWA 3DWYA 5E73A 4N4HA 5FE4A 4YYHA 4X2IA 5D3RA 5E3GA 4YAXA 5L97A 3MQMA 5E9YA 4HBXA 4TT4A 5IGMA 5ENJA 5I88A 3P1CA 2RFJA 4CUQA 3P1FA 3Q2FA 5FE6A 5HJCA 2I8NA 4PS5A 5TCMA 4UYGA 5II1A 2NXBA 4NR7A 1WUMA 3HMEA 4IOOA 5EA1A 4C67A 5E74A 5L99A 5EP7A 5EM3A 5HEMA 5FG5A 5AMFA 5D0CA 5A5OA 5D7XA 2DVRA 4NR8A 4YK0A 5F62A 4WHUA 5FE2A 2F6JA 5A81A 5CS8A 4QSPA 4RVRA 4CFLA 2DVSA 4IR5A 5G4RA 5H85A 3SVGA 5CQ6A 4NR5A 4NR9A 5HLSA 2DWWA 4YYIA 5F61A 3O34A 4KV4A 4NYXA 4O7FA 4UIWA 4NRAA 5BT3A 5CU8A 5LKTA 4NUCA 4FLPA 2GRCA 4QNSA 4NYWA 4LYIA 4UIYA 5CQ3A 5A5NA 5ACYA 5I29A 5CRZA 2RNWA 4ZQLA 4UIVA 4NR4A 5ETDA 5F3AA 4YYGA 5IIDA 2RO1A 4UYEA 5FG6A 5DKDA 5A7CA 4TZ2A 3MUKA 4NQNA 5ENIA 4Z93A 3O33A 4QR5A 4Q0OA 3K2JA 4O72A 3IU5A 5LJ2A 2LSPB 5E0RA 4NRBA 4CUSA 5FE0A 4BHWA 4BW1A 5I40A 4QSVA 4C66A 3U5JA 4PCEA 4LDFA 4TU4A 5A5RA 5F36A 3UV5A 2YQDA 5IBNA 5CQTA 4YYMA 5ENBA 5EWWA 4Q0NA 5DBMA 2L84A 5EU1A 4TYLA 4NYVA 5HM0A 5HQ6A 2R10A 4LRGA 5FH6A 4J3IA 5FG4A 5EV9A 2E7NA 4NUEA 5HRWA 5CY9A 5D24A 4A9NA 5D3SA 5F60A 5IG6A 4YYJA 4XY8A 2D9EA 5F5ZA 5FH8A 3UVYA 4N4IA 5E9LA 4UIXA 2DVVA 5IGNA 4TT2A 4TZ8A 2YEKA 3VKGA 5E3DA 5ENCA 4Y03A 3ERRA 5CRMA 5F2PA 5DX4A 2YW5A 5KTWA 3ONIA 5DW2A 5EI4A 5I7XA 5C7NA 4TS8A 5HCLA 2WP1A 4A9HA 4UITA 4YBTA 4O7BA 5ETBA 4CLBA 4HBYA 5CGPA 4IOQA 4MR3A 1WUGA 4A9KA 5ENGA 3U5MA 5FDZA 5COIA 3JVLA 4QSQA 5HRVA 3AADA 4A9FA 4MEQA 5LKUA 2N9GA 5LKXA 4TTEA 4YH4A 4O7EA 5F1LA 5KU3A 3UVWA 4QSWA 4N4FA 5CUGA 3U5OA 4OGIA 5DY7A 2E3KA 4O74A 5EWHA 1F68A 3HMHA 4QSTA 2R0SA 4IR6A 4ALGA 3MB4A 2DATA 5CUDA 4BJXA 3D1BA 4QC1A 5F25A 3D1DA 5A5PA 4NRCA 5L98A 4Z6HA 4AI6A 3NXBA 5KO4A 5D3LA 4HXLA 3ZYUA 3QZSA 4O70A 4QB3A 5CUAA 5D26A 5BT5A 3LXJA 4HXRA 5D3PA 5BT4A 5DKHA 2L85A 1JM4B 4HXSA 4XYAA 3P5OA 2R0YA 4ALHA 4IR4A 2YDWA 4E96A 5DYXA 2YELA 5C4QA 5DKCA 5JWMA 5A5SA 1N72A 5KTXA 2I7KA 5IGKA 1EQFA 4MR6A 4O77A 5ENHA 4QR3A 5A82A 4BW3A 5FE3A 4MENA 3MXFA 5DLZA 5FE9A 3JVMA 5EPBA 5CFWA 4MEOA 5L8TA 4A9EA 4YYKA 5L8UA 4OGJA 2FSAA 1E6IA 4QUUA 4MR4A 2EJNA 4QR4A 4QUTA 5CQ8A 5FB0A 4A9JA 5EQ1A 4A9IA 4O71A 5HQ7A 5CQ7A 5AD2A 5CP5A 4XUAA 5EWVA 1ZKRA 4QSSA 4NR6A 3DAIA 5EGUA 2E7OA 3MB3A 4LYSA 5CQAA 5F1HA 4CFKA 5FBXA 4QYLA 4YBSA 4PCIA 3FKMX 2OO1A 4TQNA 2YYNA 4NXJA 3AQAA 4Z1QA 5DLXA 5EISA 3G0LA 3O37A 4CUPA 4O7CA 4LZRA 3LQHA 5I83A 4IR3A 4LZSA 4O75A 4Z1SA 4AKIA 5CZGA 3SVFA 5LKZA 5AD3A 4HXKA 2H60A 4OUFA 3Q2EA 5D3TA 5CUCA 5A83A 4O76A 2DVQA 4KCXA 5LJ0A 4BW4A 2RS9B 4KV1A 3U5NA 4J0RA 3IU6A 4HXMA 4PKLA 4GPJA 3QZTA 5I1QA 4TT6A 3O36A 3UW9A 4QYDA 5FFWA 5KHMA 2L5EA 5E9MA 5E7DA 4HBWA 5A85A 5E9IA 2RI7A 5ENFA 5H1UA 4N3WA 4UYFB 5CUEA 4CL9A 5FE8A 5C8GA 3VKHA 4LYWA 3LJWA 5II2A 5C89A 2OSSA 5FE7A 2RNXA 5EK9A 4QSUA 4F3IA 4YY4A 5HFQA 5EWDA 4WHWA 4YC9A 2R0VA 5H1VA 2MJVB 4UIUA 3G0JA 5A5QA 5HQ5A 4QEUA 4UIZA 5K29A 4YADA 5E9VA 5LJ1A 4LC2A 5FFYA 1PUOA 4O7AA 4NS5A 3LQJA 2WP2A 4XUBA 5CPEA 5D3NA 3U5LA 5C85A 5I7YA 4YY6A 4QY4A 5DFDA 3LQIA 4O78A 4BW2A 5EICA 4NQMA 3SVHA 4WIVA 4QSXA 5DFBA 5IGLA 5CTLA 5DYAA 1JSPB 3P1EA 2D82A 5KTUA 3U5KA 4ZC9A 5EPRA 4HXNA 5I89A 3S92A 5G4SA 4QZSA 5CQ4A 5FB1A 4HXPA 3I3JA 4CURA 2F6NA 5L96A 5CUBA 5EWCA 4PY6A 3S91A 2DKWA 5FE1A 5DYCA 5I80A 4YABA 4J0SA 4DONA 5CQ5A 5D3JA 1X0JA 2G4AA 5AMEA 5HFRA 4CUTA 5LVRA 2OUOA 2RNYA 4QEVA 5LVQA 5LUUA 3UVDA 3TLPA 5EPSA 4YYDA 4J1PA 5HELA 5FH7A 5FFVA 4MR5A 4XY9A 5E9KA 5ENEA 3HMFA 4AKHA 4Z6IA 4ZW1A 5J0DA 2YEMA 5EVAA 4YBMA 3QZVA 4QC3A 4UYFA 3UV2A 4A9MA 3GG3A 4QBMA 4A9LA 5FE5A 4NUDA 3JVKA 3UVXA 5C87A 2KTBB 4QEWA 5TB6A 4QSRA 3U5PA 4LR6A 5HRXA 4A9OA 4UYHA 4YH3A 5D3HA 5H1TA 5JI8A 4N4GA 3UV4A 4YYNA 5HENA 5F63A 5D25A 5DYUA 4CUUA 3JVJA 4TU6A 4LZ2A 5DFCA 4IORA 4AKGA 4UYDA 4AKNA 4HBVA 4MEPA
chains in the Genus database with same CATH topology
5DW1A 3D7CA 3P1DA 3O35A 4YATA 4PTBA 1ZS5A 4HXOA 5I86A 3MULA 3RCWA 3DWYA 5E73A 4N4HA 5FE4A 4YYHA 4X2IA 5D3RA 5E3GA 4YAXA 5L97A 3MQMA 5E9YA 4HBXA 4TT4A 5IGMA 5ENJA 5I88A 3P1CA 2RFJA 4CUQA 3P1FA 3Q2FA 5FE6A 5HJCA 2I8NA 4PS5A 5TCMA 4UYGA 5II1A 2NXBA 4NR7A 1WUMA 3HMEA 4IOOA 5EA1A 4C67A 5E74A 5L99A 5EP7A 5EM3A 5HEMA 5FG5A 5AMFA 5D0CA 5A5OA 5D7XA 2DVRA 4NR8A 4YK0A 5F62A 4WHUA 5FE2A 2F6JA 5A81A 5CS8A 4QSPA 4RVRA 4CFLA 2DVSA 4IR5A 5G4RA 5H85A 3SVGA 5CQ6A 4NR5A 4NR9A 5HLSA 2DWWA 4YYIA 5F61A 3O34A 4KV4A 4NYXA 4O7FA 4UIWA 4NRAA 5BT3A 5CU8A 5LKTA 4NUCA 4FLPA 2GRCA 4QNSA 4NYWA 4LYIA 4UIYA 5CQ3A 5A5NA 5ACYA 5I29A 5CRZA 2RNWA 4ZQLA 4UIVA 4NR4A 5ETDA 5F3AA 4YYGA 5IIDA 2RO1A 4UYEA 5FG6A 5DKDA 5A7CA 4TZ2A 3MUKA 4NQNA 5ENIA 4Z93A 3O33A 4QR5A 4Q0OA 3K2JA 4O72A 3IU5A 5LJ2A 2LSPB 5E0RA 4NRBA 4CUSA 5FE0A 4BHWA 4BW1A 5I40A 4QSVA 4C66A 3U5JA 4PCEA 4LDFA 4TU4A 5A5RA 5F36A 3UV5A 2YQDA 5IBNA 5CQTA 4YYMA 5ENBA 5EWWA 4Q0NA 5DBMA 2L84A 5EU1A 4TYLA 4NYVA 5HM0A 5HQ6A 2R10A 4LRGA 5FH6A 4J3IA 5FG4A 5EV9A 2E7NA 4NUEA 5HRWA 5CY9A 5D24A 4A9NA 5D3SA 5F60A 5IG6A 4YYJA 4XY8A 2D9EA 5F5ZA 5FH8A 3UVYA 4N4IA 5E9LA 4UIXA 2DVVA 5IGNA 4TT2A 4TZ8A 2YEKA 5E3DA 5ENCA 4Y03A 5CRMA 5F2PA 5DX4A 2YW5A 5KTWA 3ONIA 5DW2A 5EI4A 5I7XA 5C7NA 4TS8A 5HCLA 2WP1A 4A9HA 4UITA 4YBTA 4O7BA 5ETBA 4CLBA 4HBYA 5CGPA 4IOQA 4MR3A 1WUGA 4A9KA 5ENGA 3U5MA 5FDZA 5COIA 3JVLA 4QSQA 5HRVA 3AADA 4A9FA 4MEQA 5LKUA 2N9GA 5LKXA 4TTEA 4YH4A 4O7EA 5F1LA 5KU3A 3UVWA 4QSWA 4N4FA 5CUGA 3U5OA 4OGIA 5DY7A 2E3KA 4O74A 5EWHA 1F68A 3HMHA 4QSTA 2R0SA 4IR6A 4ALGA 3MB4A 2DATA 5CUDA 4BJXA 4QC1A 5F25A 5A5PA 4NRCA 5L98A 4Z6HA 3NXBA 5KO4A 5D3LA 4HXLA 3ZYUA 3QZSA 4O70A 4QB3A 5CUAA 5D26A 5BT5A 3LXJA 4HXRA 5D3PA 5BT4A 5DKHA 2L85A 1JM4B 4HXSA 4XYAA 3P5OA 2R0YA 4ALHA 4IR4A 2YDWA 4E96A 5DYXA 2YELA 5C4QA 5DKCA 5JWMA 5A5SA 1N72A 5KTXA 2I7KA 5IGKA 1EQFA 4MR6A 4O77A 5ENHA 4QR3A 5A82A 4BW3A 5FE3A 4MENA 3MXFA 5DLZA 5FE9A 3JVMA 5EPBA 5CFWA 4MEOA 5L8TA 4A9EA 4YYKA 5L8UA 4OGJA 2FSAA 1E6IA 4QUUA 4MR4A 4QR4A 4QUTA 5CQ8A 5FB0A 4A9JA 5EQ1A 4A9IA 4O71A 5HQ7A 5CQ7A 5AD2A 5CP5A 4XUAA 5EWVA 4QSSA 4NR6A 3DAIA 5EGUA 2E7OA 3MB3A 4LYSA 5CQAA 5F1HA 4CFKA 5FBXA 4QYLA 4YBSA 4PCIA 3FKMX 2OO1A 4TQNA 2YYNA 4NXJA 3AQAA 4Z1QA 5DLXA 5EISA 3G0LA 3O37A 4CUPA 4O7CA 4LZRA 3LQHA 5I83A 4IR3A 4LZSA 4O75A 4Z1SA 5CZGA 3SVFA 5LKZA 5AD3A 4HXKA 2H60A 4OUFA 3Q2EA 5D3TA 5CUCA 5A83A 4O76A 2DVQA 4KCXA 5LJ0A 4BW4A 2RS9B 4KV1A 3U5NA 4J0RA 3IU6A 4HXMA 4PKLA 4GPJA 3QZTA 5I1QA 4TT6A 3O36A 3UW9A 4QYDA 5FFWA 5KHMA 2L5EA 5E9MA 5E7DA 4HBWA 5A85A 5E9IA 2RI7A 5ENFA 5H1UA 4N3WA 4UYFB 5CUEA 4CL9A 5FE8A 5C8GA 4LYWA 3LJWA 5II2A 5C89A 2OSSA 5FE7A 2RNXA 5EK9A 4QSUA 4F3IA 4YY4A 5HFQA 5EWDA 4WHWA 4YC9A 2R0VA 5H1VA 2MJVB 4UIUA 3G0JA 5A5QA 5HQ5A 4QEUA 4UIZA 5K29A 4YADA 5E9VA 5LJ1A 4LC2A 5FFYA 4O7AA 4NS5A 3LQJA 2WP2A 4XUBA 5CPEA 5D3NA 3U5LA 5C85A 5I7YA 4YY6A 4QY4A 5DFDA 3LQIA 4O78A 4BW2A 5EICA 4NQMA 3SVHA 4WIVA 4QSXA 5DFBA 5IGLA 5CTLA 5DYAA 1JSPB 3P1EA 2D82A 5KTUA 3U5KA 4ZC9A 5EPRA 4HXNA 5I89A 3S92A 5G4SA 4QZSA 5CQ4A 5FB1A 4HXPA 3I3JA 4CURA 2F6NA 5L96A 5CUBA 5EWCA 4PY6A 3S91A 2DKWA 5FE1A 5DYCA 5I80A 4YABA 4J0SA 4DONA 5CQ5A 5D3JA 1X0JA 2G4AA 5AMEA 5HFRA 4CUTA 5LVRA 2OUOA 2RNYA 4QEVA 5LVQA 5LUUA 3UVDA 3TLPA 5EPSA 4YYDA 4J1PA 5HELA 5FH7A 5FFVA 4MR5A 4XY9A 5E9KA 5ENEA 3HMFA 4Z6IA 4ZW1A 5J0DA 2YEMA 5EVAA 4YBMA 3QZVA 4QC3A 4UYFA 3UV2A 4A9MA 3GG3A 4QBMA 4A9LA 5FE5A 4NUDA 3JVKA 3UVXA 5C87A 2KTBB 4QEWA 5TB6A 4QSRA 3U5PA 4LR6A 5HRXA 4A9OA 4UYHA 4YH3A 5D3HA 5H1TA 5JI8A 4N4GA 3UV4A 4YYNA 5HENA 5F63A 5D25A 5DYUA 4CUUA 3JVJA 4TU6A 4LZ2A 5DFCA 4IORA 4UYDA 4AKNA 4HBVA 4MEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DW1 A;  3D7C A;  3P1D A;  3O35 A;  4YAT A;  4PTB A;  1ZS5 A;  4HXO A;  5I86 A;  3MUL A;  3RCW A;  3DWY A;  5E73 A;  4N4H A;  5FE4 A;  4YYH A;  4X2I A;  5D3R A;  5E3G A;  4YAX A;  5L97 A;  3MQM A;  5E9Y A;  4HBX A;  4TT4 A;  5IGM A;  5ENJ A;  5I88 A;  3P1C A;  2RFJ A;  4CUQ A;  3P1F A;  3Q2F A;  5FE6 A;  5HJC A;  2I8N A;  4PS5 A;  5TCM A;  4UYG A;  5II1 A;  2NXB A;  4NR7 A;  1WUM A;  3HME A;  4IOO A;  5EA1 A;  4C67 A;  5E74 A;  5L99 A;  5EP7 A;  5EM3 A;  5HEM A;  5FG5 A;  5AMF A;  5D0C A;  5A5O A;  5D7X A;  2DVR A;  4NR8 A;  4YK0 A;  5F62 A;  4WHU A;  5FE2 A;  2F6J A;  5A81 A;  5CS8 A;  4QSP A;  4RVR A;  4CFL A;  2DVS A;  4IR5 A;  5G4R A;  5H85 A;  3SVG A;  5CQ6 A;  4NR5 A;  4NR9 A;  5HLS A;  2DWW A;  4YYI A;  5F61 A;  3O34 A;  4KV4 A;  4NYX A;  4O7F A;  4UIW A;  4NRA A;  5BT3 A;  5CU8 A;  5LKT A;  4NUC A;  4FLP A;  2GRC A;  4QNS A;  4NYW A;  4LYI A;  4UIY A;  5CQ3 A;  5A5N A;  5ACY A;  5I29 A;  5CRZ A;  2RNW A;  4ZQL A;  4UIV A;  4NR4 A;  5ETD A;  5F3A A;  4YYG A;  5IID A;  2RO1 A;  4UYE A;  5FG6 A;  5DKD A;  5A7C A;  4TZ2 A;  3MUK A;  4NQN A;  5ENI A;  4Z93 A;  3O33 A;  4QR5 A;  4Q0O A;  3K2J A;  4O72 A;  3IU5 A;  5LJ2 A;  2LSP B;  5E0R A;  4NRB A;  4CUS A;  5FE0 A;  4BHW A;  4BW1 A;  5I40 A;  4QSV A;  4C66 A;  3U5J A;  4PCE A;  4LDF A;  4TU4 A;  5A5R A;  5F36 A;  3UV5 A;  2YQD A;  5IBN A;  5CQT A;  4YYM A;  5ENB A;  5EWW A;  4Q0N A;  5DBM A;  2L84 A;  5EU1 A;  4TYL A;  4NYV A;  5HM0 A;  5HQ6 A;  2R10 A;  4LRG A;  5FH6 A;  4J3I A;  5FG4 A;  5EV9 A;  2E7N A;  4NUE A;  5HRW A;  5CY9 A;  5D24 A;  4A9N A;  5D3S A;  5F60 A;  5IG6 A;  4YYJ A;  4XY8 A;  2D9E A;  5F5Z A;  5FH8 A;  3UVY A;  4N4I A;  5E9L A;  4UIX A;  2DVV A;  5IGN A;  4TT2 A;  4TZ8 A;  2YEK A;  5E3D A;  5ENC A;  4Y03 A;  5CRM A;  5F2P A;  5DX4 A;  2YW5 A;  5KTW A;  3ONI A;  5DW2 A;  5EI4 A;  5I7X A;  5C7N A;  4TS8 A;  5HCL A;  2WP1 A;  4A9H A;  4UIT A;  4YBT A;  4O7B A;  5ETB A;  4CLB A;  4HBY A;  5CGP A;  4IOQ A;  4MR3 A;  1WUG A;  4A9K A;  5ENG A;  3U5M A;  5FDZ A;  5COI A;  3JVL A;  4QSQ A;  5HRV A;  3AAD A;  4A9F A;  4MEQ A;  5LKU A;  2N9G A;  5LKX A;  4TTE A;  4YH4 A;  4O7E A;  5F1L A;  5KU3 A;  3UVW A;  4QSW A;  4N4F A;  5CUG A;  3U5O A;  4OGI A;  5DY7 A;  2E3K A;  4O74 A;  5EWH A;  1F68 A;  3HMH A;  4QST A;  2R0S A;  4IR6 A;  4ALG A;  3MB4 A;  2DAT A;  5CUD A;  4BJX A;  4QC1 A;  5F25 A;  5A5P A;  4NRC A;  5L98 A;  4Z6H A;  3NXB A;  5KO4 A;  5D3L A;  4HXL A;  3ZYU A;  3QZS A;  4O70 A;  4QB3 A;  5CUA A;  5D26 A;  5BT5 A;  3LXJ A;  4HXR A;  5D3P A;  5BT4 A;  5DKH A;  2L85 A;  1JM4 B;  4HXS A;  4XYA A;  3P5O A;  2R0Y A;  4ALH A;  4IR4 A;  2YDW A;  4E96 A;  5DYX A;  2YEL A;  5C4Q A;  5DKC A;  5JWM A;  5A5S A;  1N72 A;  5KTX A;  2I7K A;  5IGK A;  1EQF A;  4MR6 A;  4O77 A;  5ENH A;  4QR3 A;  5A82 A;  4BW3 A;  5FE3 A;  4MEN A;  3MXF A;  5DLZ A;  5FE9 A;  3JVM A;  5EPB A;  5CFW A;  4MEO A;  5L8T A;  4A9E A;  4YYK A;  5L8U A;  4OGJ A;  2FSA A;  1E6I A;  4QUU A;  4MR4 A;  4QR4 A;  4QUT A;  5CQ8 A;  5FB0 A;  4A9J A;  5EQ1 A;  4A9I A;  4O71 A;  5HQ7 A;  5CQ7 A;  5AD2 A;  5CP5 A;  4XUA A;  5EWV A;  4QSS A;  4NR6 A;  3DAI A;  5EGU A;  2E7O A;  3MB3 A;  4LYS A;  5CQA A;  5F1H A;  4CFK A;  5FBX A;  4QYL A;  4YBS A;  4PCI A;  3FKM X;  2OO1 A;  4TQN A;  2YYN A;  4NXJ A;  3AQA A;  4Z1Q A;  5DLX A;  5EIS A;  3G0L A;  3O37 A;  4CUP A;  4O7C A;  4LZR A;  3LQH A;  5I83 A;  4IR3 A;  4LZS A;  4O75 A;  4Z1S A;  5CZG A;  3SVF A;  5LKZ A;  5AD3 A;  4HXK A;  2H60 A;  4OUF A;  3Q2E A;  5D3T A;  5CUC A;  5A83 A;  4O76 A;  2DVQ A;  4KCX A;  5LJ0 A;  4BW4 A;  2RS9 B;  4KV1 A;  3U5N A;  4J0R A;  3IU6 A;  4HXM A;  4PKL A;  4GPJ A;  3QZT A;  5I1Q A;  4TT6 A;  3O36 A;  3UW9 A;  4QYD A;  5FFW A;  5KHM A;  2L5E A;  5E9M A;  5E7D A;  4HBW A;  5A85 A;  5E9I A;  2RI7 A;  5ENF A;  5H1U A;  4N3W A;  4UYF B;  5CUE A;  4CL9 A;  5FE8 A;  5C8G A;  4LYW A;  3LJW A;  5II2 A;  5C89 A;  2OSS A;  5FE7 A;  2RNX A;  5EK9 A;  4QSU A;  4F3I A;  4YY4 A;  5HFQ A;  5EWD A;  4WHW A;  4YC9 A;  2R0V A;  5H1V A;  2MJV B;  4UIU A;  3G0J A;  5A5Q A;  5HQ5 A;  4QEU A;  4UIZ A;  5K29 A;  4YAD A;  5E9V A;  5LJ1 A;  4LC2 A;  5FFY A;  4O7A A;  4NS5 A;  3LQJ A;  2WP2 A;  4XUB A;  5CPE A;  5D3N A;  3U5L A;  5C85 A;  5I7Y A;  4YY6 A;  4QY4 A;  5DFD A;  3LQI A;  4O78 A;  4BW2 A;  5EIC A;  4NQM A;  3SVH A;  4WIV A;  4QSX A;  5DFB A;  5IGL A;  5CTL A;  5DYA A;  1JSP B;  3P1E A;  2D82 A;  5KTU A;  3U5K A;  4ZC9 A;  5EPR A;  4HXN A;  5I89 A;  3S92 A;  5G4S A;  4QZS A;  5CQ4 A;  5FB1 A;  4HXP A;  3I3J A;  4CUR A;  2F6N A;  5L96 A;  5CUB A;  5EWC A;  4PY6 A;  3S91 A;  2DKW A;  5FE1 A;  5DYC A;  5I80 A;  4YAB A;  4J0S A;  4DON A;  5CQ5 A;  5D3J A;  1X0J A;  2G4A A;  5AME A;  5HFR A;  4CUT A;  5LVR A;  2OUO A;  2RNY A;  4QEV A;  5LVQ A;  5LUU A;  3UVD A;  3TLP A;  5EPS A;  4YYD A;  4J1P A;  5HEL A;  5FH7 A;  5FFV A;  4MR5 A;  4XY9 A;  5E9K A;  5ENE A;  3HMF A;  4Z6I A;  4ZW1 A;  5J0D A;  2YEM A;  5EVA A;  4YBM A;  3QZV A;  4QC3 A;  4UYF A;  3UV2 A;  4A9M A;  3GG3 A;  4QBM A;  4A9L A;  5FE5 A;  4NUD A;  3JVK A;  3UVX A;  5C87 A;  2KTB B;  4QEW A;  5TB6 A;  4QSR A;  3U5P A;  4LR6 A;  5HRX A;  4A9O A;  4UYH A;  4YH3 A;  5D3H A;  5H1T A;  5JI8 A;  4N4G A;  3UV4 A;  4YYN A;  5HEN A;  5F63 A;  5D25 A;  5DYU A;  4CUU A;  3JVJ A;  4TU6 A;  4LZ2 A;  5DFC A;  4IOR A;  4UYD A;  4AKN A;  4HBV A;  4MEP A; 
#chains in the Genus database with same CATH topology
 5DW1 A;  3D7C A;  3P1D A;  3O35 A;  4YAT A;  4PTB A;  1ZS5 A;  4HXO A;  5I86 A;  3MUL A;  3RCW A;  3DWY A;  5E73 A;  4N4H A;  5FE4 A;  4YYH A;  4X2I A;  5D3R A;  5E3G A;  4YAX A;  5L97 A;  3MQM A;  5E9Y A;  4HBX A;  4TT4 A;  5IGM A;  5ENJ A;  5I88 A;  3P1C A;  2RFJ A;  4CUQ A;  3P1F A;  3Q2F A;  5FE6 A;  5HJC A;  2I8N A;  4PS5 A;  5TCM A;  4UYG A;  5II1 A;  2NXB A;  4NR7 A;  1WUM A;  3HME A;  4IOO A;  5EA1 A;  4C67 A;  5E74 A;  5L99 A;  5EP7 A;  5EM3 A;  5HEM A;  5FG5 A;  5AMF A;  5D0C A;  5A5O A;  5D7X A;  2DVR A;  4NR8 A;  4YK0 A;  5F62 A;  4WHU A;  5FE2 A;  2F6J A;  5A81 A;  5CS8 A;  4QSP A;  4RVR A;  4CFL A;  2DVS A;  4IR5 A;  5G4R A;  5H85 A;  3SVG A;  5CQ6 A;  4NR5 A;  4NR9 A;  5HLS A;  2DWW A;  4YYI A;  5F61 A;  3O34 A;  4KV4 A;  4NYX A;  4O7F A;  4UIW A;  4NRA A;  5BT3 A;  5CU8 A;  5LKT A;  4NUC A;  4FLP A;  2GRC A;  4QNS A;  4NYW A;  4LYI A;  4UIY A;  5CQ3 A;  5A5N A;  5ACY A;  5I29 A;  5CRZ A;  2RNW A;  4ZQL A;  4UIV A;  4NR4 A;  5ETD A;  5F3A A;  4YYG A;  5IID A;  2RO1 A;  4UYE A;  5FG6 A;  5DKD A;  5A7C A;  4TZ2 A;  3MUK A;  4NQN A;  5ENI A;  4Z93 A;  3O33 A;  4QR5 A;  4Q0O A;  3K2J A;  4O72 A;  3IU5 A;  5LJ2 A;  2LSP B;  5E0R A;  4NRB A;  4CUS A;  5FE0 A;  4BHW A;  4BW1 A;  5I40 A;  4QSV A;  4C66 A;  3U5J A;  4PCE A;  4LDF A;  4TU4 A;  5A5R A;  5F36 A;  3UV5 A;  2YQD A;  5IBN A;  5CQT A;  4YYM A;  5ENB A;  5EWW A;  4Q0N A;  5DBM A;  2L84 A;  5EU1 A;  4TYL A;  4NYV A;  5HM0 A;  5HQ6 A;  2R10 A;  4LRG A;  5FH6 A;  4J3I A;  5FG4 A;  5EV9 A;  2E7N A;  4NUE A;  5HRW A;  5CY9 A;  5D24 A;  4A9N A;  5D3S A;  5F60 A;  5IG6 A;  4YYJ A;  4XY8 A;  2D9E A;  5F5Z A;  5FH8 A;  3UVY A;  4N4I A;  5E9L A;  4UIX A;  2DVV A;  5IGN A;  4TT2 A;  4TZ8 A;  2YEK A;  3VKG A;  5E3D A;  5ENC A;  4Y03 A;  3ERR A;  5CRM A;  5F2P A;  5DX4 A;  2YW5 A;  5KTW A;  3ONI A;  5DW2 A;  5EI4 A;  5I7X A;  5C7N A;  4TS8 A;  5HCL A;  2WP1 A;  4A9H A;  4UIT A;  4YBT A;  4O7B A;  5ETB A;  4CLB A;  4HBY A;  5CGP A;  4IOQ A;  4MR3 A;  1WUG A;  4A9K A;  5ENG A;  3U5M A;  5FDZ A;  5COI A;  3JVL A;  4QSQ A;  5HRV A;  3AAD A;  4A9F A;  4MEQ A;  5LKU A;  2N9G A;  5LKX A;  4TTE A;  4YH4 A;  4O7E A;  5F1L A;  5KU3 A;  3UVW A;  4QSW A;  4N4F A;  5CUG A;  3U5O A;  4OGI A;  5DY7 A;  2E3K A;  4O74 A;  5EWH A;  1F68 A;  3HMH A;  4QST A;  2R0S A;  4IR6 A;  4ALG A;  3MB4 A;  2DAT A;  5CUD A;  4BJX A;  3D1B A;  4QC1 A;  5F25 A;  3D1D A;  5A5P A;  4NRC A;  5L98 A;  4Z6H A;  4AI6 A;  3NXB A;  5KO4 A;  5D3L A;  4HXL A;  3ZYU A;  3QZS A;  4O70 A;  4QB3 A;  5CUA A;  5D26 A;  5BT5 A;  3LXJ A;  4HXR A;  5D3P A;  5BT4 A;  5DKH A;  2L85 A;  1JM4 B;  4HXS A;  4XYA A;  3P5O A;  2R0Y A;  4ALH A;  4IR4 A;  2YDW A;  4E96 A;  5DYX A;  2YEL A;  5C4Q A;  5DKC A;  5JWM A;  5A5S A;  1N72 A;  5KTX A;  2I7K A;  5IGK A;  1EQF A;  4MR6 A;  4O77 A;  5ENH A;  4QR3 A;  5A82 A;  4BW3 A;  5FE3 A;  4MEN A;  3MXF A;  5DLZ A;  5FE9 A;  3JVM A;  5EPB A;  5CFW A;  4MEO A;  5L8T A;  4A9E A;  4YYK A;  5L8U A;  4OGJ A;  2FSA A;  1E6I A;  4QUU A;  4MR4 A;  2EJN A;  4QR4 A;  4QUT A;  5CQ8 A;  5FB0 A;  4A9J A;  5EQ1 A;  4A9I A;  4O71 A;  5HQ7 A;  5CQ7 A;  5AD2 A;  5CP5 A;  4XUA A;  5EWV A;  1ZKR A;  4QSS A;  4NR6 A;  3DAI A;  5EGU A;  2E7O A;  3MB3 A;  4LYS A;  5CQA A;  5F1H A;  4CFK A;  5FBX A;  4QYL A;  4YBS A;  4PCI A;  3FKM X;  2OO1 A;  4TQN A;  2YYN A;  4NXJ A;  3AQA A;  4Z1Q A;  5DLX A;  5EIS A;  3G0L A;  3O37 A;  4CUP A;  4O7C A;  4LZR A;  3LQH A;  5I83 A;  4IR3 A;  4LZS A;  4O75 A;  4Z1S A;  4AKI A;  5CZG A;  3SVF A;  5LKZ A;  5AD3 A;  4HXK A;  2H60 A;  4OUF A;  3Q2E A;  5D3T A;  5CUC A;  5A83 A;  4O76 A;  2DVQ A;  4KCX A;  5LJ0 A;  4BW4 A;  2RS9 B;  4KV1 A;  3U5N A;  4J0R A;  3IU6 A;  4HXM A;  4PKL A;  4GPJ A;  3QZT A;  5I1Q A;  4TT6 A;  3O36 A;  3UW9 A;  4QYD A;  5FFW A;  5KHM A;  2L5E A;  5E9M A;  5E7D A;  4HBW A;  5A85 A;  5E9I A;  2RI7 A;  5ENF A;  5H1U A;  4N3W A;  4UYF B;  5CUE A;  4CL9 A;  5FE8 A;  5C8G A;  3VKH A;  4LYW A;  3LJW A;  5II2 A;  5C89 A;  2OSS A;  5FE7 A;  2RNX A;  5EK9 A;  4QSU A;  4F3I A;  4YY4 A;  5HFQ A;  5EWD A;  4WHW A;  4YC9 A;  2R0V A;  5H1V A;  2MJV B;  4UIU A;  3G0J A;  5A5Q A;  5HQ5 A;  4QEU A;  4UIZ A;  5K29 A;  4YAD A;  5E9V A;  5LJ1 A;  4LC2 A;  5FFY A;  1PUO A;  4O7A A;  4NS5 A;  3LQJ A;  2WP2 A;  4XUB A;  5CPE A;  5D3N A;  3U5L A;  5C85 A;  5I7Y A;  4YY6 A;  4QY4 A;  5DFD A;  3LQI A;  4O78 A;  4BW2 A;  5EIC A;  4NQM A;  3SVH A;  4WIV A;  4QSX A;  5DFB A;  5IGL A;  5CTL A;  5DYA A;  1JSP B;  3P1E A;  2D82 A;  5KTU A;  3U5K A;  4ZC9 A;  5EPR A;  4HXN A;  5I89 A;  3S92 A;  5G4S A;  4QZS A;  5CQ4 A;  5FB1 A;  4HXP A;  3I3J A;  4CUR A;  2F6N A;  5L96 A;  5CUB A;  5EWC A;  4PY6 A;  3S91 A;  2DKW A;  5FE1 A;  5DYC A;  5I80 A;  4YAB A;  4J0S A;  4DON A;  5CQ5 A;  5D3J A;  1X0J A;  2G4A A;  5AME A;  5HFR A;  4CUT A;  5LVR A;  2OUO A;  2RNY A;  4QEV A;  5LVQ A;  5LUU A;  3UVD A;  3TLP A;  5EPS A;  4YYD A;  4J1P A;  5HEL A;  5FH7 A;  5FFV A;  4MR5 A;  4XY9 A;  5E9K A;  5ENE A;  3HMF A;  4AKH A;  4Z6I A;  4ZW1 A;  5J0D A;  2YEM A;  5EVA A;  4YBM A;  3QZV A;  4QC3 A;  4UYF A;  3UV2 A;  4A9M A;  3GG3 A;  4QBM A;  4A9L A;  5FE5 A;  4NUD A;  3JVK A;  3UVX A;  5C87 A;  2KTB B;  4QEW A;  5TB6 A;  4QSR A;  3U5P A;  4LR6 A;  5HRX A;  4A9O A;  4UYH A;  4YH3 A;  5D3H A;  5H1T A;  5JI8 A;  4N4G A;  3UV4 A;  4YYN A;  5HEN A;  5F63 A;  5D25 A;  5DYU A;  4CUU A;  3JVJ A;  4TU6 A;  4LZ2 A;  5DFC A;  4IOR A;  4AKG A;  4UYD A;  4AKN A;  4HBV A;  4MEP A; 
#chains in the Genus database with same CATH homology
 5DW1 A;  3D7C A;  3P1D A;  3O35 A;  4YAT A;  4PTB A;  1ZS5 A;  4HXO A;  5I86 A;  3MUL A;  3RCW A;  3DWY A;  5E73 A;  4N4H A;  5FE4 A;  4YYH A;  4X2I A;  5D3R A;  5E3G A;  4YAX A;  5L97 A;  3MQM A;  5E9Y A;  4HBX A;  4TT4 A;  5IGM A;  5ENJ A;  5I88 A;  3P1C A;  2RFJ A;  4CUQ A;  3P1F A;  3Q2F A;  5FE6 A;  5HJC A;  2I8N A;  4PS5 A;  5TCM A;  4UYG A;  5II1 A;  2NXB A;  4NR7 A;  1WUM A;  3HME A;  4IOO A;  5EA1 A;  4C67 A;  5E74 A;  5L99 A;  5EP7 A;  5EM3 A;  5HEM A;  5FG5 A;  5AMF A;  5D0C A;  5A5O A;  5D7X A;  2DVR A;  4NR8 A;  4YK0 A;  5F62 A;  4WHU A;  5FE2 A;  2F6J A;  5A81 A;  5CS8 A;  4QSP A;  4RVR A;  4CFL A;  2DVS A;  4IR5 A;  5G4R A;  5H85 A;  3SVG A;  5CQ6 A;  4NR5 A;  4NR9 A;  5HLS A;  2DWW A;  4YYI A;  5F61 A;  3O34 A;  4KV4 A;  4NYX A;  4O7F A;  4UIW A;  4NRA A;  5BT3 A;  5CU8 A;  5LKT A;  4NUC A;  4FLP A;  2GRC A;  4QNS A;  4NYW A;  4LYI A;  4UIY A;  5CQ3 A;  5A5N A;  5ACY A;  5I29 A;  5CRZ A;  2RNW A;  4ZQL A;  4UIV A;  4NR4 A;  5ETD A;  5F3A A;  4YYG A;  5IID A;  2RO1 A;  4UYE A;  5FG6 A;  5DKD A;  5A7C A;  4TZ2 A;  3MUK A;  4NQN A;  5ENI A;  4Z93 A;  3O33 A;  4QR5 A;  4Q0O A;  3K2J A;  4O72 A;  3IU5 A;  5LJ2 A;  2LSP B;  5E0R A;  4NRB A;  4CUS A;  5FE0 A;  4BHW A;  4BW1 A;  5I40 A;  4QSV A;  4C66 A;  3U5J A;  4PCE A;  4LDF A;  4TU4 A;  5A5R A;  5F36 A;  3UV5 A;  2YQD A;  5IBN A;  5CQT A;  4YYM A;  5ENB A;  5EWW A;  4Q0N A;  5DBM A;  2L84 A;  5EU1 A;  4TYL A;  4NYV A;  5HM0 A;  5HQ6 A;  2R10 A;  4LRG A;  5FH6 A;  4J3I A;  5FG4 A;  5EV9 A;  2E7N A;  4NUE A;  5HRW A;  5CY9 A;  5D24 A;  4A9N A;  5D3S A;  5F60 A;  5IG6 A;  4YYJ A;  4XY8 A;  2D9E A;  5F5Z A;  5FH8 A;  3UVY A;  4N4I A;  5E9L A;  4UIX A;  2DVV A;  5IGN A;  4TT2 A;  4TZ8 A;  2YEK A;  5E3D A;  5ENC A;  4Y03 A;  5CRM A;  5F2P A;  5DX4 A;  2YW5 A;  5KTW A;  3ONI A;  5DW2 A;  5EI4 A;  5I7X A;  5C7N A;  4TS8 A;  5HCL A;  2WP1 A;  4A9H A;  4UIT A;  4YBT A;  4O7B A;  5ETB A;  4CLB A;  4HBY A;  5CGP A;  4IOQ A;  4MR3 A;  1WUG A;  4A9K A;  5ENG A;  3U5M A;  5FDZ A;  5COI A;  3JVL A;  4QSQ A;  5HRV A;  3AAD A;  4A9F A;  4MEQ A;  5LKU A;  2N9G A;  5LKX A;  4TTE A;  4YH4 A;  4O7E A;  5F1L A;  5KU3 A;  3UVW A;  4QSW A;  4N4F A;  5CUG A;  3U5O A;  4OGI A;  5DY7 A;  2E3K A;  4O74 A;  5EWH A;  1F68 A;  3HMH A;  4QST A;  2R0S A;  4IR6 A;  4ALG A;  3MB4 A;  2DAT A;  5CUD A;  4BJX A;  4QC1 A;  5F25 A;  5A5P A;  4NRC A;  5L98 A;  4Z6H A;  3NXB A;  5KO4 A;  5D3L A;  4HXL A;  3ZYU A;  3QZS A;  4O70 A;  4QB3 A;  5CUA A;  5D26 A;  5BT5 A;  3LXJ A;  4HXR A;  5D3P A;  5BT4 A;  5DKH A;  2L85 A;  1JM4 B;  4HXS A;  4XYA A;  3P5O A;  2R0Y A;  4ALH A;  4IR4 A;  2YDW A;  4E96 A;  5DYX A;  2YEL A;  5C4Q A;  5DKC A;  5JWM A;  5A5S A;  1N72 A;  5KTX A;  2I7K A;  5IGK A;  1EQF A;  4MR6 A;  4O77 A;  5ENH A;  4QR3 A;  5A82 A;  4BW3 A;  5FE3 A;  4MEN A;  3MXF A;  5DLZ A;  5FE9 A;  3JVM A;  5EPB A;  5CFW A;  4MEO A;  5L8T A;  4A9E A;  4YYK A;  5L8U A;  4OGJ A;  2FSA A;  1E6I A;  4QUU A;  4MR4 A;  4QR4 A;  4QUT A;  5CQ8 A;  5FB0 A;  4A9J A;  5EQ1 A;  4A9I A;  4O71 A;  5HQ7 A;  5CQ7 A;  5AD2 A;  5CP5 A;  4XUA A;  5EWV A;  4QSS A;  4NR6 A;  3DAI A;  5EGU A;  2E7O A;  3MB3 A;  4LYS A;  5CQA A;  5F1H A;  4CFK A;  5FBX A;  4QYL A;  4YBS A;  4PCI A;  3FKM X;  2OO1 A;  4TQN A;  2YYN A;  4NXJ A;  3AQA A;  4Z1Q A;  5DLX A;  5EIS A;  3G0L A;  3O37 A;  4CUP A;  4O7C A;  4LZR A;  3LQH A;  5I83 A;  4IR3 A;  4LZS A;  4O75 A;  4Z1S A;  5CZG A;  3SVF A;  5LKZ A;  5AD3 A;  4HXK A;  2H60 A;  4OUF A;  3Q2E A;  5D3T A;  5CUC A;  5A83 A;  4O76 A;  2DVQ A;  4KCX A;  5LJ0 A;  4BW4 A;  2RS9 B;  4KV1 A;  3U5N A;  4J0R A;  3IU6 A;  4HXM A;  4PKL A;  4GPJ A;  3QZT A;  5I1Q A;  4TT6 A;  3O36 A;  3UW9 A;  4QYD A;  5FFW A;  5KHM A;  2L5E A;  5E9M A;  5E7D A;  4HBW A;  5A85 A;  5E9I A;  2RI7 A;  5ENF A;  5H1U A;  4N3W A;  4UYF B;  5CUE A;  4CL9 A;  5FE8 A;  5C8G A;  4LYW A;  3LJW A;  5II2 A;  5C89 A;  2OSS A;  5FE7 A;  2RNX A;  5EK9 A;  4QSU A;  4F3I A;  4YY4 A;  5HFQ A;  5EWD A;  4WHW A;  4YC9 A;  2R0V A;  5H1V A;  2MJV B;  4UIU A;  3G0J A;  5A5Q A;  5HQ5 A;  4QEU A;  4UIZ A;  5K29 A;  4YAD A;  5E9V A;  5LJ1 A;  4LC2 A;  5FFY A;  4O7A A;  4NS5 A;  3LQJ A;  2WP2 A;  4XUB A;  5CPE A;  5D3N A;  3U5L A;  5C85 A;  5I7Y A;  4YY6 A;  4QY4 A;  5DFD A;  3LQI A;  4O78 A;  4BW2 A;  5EIC A;  4NQM A;  3SVH A;  4WIV A;  4QSX A;  5DFB A;  5IGL A;  5CTL A;  5DYA A;  1JSP B;  3P1E A;  2D82 A;  5KTU A;  3U5K A;  4ZC9 A;  5EPR A;  4HXN A;  5I89 A;  3S92 A;  5G4S A;  4QZS A;  5CQ4 A;  5FB1 A;  4HXP A;  3I3J A;  4CUR A;  2F6N A;  5L96 A;  5CUB A;  5EWC A;  4PY6 A;  3S91 A;  2DKW A;  5FE1 A;  5DYC A;  5I80 A;  4YAB A;  4J0S A;  4DON A;  5CQ5 A;  5D3J A;  1X0J A;  2G4A A;  5AME A;  5HFR A;  4CUT A;  5LVR A;  2OUO A;  2RNY A;  4QEV A;  5LVQ A;  5LUU A;  3UVD A;  3TLP A;  5EPS A;  4YYD A;  4J1P A;  5HEL A;  5FH7 A;  5FFV A;  4MR5 A;  4XY9 A;  5E9K A;  5ENE A;  3HMF A;  4Z6I A;  4ZW1 A;  5J0D A;  2YEM A;  5EVA A;  4YBM A;  3QZV A;  4QC3 A;  4UYF A;  3UV2 A;  4A9M A;  3GG3 A;  4QBM A;  4A9L A;  5FE5 A;  4NUD A;  3JVK A;  3UVX A;  5C87 A;  2KTB B;  4QEW A;  5TB6 A;  4QSR A;  3U5P A;  4LR6 A;  5HRX A;  4A9O A;  4UYH A;  4YH3 A;  5D3H A;  5H1T A;  5JI8 A;  4N4G A;  3UV4 A;  4YYN A;  5HEN A;  5F63 A;  5D25 A;  5DYU A;  4CUU A;  3JVJ A;  4TU6 A;  4LZ2 A;  5DFC A;  4IOR A;  4UYD A;  4AKN A;  4HBV A;  4MEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...