5A92A

15k x-ray structure with cefotaxime: exploring the mechanism of beta- lactam ring protonation in the class a beta-lactamase acylation mechanism using neutron and x-ray crystallography
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
260
structure length
260
Chain Sequence
SVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploring the Mechanism of Beta-Lactam Ring Protonation in the Class a Beta-Lactamase Acylation Mechanism Using Neutron and X-Ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE CTX-M-97
total genus 92
structure length 260
sequence length 260
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5a92A00
1YMXA 2HDUA 1K54C 1LLBA 4GZBA 4ZTKA 3O88A 4FH2A 2EX8A 5DVAA 1EI5A 2J9PA 3HL9A 3E2KA 2JCHA 3IWQA 2WGVA 1M40A 4PM9A 4KENB 4P85A 4GDBA 4ZBEA 4S2IA 4A5RA 4B4ZA 3OPRA 3N8LA 4OKPA 2XK1A 2C6WB 5E2FA 4O7DA 2DRWA 5FI2A 3SS4A 1JTDA 3ITAA 4R3BA 2H0TA 4JXWA 5EVID 1IKGA 2BLSA 2VGJA 3Q1FA 4WZ5A 5AQ7A 1YLWA 4QJGA 4OOMA 1IYPA 1L2SA 1RP5A 4JXGA 1K56D 2ZQAA 5EVLA 3UY6A 5FSRA 5EVIC 2B5RA 3UDIA 3HLDA 1ERQA 2OV5A 4GDNA 4QY6A 1DJCA 1ES5A 1CK3A 3ZFZA 4JLFA 1ALQA 4NK3A 4BD0A 4R0QA 1Q2QA 1XPBA 4JKTA 5HW3A 2WGWB 4OLGA 4E3JA 1TEMA 4KZAA 4YFMA 3MZEA 2XH9A 3RXWA 5FQJA 5TFQA 4IVIA 3MZDA 3TSGA 3G32A 3EQUA 1PI4A 3ZDJA 4BL3A 4R4RA 2FFYA 1E3UA 5JYOA 1ONGA 2XDMA 3IXGA 4N92A 4DE2A 3PBQA 3Q7ZA 5GHZA 1FCMA 1XA7A 1K4EA 1EROA 4DKIA 4OP5A 3OCNA 3PBOA 2Q9MA 3C7VA 3HUNA 3NBLA 3NC8A 5GLBA 4KQRA 4UA7A 5TR7A 5M18A 1NY0A 2RL3A 2XLNA 2A49A 5CHUA 2ZC6B 5G18A 2JE5A 5EVIA 1NYMA 3MFDA 5F83A 3G34A 3UDXA 1ESUA 3UDFA 1KVLA 5AQ9A 1MWSA 2WYXA 4WYYA 4ZJ3A 3M2KA 4DE3A 3VSKA 3HBRA 3QNCA 3WRZA 1FOFA 4KZ6A 2WUQA 3CMZA 4QY5A 3SH8A 4BQMA 4EV4A 5KMWA 5U47A 5FAPA 4K0WA 4QB8A 3TOIA 1YLZA 3P98A 3CZDA 1XP4A 4S2NA 5EOOA 4LV1A 4Y0TA 2HDRA 4EWFA 2J8YA 3BLMA 2WAEA 4FSFA 4K91A 2PU4A 3OZHA 1HVBA 3ZHHA 1RGZA 4F94A 1YLPA 3PBNA 1PWCA 1CEFA 3PBTA 3FKVA 2WGIA 3LO7A 4HBTA 5AQAA 1NZUA 4PMAA 4S2OA 2JC7A 4U0XA 1W8YA 1XGIA 5EUAA 4IVKA 1HTZA 3V5MA 5KSCA 4UA9A 1H5XA 1K57C 2A3UA 4KZBA 1IYOA 3PBSA 1OMEA 3UPPA 3G30A 4JPMA 4CJNA 2Y2MA 1YMSA 3MXRA 5EPHA 2FFFB 1Z6FA 4PM8A 3PBRA 2VGKA 5HAIA 2Y2KA 1PI5A 3TG9A 1ONHA 3SOIA 2PU2A 5GL9A 3HLBA 2PBYA 3HVFA 3LY4A 1IYQA 2J7VA 1ZKJA 3M2JA 4OPQA 1MBLA 1LHYA 2ZM8A 4XUXA 1WYCA 1TVFA 3RJUA 5CEDA 4N1XA 3AGEA 4HBUA 2EX9A 3C4OA 3GV9A 1L0FA 5CHJA 1BZAA 5DTTA 1MWRA 3ZVWA 4E3LA 3GSGA 3UPOA 3A3IA 1QMFA 3G31A 3NCKA 5EOEA 5FATA 1QMEA 5CRFA 5A93A 2WAFA 2ZC5B 3ZNYA 1YLTA 2EFUA 1K56A 3ZG5A 4ZAMA 3Q82A 1SDEA 3E2LA 1KDSA 3DTMA 1ES2A 1KVMA 3IF5A 3NDGA 4DF6A 5DF9A 2HDQA 5DTSA 2EFXA 2H0YA 3B3XA 3MKFA 3GQZA 1ERMA 2J9OA 1KE4A 2Z2MB 1NXYA 4B88A 3CJMA 5HFOA 3RXXA 2Y2NA 4E3MA 3OCLA 1LL5A 1O7EA 4IEDA 5JYPA 2EXBA 3GVBA 4KQOA 1CEGA 3IWOA 1KGFA 1XKZA 3EQVA 2X71A 4S2KA 4X56A 3VP4A 4BENA 2ZJ9A 3BFCA 1NRFA 4D2OA 2IWCA 3S1YA 2WKIA 1DJAA 3LEZA 4GNUA 5E2HA 3BFEA 2IWDA 1BLSA 3UE3A 4C3QA 4GOGA 1U60A 1K4FA 1BLHA 4K0XA 2P9VB 1GHMA 2XFTA 4FH4A 1L0EA 1EWZA 4S2PA 3IXBA 4R4SA 4QU3A 5FI6A 4MBHA 4IBXA 2ZQ8A 3C4PA 4Y0OA 4MEZA 5HARA 5CERA 3AGDA 3LY3A 1H8YA 2H10A 1DJBA 3W4QA 4CPKA 4DE1A 1GCEA 3DW0A 3OPHA 3IF6A 3HLCA 2DNSA 3Q81A 2HP5A 2XD5A 1JWVA 4BD1A 4ZDXA 4E3NA 2P74A 4OH0A 3IF6B 4PM6A 3V39A 3P09A 3BM6A 3Q7VA 1S6RA 1GA9A 2QMIA 2WADA 4E3OA 5J8XA 5EECA 5HAPA 4QHCA 3HLGA 1I2SA 4OOYA 4N9LA 4GB7A 3W4PA 4KG2A 4E6WA 1ZG6A 1I5QA 4KG5A 1L0GA 1CI8A 4HEFA 5HX9A 2Z2LB 3VMAA 3WWXA 4X6TA 2GDNA 2CC1A 1ES4A 4L0LA 4X68A 2Y55A 3BLSA 5CGWA 5GLDA 1E3UD 3VOYA 4PM5A 2QPNA 4S2JA 4X53A 4U3TA 1K55C 3IHAA 3VSLA 3A3FA 4WZ5C 3QNBA 5CECA 2V20A 4UHUA 4WMCD 5CTNA 1Y54A 3N6IA 2XF3A 3DWZA 3IH9A 3HLEA 1BULA 4WM9A 3FKWA 2OLUA 1LI9A 1TDGA 2ZQ9A 4WBGA 3IF6C 5IHVA 3I7JA 2V1ZA 4MNRA 2XEPA 1K54A 2OLVA 4RX3A 4WEKA 3SS5A 5M19A 3OC2A 4OLDA 4WMCA 3W4OA 2EXAA 5A92A 5GLCA 1FCOA 5KZHA 1I2WA 2UWXA 3FZCA 3UO9A 1K57A 3CG5A 1FR1A 1JVJA 3IH8A 4Q8IA 4HESA 1L0DA 1YM1A 3UE1A 3BECA 1MWTA 2G2UA 1W5DA 4EUZA 3BFFA 5HL1A 2QZ6A 4PM7A 1NYYA 4LV3A 1N4OA 1NJ4A 3C7UA 5E2GA 5CEBA 4Z9QA 5D3OA 1M6KA 3IT9A 3O86A 4FCFA 1GHIA 2WKEA 1K25A 1JWZA 1YLJA 2G2WA 3ISGA 3AGFA 5FA7A 3WS4A 3IXHA 5E43A 3FWLA 1K38A 2XR0A 2ZC7A 5FQMA 1J9MA 4DDYA 4GKUA 1K6SA 3A3DA 4KZ9A 4C75A 3VP0A 2ZC4B 3ZCZA 1KGGA 3UNWA 5F1FA 2ZQDA 4LCMA 1PWGA 1SHVA 4EBPA 1PWDA 4RA7A 4RVAA 5GHXA 3S4XA 3JYIA 4N1HA 2Y4AA 5CHMA 2Y2PA 3W8KA 1WYBA 2HPBA 4OQ0A 2WK0A 4ID4A 4RX2A 3VOZA 3ZGAB 4JXVA 1MPLA 4ZJ1A 3O87A 5GHYA 1MY8A 5FQKA 2XD1A 1IKIA 3BRMA 3IQAA 4S2MA 3PTEA 5FDHA 3HLWA 3NIAA 5FQQA 4OQIA 4LV0A 4GD6A 3OPLA 4E3KA 4FD8A 2ZC3B 3ZG0A 3ZG8B 3A3JA 3GMWA 4OVDA 2XGNA 4EBLA 1BLCA 2ZLYA 1G6AA 5A90A 1XX2A 4UAAA 3Q07A 3VFHA 1BUEA 2HP9A 1XA1A 2OSUA 4OPRA 2DCFA 5FQIA 4LENA 3HREA 1MWUA 2Y2JA 4WELA 2Y59A 3IHBA 4EQIA 3WS5A 5A91A 2ZM2A 2Y2QA 1Q2PA 3O3VA 4UA6A 1ZC2A 3G2ZA 5F82A 3C5AA 1PW1A 2Y2OA 5AQBA 1VM1A 3MZFA 3GR2A 5KSHA 4DRTA 1YT4A 2BG1A 4JBFA 5CGSA 4DDSA 3MBZA 4E6XA 4OPYA 2V2FF 4H8RA 3N7WA 5FAQA 5CGXA 2ZQ7A 4KG6A 1YQSA 3SH9A 4NETA 1RGYA 1PYYA 1HZOA 4OQHA 1NZOA 2WZZA 5FQ9A 5DF8A 1PZOA 2HDSA 1RCJA 2WZXA 1K6RA 4B4XA 3G35A 3N8RA 3M6HA 1MXOA 2JBFA 3MKEA 3N4IA 4X55A 4U0TA 5E2EA 2ZQCA 4WEJA 2IWBA 5FASA 1FR6A 3ZG7B 3BYDA 3LCEA 2XFSA 3PAEA 4OP8A 5EVIB 4S2LA 1CI9A 1W7FA 4JF6A 5DF7A 1GHPA 2ZM0A 3A3EA 4GD8A 4LCLA 4OPZA 3G4PA 3SH7A 3GRJA 3MXSA 3S22A 3HUOA 3ITBA 3ZVTA 1YLYA 1BLPA 1WE4A 4OOLA 1IEMA 2E8IA 1FSWA 2Y91A 4PPRA 2ZMAA 5TGFA 2WKHA 1SDNA 4JF5A 4KZ3A 1VQQA 1FSYA 1XXMA 4QD4A 4Y0UA 1KGEA 3HUMA 4P6BA 4R1GA 1JWPA 1C3BA 4C6YA 2R9XA 3DWKA 3VP1A 3IXDA 1PZPA 4MLLA 3VP3A 2X01A 3FYZA 1TDLA 5BOHA 3WS1A 3Q7VB 5EE8A 4GN2A 3NDEA 1O07A 4E3IA 5CXWA 3NI9A 1S0WA 3GTCA 2X02A 3UPNA 3OPPA 1IYSA 4XXRA 3WRTA 3WS0A 3D4FA 2I72A 5L2FA 4JF4A 4XUZA 1FCNA 4DE0A 4KZ8A 3V50A 4MBFA 1KE0A 1KDWA 2HP6A 4OQGA 1BTLA 1MKIA 3NY4A 3SS3A 1LI0A 4Y7PA 4EBNA 1ES3A 3UE0A 3V3SA 4KQQA 3HLFA 4P87A 2XQZA 4WZ4A 4N9KA 1KE3A 1JTGA 5FI7A 2WGWA 1PIOA 3BFDA 3ZG9B 1ESIA 4YINA 1SCWA 4S2NC 2Q9NA 4DXCA 1H8ZA 5I94A 1G68A 5CTMA 3M6BA 3ZNTA 1HD8A 4R23A 5DTKA 3VP2A 4R3JA 4BJPA 3IWIA 4KZ5A 4M3KA 2R9WA 4KZ7A 2EX6A 1BSGA 3FV7A 1BT5A 1E4DA 3VFFA 3UN7A 4OONA 2Y2GA 4RYEA 5F1GA 4BL2A 1AXBA 1GA0A 3BEBA 5HAQA 4P0MA 2RCXA 1W8QA 1XGJA 1SKFA 2P9VA 4LV2A 4MBKA 5GLAA 4IBRA 2C5WB 3N8SA 4BLMA 1ZG4A 2H5SA 3G2YA 3WS2A 1K55A 4DXBA 2Y2LA 4KZ4A 1IELA 2EX2A 1LL9A 2Y2HA 4X69A 5FAOA 3BFGA 1PW8A 4JXSA 1FQGA 4ZJ2A 3QHYA 2Y2IA 1E25A 3V3RA 2ZD8A 1DY6A 1N9BA 1W79A 3PAGA 5M1AA
chains in the Genus database with same CATH superfamily
4GZBA 1LLBA 4ZTKA 2Z6CA 5DVAA 1EI5A 3HL9A 3E2KA 3IWQA 1M40A 4KENB 4ZBEA 4S2IA 1S66L 2C6WB 5K5BA 2J3WA 4O7DA 5FI2A 4R3BA 3T12B 5EVID 1IKGA 2BLSA 2VGJA 1YLWA 3NOUC 1RP5A 3QP2A 1NLZA 5EVLA 3UY6A 5EVIC 3UDIA 4LLOB 1ERQA 3UB7A 4JLFA 3S7PA 3B47A 2QKPA 5HSQA 4O0PA 1ODVA 2M7VA 4JKTA 3LR0A 1TEMA 3MZEA 3RXWA 2HJ9C 3LIFA 3ZDJA 3A0VA 4HH3A 5EV0A 1ONGA 3IXGA 4N92A 1V9YA 3PBQA 4QWOA 1XA7A 4ZRRA 3MMHA 3OCNA 3E0YA 3C7VA 3UB6A 2XLNA 5CHUA 5G18A 1L3LA 1NYMA 3MFDA 2W3HA 3G6OA 1ESUA 1Y4OA 2UV0E 4E04A 3M2KA 4D60A 4CLCA 1FOFA 4KZ6A 2WUQA 4QY5A 3UMEA 2PHYA 4CLCB 4LRZE 3PYPA 3TOIA 1YLZA 4BBTA 2MJ6A 3P98A 1XP4A 1JNUA 4KQDA 4LV1A 4I3JA 2J8YA 4K91A 5L07A 1RGZA 1YLPA 3PBNA 2P08A 3FKVA 4GJ4A 4PMAA 3EGXC 2JC7A 5EUAA 3V5MA 4KZBA 2A3UA 1IYOA 1OMEA 3UPPA 2Y2MA 2J80A 3MXRA 4EUVA 2V0UA 2PU2A 3CUEC 3HLBA 2PBYA 5DJTA 4CQHA 1NRJA 5CHJA 1BZAA 5DKKA 3R7WB 3MSHA 3UPOA 3GSGA 4GS9B 3U2AA 5A93A 1UGUA 3LIDA 2EWVA 3GECA 2KDKA 1KVMA 3NDGA 2W1RA 5DFYA 3GQZA 1ERMA 1PRQA 2J9OA 4HQAA 4E3MA 3DAVA 3GVBA 3IWOA 4S2KA 3EQVA 2X71A 4GHIA 2ZJ9A 3ZYTA 2IWCA 1W63M 1BLSA 3UE3A 1U60A 1N9OA 4K0XA 2P9VB 1GHMA 5HWWA 4FH4A 2VV6A 2ZQ8A 4Y0OA 5EM0A 4MEZA 3AGDA 1IFQA 4GW9A 3S7QA 3UB8A 3UE6A 3H82A 2HP5A 1JWVA 1T1BA 4O01A 4E3OA 3ICYA 3KSFA 1MC0A 4E6WA 2JKGA 5HX9A 4GCZA 4Y5FA 2CC1A 4HH2A 5CGWA 3BLSA 4S2JA 4U3TA 2VJWA 2V20A 4UHUA 4WMCD 2IA2A 1GSVA 4GLQA 2VV8A 3JVUA 3B42A 1TS6A 1FILA 3UO9A 1K57A 1FR1A 1JVJA 4HESA 1TS0A 1YM1A 3UE1A 3BECA 5L09A 4HJ4A 4LV3A 1HLUP 4WF0A 2VLGA 4EXOA 1OJGA 2WKEA 1YLJA 3IXHA 3FWLA 4MN7A 4KZ9A 4C75A 2ZC4B 1TS8A 1KGGA 5C5KA 1PWGA 4RA7A 4RVAA 3S4XA 2ZOIA 2HPBA 2D02A 1K0KA 4ID4A 3ZGAB 3VOZA 2PDRA 3O87A 1MY8A 5FQQA 3A3JA 3GMWA 1LSVA 2ZL1A 1XA1A 1S67L 3IHBA 3G2ZA 4R6LA 2HJEA 4DRTA 1YT4A 2BG1A 4JBFA 1OTAA 2QWSA 4BMWA 4OQHA 2OWJA 2A2LA 4PAUA 2WZXA 1MXOA 4X55A 5FASA 1T19A 1LL8A 3HJIA 4OP8A 3FG8A 4ME4A 3MXSA 3BQAA 4Q0JA 1YLYA 4PKYA 1IEMA 4BWIA 2XSSA 4PPRA 5TGFA 2WKHA 3LR4A 1ZHHB 1FSYA 5HPIA 1OTBA 1KGEA 1JWPA 4C6YA 4KUKA 3VE4A 3VP1A 3IXDA 1TDLA 2O0YA 5EE8A 4GN2A 1S0WA 3GTCA 2X02A 3LUQA 5J4EA 1FCNA 2OAQ1 3IBRA 4DN0A 3MXQA 4Y7PA 4EBNA 4IUKA 1ES3A 1S1YA 2M1CA 3BWLA 4P87A 1H8MA 2YKFA 2VV7A 1JTGA 2WGWA 2VKSA 2HV1A 1A0KA 2LB5A 4KZ7A 2P04A 2I9VA 3FV7A 1BT5A 3UB5P 1E4DA 3VFFA 3UN7A 2VGLM 4OONA 1AXBA 2AVXA 2XRNA 2RCXA 4LV2A 4MBKA 3T1RA 3N8SA 2H5SA 3G2YA 3WS2A 1K55A 4KZ4A 5FAOA 3BFGA 2M7UA 1FQGA 5GHXA 2ZD8A 1W79A 2HZ5A 2CMNA 1YMXA 3O88A 2EX8A 4DMZA 3UB9A 2J9PA 5FEFA 4IJGA 4NXBA 4LRXC 2A24B 1AWIA 4B4ZA 3N8LA 4FOFA 5E2FA 4MN5A 3ITAA 1Y28A 2H0TA 4NKPA 3Q1FA 4QJGA 4OOMA 1L2SA 1G6OA 5FSRA 3P01A 3HLDA 4NXEA 1CK3A 3MR0A 1GSWA 4BD0A 4R0QA 4E3JA 4KZAA 1PNEA 4IVIA 1PI4A 2FFYA 5A8BA 5JYOA 4DKIA 4Z1WA 2Q9MA 3NC8A 5GLBA 4KQRA 5TR7A 5M18A 1NY0A 2RL3A 4G3WA 3T4TA 2QYBA 2ZMFA 3UDFA 5AQ9A 4HHDA 1MWSA 4ZJ3A 2VZWA 4WN5A 4EV4A 3CMZA 5KMWA 4HI4A 3S7OA 1VETA 3O5YA 3DBAA 5EOOA 4Y0TA 2HDRA 4HNBA 5AJGA 4EWFA 3BLMA 2PU4A 3OZHA 3ZHHA 2JKTM 3T50A 2OWHA 2WGIA 4HBTA 3IS2B 4S2OA 4CLCE 2W3DA 1W8YA 4IVKA 1HTZA 5KSCA 4UA9A 2VA0A 4JPMA 1YMSA 1VHMA 5EPHA 4PM8A 2VGKA 5HAIA 3CPTB 1ONHA 2ACGA 5GL9A 2W1TB 3LY4A 3H9WA 1ZKJA 3EEHA 1MBLA 1LHYA 4XUXA 1WYCA 5CEDA 4G3VA 4HBUA 2EX9A 5DTTA 3GV9A 1L0FA 3ZVWA 4E3LA 3A3IA 4RQ9A 3QP1A 5EOEA 1QMEA 4F3LA 2EFUA 3ZG5A 1SDEA 2ZMVA 3DTMA 1ES2A 1OTEA 4JGOA 5IU1A 3IF5A 5DF9A 1ZTUA 2H0YA 3CITA 2BTFP 2Z2MB 1NXYA 2FZ0A 2V0WA 3OCLA 3EGDC 1LL5A 5JYPA 2OAP1 1XKZA 2O9CA 3F1NA 3BFCA 1NRFA 2WKIA 1YSPA 4C3QA 3PHYA 4UEYA 1EWZA 2LB9A 5FI6A 4MBHA 4IBXA 3T1SA 5L10A 5HARA 5CERA 3LY3A 4BBVA 1H8YA 2H10A 1DJBA 2VK3A 4CPKA 3OPHA 2XD5A 4PM6A 5HPFA 3V39A 2V8FA 2W1TA 4QHCA 4OOYA 2ZOHA 3W4PA 4NXGA 1ZG6A 1CI8A 2JHEA 1ES4A 4L0LA 4X68A 3TE8A 4PM5A 2QPNA 1DP9A 3BQ8A 3A3FA 5FEGA 3L9KA 3QNBA 5HD5A 5CTNA 3N6IA 3IH9A 3DWZA 1N9LA 2OLUA 1LI9A 3CAXA 3IF6C 3I7JA 2V1ZA 5M19A 4RX3A 4WMCA 2EXAA 1KOUA 5GLCA 1FCOA 4O8GA 1I2WA 4X1LA 3FZCA 1VETB 3CG5A 4MN6A 1MWTA 2G2UA 5HL1A 1NYYA 5FDSA 1NJ4A 5E2GA 4Z9QA 2PD8A 5D3OA 4HJ3A 1GHIA 3ISGA 3NOPC 5E43A 2ZC7A 1J9MA 4DDYA 2W0NA 1YSQA 3ZCZA 5HWTA 5F1FA 1PFLA 3L7HA 1SHVA 4N1HA 2Y4AA 5CHMA 1WYBA 4Y17A 3C8CA 2WK0A 1MPLA 3D3OA 4ZJ1A 1IKIA 3K3DA 3D72A 1G28A 5FDHA 4X25A 3HLWA 3OPLA 3ZG0A 4LPZA 4EBLA 5A90A 4UAAA 3VFHA 1BUEA 2HP9A 4OPRA 4EESA 2Y2JA 4WELA 4EQ1A 4EQIA 3WS5A 3O3VA 4UA6A 1ZC2A 4LRYC 3C5AA 3MZFA 5KSHA 3MBZA 4E6XA 4H8RA 1S4SA 5CGXA 4KG6A 1YQSA 2V8CA 4NETA 1RGYA 1PYYA 5G4YA 3BJNA 3CWFA 2WZZA 1UWPX 4FUWA 4B4XA 3N8RA 3BY9A 3M6HA 2JBFA 3IS2A 3N4IA 5E2EA 1XFNA 3BYDA 3PAEA 4JF6A 5DF7A 2K31A 4GD8A 5HWVA 5TBMA 3ZVTA 2E8IA 1FSWA 2PRFA 3MQ0A 4ETXA 3SW1A 5EFWA 3DWKA 2X01A 3WS1A 3Q7VB 1SKOA 4E3IA 3NI9A 4H6JB 2QJ7A 3UPNA 1GSXA 3D4FA 3K3CA 4KZ8A 4ARZB 3VV4A 1KDWA 4CLCD 3MJQA 3IX8A 4KUOA 1F9IA 2WKRA 3UE0A 3HLFA 3W2ZA 2P7JA 4K08A 4WZ4A 1ESIA 1VEUA 3U4LP 3RFBA 1H8ZA 2VX8A 5I94A 3B33A 3LIEA 2YKHA 4R23A 4BJPA 1Z09A 5F69A 2Y2GA 4RYEA 3T4LA 3C38A 4I38A 3BEBA 5HAQA 2GJ3A 2W3GA 1XGJA 1SKFA 5GLAA 2OOLA 3LEQA 1IELA 1D7EA 4JXSA 2Y2IA 3NIAA 3PAGA 2K7SA 2HDUA 4NEED 4UQIM 3VOLA 2L0WA 1X0OA 3LICA 2WGVA 4PM9A 4Y13A 4P85A 4GDBA 1STZA 3OPRA 4OKPA 2XK1A 3SS4A 1JTDA 4JGRA 1CQAA 4JXWA 4HY8A 4WZ5A 3KSGA 4HJ6A 1K56D 1OT6A 2B5RA 1DJCA 1ES5A 1N9NA 4Y3IA 5F6AA 3H82B 5HZHA 2HGVA 1XPBA 1T1CA 5HW3A 2WGWB 2XH9A 1LSXA 3MZDA 3G32A 3EQUA 1J3WA 4LFUA 3F1OB 2XDMA 4DE2A 5GHZA 4MMNA 1FCMA 1K4EA 3NULA 1OJ5A 5TBMB 2XROA 1T1AA 3HUNA 3NBLA 4JGPA 2ZC6B 2JE5A 5F83A 5EVEA 3G34A 4FTXA 1KVLA 4WLAA 4WYYA 4P6ZM 4XT2A 3T4OA 3HBRA 3SH8A 4BQMA 3IX4A 2VGLS 5U47A 4QB8A 1BYWA 2J3TD 4X1MA 2WAEA 3P7NA 3TW8A 4F94A 3BW6A 1CEFA 3LO7A 5AQAA 1NZUA 3LR3A 5G4ZA 4CLCC 1K57C 3PBSA 4CJNA 2DMWA 2FFFB 4EEPA 3SOIA 3HVFA 4I3AA 3DTKA 4JGQA 5HDCA 1IYQA 1LSWA 4EERA 3T1XA 5AVFA 2Z6DA 3M2JA 2ZM8A 2GNXA 1P97A 1TVFA 3RJUA 3LI9A 3C4OA 4BBUA 1QMFA 3G31A 5FATA 5CRFA 3DTIA 2ZC5B 3ZNYA 2KOIA 1YLTA 2GZAA 3E2LA 2KLIA 2HDQA 2EFXA 3CHWP 3MKFA 1S1ZA 1KE4A 4B88A 5IS1A 4NXFA 2Y2NA 1T18A 3NHQA 3RXXA 1O7EA 4IEDA 2EXBA 1CEGA 3VP4A 4BENA 5MC7A 3ZQ5A 2V9AA 3LEZA 3BFEA 5L8MA 1DP6A 4GOGA 2R78A 1L0EA 4R4SA 4EW7A 2FH5A 3C4PA 2WKQA 3LFVA 3R7WA 3W4QA 3DW0A 3IF6A 2DNSA 3MF0A 3CI6A 5F5YA 4E3NA 2WKPA 4OH0A 2W3FA 3IF6B 3P09A 3Q7VA 2QMIA 5EECA 2XA7M 1I2SA 4N9LA 1VB6A 3NOTC 4KG5A 1L0GA 3VMAA 4HEFA 3WWXA 5GLDA 2Y55A 3VOYA 2V1AA 4X53A 3IHAA 3VSLA 5CECA 1EW0A 3MQOA 3QP6A 2XF3A 3VE3A 3HLEA 1BULA 4WM9A 2ZQ9A 5IHVA 4WBGA 4OLDA 4B9OA 5A92A 3W4OA 1SKOB 3TRCA 5KZHA 3NECA 4EETB 1CJFA 3IH8A 4AFIA 1L0DA 1DP8A 2D01A 2EWWA 3BFFA 3PR6A 2QZ6A 4PM7A 3CUEA 4M4XA 3IT9A 4FCFA 2Y8HA 5HDDA 1K25A 1JWZA 5FA7A 3T4QA 3WS4A 5FQMA 4GKUA 1K6SA 2B02A 2O99A 3S7NA 4EBPA 3QP5A 1PWDA 3JYIA 3LIBA 3EEAA 4OQ0A 4MCWA 4RX2A 5CX7A 4JXVA 4P6ZS 4B93A 3T1QB 5FQKA 3BRMA 3IQAA 3F1PA 4I5SA 3KYZA 2JKTI 3CLOA 3E4QA 4OQIA 4LV0A 4E3KA 2ZC3B 2XGNA 1BLCA 2ZLYA 1XX2A 1OPXA 3Q07A 2OSUA 1G5UA 4GS9A 4LENA 3HREA 1MWUA 3KYQA 2Y59A 2ZBBA 2Q0OA 2GX5A 2Y2QA 3DTEA 5F82A 2Y2OA 5AQBA 4HP9A 2NUPC 2V2FF 5FAQA 2ZQ7A 4XT2B 3SH9A 1V9ZA 3JVVA 1NZOA 5DF8A 2HDSA 1K6RA 3MKEA 4U0TA 2ZQCA 2IWBA 1FR6A 5EVIB 4S2LA 1W7FA 1GHPA 4LCLA 3A3EA 2PT7A 3SH7A 3GRJA 3S22A 3HUOA 2H28A 4OOLA 2Y91A 2PD7A 3F1OA 2ZMAA 2INWA 4JF5A 4KZ3A 4Q0HA 1XXMA 5AVEA 3HUMA 1C3BA 2R9XA 5HL6A 4MLLA 3VP3A 1XJ6A 5BOHA 5IT5A 2BASA 1F98A 1S4RA 3NDEA 3OPPA 3WRTA 2I72A 4R38A 5L2FA 1VEUB 4JF4A 3KYEA 4L9EA 3V50A 4MBFA 1KE0A 2HP6A 2JKRM 1BTLA 1MKIA 1LI0A 3NJAA 2PR6A 1OTDA 3V3SA 5FI7A 2PYRA 1SCWA 4S2NC 2Q9NA 4DXCA 1G68A 5CTMA 2A24A 1HD8A 4R3JA 3OBFA 4YNRA 2R9WA 3FPWA 5F1GA 4BL2A 1P0ZA 3KX0X 3T4KA 3LIAA 3JPUA 2P9VA 2C5WB 1DRMA 4DXBA 4X69A 4NG2A 1PW8A 3QHYA 3V3RA 1DY6A 1N9BA 3KO6A 1K54C 4FH2A 1TS7A 4R70A 2JCHA 3D9YA 4A5RA 3LGOA 2DRWA 4ARZA 5AQ7A 1IYPA 3HJKA 4JXGA 2ZQAA 1W63Q 2OV5A 4GDNA 4QY6A 2PBDP 3ZFZA 4NK3A 1ALQA 1XJ2A 3C2WA 1Q2QA 4OLGA 4YFMA 5J3WA 5FQJA 5TFQA 3TSGA 3PXPA 4BL3A 4R4RA 1E3UA 3GDIA 2W27A 3Q7ZA 2PYPA 5DFXA 1H3QA 3HCYA 1EROA 4OP5A 3EOIA 3PBOA 3C30A 3RH8B 2PR5A 4UA7A 3QP4A 3T4JA 2A49A 1WA9A 5EVIA 2L1MA 3IX3A 3UDXA 3R4KA 2WYXA 4DE3A 3VSKA 3QNCA 3WRZA 5DKLA 4I3IA 1OT9A 2XA7S 2W3EA 5FAPA 3H7WB 4K0WA 2QJ5A 2NUTC 1XFQA 3CZDA 4S2NA 1UWNX 4FSFA 1HVBA 1PWCA 3PBTA 3UMDA 4U0XA 1XGIA 2ZL1B 1NLYA 1H5XA 1YKDA 3G30A 3LI8A 1Z6FA 3PBRA 2Y2KA 1PI5A 3KSHA 3TG9A 2J7VA 4ETZA 5KIZA 4OPQA 4N1XA 3AGEA 3K2NA 1MWRA 3NCKA 2WAFA 2V1BA 2JKRI 1K56A 2QHKA 4PHTA 4ZAMA 3Q82A 1KDSA 4DF6A 5DTSA 3B3XA 3A0SA 4WUJA 4EU0A 1MZUA 3SZTA 3CJMA 5HFOA 1YPRA 2L4RA 4KQOA 1KGFA 4X56A 1TF1A 3LYXA 1TD5A 1P9RA 4D2OA 3S1YA 2HF6A 1DJAA 4GNUA 5E2HA 2IWDA 3KSIA 1K4FA 1BLHA 2XFTA 4EEUA 4S2PA 3IXBA 1NWZA 1P9WA 4QU3A 4F3LB 4II7A 2G7UA 4G3KA 4DE1A 1GCEA 3HLCA 3Q81A 4BD1A 4ZDXA 2P74A 3OLOA 3BM6A 1S6RA 1GA9A 2WADA 5J8XA 5HAPA 3HLGA 4GB7A 5DJUA 4KG2A 1I5QA 2Z2LB 4X6TA 2GDNA 3ULFA 1E3UD 1K55C 4WZ5C 1LT0A 1SZVA 4H6JA 3LR5A 4PKYG 1Y54A 3FKWA 4L9GA 1TDGA 4MNRA 2XEPA 1K54A 2OLVA 3SS5A 4WEKA 4DJ2A 3OC2A 1ACFA 2J3TC 3A0RA 5HDSA 4R3AA 2UWXA 4Y15A 4DJ3A 4Q8IA 5J7EA 1YAXA 1W5DA 4EUZA 1F5MA 1N4OA 5CEBA 3C7UA 4I39A 1M6KA 3O86A 2G2WA 3TJZC 1XJ3A 3AGFA 1K38A 2E8JA 2XR0A 3EWKA 3A3DA 3VP0A 4WL9A 3UNWA 2EA9A 2ZQDA 4IUHA 4LGWA 4LCMA 4Q0IA 3FPVA 3T4SA 3W8KA 2O9BA 2Y2PA 1F2KA 5GHYA 2XD1A 4S2MA 3PTEA 2PAVP 4GD6A 2O9AA 4FD8A 3ZG8B 4OVDA 1G6AA 5FQIA 2DCFA 3IBJA 5EM1A 4YWZA 3MFXA 5A91A 2ZM2A 1Q2PA 5TJJA 1D06A 1PW1A 1VM1A 3E98A 3GR2A 3V67A 3H7WA 3FC7A 5CGSA 4DDSA 3CPTA 4HP4A 4OPYA 3N7WA 5F68A 3E4OA 2K2NA 1FIKA 1HZOA 2KX6A 4ESPA 5FQ9A 1PZOA 1RCJA 1H0MA 3G35A 4IHQA 4WEJA 1XJ4A 3ZG7B 3LCEA 4L9FA 2XFSA 1CI9A 2ZM0A 4OPZA 3G4PA 3ITBA 1BLPA 1WE4A 2JN7A 3MQQA 1SDNA 1VQQA 2B95A 4QD4A 4Y0UA 4P6BA 4R1GA 1PZPA 3FYZA 1O07A 5CXWA 4MDZA 2Y79A 1IYSA 4XXRA 3WS0A 4QPRA 4XUZA 4DE0A 4OQGA 3BY8A 3NY4A 3SS3A 3OOVA 2VEAA 4Y2FA 3RTYA 4KQQA 3F1PB 2XQZA 4N9KA 1KE3A 4HIAA 1PIOA 3BFDA 3ZG9B 4YINA 1MKMA 3M6BA 3ZNTA 4GHIB 3E4PA 5DTKA 3VP2A 3IWIA 4KZ5A 4M3KA 5FL3A 1D1JA 2EX6A 1BSGA 1IOUA 1OTIA 2B18A 1GA0A 4P0MA 3MS6A 1CF0A 4YOFA 1W8QA 4HOIA 4IBRA 4BLMA 1ZG4A 5LBRA 3QP8A 2JKFA 2Y2LA 5HD3A 2EX2A 1LL9A 2Y2HA 3F1NB 4ZJ2A 4UQIS 1E25A 5I5LA 5M1AA
chains in the Genus database with same CATH topology
1YMXA 2HDUA 1K54C 1LLBA 4GZBA 4ZTKA 3O88A 4FH2A 2EX8A 5DVAA 1EI5A 2J9PA 3HL9A 3E2KA 2JCHA 3IWQA 2WGVA 1M40A 4PM9A 4KENB 4P85A 4GDBA 4ZBEA 4S2IA 4A5RA 4B4ZA 3OPRA 3N8LA 4OKPA 2XK1A 2C6WB 5E2FA 4O7DA 2DRWA 5FI2A 3SS4A 1JTDA 3ITAA 4R3BA 2H0TA 4JXWA 5EVID 1IKGA 2BLSA 2VGJA 3Q1FA 4WZ5A 5AQ7A 1YLWA 4QJGA 4OOMA 1IYPA 1L2SA 1RP5A 4JXGA 1K56D 2ZQAA 5EVLA 3UY6A 5FSRA 5EVIC 2B5RA 3UDIA 3HLDA 1ERQA 2OV5A 4GDNA 4QY6A 1DJCA 1ES5A 1CK3A 3ZFZA 4JLFA 1ALQA 4NK3A 4BD0A 4R0QA 1Q2QA 1XPBA 4JKTA 5HW3A 2WGWB 4OLGA 4E3JA 1TEMA 4KZAA 4YFMA 3MZEA 2XH9A 3RXWA 5FQJA 5TFQA 4IVIA 3MZDA 3TSGA 3G32A 3EQUA 1PI4A 3ZDJA 4BL3A 4R4RA 2FFYA 1E3UA 5JYOA 1ONGA 2XDMA 3IXGA 4N92A 4DE2A 3PBQA 3Q7ZA 5GHZA 1FCMA 1XA7A 1K4EA 1EROA 4DKIA 4OP5A 3OCNA 3PBOA 2Q9MA 3C7VA 3HUNA 3NBLA 3NC8A 5GLBA 4KQRA 4UA7A 5TR7A 5M18A 1NY0A 2RL3A 2XLNA 2A49A 5CHUA 2ZC6B 5G18A 2JE5A 5EVIA 1NYMA 3MFDA 5F83A 3G34A 3UDXA 1ESUA 3UDFA 1KVLA 5AQ9A 1MWSA 2WYXA 4WYYA 4ZJ3A 3M2KA 4DE3A 3VSKA 3HBRA 3QNCA 3WRZA 1FOFA 4KZ6A 2WUQA 3CMZA 4QY5A 3SH8A 4BQMA 4EV4A 5KMWA 5U47A 5FAPA 4K0WA 4QB8A 3TOIA 1YLZA 3P98A 3CZDA 1XP4A 4S2NA 5EOOA 4LV1A 4Y0TA 2HDRA 4EWFA 2J8YA 3BLMA 2WAEA 4FSFA 4K91A 2PU4A 3OZHA 1HVBA 3ZHHA 1RGZA 4F94A 1YLPA 3PBNA 1PWCA 1CEFA 3PBTA 3FKVA 2WGIA 3LO7A 4HBTA 5AQAA 1NZUA 4PMAA 4S2OA 2JC7A 4U0XA 1W8YA 1XGIA 5EUAA 4IVKA 1HTZA 3V5MA 5KSCA 4UA9A 1H5XA 1K57C 2A3UA 4KZBA 1IYOA 3PBSA 1OMEA 3UPPA 3G30A 4JPMA 4CJNA 2Y2MA 1YMSA 3MXRA 5EPHA 2FFFB 1Z6FA 4PM8A 3PBRA 2VGKA 5HAIA 2Y2KA 1PI5A 3TG9A 1ONHA 3SOIA 2PU2A 5GL9A 3HLBA 2PBYA 3HVFA 3LY4A 1IYQA 2J7VA 1ZKJA 3M2JA 4OPQA 1MBLA 1LHYA 2ZM8A 4XUXA 1WYCA 1TVFA 3RJUA 5CEDA 4N1XA 3AGEA 4HBUA 2EX9A 3C4OA 3GV9A 1L0FA 5CHJA 1BZAA 5DTTA 1MWRA 3ZVWA 4E3LA 3GSGA 3UPOA 3A3IA 1QMFA 3G31A 3NCKA 5EOEA 5FATA 1QMEA 5CRFA 5A93A 2WAFA 2ZC5B 3ZNYA 1YLTA 2EFUA 1K56A 3ZG5A 4ZAMA 3Q82A 1SDEA 3E2LA 1KDSA 3DTMA 1ES2A 1KVMA 3IF5A 3NDGA 4DF6A 5DF9A 2HDQA 5DTSA 2EFXA 2H0YA 3B3XA 3MKFA 3GQZA 1ERMA 2J9OA 1KE4A 2Z2MB 1NXYA 4B88A 3CJMA 5HFOA 3RXXA 2Y2NA 4E3MA 3OCLA 1LL5A 1O7EA 4IEDA 5JYPA 2EXBA 3GVBA 4KQOA 1CEGA 3IWOA 1KGFA 1XKZA 3EQVA 2X71A 4S2KA 4X56A 3VP4A 4BENA 2ZJ9A 3BFCA 1NRFA 4D2OA 2IWCA 3S1YA 2WKIA 1DJAA 3LEZA 4GNUA 5E2HA 3BFEA 2IWDA 1BLSA 3UE3A 4C3QA 4GOGA 1U60A 1K4FA 1BLHA 4K0XA 2P9VB 1GHMA 2XFTA 4FH4A 1L0EA 1EWZA 4S2PA 3IXBA 4R4SA 4QU3A 5FI6A 4MBHA 4IBXA 2ZQ8A 3C4PA 4Y0OA 4MEZA 5HARA 5CERA 3AGDA 3LY3A 1H8YA 2H10A 1DJBA 3W4QA 4CPKA 4DE1A 1GCEA 3DW0A 3OPHA 3IF6A 3HLCA 2DNSA 3Q81A 2HP5A 2XD5A 1JWVA 4BD1A 4ZDXA 4E3NA 2P74A 4OH0A 3IF6B 4PM6A 3V39A 3P09A 3BM6A 3Q7VA 1S6RA 1GA9A 2QMIA 2WADA 4E3OA 5J8XA 5EECA 5HAPA 4QHCA 3HLGA 1I2SA 4OOYA 4N9LA 4GB7A 3W4PA 4KG2A 4E6WA 1ZG6A 1I5QA 4KG5A 1L0GA 1CI8A 4HEFA 5HX9A 2Z2LB 3VMAA 3WWXA 4X6TA 2GDNA 2CC1A 1ES4A 4L0LA 4X68A 2Y55A 3BLSA 5CGWA 5GLDA 1E3UD 3VOYA 4PM5A 2QPNA 4S2JA 4X53A 4U3TA 1K55C 3IHAA 3VSLA 3A3FA 4WZ5C 3QNBA 5CECA 2V20A 4UHUA 4WMCD 5CTNA 1Y54A 3N6IA 2XF3A 3DWZA 3IH9A 3HLEA 1BULA 4WM9A 3FKWA 2OLUA 1LI9A 1TDGA 2ZQ9A 4WBGA 3IF6C 5IHVA 3I7JA 2V1ZA 4MNRA 2XEPA 1K54A 2OLVA 4RX3A 4WEKA 3SS5A 5M19A 3OC2A 4OLDA 4WMCA 3W4OA 2EXAA 5A92A 5GLCA 1FCOA 5KZHA 1I2WA 2UWXA 3FZCA 3UO9A 1K57A 3CG5A 1FR1A 1JVJA 3IH8A 4Q8IA 4HESA 1L0DA 1YM1A 3UE1A 3BECA 1MWTA 2G2UA 1W5DA 4EUZA 3BFFA 5HL1A 2QZ6A 4PM7A 1NYYA 4LV3A 1N4OA 1NJ4A 3C7UA 5E2GA 5CEBA 4Z9QA 5D3OA 1M6KA 3IT9A 3O86A 4FCFA 1GHIA 2WKEA 1K25A 1JWZA 1YLJA 2G2WA 3ISGA 3AGFA 5FA7A 3WS4A 3IXHA 5E43A 3FWLA 1K38A 2XR0A 2ZC7A 5FQMA 1J9MA 4DDYA 4GKUA 1K6SA 3A3DA 4KZ9A 4C75A 3VP0A 2ZC4B 3ZCZA 1KGGA 3UNWA 5F1FA 2ZQDA 4LCMA 1PWGA 1SHVA 4EBPA 1PWDA 4RA7A 4RVAA 5GHXA 3S4XA 3JYIA 4N1HA 2Y4AA 5CHMA 2Y2PA 3W8KA 1WYBA 2HPBA 4OQ0A 2WK0A 4ID4A 4RX2A 3VOZA 3ZGAB 4JXVA 1MPLA 4ZJ1A 3O87A 5GHYA 1MY8A 5FQKA 2XD1A 1IKIA 3BRMA 3IQAA 4S2MA 3PTEA 5FDHA 3HLWA 3NIAA 5FQQA 4OQIA 4LV0A 4GD6A 3OPLA 4E3KA 4FD8A 2ZC3B 3ZG0A 3ZG8B 3A3JA 3GMWA 4OVDA 2XGNA 4EBLA 1BLCA 2ZLYA 1G6AA 5A90A 1XX2A 4UAAA 3Q07A 3VFHA 1BUEA 2HP9A 1XA1A 2OSUA 4OPRA 2DCFA 5FQIA 4LENA 3HREA 1MWUA 2Y2JA 4WELA 2Y59A 3IHBA 4EQIA 3WS5A 5A91A 2ZM2A 2Y2QA 1Q2PA 3O3VA 4UA6A 1ZC2A 3G2ZA 5F82A 3C5AA 1PW1A 2Y2OA 5AQBA 1VM1A 3MZFA 3GR2A 5KSHA 4DRTA 1YT4A 2BG1A 4JBFA 5CGSA 4DDSA 3MBZA 4E6XA 4OPYA 2V2FF 4H8RA 3N7WA 5FAQA 5CGXA 2ZQ7A 4KG6A 1YQSA 3SH9A 4NETA 1RGYA 1PYYA 1HZOA 4OQHA 1NZOA 2WZZA 5FQ9A 5DF8A 1PZOA 2HDSA 1RCJA 2WZXA 1K6RA 4B4XA 3G35A 3N8RA 3M6HA 1MXOA 2JBFA 3MKEA 3N4IA 4X55A 4U0TA 5E2EA 2ZQCA 4WEJA 2IWBA 5FASA 1FR6A 3ZG7B 3BYDA 3LCEA 2XFSA 3PAEA 4OP8A 5EVIB 4S2LA 1CI9A 1W7FA 4JF6A 5DF7A 1GHPA 2ZM0A 3A3EA 4GD8A 4LCLA 4OPZA 3G4PA 3SH7A 3GRJA 3MXSA 3S22A 3HUOA 3ITBA 3ZVTA 1YLYA 1BLPA 1WE4A 4OOLA 1IEMA 2E8IA 1FSWA 2Y91A 4PPRA 2ZMAA 5TGFA 2WKHA 1SDNA 4JF5A 4KZ3A 1VQQA 1FSYA 1XXMA 4QD4A 4Y0UA 1KGEA 3HUMA 4P6BA 4R1GA 1JWPA 1C3BA 4C6YA 2R9XA 3DWKA 3VP1A 3IXDA 1PZPA 4MLLA 3VP3A 2X01A 3FYZA 1TDLA 5BOHA 3WS1A 3Q7VB 5EE8A 4GN2A 3NDEA 1O07A 4E3IA 5CXWA 3NI9A 1S0WA 3GTCA 2X02A 3UPNA 3OPPA 1IYSA 4XXRA 3WRTA 3WS0A 3D4FA 2I72A 5L2FA 4JF4A 4XUZA 1FCNA 4DE0A 4KZ8A 3V50A 4MBFA 1KE0A 1KDWA 2HP6A 4OQGA 1BTLA 1MKIA 3NY4A 3SS3A 1LI0A 4Y7PA 4EBNA 1ES3A 3UE0A 3V3SA 4KQQA 3HLFA 4P87A 2XQZA 4WZ4A 4N9KA 1KE3A 1JTGA 5FI7A 2WGWA 1PIOA 3BFDA 3ZG9B 1ESIA 4YINA 1SCWA 4S2NC 2Q9NA 4DXCA 1H8ZA 5I94A 1G68A 5CTMA 3M6BA 3ZNTA 1HD8A 4R23A 5DTKA 3VP2A 4R3JA 4BJPA 3IWIA 4KZ5A 4M3KA 2R9WA 4KZ7A 2EX6A 1BSGA 3FV7A 1BT5A 1E4DA 3VFFA 3UN7A 4OONA 2Y2GA 4RYEA 5F1GA 4BL2A 1AXBA 1GA0A 3BEBA 5HAQA 4P0MA 2RCXA 1W8QA 1XGJA 1SKFA 2P9VA 4LV2A 4MBKA 5GLAA 4IBRA 2C5WB 3N8SA 4BLMA 1ZG4A 2H5SA 3G2YA 3WS2A 1K55A 4DXBA 2Y2LA 4KZ4A 1IELA 2EX2A 1LL9A 2Y2HA 4X69A 5FAOA 3BFGA 1PW8A 4JXSA 1FQGA 4ZJ2A 3QHYA 2Y2IA 1E25A 3V3RA 2ZD8A 1DY6A 1N9BA 1W79A 3PAGA 5M1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YMX A;  2HDU A;  1K54 C;  1LLB A;  4GZB A;  4ZTK A;  3O88 A;  4FH2 A;  2EX8 A;  5DVA A;  1EI5 A;  2J9P A;  3HL9 A;  3E2K A;  2JCH A;  3IWQ A;  2WGV A;  1M40 A;  4PM9 A;  4KEN B;  4P85 A;  4GDB A;  4ZBE A;  4S2I A;  4A5R A;  4B4Z A;  3OPR A;  3N8L A;  4OKP A;  2XK1 A;  2C6W B;  5E2F A;  4O7D A;  2DRW A;  5FI2 A;  3SS4 A;  1JTD A;  3ITA A;  4R3B A;  2H0T A;  4JXW A;  5EVI D;  1IKG A;  2BLS A;  2VGJ A;  3Q1F A;  4WZ5 A;  5AQ7 A;  1YLW A;  4QJG A;  4OOM A;  1IYP A;  1L2S A;  1RP5 A;  4JXG A;  1K56 D;  2ZQA A;  5EVL A;  3UY6 A;  5FSR A;  5EVI C;  2B5R A;  3UDI A;  3HLD A;  1ERQ A;  2OV5 A;  4GDN A;  4QY6 A;  1DJC A;  1ES5 A;  1CK3 A;  3ZFZ A;  4JLF A;  1ALQ A;  4NK3 A;  4BD0 A;  4R0Q A;  1Q2Q A;  1XPB A;  4JKT A;  5HW3 A;  2WGW B;  4OLG A;  4E3J A;  1TEM A;  4KZA A;  4YFM A;  3MZE A;  2XH9 A;  3RXW A;  5FQJ A;  5TFQ A;  4IVI A;  3MZD A;  3TSG A;  3G32 A;  3EQU A;  1PI4 A;  3ZDJ A;  4BL3 A;  4R4R A;  2FFY A;  1E3U A;  5JYO A;  1ONG A;  2XDM A;  3IXG A;  4N92 A;  4DE2 A;  3PBQ A;  3Q7Z A;  5GHZ A;  1FCM A;  1XA7 A;  1K4E A;  1ERO A;  4DKI A;  4OP5 A;  3OCN A;  3PBO A;  2Q9M A;  3C7V A;  3HUN A;  3NBL A;  3NC8 A;  5GLB A;  4KQR A;  4UA7 A;  5TR7 A;  5M18 A;  1NY0 A;  2RL3 A;  2XLN A;  2A49 A;  5CHU A;  2ZC6 B;  5G18 A;  2JE5 A;  5EVI A;  1NYM A;  3MFD A;  5F83 A;  3G34 A;  3UDX A;  1ESU A;  3UDF A;  1KVL A;  5AQ9 A;  1MWS A;  2WYX A;  4WYY A;  4ZJ3 A;  3M2K A;  4DE3 A;  3VSK A;  3HBR A;  3QNC A;  3WRZ A;  1FOF A;  4KZ6 A;  2WUQ A;  3CMZ A;  4QY5 A;  3SH8 A;  4BQM A;  4EV4 A;  5KMW A;  5U47 A;  5FAP A;  4K0W A;  4QB8 A;  3TOI A;  1YLZ A;  3P98 A;  3CZD A;  1XP4 A;  4S2N A;  5EOO A;  4LV1 A;  4Y0T A;  2HDR A;  4EWF A;  2J8Y A;  3BLM A;  2WAE A;  4FSF A;  4K91 A;  2PU4 A;  3OZH A;  1HVB A;  3ZHH A;  1RGZ A;  4F94 A;  1YLP A;  3PBN A;  1PWC A;  1CEF A;  3PBT A;  3FKV A;  2WGI A;  3LO7 A;  4HBT A;  5AQA A;  1NZU A;  4PMA A;  4S2O A;  2JC7 A;  4U0X A;  1W8Y A;  1XGI A;  5EUA A;  4IVK A;  1HTZ A;  3V5M A;  5KSC A;  4UA9 A;  1H5X A;  1K57 C;  2A3U A;  4KZB A;  1IYO A;  3PBS A;  1OME A;  3UPP A;  3G30 A;  4JPM A;  4CJN A;  2Y2M A;  1YMS A;  3MXR A;  5EPH A;  2FFF B;  1Z6F A;  4PM8 A;  3PBR A;  2VGK A;  5HAI A;  2Y2K A;  1PI5 A;  3TG9 A;  1ONH A;  3SOI A;  2PU2 A;  5GL9 A;  3HLB A;  2PBY A;  3HVF A;  3LY4 A;  1IYQ A;  2J7V A;  1ZKJ A;  3M2J A;  4OPQ A;  1MBL A;  1LHY A;  2ZM8 A;  4XUX A;  1WYC A;  1TVF A;  3RJU A;  5CED A;  4N1X A;  3AGE A;  4HBU A;  2EX9 A;  3C4O A;  3GV9 A;  1L0F A;  5CHJ A;  1BZA A;  5DTT A;  1MWR A;  3ZVW A;  4E3L A;  3GSG A;  3UPO A;  3A3I A;  1QMF A;  3G31 A;  3NCK A;  5EOE A;  5FAT A;  1QME A;  5CRF A;  5A93 A;  2WAF A;  2ZC5 B;  3ZNY A;  1YLT A;  2EFU A;  1K56 A;  3ZG5 A;  4ZAM A;  3Q82 A;  1SDE A;  3E2L A;  1KDS A;  3DTM A;  1ES2 A;  1KVM A;  3IF5 A;  3NDG A;  4DF6 A;  5DF9 A;  2HDQ A;  5DTS A;  2EFX A;  2H0Y A;  3B3X A;  3MKF A;  3GQZ A;  1ERM A;  2J9O A;  1KE4 A;  2Z2M B;  1NXY A;  4B88 A;  3CJM A;  5HFO A;  3RXX A;  2Y2N A;  4E3M A;  3OCL A;  1LL5 A;  1O7E A;  4IED A;  5JYP A;  2EXB A;  3GVB A;  4KQO A;  1CEG A;  3IWO A;  1KGF A;  1XKZ A;  3EQV A;  2X71 A;  4S2K A;  4X56 A;  3VP4 A;  4BEN A;  2ZJ9 A;  3BFC A;  1NRF A;  4D2O A;  2IWC A;  3S1Y A;  2WKI A;  1DJA A;  3LEZ A;  4GNU A;  5E2H A;  3BFE A;  2IWD A;  1BLS A;  3UE3 A;  4C3Q A;  4GOG A;  1U60 A;  1K4F A;  1BLH A;  4K0X A;  2P9V B;  1GHM A;  2XFT A;  4FH4 A;  1L0E A;  1EWZ A;  4S2P A;  3IXB A;  4R4S A;  4QU3 A;  5FI6 A;  4MBH A;  4IBX A;  2ZQ8 A;  3C4P A;  4Y0O A;  4MEZ A;  5HAR A;  5CER A;  3AGD A;  3LY3 A;  1H8Y A;  2H10 A;  1DJB A;  3W4Q A;  4CPK A;  4DE1 A;  1GCE A;  3DW0 A;  3OPH A;  3IF6 A;  3HLC A;  2DNS A;  3Q81 A;  2HP5 A;  2XD5 A;  1JWV A;  4BD1 A;  4ZDX A;  4E3N A;  2P74 A;  4OH0 A;  3IF6 B;  4PM6 A;  3V39 A;  3P09 A;  3BM6 A;  3Q7V A;  1S6R A;  1GA9 A;  2QMI A;  2WAD A;  4E3O A;  5J8X A;  5EEC A;  5HAP A;  4QHC A;  3HLG A;  1I2S A;  4OOY A;  4N9L A;  4GB7 A;  3W4P A;  4KG2 A;  4E6W A;  1ZG6 A;  1I5Q A;  4KG5 A;  1L0G A;  1CI8 A;  4HEF A;  5HX9 A;  2Z2L B;  3VMA A;  3WWX A;  4X6T A;  2GDN A;  2CC1 A;  1ES4 A;  4L0L A;  4X68 A;  2Y55 A;  3BLS A;  5CGW A;  5GLD A;  1E3U D;  3VOY A;  4PM5 A;  2QPN A;  4S2J A;  4X53 A;  4U3T A;  1K55 C;  3IHA A;  3VSL A;  3A3F A;  4WZ5 C;  3QNB A;  5CEC A;  2V20 A;  4UHU A;  4WMC D;  5CTN A;  1Y54 A;  3N6I A;  2XF3 A;  3DWZ A;  3IH9 A;  3HLE A;  1BUL A;  4WM9 A;  3FKW A;  2OLU A;  1LI9 A;  1TDG A;  2ZQ9 A;  4WBG A;  3IF6 C;  5IHV A;  3I7J A;  2V1Z A;  4MNR A;  2XEP A;  1K54 A;  2OLV A;  4RX3 A;  4WEK A;  3SS5 A;  5M19 A;  3OC2 A;  4OLD A;  4WMC A;  3W4O A;  2EXA A;  5A92 A;  5GLC A;  1FCO A;  5KZH A;  1I2W A;  2UWX A;  3FZC A;  3UO9 A;  1K57 A;  3CG5 A;  1FR1 A;  1JVJ A;  3IH8 A;  4Q8I A;  4HES A;  1L0D A;  1YM1 A;  3UE1 A;  3BEC A;  1MWT A;  2G2U A;  1W5D A;  4EUZ A;  3BFF A;  5HL1 A;  2QZ6 A;  4PM7 A;  1NYY A;  4LV3 A;  1N4O A;  1NJ4 A;  3C7U A;  5E2G A;  5CEB A;  4Z9Q A;  5D3O A;  1M6K A;  3IT9 A;  3O86 A;  4FCF A;  1GHI A;  2WKE A;  1K25 A;  1JWZ A;  1YLJ A;  2G2W A;  3ISG A;  3AGF A;  5FA7 A;  3WS4 A;  3IXH A;  5E43 A;  3FWL A;  1K38 A;  2XR0 A;  2ZC7 A;  5FQM A;  1J9M A;  4DDY A;  4GKU A;  1K6S A;  3A3D A;  4KZ9 A;  4C75 A;  3VP0 A;  2ZC4 B;  3ZCZ A;  1KGG A;  3UNW A;  5F1F A;  2ZQD A;  4LCM A;  1PWG A;  1SHV A;  4EBP A;  1PWD A;  4RA7 A;  4RVA A;  5GHX A;  3S4X A;  3JYI A;  4N1H A;  2Y4A A;  5CHM A;  2Y2P A;  3W8K A;  1WYB A;  2HPB A;  4OQ0 A;  2WK0 A;  4ID4 A;  4RX2 A;  3VOZ A;  3ZGA B;  4JXV A;  1MPL A;  4ZJ1 A;  3O87 A;  5GHY A;  1MY8 A;  5FQK A;  2XD1 A;  1IKI A;  3BRM A;  3IQA A;  4S2M A;  3PTE A;  5FDH A;  3HLW A;  3NIA A;  5FQQ A;  4OQI A;  4LV0 A;  4GD6 A;  3OPL A;  4E3K A;  4FD8 A;  2ZC3 B;  3ZG0 A;  3ZG8 B;  3A3J A;  3GMW A;  4OVD A;  2XGN A;  4EBL A;  1BLC A;  2ZLY A;  1G6A A;  5A90 A;  1XX2 A;  4UAA A;  3Q07 A;  3VFH A;  1BUE A;  2HP9 A;  1XA1 A;  2OSU A;  4OPR A;  2DCF A;  5FQI A;  4LEN A;  3HRE A;  1MWU A;  2Y2J A;  4WEL A;  2Y59 A;  3IHB A;  4EQI A;  3WS5 A;  5A91 A;  2ZM2 A;  2Y2Q A;  1Q2P A;  3O3V A;  4UA6 A;  1ZC2 A;  3G2Z A;  5F82 A;  3C5A A;  1PW1 A;  2Y2O A;  5AQB A;  1VM1 A;  3MZF A;  3GR2 A;  5KSH A;  4DRT A;  1YT4 A;  2BG1 A;  4JBF A;  5CGS A;  4DDS A;  3MBZ A;  4E6X A;  4OPY A;  2V2F F;  4H8R A;  3N7W A;  5FAQ A;  5CGX A;  2ZQ7 A;  4KG6 A;  1YQS A;  3SH9 A;  4NET A;  1RGY A;  1PYY A;  1HZO A;  4OQH A;  1NZO A;  2WZZ A;  5FQ9 A;  5DF8 A;  1PZO A;  2HDS A;  1RCJ A;  2WZX A;  1K6R A;  4B4X A;  3G35 A;  3N8R A;  3M6H A;  1MXO A;  2JBF A;  3MKE A;  3N4I A;  4X55 A;  4U0T A;  5E2E A;  2ZQC A;  4WEJ A;  2IWB A;  5FAS A;  1FR6 A;  3ZG7 B;  3BYD A;  3LCE A;  2XFS A;  3PAE A;  4OP8 A;  5EVI B;  4S2L A;  1CI9 A;  1W7F A;  4JF6 A;  5DF7 A;  1GHP A;  2ZM0 A;  3A3E A;  4GD8 A;  4LCL A;  4OPZ A;  3G4P A;  3SH7 A;  3GRJ A;  3MXS A;  3S22 A;  3HUO A;  3ITB A;  3ZVT A;  1YLY A;  1BLP A;  1WE4 A;  4OOL A;  1IEM A;  2E8I A;  1FSW A;  2Y91 A;  4PPR A;  2ZMA A;  5TGF A;  2WKH A;  1SDN A;  4JF5 A;  4KZ3 A;  1VQQ A;  1FSY A;  1XXM A;  4QD4 A;  4Y0U A;  1KGE A;  3HUM A;  4P6B A;  4R1G A;  1JWP A;  1C3B A;  4C6Y A;  2R9X A;  3DWK A;  3VP1 A;  3IXD A;  1PZP A;  4MLL A;  3VP3 A;  2X01 A;  3FYZ A;  1TDL A;  5BOH A;  3WS1 A;  3Q7V B;  5EE8 A;  4GN2 A;  3NDE A;  1O07 A;  4E3I A;  5CXW A;  3NI9 A;  1S0W A;  3GTC A;  2X02 A;  3UPN A;  3OPP A;  1IYS A;  4XXR A;  3WRT A;  3WS0 A;  3D4F A;  2I72 A;  5L2F A;  4JF4 A;  4XUZ A;  1FCN A;  4DE0 A;  4KZ8 A;  3V50 A;  4MBF A;  1KE0 A;  1KDW A;  2HP6 A;  4OQG A;  1BTL A;  1MKI A;  3NY4 A;  3SS3 A;  1LI0 A;  4Y7P A;  4EBN A;  1ES3 A;  3UE0 A;  3V3S A;  4KQQ A;  3HLF A;  4P87 A;  2XQZ A;  4WZ4 A;  4N9K A;  1KE3 A;  1JTG A;  5FI7 A;  2WGW A;  1PIO A;  3BFD A;  3ZG9 B;  1ESI A;  4YIN A;  1SCW A;  4S2N C;  2Q9N A;  4DXC A;  1H8Z A;  5I94 A;  1G68 A;  5CTM A;  3M6B A;  3ZNT A;  1HD8 A;  4R23 A;  5DTK A;  3VP2 A;  4R3J A;  4BJP A;  3IWI A;  4KZ5 A;  4M3K A;  2R9W A;  4KZ7 A;  2EX6 A;  1BSG A;  3FV7 A;  1BT5 A;  1E4D A;  3VFF A;  3UN7 A;  4OON A;  2Y2G A;  4RYE A;  5F1G A;  4BL2 A;  1AXB A;  1GA0 A;  3BEB A;  5HAQ A;  4P0M A;  2RCX A;  1W8Q A;  1XGJ A;  1SKF A;  2P9V A;  4LV2 A;  4MBK A;  5GLA A;  4IBR A;  2C5W B;  3N8S A;  4BLM A;  1ZG4 A;  2H5S A;  3G2Y A;  3WS2 A;  1K55 A;  4DXB A;  2Y2L A;  4KZ4 A;  1IEL A;  2EX2 A;  1LL9 A;  2Y2H A;  4X69 A;  5FAO A;  3BFG A;  1PW8 A;  4JXS A;  1FQG A;  4ZJ2 A;  3QHY A;  2Y2I A;  1E25 A;  3V3R A;  2ZD8 A;  1DY6 A;  1N9B A;  1W79 A;  3PAG A;  5M1A A; 
#chains in the Genus database with same CATH topology
 4GZB A;  1LLB A;  4ZTK A;  2Z6C A;  5DVA A;  1EI5 A;  3HL9 A;  3E2K A;  3IWQ A;  1M40 A;  4KEN B;  4ZBE A;  4S2I A;  1S66 L;  2C6W B;  5K5B A;  2J3W A;  4O7D A;  5FI2 A;  4R3B A;  3T12 B;  5EVI D;  1IKG A;  2BLS A;  2VGJ A;  1YLW A;  3NOU C;  1RP5 A;  3QP2 A;  1NLZ A;  5EVL A;  3UY6 A;  5EVI C;  3UDI A;  4LLO B;  1ERQ A;  3UB7 A;  4JLF A;  3S7P A;  3B47 A;  2QKP A;  5HSQ A;  4O0P A;  1ODV A;  2M7V A;  4JKT A;  3LR0 A;  1TEM A;  3MZE A;  3RXW A;  2HJ9 C;  3LIF A;  3ZDJ A;  3A0V A;  4HH3 A;  5EV0 A;  1ONG A;  3IXG A;  4N92 A;  1V9Y A;  3PBQ A;  4QWO A;  1XA7 A;  4ZRR A;  3MMH A;  3OCN A;  3E0Y A;  3C7V A;  3UB6 A;  2XLN A;  5CHU A;  5G18 A;  1L3L A;  1NYM A;  3MFD A;  2W3H A;  3G6O A;  1ESU A;  1Y4O A;  2UV0 E;  4E04 A;  3M2K A;  4D60 A;  4CLC A;  1FOF A;  4KZ6 A;  2WUQ A;  4QY5 A;  3UME A;  2PHY A;  4CLC B;  4LRZ E;  3PYP A;  3TOI A;  1YLZ A;  4BBT A;  2MJ6 A;  3P98 A;  1XP4 A;  1JNU A;  4KQD A;  4LV1 A;  4I3J A;  2J8Y A;  4K91 A;  5L07 A;  1RGZ A;  1YLP A;  3PBN A;  2P08 A;  3FKV A;  4GJ4 A;  4PMA A;  3EGX C;  2JC7 A;  5EUA A;  3V5M A;  4KZB A;  2A3U A;  1IYO A;  1OME A;  3UPP A;  2Y2M A;  2J80 A;  3MXR A;  4EUV A;  2V0U A;  2PU2 A;  3CUE C;  3HLB A;  2PBY A;  5DJT A;  4CQH A;  1NRJ A;  5CHJ A;  1BZA A;  5DKK A;  3R7W B;  3MSH A;  3UPO A;  3GSG A;  4GS9 B;  3U2A A;  5A93 A;  1UGU A;  3LID A;  2EWV A;  3GEC A;  2KDK A;  1KVM A;  3NDG A;  2W1R A;  5DFY A;  3GQZ A;  1ERM A;  1PRQ A;  2J9O A;  4HQA A;  4E3M A;  3DAV A;  3GVB A;  3IWO A;  4S2K A;  3EQV A;  2X71 A;  4GHI A;  2ZJ9 A;  3ZYT A;  2IWC A;  1W63 M;  1BLS A;  3UE3 A;  1U60 A;  1N9O A;  4K0X A;  2P9V B;  1GHM A;  5HWW A;  4FH4 A;  2VV6 A;  2ZQ8 A;  4Y0O A;  5EM0 A;  4MEZ A;  3AGD A;  1IFQ A;  4GW9 A;  3S7Q A;  3UB8 A;  3UE6 A;  3H82 A;  2HP5 A;  1JWV A;  1T1B A;  4O01 A;  4E3O A;  3ICY A;  3KSF A;  1MC0 A;  4E6W A;  2JKG A;  5HX9 A;  4GCZ A;  4Y5F A;  2CC1 A;  4HH2 A;  5CGW A;  3BLS A;  4S2J A;  4U3T A;  2VJW A;  2V20 A;  4UHU A;  4WMC D;  2IA2 A;  1GSV A;  4GLQ A;  2VV8 A;  3JVU A;  3B42 A;  1TS6 A;  1FIL A;  3UO9 A;  1K57 A;  1FR1 A;  1JVJ A;  4HES A;  1TS0 A;  1YM1 A;  3UE1 A;  3BEC A;  5L09 A;  4HJ4 A;  4LV3 A;  1HLU P;  4WF0 A;  2VLG A;  4EXO A;  1OJG A;  2WKE A;  1YLJ A;  3IXH A;  3FWL A;  4MN7 A;  4KZ9 A;  4C75 A;  2ZC4 B;  1TS8 A;  1KGG A;  5C5K A;  1PWG A;  4RA7 A;  4RVA A;  3S4X A;  2ZOI A;  2HPB A;  2D02 A;  1K0K A;  4ID4 A;  3ZGA B;  3VOZ A;  2PDR A;  3O87 A;  1MY8 A;  5FQQ A;  3A3J A;  3GMW A;  1LSV A;  2ZL1 A;  1XA1 A;  1S67 L;  3IHB A;  3G2Z A;  4R6L A;  2HJE A;  4DRT A;  1YT4 A;  2BG1 A;  4JBF A;  1OTA A;  2QWS A;  4BMW A;  4OQH A;  2OWJ A;  2A2L A;  4PAU A;  2WZX A;  1MXO A;  4X55 A;  5FAS A;  1T19 A;  1LL8 A;  3HJI A;  4OP8 A;  3FG8 A;  4ME4 A;  3MXS A;  3BQA A;  4Q0J A;  1YLY A;  4PKY A;  1IEM A;  4BWI A;  2XSS A;  4PPR A;  5TGF A;  2WKH A;  3LR4 A;  1ZHH B;  1FSY A;  5HPI A;  1OTB A;  1KGE A;  1JWP A;  4C6Y A;  4KUK A;  3VE4 A;  3VP1 A;  3IXD A;  1TDL A;  2O0Y A;  5EE8 A;  4GN2 A;  1S0W A;  3GTC A;  2X02 A;  3LUQ A;  5J4E A;  1FCN A;  2OAQ 1;  3IBR A;  4DN0 A;  3MXQ A;  4Y7P A;  4EBN A;  4IUK A;  1ES3 A;  1S1Y A;  2M1C A;  3BWL A;  4P87 A;  1H8M A;  2YKF A;  2VV7 A;  1JTG A;  2WGW A;  2VKS A;  2HV1 A;  1A0K A;  2LB5 A;  4KZ7 A;  2P04 A;  2I9V A;  3FV7 A;  1BT5 A;  3UB5 P;  1E4D A;  3VFF A;  3UN7 A;  2VGL M;  4OON A;  1AXB A;  2AVX A;  2XRN A;  2RCX A;  4LV2 A;  4MBK A;  3T1R A;  3N8S A;  2H5S A;  3G2Y A;  3WS2 A;  1K55 A;  4KZ4 A;  5FAO A;  3BFG A;  2M7U A;  1FQG A;  5GHX A;  2ZD8 A;  1W79 A;  2HZ5 A;  2CMN A;  1YMX A;  3O88 A;  2EX8 A;  4DMZ A;  3UB9 A;  2J9P A;  5FEF A;  4IJG A;  4NXB A;  4LRX C;  2A24 B;  1AWI A;  4B4Z A;  3N8L A;  4FOF A;  5E2F A;  4MN5 A;  3ITA A;  1Y28 A;  2H0T A;  4NKP A;  3Q1F A;  4QJG A;  4OOM A;  1L2S A;  1G6O A;  5FSR A;  3P01 A;  3HLD A;  4NXE A;  1CK3 A;  3MR0 A;  1GSW A;  4BD0 A;  4R0Q A;  4E3J A;  4KZA A;  1PNE A;  4IVI A;  1PI4 A;  2FFY A;  5A8B A;  5JYO A;  4DKI A;  4Z1W A;  2Q9M A;  3NC8 A;  5GLB A;  4KQR A;  5TR7 A;  5M18 A;  1NY0 A;  2RL3 A;  4G3W A;  3T4T A;  2QYB A;  2ZMF A;  3UDF A;  5AQ9 A;  4HHD A;  1MWS A;  4ZJ3 A;  2VZW A;  4WN5 A;  4EV4 A;  3CMZ A;  5KMW A;  4HI4 A;  3S7O A;  1VET A;  3O5Y A;  3DBA A;  5EOO A;  4Y0T A;  2HDR A;  4HNB A;  5AJG A;  4EWF A;  3BLM A;  2PU4 A;  3OZH A;  3ZHH A;  2JKT M;  3T50 A;  2OWH A;  2WGI A;  4HBT A;  3IS2 B;  4S2O A;  4CLC E;  2W3D A;  1W8Y A;  4IVK A;  1HTZ A;  5KSC A;  4UA9 A;  2VA0 A;  4JPM A;  1YMS A;  1VHM A;  5EPH A;  4PM8 A;  2VGK A;  5HAI A;  3CPT B;  1ONH A;  2ACG A;  5GL9 A;  2W1T B;  3LY4 A;  3H9W A;  1ZKJ A;  3EEH A;  1MBL A;  1LHY A;  4XUX A;  1WYC A;  5CED A;  4G3V A;  4HBU A;  2EX9 A;  5DTT A;  3GV9 A;  1L0F A;  3ZVW A;  4E3L A;  3A3I A;  4RQ9 A;  3QP1 A;  5EOE A;  1QME A;  4F3L A;  2EFU A;  3ZG5 A;  1SDE A;  2ZMV A;  3DTM A;  1ES2 A;  1OTE A;  4JGO A;  5IU1 A;  3IF5 A;  5DF9 A;  1ZTU A;  2H0Y A;  3CIT A;  2BTF P;  2Z2M B;  1NXY A;  2FZ0 A;  2V0W A;  3OCL A;  3EGD C;  1LL5 A;  5JYP A;  2OAP 1;  1XKZ A;  2O9C A;  3F1N A;  3BFC A;  1NRF A;  2WKI A;  1YSP A;  4C3Q A;  3PHY A;  4UEY A;  1EWZ A;  2LB9 A;  5FI6 A;  4MBH A;  4IBX A;  3T1S A;  5L10 A;  5HAR A;  5CER A;  3LY3 A;  4BBV A;  1H8Y A;  2H10 A;  1DJB A;  2VK3 A;  4CPK A;  3OPH A;  2XD5 A;  4PM6 A;  5HPF A;  3V39 A;  2V8F A;  2W1T A;  4QHC A;  4OOY A;  2ZOH A;  3W4P A;  4NXG A;  1ZG6 A;  1CI8 A;  2JHE A;  1ES4 A;  4L0L A;  4X68 A;  3TE8 A;  4PM5 A;  2QPN A;  1DP9 A;  3BQ8 A;  3A3F A;  5FEG A;  3L9K A;  3QNB A;  5HD5 A;  5CTN A;  3N6I A;  3IH9 A;  3DWZ A;  1N9L A;  2OLU A;  1LI9 A;  3CAX A;  3IF6 C;  3I7J A;  2V1Z A;  5M19 A;  4RX3 A;  4WMC A;  2EXA A;  1KOU A;  5GLC A;  1FCO A;  4O8G A;  1I2W A;  4X1L A;  3FZC A;  1VET B;  3CG5 A;  4MN6 A;  1MWT A;  2G2U A;  5HL1 A;  1NYY A;  5FDS A;  1NJ4 A;  5E2G A;  4Z9Q A;  2PD8 A;  5D3O A;  4HJ3 A;  1GHI A;  3ISG A;  3NOP C;  5E43 A;  2ZC7 A;  1J9M A;  4DDY A;  2W0N A;  1YSQ A;  3ZCZ A;  5HWT A;  5F1F A;  1PFL A;  3L7H A;  1SHV A;  4N1H A;  2Y4A A;  5CHM A;  1WYB A;  4Y17 A;  3C8C A;  2WK0 A;  1MPL A;  3D3O A;  4ZJ1 A;  1IKI A;  3K3D A;  3D72 A;  1G28 A;  5FDH A;  4X25 A;  3HLW A;  3OPL A;  3ZG0 A;  4LPZ A;  4EBL A;  5A90 A;  4UAA A;  3VFH A;  1BUE A;  2HP9 A;  4OPR A;  4EES A;  2Y2J A;  4WEL A;  4EQ1 A;  4EQI A;  3WS5 A;  3O3V A;  4UA6 A;  1ZC2 A;  4LRY C;  3C5A A;  3MZF A;  5KSH A;  3MBZ A;  4E6X A;  4H8R A;  1S4S A;  5CGX A;  4KG6 A;  1YQS A;  2V8C A;  4NET A;  1RGY A;  1PYY A;  5G4Y A;  3BJN A;  3CWF A;  2WZZ A;  1UWP X;  4FUW A;  4B4X A;  3N8R A;  3BY9 A;  3M6H A;  2JBF A;  3IS2 A;  3N4I A;  5E2E A;  1XFN A;  3BYD A;  3PAE A;  4JF6 A;  5DF7 A;  2K31 A;  4GD8 A;  5HWV A;  5TBM A;  3ZVT A;  2E8I A;  1FSW A;  2PRF A;  3MQ0 A;  4ETX A;  3SW1 A;  5EFW A;  3DWK A;  2X01 A;  3WS1 A;  3Q7V B;  1SKO A;  4E3I A;  3NI9 A;  4H6J B;  2QJ7 A;  3UPN A;  1GSX A;  3D4F A;  3K3C A;  4KZ8 A;  4ARZ B;  3VV4 A;  1KDW A;  4CLC D;  3MJQ A;  3IX8 A;  4KUO A;  1F9I A;  2WKR A;  3UE0 A;  3HLF A;  3W2Z A;  2P7J A;  4K08 A;  4WZ4 A;  1ESI A;  1VEU A;  3U4L P;  3RFB A;  1H8Z A;  2VX8 A;  5I94 A;  3B33 A;  3LIE A;  2YKH A;  4R23 A;  4BJP A;  1Z09 A;  5F69 A;  2Y2G A;  4RYE A;  3T4L A;  3C38 A;  4I38 A;  3BEB A;  5HAQ A;  2GJ3 A;  2W3G A;  1XGJ A;  1SKF A;  5GLA A;  2OOL A;  3LEQ A;  1IEL A;  1D7E A;  4JXS A;  2Y2I A;  3NIA A;  3PAG A;  2K7S A;  2HDU A;  4NEE D;  4UQI M;  3VOL A;  2L0W A;  1X0O A;  3LIC A;  2WGV A;  4PM9 A;  4Y13 A;  4P85 A;  4GDB A;  1STZ A;  3OPR A;  4OKP A;  2XK1 A;  3SS4 A;  1JTD A;  4JGR A;  1CQA A;  4JXW A;  4HY8 A;  4WZ5 A;  3KSG A;  4HJ6 A;  1K56 D;  1OT6 A;  2B5R A;  1DJC A;  1ES5 A;  1N9N A;  4Y3I A;  5F6A A;  3H82 B;  5HZH A;  2HGV A;  1XPB A;  1T1C A;  5HW3 A;  2WGW B;  2XH9 A;  1LSX A;  3MZD A;  3G32 A;  3EQU A;  1J3W A;  4LFU A;  3F1O B;  2XDM A;  4DE2 A;  5GHZ A;  4MMN A;  1FCM A;  1K4E A;  3NUL A;  1OJ5 A;  5TBM B;  2XRO A;  1T1A A;  3HUN A;  3NBL A;  4JGP A;  2ZC6 B;  2JE5 A;  5F83 A;  5EVE A;  3G34 A;  4FTX A;  1KVL A;  4WLA A;  4WYY A;  4P6Z M;  4XT2 A;  3T4O A;  3HBR A;  3SH8 A;  4BQM A;  3IX4 A;  2VGL S;  5U47 A;  4QB8 A;  1BYW A;  2J3T D;  4X1M A;  2WAE A;  3P7N A;  3TW8 A;  4F94 A;  3BW6 A;  1CEF A;  3LO7 A;  5AQA A;  1NZU A;  3LR3 A;  5G4Z A;  4CLC C;  1K57 C;  3PBS A;  4CJN A;  2DMW A;  2FFF B;  4EEP A;  3SOI A;  3HVF A;  4I3A A;  3DTK A;  4JGQ A;  5HDC A;  1IYQ A;  1LSW A;  4EER A;  3T1X A;  5AVF A;  2Z6D A;  3M2J A;  2ZM8 A;  2GNX A;  1P97 A;  1TVF A;  3RJU A;  3LI9 A;  3C4O A;  4BBU A;  1QMF A;  3G31 A;  5FAT A;  5CRF A;  3DTI A;  2ZC5 B;  3ZNY A;  2KOI A;  1YLT A;  2GZA A;  3E2L A;  2KLI A;  2HDQ A;  2EFX A;  3CHW P;  3MKF A;  1S1Z A;  1KE4 A;  4B88 A;  5IS1 A;  4NXF A;  2Y2N A;  1T18 A;  3NHQ A;  3RXX A;  1O7E A;  4IED A;  2EXB A;  1CEG A;  3VP4 A;  4BEN A;  5MC7 A;  3ZQ5 A;  2V9A A;  3LEZ A;  3BFE A;  5L8M A;  1DP6 A;  4GOG A;  2R78 A;  1L0E A;  4R4S A;  4EW7 A;  2FH5 A;  3C4P A;  2WKQ A;  3LFV A;  3R7W A;  3W4Q A;  3DW0 A;  3IF6 A;  2DNS A;  3MF0 A;  3CI6 A;  5F5Y A;  4E3N A;  2WKP A;  4OH0 A;  2W3F A;  3IF6 B;  3P09 A;  3Q7V A;  2QMI A;  5EEC A;  2XA7 M;  1I2S A;  4N9L A;  1VB6 A;  3NOT C;  4KG5 A;  1L0G A;  3VMA A;  4HEF A;  3WWX A;  5GLD A;  2Y55 A;  3VOY A;  2V1A A;  4X53 A;  3IHA A;  3VSL A;  5CEC A;  1EW0 A;  3MQO A;  3QP6 A;  2XF3 A;  3VE3 A;  3HLE A;  1BUL A;  4WM9 A;  2ZQ9 A;  5IHV A;  4WBG A;  4OLD A;  4B9O A;  5A92 A;  3W4O A;  1SKO B;  3TRC A;  5KZH A;  3NEC A;  4EET B;  1CJF A;  3IH8 A;  4AFI A;  1L0D A;  1DP8 A;  2D01 A;  2EWW A;  3BFF A;  3PR6 A;  2QZ6 A;  4PM7 A;  3CUE A;  4M4X A;  3IT9 A;  4FCF A;  2Y8H A;  5HDD A;  1K25 A;  1JWZ A;  5FA7 A;  3T4Q A;  3WS4 A;  5FQM A;  4GKU A;  1K6S A;  2B02 A;  2O99 A;  3S7N A;  4EBP A;  3QP5 A;  1PWD A;  3JYI A;  3LIB A;  3EEA A;  4OQ0 A;  4MCW A;  4RX2 A;  5CX7 A;  4JXV A;  4P6Z S;  4B93 A;  3T1Q B;  5FQK A;  3BRM A;  3IQA A;  3F1P A;  4I5S A;  3KYZ A;  2JKT I;  3CLO A;  3E4Q A;  4OQI A;  4LV0 A;  4E3K A;  2ZC3 B;  2XGN A;  1BLC A;  2ZLY A;  1XX2 A;  1OPX A;  3Q07 A;  2OSU A;  1G5U A;  4GS9 A;  4LEN A;  3HRE A;  1MWU A;  3KYQ A;  2Y59 A;  2ZBB A;  2Q0O A;  2GX5 A;  2Y2Q A;  3DTE A;  5F82 A;  2Y2O A;  5AQB A;  4HP9 A;  2NUP C;  2V2F F;  5FAQ A;  2ZQ7 A;  4XT2 B;  3SH9 A;  1V9Z A;  3JVV A;  1NZO A;  5DF8 A;  2HDS A;  1K6R A;  3MKE A;  4U0T A;  2ZQC A;  2IWB A;  1FR6 A;  5EVI B;  4S2L A;  1W7F A;  1GHP A;  4LCL A;  3A3E A;  2PT7 A;  3SH7 A;  3GRJ A;  3S22 A;  3HUO A;  2H28 A;  4OOL A;  2Y91 A;  2PD7 A;  3F1O A;  2ZMA A;  2INW A;  4JF5 A;  4KZ3 A;  4Q0H A;  1XXM A;  5AVE A;  3HUM A;  1C3B A;  2R9X A;  5HL6 A;  4MLL A;  3VP3 A;  1XJ6 A;  5BOH A;  5IT5 A;  2BAS A;  1F98 A;  1S4R A;  3NDE A;  3OPP A;  3WRT A;  2I72 A;  4R38 A;  5L2F A;  1VEU B;  4JF4 A;  3KYE A;  4L9E A;  3V50 A;  4MBF A;  1KE0 A;  2HP6 A;  2JKR M;  1BTL A;  1MKI A;  1LI0 A;  3NJA A;  2PR6 A;  1OTD A;  3V3S A;  5FI7 A;  2PYR A;  1SCW A;  4S2N C;  2Q9N A;  4DXC A;  1G68 A;  5CTM A;  2A24 A;  1HD8 A;  4R3J A;  3OBF A;  4YNR A;  2R9W A;  3FPW A;  5F1G A;  4BL2 A;  1P0Z A;  3KX0 X;  3T4K A;  3LIA A;  3JPU A;  2P9V A;  2C5W B;  1DRM A;  4DXB A;  4X69 A;  4NG2 A;  1PW8 A;  3QHY A;  3V3R A;  1DY6 A;  1N9B A;  3KO6 A;  1K54 C;  4FH2 A;  1TS7 A;  4R70 A;  2JCH A;  3D9Y A;  4A5R A;  3LGO A;  2DRW A;  4ARZ A;  5AQ7 A;  1IYP A;  3HJK A;  4JXG A;  2ZQA A;  1W63 Q;  2OV5 A;  4GDN A;  4QY6 A;  2PBD P;  3ZFZ A;  4NK3 A;  1ALQ A;  1XJ2 A;  3C2W A;  1Q2Q A;  4OLG A;  4YFM A;  5J3W A;  5FQJ A;  5TFQ A;  3TSG A;  3PXP A;  4BL3 A;  4R4R A;  1E3U A;  3GDI A;  2W27 A;  3Q7Z A;  2PYP A;  5DFX A;  1H3Q A;  3HCY A;  1ERO A;  4OP5 A;  3EOI A;  3PBO A;  3C30 A;  3RH8 B;  2PR5 A;  4UA7 A;  3QP4 A;  3T4J A;  2A49 A;  1WA9 A;  5EVI A;  2L1M A;  3IX3 A;  3UDX A;  3R4K A;  2WYX A;  4DE3 A;  3VSK A;  3QNC A;  3WRZ A;  5DKL A;  4I3I A;  1OT9 A;  2XA7 S;  2W3E A;  5FAP A;  3H7W B;  4K0W A;  2QJ5 A;  2NUT C;  1XFQ A;  3CZD A;  4S2N A;  1UWN X;  4FSF A;  1HVB A;  1PWC A;  3PBT A;  3UMD A;  4U0X A;  1XGI A;  2ZL1 B;  1NLY A;  1H5X A;  1YKD A;  3G30 A;  3LI8 A;  1Z6F A;  3PBR A;  2Y2K A;  1PI5 A;  3KSH A;  3TG9 A;  2J7V A;  4ETZ A;  5KIZ A;  4OPQ A;  4N1X A;  3AGE A;  3K2N A;  1MWR A;  3NCK A;  2WAF A;  2V1B A;  2JKR I;  1K56 A;  2QHK A;  4PHT A;  4ZAM A;  3Q82 A;  1KDS A;  4DF6 A;  5DTS A;  3B3X A;  3A0S A;  4WUJ A;  4EU0 A;  1MZU A;  3SZT A;  3CJM A;  5HFO A;  1YPR A;  2L4R A;  4KQO A;  1KGF A;  4X56 A;  1TF1 A;  3LYX A;  1TD5 A;  1P9R A;  4D2O A;  3S1Y A;  2HF6 A;  1DJA A;  4GNU A;  5E2H A;  2IWD A;  3KSI A;  1K4F A;  1BLH A;  2XFT A;  4EEU A;  4S2P A;  3IXB A;  1NWZ A;  1P9W A;  4QU3 A;  4F3L B;  4II7 A;  2G7U A;  4G3K A;  4DE1 A;  1GCE A;  3HLC A;  3Q81 A;  4BD1 A;  4ZDX A;  2P74 A;  3OLO A;  3BM6 A;  1S6R A;  1GA9 A;  2WAD A;  5J8X A;  5HAP A;  3HLG A;  4GB7 A;  5DJU A;  4KG2 A;  1I5Q A;  2Z2L B;  4X6T A;  2GDN A;  3ULF A;  1E3U D;  1K55 C;  4WZ5 C;  1LT0 A;  1SZV A;  4H6J A;  3LR5 A;  4PKY G;  1Y54 A;  3FKW A;  4L9G A;  1TDG A;  4MNR A;  2XEP A;  1K54 A;  2OLV A;  3SS5 A;  4WEK A;  4DJ2 A;  3OC2 A;  1ACF A;  2J3T C;  3A0R A;  5HDS A;  4R3A A;  2UWX A;  4Y15 A;  4DJ3 A;  4Q8I A;  5J7E A;  1YAX A;  1W5D A;  4EUZ A;  1F5M A;  1N4O A;  5CEB A;  3C7U A;  4I39 A;  1M6K A;  3O86 A;  2G2W A;  3TJZ C;  1XJ3 A;  3AGF A;  1K38 A;  2E8J A;  2XR0 A;  3EWK A;  3A3D A;  3VP0 A;  4WL9 A;  3UNW A;  2EA9 A;  2ZQD A;  4IUH A;  4LGW A;  4LCM A;  4Q0I A;  3FPV A;  3T4S A;  3W8K A;  2O9B A;  2Y2P A;  1F2K A;  5GHY A;  2XD1 A;  4S2M A;  3PTE A;  2PAV P;  4GD6 A;  2O9A A;  4FD8 A;  3ZG8 B;  4OVD A;  1G6A A;  5FQI A;  2DCF A;  3IBJ A;  5EM1 A;  4YWZ A;  3MFX A;  5A91 A;  2ZM2 A;  1Q2P A;  5TJJ A;  1D06 A;  1PW1 A;  1VM1 A;  3E98 A;  3GR2 A;  3V67 A;  3H7W A;  3FC7 A;  5CGS A;  4DDS A;  3CPT A;  4HP4 A;  4OPY A;  3N7W A;  5F68 A;  3E4O A;  2K2N A;  1FIK A;  1HZO A;  2KX6 A;  4ESP A;  5FQ9 A;  1PZO A;  1RCJ A;  1H0M A;  3G35 A;  4IHQ A;  4WEJ A;  1XJ4 A;  3ZG7 B;  3LCE A;  4L9F A;  2XFS A;  1CI9 A;  2ZM0 A;  4OPZ A;  3G4P A;  3ITB A;  1BLP A;  1WE4 A;  2JN7 A;  3MQQ A;  1SDN A;  1VQQ A;  2B95 A;  4QD4 A;  4Y0U A;  4P6B A;  4R1G A;  1PZP A;  3FYZ A;  1O07 A;  5CXW A;  4MDZ A;  2Y79 A;  1IYS A;  4XXR A;  3WS0 A;  4QPR A;  4XUZ A;  4DE0 A;  4OQG A;  3BY8 A;  3NY4 A;  3SS3 A;  3OOV A;  2VEA A;  4Y2F A;  3RTY A;  4KQQ A;  3F1P B;  2XQZ A;  4N9K A;  1KE3 A;  4HIA A;  1PIO A;  3BFD A;  3ZG9 B;  4YIN A;  1MKM A;  3M6B A;  3ZNT A;  4GHI B;  3E4P A;  5DTK A;  3VP2 A;  3IWI A;  4KZ5 A;  4M3K A;  5FL3 A;  1D1J A;  2EX6 A;  1BSG A;  1IOU A;  1OTI A;  2B18 A;  1GA0 A;  4P0M A;  3MS6 A;  1CF0 A;  4YOF A;  1W8Q A;  4HOI A;  4IBR A;  4BLM A;  1ZG4 A;  5LBR A;  3QP8 A;  2JKF A;  2Y2L A;  5HD3 A;  2EX2 A;  1LL9 A;  2Y2H A;  3F1N B;  4ZJ2 A;  4UQI S;  1E25 A;  5I5L A;  5M1A A; 
#chains in the Genus database with same CATH homology
 1YMX A;  2HDU A;  1K54 C;  1LLB A;  4GZB A;  4ZTK A;  3O88 A;  4FH2 A;  2EX8 A;  5DVA A;  1EI5 A;  2J9P A;  3HL9 A;  3E2K A;  2JCH A;  3IWQ A;  2WGV A;  1M40 A;  4PM9 A;  4KEN B;  4P85 A;  4GDB A;  4ZBE A;  4S2I A;  4A5R A;  4B4Z A;  3OPR A;  3N8L A;  4OKP A;  2XK1 A;  2C6W B;  5E2F A;  4O7D A;  2DRW A;  5FI2 A;  3SS4 A;  1JTD A;  3ITA A;  4R3B A;  2H0T A;  4JXW A;  5EVI D;  1IKG A;  2BLS A;  2VGJ A;  3Q1F A;  4WZ5 A;  5AQ7 A;  1YLW A;  4QJG A;  4OOM A;  1IYP A;  1L2S A;  1RP5 A;  4JXG A;  1K56 D;  2ZQA A;  5EVL A;  3UY6 A;  5FSR A;  5EVI C;  2B5R A;  3UDI A;  3HLD A;  1ERQ A;  2OV5 A;  4GDN A;  4QY6 A;  1DJC A;  1ES5 A;  1CK3 A;  3ZFZ A;  4JLF A;  1ALQ A;  4NK3 A;  4BD0 A;  4R0Q A;  1Q2Q A;  1XPB A;  4JKT A;  5HW3 A;  2WGW B;  4OLG A;  4E3J A;  1TEM A;  4KZA A;  4YFM A;  3MZE A;  2XH9 A;  3RXW A;  5FQJ A;  5TFQ A;  4IVI A;  3MZD A;  3TSG A;  3G32 A;  3EQU A;  1PI4 A;  3ZDJ A;  4BL3 A;  4R4R A;  2FFY A;  1E3U A;  5JYO A;  1ONG A;  2XDM A;  3IXG A;  4N92 A;  4DE2 A;  3PBQ A;  3Q7Z A;  5GHZ A;  1FCM A;  1XA7 A;  1K4E A;  1ERO A;  4DKI A;  4OP5 A;  3OCN A;  3PBO A;  2Q9M A;  3C7V A;  3HUN A;  3NBL A;  3NC8 A;  5GLB A;  4KQR A;  4UA7 A;  5TR7 A;  5M18 A;  1NY0 A;  2RL3 A;  2XLN A;  2A49 A;  5CHU A;  2ZC6 B;  5G18 A;  2JE5 A;  5EVI A;  1NYM A;  3MFD A;  5F83 A;  3G34 A;  3UDX A;  1ESU A;  3UDF A;  1KVL A;  5AQ9 A;  1MWS A;  2WYX A;  4WYY A;  4ZJ3 A;  3M2K A;  4DE3 A;  3VSK A;  3HBR A;  3QNC A;  3WRZ A;  1FOF A;  4KZ6 A;  2WUQ A;  3CMZ A;  4QY5 A;  3SH8 A;  4BQM A;  4EV4 A;  5KMW A;  5U47 A;  5FAP A;  4K0W A;  4QB8 A;  3TOI A;  1YLZ A;  3P98 A;  3CZD A;  1XP4 A;  4S2N A;  5EOO A;  4LV1 A;  4Y0T A;  2HDR A;  4EWF A;  2J8Y A;  3BLM A;  2WAE A;  4FSF A;  4K91 A;  2PU4 A;  3OZH A;  1HVB A;  3ZHH A;  1RGZ A;  4F94 A;  1YLP A;  3PBN A;  1PWC A;  1CEF A;  3PBT A;  3FKV A;  2WGI A;  3LO7 A;  4HBT A;  5AQA A;  1NZU A;  4PMA A;  4S2O A;  2JC7 A;  4U0X A;  1W8Y A;  1XGI A;  5EUA A;  4IVK A;  1HTZ A;  3V5M A;  5KSC A;  4UA9 A;  1H5X A;  1K57 C;  2A3U A;  4KZB A;  1IYO A;  3PBS A;  1OME A;  3UPP A;  3G30 A;  4JPM A;  4CJN A;  2Y2M A;  1YMS A;  3MXR A;  5EPH A;  2FFF B;  1Z6F A;  4PM8 A;  3PBR A;  2VGK A;  5HAI A;  2Y2K A;  1PI5 A;  3TG9 A;  1ONH A;  3SOI A;  2PU2 A;  5GL9 A;  3HLB A;  2PBY A;  3HVF A;  3LY4 A;  1IYQ A;  2J7V A;  1ZKJ A;  3M2J A;  4OPQ A;  1MBL A;  1LHY A;  2ZM8 A;  4XUX A;  1WYC A;  1TVF A;  3RJU A;  5CED A;  4N1X A;  3AGE A;  4HBU A;  2EX9 A;  3C4O A;  3GV9 A;  1L0F A;  5CHJ A;  1BZA A;  5DTT A;  1MWR A;  3ZVW A;  4E3L A;  3GSG A;  3UPO A;  3A3I A;  1QMF A;  3G31 A;  3NCK A;  5EOE A;  5FAT A;  1QME A;  5CRF A;  5A93 A;  2WAF A;  2ZC5 B;  3ZNY A;  1YLT A;  2EFU A;  1K56 A;  3ZG5 A;  4ZAM A;  3Q82 A;  1SDE A;  3E2L A;  1KDS A;  3DTM A;  1ES2 A;  1KVM A;  3IF5 A;  3NDG A;  4DF6 A;  5DF9 A;  2HDQ A;  5DTS A;  2EFX A;  2H0Y A;  3B3X A;  3MKF A;  3GQZ A;  1ERM A;  2J9O A;  1KE4 A;  2Z2M B;  1NXY A;  4B88 A;  3CJM A;  5HFO A;  3RXX A;  2Y2N A;  4E3M A;  3OCL A;  1LL5 A;  1O7E A;  4IED A;  5JYP A;  2EXB A;  3GVB A;  4KQO A;  1CEG A;  3IWO A;  1KGF A;  1XKZ A;  3EQV A;  2X71 A;  4S2K A;  4X56 A;  3VP4 A;  4BEN A;  2ZJ9 A;  3BFC A;  1NRF A;  4D2O A;  2IWC A;  3S1Y A;  2WKI A;  1DJA A;  3LEZ A;  4GNU A;  5E2H A;  3BFE A;  2IWD A;  1BLS A;  3UE3 A;  4C3Q A;  4GOG A;  1U60 A;  1K4F A;  1BLH A;  4K0X A;  2P9V B;  1GHM A;  2XFT A;  4FH4 A;  1L0E A;  1EWZ A;  4S2P A;  3IXB A;  4R4S A;  4QU3 A;  5FI6 A;  4MBH A;  4IBX A;  2ZQ8 A;  3C4P A;  4Y0O A;  4MEZ A;  5HAR A;  5CER A;  3AGD A;  3LY3 A;  1H8Y A;  2H10 A;  1DJB A;  3W4Q A;  4CPK A;  4DE1 A;  1GCE A;  3DW0 A;  3OPH A;  3IF6 A;  3HLC A;  2DNS A;  3Q81 A;  2HP5 A;  2XD5 A;  1JWV A;  4BD1 A;  4ZDX A;  4E3N A;  2P74 A;  4OH0 A;  3IF6 B;  4PM6 A;  3V39 A;  3P09 A;  3BM6 A;  3Q7V A;  1S6R A;  1GA9 A;  2QMI A;  2WAD A;  4E3O A;  5J8X A;  5EEC A;  5HAP A;  4QHC A;  3HLG A;  1I2S A;  4OOY A;  4N9L A;  4GB7 A;  3W4P A;  4KG2 A;  4E6W A;  1ZG6 A;  1I5Q A;  4KG5 A;  1L0G A;  1CI8 A;  4HEF A;  5HX9 A;  2Z2L B;  3VMA A;  3WWX A;  4X6T A;  2GDN A;  2CC1 A;  1ES4 A;  4L0L A;  4X68 A;  2Y55 A;  3BLS A;  5CGW A;  5GLD A;  1E3U D;  3VOY A;  4PM5 A;  2QPN A;  4S2J A;  4X53 A;  4U3T A;  1K55 C;  3IHA A;  3VSL A;  3A3F A;  4WZ5 C;  3QNB A;  5CEC A;  2V20 A;  4UHU A;  4WMC D;  5CTN A;  1Y54 A;  3N6I A;  2XF3 A;  3DWZ A;  3IH9 A;  3HLE A;  1BUL A;  4WM9 A;  3FKW A;  2OLU A;  1LI9 A;  1TDG A;  2ZQ9 A;  4WBG A;  3IF6 C;  5IHV A;  3I7J A;  2V1Z A;  4MNR A;  2XEP A;  1K54 A;  2OLV A;  4RX3 A;  4WEK A;  3SS5 A;  5M19 A;  3OC2 A;  4OLD A;  4WMC A;  3W4O A;  2EXA A;  5A92 A;  5GLC A;  1FCO A;  5KZH A;  1I2W A;  2UWX A;  3FZC A;  3UO9 A;  1K57 A;  3CG5 A;  1FR1 A;  1JVJ A;  3IH8 A;  4Q8I A;  4HES A;  1L0D A;  1YM1 A;  3UE1 A;  3BEC A;  1MWT A;  2G2U A;  1W5D A;  4EUZ A;  3BFF A;  5HL1 A;  2QZ6 A;  4PM7 A;  1NYY A;  4LV3 A;  1N4O A;  1NJ4 A;  3C7U A;  5E2G A;  5CEB A;  4Z9Q A;  5D3O A;  1M6K A;  3IT9 A;  3O86 A;  4FCF A;  1GHI A;  2WKE A;  1K25 A;  1JWZ A;  1YLJ A;  2G2W A;  3ISG A;  3AGF A;  5FA7 A;  3WS4 A;  3IXH A;  5E43 A;  3FWL A;  1K38 A;  2XR0 A;  2ZC7 A;  5FQM A;  1J9M A;  4DDY A;  4GKU A;  1K6S A;  3A3D A;  4KZ9 A;  4C75 A;  3VP0 A;  2ZC4 B;  3ZCZ A;  1KGG A;  3UNW A;  5F1F A;  2ZQD A;  4LCM A;  1PWG A;  1SHV A;  4EBP A;  1PWD A;  4RA7 A;  4RVA A;  5GHX A;  3S4X A;  3JYI A;  4N1H A;  2Y4A A;  5CHM A;  2Y2P A;  3W8K A;  1WYB A;  2HPB A;  4OQ0 A;  2WK0 A;  4ID4 A;  4RX2 A;  3VOZ A;  3ZGA B;  4JXV A;  1MPL A;  4ZJ1 A;  3O87 A;  5GHY A;  1MY8 A;  5FQK A;  2XD1 A;  1IKI A;  3BRM A;  3IQA A;  4S2M A;  3PTE A;  5FDH A;  3HLW A;  3NIA A;  5FQQ A;  4OQI A;  4LV0 A;  4GD6 A;  3OPL A;  4E3K A;  4FD8 A;  2ZC3 B;  3ZG0 A;  3ZG8 B;  3A3J A;  3GMW A;  4OVD A;  2XGN A;  4EBL A;  1BLC A;  2ZLY A;  1G6A A;  5A90 A;  1XX2 A;  4UAA A;  3Q07 A;  3VFH A;  1BUE A;  2HP9 A;  1XA1 A;  2OSU A;  4OPR A;  2DCF A;  5FQI A;  4LEN A;  3HRE A;  1MWU A;  2Y2J A;  4WEL A;  2Y59 A;  3IHB A;  4EQI A;  3WS5 A;  5A91 A;  2ZM2 A;  2Y2Q A;  1Q2P A;  3O3V A;  4UA6 A;  1ZC2 A;  3G2Z A;  5F82 A;  3C5A A;  1PW1 A;  2Y2O A;  5AQB A;  1VM1 A;  3MZF A;  3GR2 A;  5KSH A;  4DRT A;  1YT4 A;  2BG1 A;  4JBF A;  5CGS A;  4DDS A;  3MBZ A;  4E6X A;  4OPY A;  2V2F F;  4H8R A;  3N7W A;  5FAQ A;  5CGX A;  2ZQ7 A;  4KG6 A;  1YQS A;  3SH9 A;  4NET A;  1RGY A;  1PYY A;  1HZO A;  4OQH A;  1NZO A;  2WZZ A;  5FQ9 A;  5DF8 A;  1PZO A;  2HDS A;  1RCJ A;  2WZX A;  1K6R A;  4B4X A;  3G35 A;  3N8R A;  3M6H A;  1MXO A;  2JBF A;  3MKE A;  3N4I A;  4X55 A;  4U0T A;  5E2E A;  2ZQC A;  4WEJ A;  2IWB A;  5FAS A;  1FR6 A;  3ZG7 B;  3BYD A;  3LCE A;  2XFS A;  3PAE A;  4OP8 A;  5EVI B;  4S2L A;  1CI9 A;  1W7F A;  4JF6 A;  5DF7 A;  1GHP A;  2ZM0 A;  3A3E A;  4GD8 A;  4LCL A;  4OPZ A;  3G4P A;  3SH7 A;  3GRJ A;  3MXS A;  3S22 A;  3HUO A;  3ITB A;  3ZVT A;  1YLY A;  1BLP A;  1WE4 A;  4OOL A;  1IEM A;  2E8I A;  1FSW A;  2Y91 A;  4PPR A;  2ZMA A;  5TGF A;  2WKH A;  1SDN A;  4JF5 A;  4KZ3 A;  1VQQ A;  1FSY A;  1XXM A;  4QD4 A;  4Y0U A;  1KGE A;  3HUM A;  4P6B A;  4R1G A;  1JWP A;  1C3B A;  4C6Y A;  2R9X A;  3DWK A;  3VP1 A;  3IXD A;  1PZP A;  4MLL A;  3VP3 A;  2X01 A;  3FYZ A;  1TDL A;  5BOH A;  3WS1 A;  3Q7V B;  5EE8 A;  4GN2 A;  3NDE A;  1O07 A;  4E3I A;  5CXW A;  3NI9 A;  1S0W A;  3GTC A;  2X02 A;  3UPN A;  3OPP A;  1IYS A;  4XXR A;  3WRT A;  3WS0 A;  3D4F A;  2I72 A;  5L2F A;  4JF4 A;  4XUZ A;  1FCN A;  4DE0 A;  4KZ8 A;  3V50 A;  4MBF A;  1KE0 A;  1KDW A;  2HP6 A;  4OQG A;  1BTL A;  1MKI A;  3NY4 A;  3SS3 A;  1LI0 A;  4Y7P A;  4EBN A;  1ES3 A;  3UE0 A;  3V3S A;  4KQQ A;  3HLF A;  4P87 A;  2XQZ A;  4WZ4 A;  4N9K A;  1KE3 A;  1JTG A;  5FI7 A;  2WGW A;  1PIO A;  3BFD A;  3ZG9 B;  1ESI A;  4YIN A;  1SCW A;  4S2N C;  2Q9N A;  4DXC A;  1H8Z A;  5I94 A;  1G68 A;  5CTM A;  3M6B A;  3ZNT A;  1HD8 A;  4R23 A;  5DTK A;  3VP2 A;  4R3J A;  4BJP A;  3IWI A;  4KZ5 A;  4M3K A;  2R9W A;  4KZ7 A;  2EX6 A;  1BSG A;  3FV7 A;  1BT5 A;  1E4D A;  3VFF A;  3UN7 A;  4OON A;  2Y2G A;  4RYE A;  5F1G A;  4BL2 A;  1AXB A;  1GA0 A;  3BEB A;  5HAQ A;  4P0M A;  2RCX A;  1W8Q A;  1XGJ A;  1SKF A;  2P9V A;  4LV2 A;  4MBK A;  5GLA A;  4IBR A;  2C5W B;  3N8S A;  4BLM A;  1ZG4 A;  2H5S A;  3G2Y A;  3WS2 A;  1K55 A;  4DXB A;  2Y2L A;  4KZ4 A;  1IEL A;  2EX2 A;  1LL9 A;  2Y2H A;  4X69 A;  5FAO A;  3BFG A;  1PW8 A;  4JXS A;  1FQG A;  4ZJ2 A;  3QHY A;  2Y2I A;  1E25 A;  3V3R A;  2ZD8 A;  1DY6 A;  1N9B A;  1W79 A;  3PAG A;  5M1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...