5A8IA

Crystal structure of the fha domain of arna from sulfolobus acidocaldarius
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
PTNRYYIYFIQTPNENLVNKKVLLNFDLFPSVSMGRSPENIVIVPDSEVSRKHAVIYLDNSELYIEDLNSTNGTYVYDGKQFTPIKGKQKIEPNSIIKLGNQTIVRILKEWSHPQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARNA
publication title Phosphorylation-Dependent Interaction between an Archaeal Von Willebrand and Fha Domain Recruits Arna-Arnb Complex to DNA for Repression of Motility
rcsb
source organism Sulfolobus acidocaldarius
molecule tags Transcription
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00498 FHA FHA domain
A PF13240 zinc_ribbon_2 zinc-ribbon domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 5a8iA00
2KB3A 2JQLA 2CSWA 1J4OA 3UV0A 1FHQA 2LC1A 5E50A 2FEZA 4EJQA 1G3GA 1QU5A 3FM8A 4D9VA 1DMZA 1K2MA 1J4LA 3UNMA 5DJOA 3OUNA 2KB4A 4JONA 1UJXA 1K3NA 1K3JA 3UNNA 3GQSA 2JQIA 2A0TA 1UHTA 3HUEA 3UOTA 1WV3A 1J4KA 2KFUA 2JQJA 2G1LA 2XT9B 4G2SA 3HUFA 3MDBA 2JPEA 3UMZA 1GXCA 3ELSA 3HX1A 4EGXA 1YJ5C 5A8IA 1J4PA 3I6WA 1J4QA 3VA1A 2AFFA 3VPYA 1WLNA 1LGQA 1K3QA 2KKLA 3PO8A 4A0EA 1K2NA 2BRFA 1MZKA 2JKDA 1R21A 2W3OA 3I0NA 3UN0A 3ELVA 2FF4A 2PIEA 3I6UA 3I0MA 3KT9A 2EH0A 4H87A 1LGPA 3POAA 1FHRA 1YJMA 3VA4A 4QCJA 1G6GA
chains in the Genus database with same CATH superfamily
3V7WA 2KB3A 2JQLA 2CSWA 1J4OA 1U7VB 3UV0A 1FHQA 2LC1A 5E50A 1ZOQA 3DITA 2FEZA 3V8QA 5JEOA 4L02A 1G88A 3PFNA 1J2FA 1U0TA 4EJQA 2I29A 3S40A 3AFOA 1G3GA 1QU5A 3FM8A 3V8RA 2XXSA 4KU0D 3V7UA 4D9VA 5JEMA 2I2AA 1DMZA 1K2MA 1J4LA 3UNMA 5DJOA 3OUNA 5EJHA 3VZCA 2KB4A 4JIWD 4JONA 1UJXA 2JGRA 2Q5FA 1K3NA 1K3JA 2BONA 3VZDA 3UNNA 3GQSA 5JERA 5DHPA 2JQIA 4V24A 3GMJA 1KHXA 3A77A 2A0TA 1UHTA 3HUEA 3UOTA 1Z0ZA 1WV3A 5DHQA 1J4KA 3VZBA 1Y3HA 2KFUA 2JQJA 5DHTA 2P1RA 2I2FA 2QV7A 2G1LA 2XT9B 4G2SA 3HUFA 4DY6A 3MDBA 5EJFA 3V8PA 3V80A 1U0RA 2JPEA 2I2BA 3UMZA 1GXCA 3ELSA 3HX1A 4EGXA 1YJ5C 5A8IA 1J4PA 1Y3IA 3I6WA 5EJIA 4A4YA 1YGSA 4HAOA 4JIVD 1J4QA 3VA1A 1MJSA 1MR1A 2AFFA 3VPYA 1Z0SA 1MK2A 1WLNA 1LGQA 1K3QA 2KKLA 3PO8A 4A0EA 2I1WA 1K2NA 1DD1A 4WRRA 2BRFA 1MZKA 3V7YA 2JKDA 5JELA 1R21A 1Z0UA 2W3OA 4WERA 5DHRA 1YT5A 5BVIA 3I0NA 3DSHA 5EJGA 3UN0A 2AN1A 5DHSA 3ELVA 2FF4A 2PIEA 3I6UA 3V8NA 1U7FA 5JEJA 3V8MA 4R9PA 2I2DA 5JEKA 1SUWA 3I0MA 3KT9A 2EH0A 4H87A 1U7VA 1QWTA 1LGPA 3T5PA 5DHUA 3POAA 2I2CA 2QVLA 5C4VA 1DEVA 1FHRA 1YJMA 1U7FB 3VA4A 1KHUA 4QCJA 1G6GA
chains in the Genus database with same CATH topology
2KB3A 2JQLA 2CSWA 1J4OA 1U7VB 3UV0A 1FHQA 2LC1A 5E50A 1ZOQA 3DITA 2FEZA 5JEOA 4L02A 1G88A 1J2FA 4EJQA 3S40A 1G3GA 1QU5A 3FM8A 2XXSA 4KU0D 4D9VA 5JEMA 1DMZA 1K2MA 1J4LA 3UNMA 5DJOA 3OUNA 3VZCA 2KB4A 4JIWD 4JONA 1UJXA 2JGRA 1K3NA 1K3JA 2BONA 3VZDA 3UNNA 3GQSA 5JERA 2JQIA 4V24A 3GMJA 1KHXA 3A77A 2A0TA 1UHTA 3HUEA 3UOTA 1WV3A 1J4KA 3VZBA 2KFUA 2JQJA 2P1RA 2QV7A 2G1LA 2XT9B 4G2SA 3HUFA 3MDBA 2JPEA 3UMZA 1GXCA 3ELSA 3HX1A 4EGXA 1YJ5C 5A8IA 3I6WA 1J4PA 4A4YA 1YGSA 4JIVD 1J4QA 3VA1A 1MJSA 1MR1A 2AFFA 3VPYA 1MK2A 1WLNA 1LGQA 1K3QA 2KKLA 3PO8A 4A0EA 1K2NA 1DD1A 4WRRA 2BRFA 1MZKA 5JELA 2JKDA 1R21A 2W3OA 4WERA 5BVIA 3I0NA 3DSHA 3UN0A 3ELVA 2FF4A 2PIEA 3I6UA 1U7FA 5JEJA 4R9PA 5JEKA 3I0MA 3KT9A 2EH0A 4H87A 1U7VA 1QWTA 1LGPA 3T5PA 3POAA 2QVLA 5C4VA 1DEVA 1FHRA 1YJMA 1U7FB 3VA4A 1KHUA 4QCJA 1G6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KB3 A;  2JQL A;  2CSW A;  1J4O A;  3UV0 A;  1FHQ A;  2LC1 A;  5E50 A;  2FEZ A;  4EJQ A;  1G3G A;  1QU5 A;  3FM8 A;  4D9V A;  1DMZ A;  1K2M A;  1J4L A;  3UNM A;  5DJO A;  3OUN A;  2KB4 A;  4JON A;  1UJX A;  1K3N A;  1K3J A;  3UNN A;  3GQS A;  2JQI A;  2A0T A;  1UHT A;  3HUE A;  3UOT A;  1WV3 A;  1J4K A;  2KFU A;  2JQJ A;  2G1L A;  2XT9 B;  4G2S A;  3HUF A;  3MDB A;  2JPE A;  3UMZ A;  1GXC A;  3ELS A;  3HX1 A;  4EGX A;  1YJ5 C;  5A8I A;  1J4P A;  3I6W A;  1J4Q A;  3VA1 A;  2AFF A;  3VPY A;  1WLN A;  1LGQ A;  1K3Q A;  2KKL A;  3PO8 A;  4A0E A;  1K2N A;  2BRF A;  1MZK A;  2JKD A;  1R21 A;  2W3O A;  3I0N A;  3UN0 A;  3ELV A;  2FF4 A;  2PIE A;  3I6U A;  3I0M A;  3KT9 A;  2EH0 A;  4H87 A;  1LGP A;  3POA A;  1FHR A;  1YJM A;  3VA4 A;  4QCJ A;  1G6G A; 
#chains in the Genus database with same CATH topology
 3V7W A;  2KB3 A;  2JQL A;  2CSW A;  1J4O A;  1U7V B;  3UV0 A;  1FHQ A;  2LC1 A;  5E50 A;  1ZOQ A;  3DIT A;  2FEZ A;  3V8Q A;  5JEO A;  4L02 A;  1G88 A;  3PFN A;  1J2F A;  1U0T A;  4EJQ A;  2I29 A;  3S40 A;  3AFO A;  1G3G A;  1QU5 A;  3FM8 A;  3V8R A;  2XXS A;  4KU0 D;  3V7U A;  4D9V A;  5JEM A;  2I2A A;  1DMZ A;  1K2M A;  1J4L A;  3UNM A;  5DJO A;  3OUN A;  5EJH A;  3VZC A;  2KB4 A;  4JIW D;  4JON A;  1UJX A;  2JGR A;  2Q5F A;  1K3N A;  1K3J A;  2BON A;  3VZD A;  3UNN A;  3GQS A;  5JER A;  5DHP A;  2JQI A;  4V24 A;  3GMJ A;  1KHX A;  3A77 A;  2A0T A;  1UHT A;  3HUE A;  3UOT A;  1Z0Z A;  1WV3 A;  5DHQ A;  1J4K A;  3VZB A;  1Y3H A;  2KFU A;  2JQJ A;  5DHT A;  2P1R A;  2I2F A;  2QV7 A;  2G1L A;  2XT9 B;  4G2S A;  3HUF A;  4DY6 A;  3MDB A;  5EJF A;  3V8P A;  3V80 A;  1U0R A;  2JPE A;  2I2B A;  3UMZ A;  1GXC A;  3ELS A;  3HX1 A;  4EGX A;  1YJ5 C;  5A8I A;  1J4P A;  1Y3I A;  3I6W A;  5EJI A;  4A4Y A;  1YGS A;  4HAO A;  4JIV D;  1J4Q A;  3VA1 A;  1MJS A;  1MR1 A;  2AFF A;  3VPY A;  1Z0S A;  1MK2 A;  1WLN A;  1LGQ A;  1K3Q A;  2KKL A;  3PO8 A;  4A0E A;  2I1W A;  1K2N A;  1DD1 A;  4WRR A;  2BRF A;  1MZK A;  3V7Y A;  2JKD A;  5JEL A;  1R21 A;  1Z0U A;  2W3O A;  4WER A;  5DHR A;  1YT5 A;  5BVI A;  3I0N A;  3DSH A;  5EJG A;  3UN0 A;  2AN1 A;  5DHS A;  3ELV A;  2FF4 A;  2PIE A;  3I6U A;  3V8N A;  1U7F A;  5JEJ A;  3V8M A;  4R9P A;  2I2D A;  5JEK A;  1SUW A;  3I0M A;  3KT9 A;  2EH0 A;  4H87 A;  1U7V A;  1QWT A;  1LGP A;  3T5P A;  5DHU A;  3POA A;  2I2C A;  2QVL A;  5C4V A;  1DEV A;  1FHR A;  1YJM A;  1U7F B;  3VA4 A;  1KHU A;  4QCJ A;  1G6G A; 
#chains in the Genus database with same CATH homology
 2KB3 A;  2JQL A;  2CSW A;  1J4O A;  1U7V B;  3UV0 A;  1FHQ A;  2LC1 A;  5E50 A;  1ZOQ A;  3DIT A;  2FEZ A;  5JEO A;  4L02 A;  1G88 A;  1J2F A;  4EJQ A;  3S40 A;  1G3G A;  1QU5 A;  3FM8 A;  2XXS A;  4KU0 D;  4D9V A;  5JEM A;  1DMZ A;  1K2M A;  1J4L A;  3UNM A;  5DJO A;  3OUN A;  3VZC A;  2KB4 A;  4JIW D;  4JON A;  1UJX A;  2JGR A;  1K3N A;  1K3J A;  2BON A;  3VZD A;  3UNN A;  3GQS A;  5JER A;  2JQI A;  4V24 A;  3GMJ A;  1KHX A;  3A77 A;  2A0T A;  1UHT A;  3HUE A;  3UOT A;  1WV3 A;  1J4K A;  3VZB A;  2KFU A;  2JQJ A;  2P1R A;  2QV7 A;  2G1L A;  2XT9 B;  4G2S A;  3HUF A;  3MDB A;  2JPE A;  3UMZ A;  1GXC A;  3ELS A;  3HX1 A;  4EGX A;  1YJ5 C;  5A8I A;  3I6W A;  1J4P A;  4A4Y A;  1YGS A;  4JIV D;  1J4Q A;  3VA1 A;  1MJS A;  1MR1 A;  2AFF A;  3VPY A;  1MK2 A;  1WLN A;  1LGQ A;  1K3Q A;  2KKL A;  3PO8 A;  4A0E A;  1K2N A;  1DD1 A;  4WRR A;  2BRF A;  1MZK A;  5JEL A;  2JKD A;  1R21 A;  2W3O A;  4WER A;  5BVI A;  3I0N A;  3DSH A;  3UN0 A;  3ELV A;  2FF4 A;  2PIE A;  3I6U A;  1U7F A;  5JEJ A;  4R9P A;  5JEK A;  3I0M A;  3KT9 A;  2EH0 A;  4H87 A;  1U7V A;  1QWT A;  1LGP A;  3T5P A;  3POA A;  2QVL A;  5C4V A;  1DEV A;  1FHR A;  1YJM A;  1U7F B;  3VA4 A;  1KHU A;  4QCJ A;  1G6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...