5A92A

15k x-ray structure with cefotaxime: exploring the mechanism of beta- lactam ring protonation in the class a beta-lactamase acylation mechanism using neutron and x-ray crystallography
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
260
structure length
260
Chain Sequence
b'SVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE CTX-M-97
publication title Exploring the Mechanism of Beta-Lactam Ring Protonation in the Class a Beta-Lactamase Acylation Mechanism Using Neutron and X-Ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 92
structure length 260
sequence length 260
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5a92A00
1NYYA 3O3VA 2V1ZA 2ZQ7A 3RXWA 1HTZA 5GLCA 2OSUA 1J9MA 1IKIA 4A5RA 1G6AA 4EBLA 4ZAMA 3AGEA 1Y54A 2C6WB 2ZC7A 3BFCA 3PBOA 4WBGA 4Y7PA 2WUQA 4JF4A 4K91A 4S2JA 1FOFA 2BG1A 5F1FA 4OQGA 1IYPA 3HLEA 1CI9A 4JKTA 4KZ4A 1K25A 3ZG8B 3Q1FA 4DDSA 2C5WB 2V20A 1JVJA 3W4OA 1XXMA 5CGSA 2IWDA 3S22A 4OP5A 3O88A 1ES2A 4RA7A 4HBTA 1GHIA 2H0TA 4MBKA 3HLDA 4BQMA 5FASA 4JXSA 1BZAA 4OOYA 3ZGAB 3BYDA 5CEBA 2ZLYA 5KMWA 1S0WA 3OCLA 4OKPA 5FQQA 2HP5A 2Z2LB 3E2KA 4S2MA 2GDNA 3VP0A 1C3BA 1HZOA 1KDSA 3MXSA 1K55A 1JWZA 4X68A 4DKIA 4EV4A 4E3NA 3UN7A 1MKIA 1LI0A 3P98A 1ERQA 2ZC4B 4OP8A 4KG2A 3IH9A 3BFFA 1EWZA 5CGWA 1NZOA 3BRMA 4FH4A 4DE2A 3C7UA 5EVIC 1VM1A 2WGWB 3MZEA 1JWVA 1LL5A 2Y59A 4KZ3A 4MEZA 5HAPA 3SH7A 4OH0A 3FWLA 1XX2A 3G4PA 2XR0A 1PZPA 1NJ4A 1BTLA 1YLWA 3NDEA 1IEMA 3PAGA 4WZ5A 4KQRA 2H0YA 3W8KA 3UDIA 1FR1A 3Q7VA 1AXBA 3S1YA 1K6SA 5DF9A 4ZBEA 5FI2A 3UE0A 4B88A 3IWOA 2ZM2A 3MKFA 2WKIA 3GMWA 5G18A 4RVAA 1ZG4A 4MNRA 2XD5A 5F1GA 1FR6A 3CZDA 2G2WA 4PM5A 1W7FA 3NDGA 3C4OA 4KZ9A 5M1AA 2JE5A 1OMEA 2X71A 3G31A 3VP1A 1LI9A 2QZ6A 4WYYA 3JYIA 2HDQA 4PM8A 4FH2A 1ESUA 4GOGA 4E3MA 1KE0A 1BLHA 5CEDA 5HX9A 1HVBA 4LV2A 2EXBA 1MWUA 4OONA 2B5RA 2ZQCA 3MFDA 3C5AA 1FSWA 3MZDA 4GDBA 2Y55A 2WAFA 3GVBA 4GNUA 4YFMA 1KGFA 5CHJA 3GSGA 4PM6A 1TDLA 1W79A 5FQIA 4C75A 1BULA 4S2NA 3TOIA 1I2SA 5FDHA 1K56D 5EPHA 5IHVA 4LENA 4E3KA 3WRZA 2XFSA 1QMFA 3D4FA 5FAOA 2EFXA 3N7WA 1KDWA 4E6WA 5E43A 2OV5A 2Y91A 2ZMAA 3IXGA 2JC7A 4OPRA 4BJPA 4FD8A 1CK3A 1DY6A 3ZG5A 3TG9A 3A3EA 2XD1A 3G2YA 4N1HA 3WS5A 4HBUA 2HP9A 1RGYA 2Y2NA 3VFHA 1XP4A 1XGIA 1ONGA 1CEFA 1PW1A 3UO9A 1SHVA 5HFOA 2V2FF 5A90A 3G2ZA 1BSGA 5EVIB 1U60A 1NXYA 3VP4A 2H10A 3OPHA 3SS3A 4DE1A 4XXRA 1E4DA 4NK3A 3OZHA 3GRJA 2QPNA 4IEDA 1ALQA 4GD8A 1MPLA 4UAAA 5FAPA 4LV1A 3VP2A 1WYBA 1YQSA 1M6KA 4KQOA 3VFFA 1K54C 3FZCA 4N9KA 2P74A 1ZKJA 3PAEA 1MWRA 5FQMA 3BM6A 3BFEA 3V39A 2Q9NA 5DF7A 4BL3A 1JTDA 1L0EA 1JTGA 1EI5A 4P87A 4U0XA 3NCKA 5DVAA 3BFDA 3C7VA 2Y4AA 2XGNA 3ZNYA 5GHXA 3MZFA 4P85A 3Q82A 4Y0OA 1K55C 5FQKA 3SH8A 3ZCZA 3OPPA 1XKZA 1N4OA 4IVIA 3G30A 4DXCA 1DJBA 4F94A 3BECA 4R3BA 3PBTA 3DTMA 3QNBA 2Q9MA 2FFFB 3N6IA 1RCJA 2DNSA 2E8IA 2X02A 2WZXA 4H8RA 1DJCA 4KQQA 1PI5A 4YINA 4WZ5C 1L0GA 3QNCA 2OLUA 5CRFA 2EX6A 3LO7A 3ZNTA 4PPRA 1Z6FA 3OPLA 1NYMA 4R0QA 1JWPA 4EBPA 4LCMA 2XDMA 5CERA 2WGWA 5GL9A 1ONHA 1L0FA 4DDYA 3DW0A 1W8YA 3IF6A 1PYYA 1LLBA 3ZFZA 1YLYA 3IHAA 4GZBA 4WEKA 5E2EA 1K56A 3ZHHA 1M40A 4RX2A 3HUMA 2J8YA 3VP3A 1K38A 1MWSA 5CTNA 3EQUA 3V50A 2XLNA 2PU2A 2HDUA 4X6TA 4B4XA 3EQVA 2WADA 5FAQA 4MLLA 4X69A 5M19A 5DTSA 4S2LA 5FA7A 3FKVA 1NY0A 4QU3A 5DTTA 3GR2A 1I5QA 3ISGA 4KZ7A 4EUZA 2J9PA 5HL1A 4IBXA 5DF8A 1O7EA 2WKHA 1FSYA 3OC2A 2ZQ8A 4FCFA 1WYCA 1FCNA 4OQIA 5FSRA 5HAQA 3WS1A 3PBRA 4S2NC 4UA9A 3A3IA 4KZ8A 1Q2PA 2XF3A 2XEPA 1GHPA 1LL9A 2RL3A 4GN2A 4OQHA 4Y0UA 4C3QA 4KG5A 4QD4A 3ZVWA 3E2LA 3S4XA 3VSKA 5U47A 3DWZA 1E25A 3O87A 1YMSA 2VGJA 1PWDA 3A3FA 4CJNA 5E2FA 4ZDXA 1K57A 4QJGA 3VSLA 5J8XA 1YM1A 4R3JA 1LHYA 1ZC2A 1N9BA 2ZC6B 4JLFA 3BLSA 3IQAA 3VMAA 5KSHA 4M3KA 5GHZA 1E3UD 3OPRA 3IWQA 2Z2MB 3IF5A 3IH8A 1XPBA 4KENB 3HLWA 5A92A 4E3LA 1BLPA 4FSFA 5TGFA 3BFGA 3LCEA 1IYSA 1XGJA 3LY4A 1H8YA 2HPBA 4HESA 3GV9A 4GD6A 4DF6A 1KVLA 1PI4A 1XA1A 5EUAA 5L2FA 3UNWA 1PWGA 1QMEA 2XH9A 3GTCA 3FV7A 4K0XA 5EVIA 5TFQA 2Y2QA 2HDSA 5FI7A 1GCEA 4BD1A 3IXDA 3Q07A 5CHUA 1KE4A 3LY3A 4KZ5A 1FCOA 5A93A 2HP6A 2Y2IA 1YMXA 2XK1A 4JXGA 3SS5A 4WMCD 2ZM8A 1HD8A 1O07A 3QHYA 4JF6A 4KZAA 4U0TA 1VQQA 1CI8A 3A3DA 4S2KA 3A3JA 3CJMA 3G32A 3NY4A 3PBNA 2J9OA 3UPPA 3VOYA 1YT4A 3WRTA 5TR7A 4OLDA 2FFYA 3TSGA 2EX8A 4GDNA 3SS4A 3V5MA 3NIAA 3HUNA 4R23A 1TVFA 4OPQA 3AGFA 4QHCA 2Y2MA 4LV0A 3P09A 3NI9A 4ZTKA 2WYXA 1YLJA 2Y2PA 3G35A 4N9LA 3IHBA 3WS4A 5E2GA 3IF6C 2ZQ9A 1BLCA 4OQ0A 3DWKA 1ES3A 3NC8A 1BLSA 3SOIA 5FQ9A 2WZZA 4JF5A 2ZQDA 1MBLA 1KGEA 1EROA 5KZHA 3UE1A 3HBRA 5EE8A 3UY6A 2ZM0A 1W5DA 1YLTA 4S2PA 4DXBA 3UPOA 1IKGA 4XUZA 3ZDJA 1TDGA 2J7VA 2DRWA 5EOOA 5FQJA 5EVID 2CC1A 1SDEA 4GKUA 3WS0A 1KGGA 3NBLA 5AQBA 2Y2GA 3IWIA 5CGXA 1FQGA 2WAEA 2Y2HA 5F83A 1E3UA 1WE4A 2EXAA 4MBFA 4UA7A 4Z9QA 5EOEA 1RP5A 2PBYA 1H5XA 2R9WA 3O86A 3Q7ZA 4RYEA 5E2HA 3HLCA 1TEMA 3PBQA 3I7JA 3HREA 5CXWA 4UHUA 2P9VB 3G34A 5D3OA 5M18A 3HLFA 4PM9A 1MXOA 3ITBA 3N8RA 2QMIA 1CEGA 1DJAA 5CTMA 2I72A 1K57C 5GHYA 5GLAA 3N8SA 4PMAA 3HUOA 5HAIA 3ZG0A 3ZVTA 3HLBA 2Y2OA 1S6RA 3IXBA 5F82A 1K54A 5BOHA 3FYZA 2EX9A 4RX3A 2Y2JA 4WEJA 1MWTA 5I94A 5DTKA 3WWXA 3HL9A 1K6RA 4PM7A 4ID4A 1SCWA 4OLGA 4X55A 5FATA 3V3SA 3IXHA 3UPNA 4WMCA 1ES4A 1SKFA 5KSCA 2DCFA 4P6BA 2UWXA 3RJUA 1L2SA 2EX2A 4KG6A 3UDFA 1PW8A 4EWFA 3N8LA 5GLDA 4BD0A 4WZ4A 4LCLA 2A3UA 4B4ZA 4Q8IA 1IYOA 4OOLA 3BLMA 3W4PA 3SH9A 4QY6A 3M6BA 4DE3A 3M2JA 4R4RA 1IELA 3IF6B 4S2IA 5AQ7A 5AQAA 2JBFA 3W4QA 3HVFA 4X53A 1ERMA 3UE3A 2VGKA 1GHMA 5AQ9A 4R1GA 5EVLA 3M6HA 4E3OA 3C4PA 4BLMA 1NZUA 4NETA 1IYQA 1ZG6A 4EBNA 1PIOA 5HW3A 3MXRA 4OPYA 1W8QA 1H8ZA 4UA6A 4Y0TA 2OLVA 4N1XA 1GA9A 3Q7VB 5CECA 3RXXA 4BL2A 4KZ6A 1XA7A 4BENA 3PTEA 4GB7A 5GLBA 4WELA 4JPMA 2IWBA 4E3JA 3PBSA 3MBZA 1ES5A 4JXVA 2G2UA 4U3TA 3OCNA 1I2WA 4DRTA 3WS2A 1BT5A 3ITAA 1K4EA 2JCHA 1L0DA 2Y2KA 1MY8A 3LEZA 3AGDA 4JXWA 1G68A 3N4IA 1YLZA 2A49A 3V3RA 3B3XA 2ZD8A 1ESIA 4K0WA 4OPZA 5JYOA 1BUEA 2WK0A 2XQZA 4JBFA 2PU4A 4OVDA 1GA0A 1Q2QA 2X01A 3Q81A 3GQZA 4KZBA 5HARA 3FKWA 4ZJ3A 4IBRA 4X56A 2R9XA 4QY5A 2ZC5B 2ZJ9A 1NRFA 1SDNA 4D2OA 2XFTA 2RCXA 4R4SA 1KE3A 2HDRA 2WGIA 4N92A 4DE0A 4O7DA 4ZJ1A 4C6YA 4CPKA 4HEFA 3BEBA 3HLGA 1KVMA 5CHMA 1PWCA 1PZOA 3MKEA 4OOMA 4MBHA 3UDXA 4QB8A 3VOZA 5FI6A 3ZG9B 4E3IA 2BLSA 5JYPA 3M2KA 5EECA 2EFUA 1YLPA 2H5SA 2ZQAA 4LV3A 4E6XA 1RGZA 3IT9A 2Y2LA 2P9VA 3CMZA 4WM9A 4EQIA 4XUXA 3ZG7B 4L0LA 4IVKA 3CG5A 4S2OA 4P0MA 2ZC3B 5A91A 2WGVA 2IWCA 1K4FA 1FCMA 2WKEA 4ZJ2A
chains in the Genus database with same CATH superfamily
5I5LA 4H6JA 3CUEA 5GLCA 3BQAA 4BMWA 4EBLA 4HIAA 3R4KA 4Y7PA 4K91A 4CLCA 1FOFA 3HLEA 1CI9A 3ZYTA 3Q1FA 1JVJA 3W4OA 5CGSA 3DBAA 4HBTA 1GHIA 3E0YA 3UB9A 5FASA 1BZAA 5FDSA 2ZLYA 3UB8A 1DP6A 3OCLA 5FQQA 2HP5A 3E2KA 3VP0A 1C3BA 3DTKA 2PR6A 4EV4A 4E3NA 1MKIA 1LI0A 4KG2A 5EVIC 1VM1A 2WGWB 2Y59A 4KZ3A 5DFYA 1LL8A 2VA0A 3FWLA 3G4PA 1PZPA 1NJ4A 1BTLA 1YLWA 2GZAA 3NOUC 1ODVA 3UE0A 4B88A 5HWWA 3GMWA 5G18A 1ZG4A 1FR6A 3CZDA 4YOFA 1W7FA 3NDGA 3C4OA 4KZ9A 5M1AA 4WL9A 1OMEA 3QP4A 4WYYA 3JYIA 5G4YA 4O01A 1NLZA 4GOGA 1BLHA 5HX9A 3UMDA 3BY8A 1MWUA 4OONA 1CJFA 2ZQCA 1FSWA 3CITA 3GVBA 4EEUA 4PM6A 1TDLA 3E4QA 4C75A 1S4SA 1UGUA 3TW8A 2EFXA 3N7WA 4JGPA 3LIEA 1AWIA 1CK3A 4B9OA 1XP4A 5FL3A 1ONGA 1SHVA 4HY8A 3G2ZA 3E4OA 4XXRA 3CPTA 4DE1A 4NK3A 2QPNA 1ALQA 2GNXA 4GD8A 4X1LA 3VP2A 3IX3A 3VFFA 1K54C 4N9KA 3DTIA 1T19A 2P74A 5FQMA 5J7EA 2W3GA 2Q9NA 3CAXA 3RFBA 2Y4AA 4DN0A 1K55C 1YSPA 5HWTA 4I38A 3KX0X 3BECA 3DTMA 3QNBA 2E8IA 1DJCA 3QNCA 2OLUA 2OAP1 3V67A 4PPRA 1TS6A 4DDYA 3IF6A 1PYYA 3LR4A 2XRNA 1G5UA 3IHAA 2HGVA 3ZHHA 1UWPX 2Q0OA 2J8YA 3CI6A 1K38A 3V50A 2XLNA 4B4XA 2HDUA 5FAQA 4X69A 2KDKA 5DTSA 4S2LA 5DTTA 1NY0A 4KZ7A 1O7EA 1FSYA 3OC2A 4NXEA 4S2NC 4UA9A 3JVUA 4KZ8A 2XF3A 4WN5A 1NLYA 5IU1A 4JGRA 3ZVWA 3UB5P 2I9VA 1PWDA 3A3FA 4GS9A 4CJNA 5E2FA 1K57A 4QJGA 3VSLA 5J8XA 1YM1A 4JLFA 4M3KA 3F1OB 3BJNA 1XPBA 3PYPA 5TGFA 1XGJA 5F6AA 1WA9A 4I3IA 1XA1A 4D60A 2KLIA 1OTEA 1QMEA 4KUKA 2XH9A 3GTCA 3FV7A 5TFQA 3PHYA 4HH2A 1GCEA 3IXDA 3MSHA 3LY3A 1XFNA 3LGOA 2XK1A 1PFLA 2ZM8A 3QHYA 3CJMA 3NY4A 4HP4A 4CLCC 3PBNA 3VOYA 3IS2A 5TR7A 4MCWA 2EX8A 3V5MA 4R23A 3HUNA 1TVFA 3AGFA 3LIDA 4QHCA 3K3CA 2R78A 2XA7M 5E2GA 4LPZA 4UQIM 3DWKA 3NC8A 1BLSA 2W3DA 2EWVA 4P6ZM 3LR0A 3HBRA 3B42A 2HJEA 2ZM0A 1W5DA 1YLTA 2JKTM 1YAXA 3UPOA 1IKGA 3LUQA 3ZDJA 4BWIA 5EOOA 5FQJA 3NBLA 5F83A 1YSQA 1WE4A 3NHQA 5EOEA 1RP5A 2PBYA 2QJ5A 3I7JA 3HREA 2QYBA 4EETB 3H9WA 3G34A 3HLFA 3ITBA 2JKRI 1DJAA 3W2ZA 2OOLA 1VEUA 3L9KA 5HZHA 4EQ1A 2VKSA 4K08A 2EX9A 1MWTA 5I94A 3WWXA 4X55A 4PAUA 3BQ8A 3UB6A 2UWXA 1L2SA 2EX2A 3DAVA 3UDFA 3N8LA 4EESA 4WZ4A 4LCLA 4R70A 4OOLA 4JGQA 1N9NA 4DE3A 1IELA 3IF6B 5AQ7A 3LIAA 5AQAA 4GCZA 4X53A 4L9EA 2PBDP 2VGKA 1F2KA 2AVXA 2WKRA 4WLAA 3KSHA 1NZUA 3EGDC 3MXRA 1H8ZA 4UA6A 4Y0TA 4N1XA 5CECA 4II7A 1XA7A 4BENA 3PTEA 5GLBA 5MC7A 3MBZA 3UMEA 2G2UA 3OCNA 1I2WA 5C5KA 4ETZA 3ITAA 1L0DA 5F68A 4GS9B 2MJ6A 1Q2QA 3GQZA 5HARA 3D3OA 2JKGA 2R9XA 4QY5A 2HF6A 2XFTA 1CQAA 2VV8A 4ZJ1A 1NWZA 4HEFA 1P0ZA 5CHMA 3MKEA 4MBHA 3UDXA 3T4LA 2ZBBA 3ZG9B 2NUTC 4ME4A 3IT9A 2WGVA 4XUXA 4L0LA 2ZC3B 1DP8A 1D1JA 2K31A 3T4JA 3O3VA 3RXWA 4Y3IA 1J9MA 1IKIA 4R3AA 2V8FA 3AGEA 2C6WB 4HH3A 4WBGA 3UY6A 5HPFA 4GLQA 2J80A 2WUQA 2BG1A 1IYPA 2KOIA 3T4TA 2E8JA 3S22A 2W1RA 1ES2A 1P9RA 4RA7A 4MBKA 4BQMA 3BYDA 3T4OA 1H8MA 1OJGA 1K55A 4Z1WA 4DKIA 3UN7A 1NZOA 1LL5A 4MEZA 3SH7A 2VGLS 4OH0A 2XR0A 4QWOA 3T1QB 1IEMA 3PAGA 3T12B 2H0YA 1FR1A 3FPWA 4LRZE 4UQIS 3S1YA 4B93A 1VEUB 3IWOA 2ZM2A 2WKIA 2XD5A 2CMNA 5TJJA 4PM5A 1T1BA 1S1YA 4I3AA 2JE5A 4HJ4A 4Q0IA 2YKFA 2D02A 2EXBA 3LICA 3MFDA 3MZDA 2Y55A 5TBMA 2WAFA 1KGFA 4Y5FA 2O99A 4S2NA 3TOIA 2B18A 5LBRA 4E3KA 1D7EA 3WRZA 2XFSA 1QMFA 3D4FA 1T1AA 3T1XA 3IXGA 2JC7A 4BJPA 3MR0A 1VHMA 3TG9A 3MJQA 2XD1A 4N1HA 2Y2NA 3PXPA 4NXGA 4EERA 1CEFA 3UO9A 3VOLA 5HFOA 5A90A 2V1BA 3VP4A 5EVIB 1U60A 3SS3A 1OT9A 1YQSA 1M6KA 4KQOA 4BBTA 5FEFA 3PAEA 3BM6A 3LYXA 5DF7A 1L0EA 1JTGA 2O9BA 5DVAA 3BFDA 5GHXA 4P85A 3SH8A 4IVIA 1N4OA 3G30A 1IFQA 1KOUA 2X02A 2WZXA 4YINA 5CRFA 4ARZA 3LO7A 3F1PB 4O8GA 1Z6FA 3OPLA 2PYRA 1JWPA 4LCMA 2XDMA 5L07A 5CERA 5GL9A 1ONHA 5DKLA 1YKDA 3DW0A 1W8YA 3GECA 1LLBA 1YLYA 3KSGA 4GZBA 5E2EA 1K56A 3HUMA 3MQQA 3VP3A 1MWSA 5CTNA 3EQUA 4PKYA 2PU2A 4X6TA 2WADA 3CLOA 5M19A 5DKKA 2ZMVA 2KX6A 3BW6A 3GR2A 4FUWA 4FCFA 4OQIA 5FSRA 3WS1A 3KSIA 1DRMA 1GHPA 2RL3A 4GN2A 1E25A 1YMSA 5AVFA 3OBFA 1LHYA 3IBRA 3C38A 2L0WA 2Z2MB 3IH8A 5CX7A 5A92A 2FH5A 2J3TC 2M7VA 2XSSA 1H8YA 2HPBA 1KVLA 1PI4A 5EUAA 5L2FA 3UNWA 2Y2QA 5CHUA 4KZ5A 1FCOA 3KYEA 3RTYA 4NXBA 5HD3A 3D72A 2Z6CA 1CI8A 3A3DA 3UPPA 1YT4A 2FFYA 3TSGA 2JKRM 3TJZC 2WYXA 1YLJA 4N9LA 3IHBA 1TS8A 1XJ2A 3VE4A 3DTEA 1BLCA 1ES3A 4HNBA 5FQ9A 2ZQDA 1KGEA 2JKFA 2J3WA 5EE8A 5L09A 5KIZA 5EVID 2CC1A 4GKUA 2M1CA 5CGXA 1VETA 4LLOB 4R38A 2EXAA 2EA9A 2R9WA 4RYEA 5E2HA 1XJ3A 1N9OA 2XROA 5CXWA 4UHUA 2P9VB 5M18A 4PM9A 2I72A 5GHYA 4KQDA 3ZVTA 4G3KA 2QKPA 4H6JB 5BOHA 4RX3A 5DTKA 3NULA 1SCWA 5FATA 3V3SA 3UPNA 4CLCB 1F5MA 5KSCA 4P6BA 2PRFA 4Q8IA 1IYOA 3BLMA 3W4PA 2JBFA 3S7NA 1ERMA 2P04A 1HLUP 4OPYA 4Y17A 2D01A 2M7UA 3JPUA 2PDRA 1T1CA 4JPMA 2IWBA 2GJ3A 4U3TA 2W1TA 3LEZA 3AGDA 4JXWA 1G68A 3N4IA 2L1MA 3V3RA 2ZD8A 4K0WA 4OPZA 5JYOA 2XQZA 3MXQA 1GA0A 2X01A 3Q81A 2ACGA 3FKWA 4IUHA 2ZJ9A 3CHWP 1NRFA 1J3WA 2RCXA 1S66L 3R7WA 4R4SA 1KE3A 2WGIA 4N92A 4DJ3A 2FZ0A 3MMHA 1PZOA 4OOMA 5EM1A 3VOZA 4E3IA 2BLSA 3M2KA 3EOIA 2EFUA 1YLPA 2ZQAA 3LIFA 2Y2LA 3S7PA 4WM9A 1TF1A 3GDIA 3ZG7B 1L3LA 2ZL1A 5HDCA 3CG5A 4S2OA 3CPTB 2IWCA 1K4FA 3S7OA 4JXSA 1NYYA 3LR3A 2V1ZA 2ZQ7A 1HTZA 4A5RA 2DMWA 1G6AA 4ZAMA 1P97A 2L4RA 3BFCA 4MN7A 4JF4A 4KUOA 4S2JA 5F1FA 4OQGA 2WKPA 4JKTA 4L9GA 1K25A 1G28A 2VX8A 3ZG8B 4DDSA 2V20A 3QP1A 1XXMA 2W0NA 2IWDA 4OP5A 3O88A 3C8CA 2H0TA 3ZGAB 5CEBA 5KMWA 4MDZA 2GDNA 2QHKA 1KDSA 3MXSA 5HDDA 4X68A 3P98A 1ERQA 4OP8A 3IH9A 1LSXA 3BFFA 3BRMA 4FH4A 4DE2A 3C7UA 3MZEA 5HAPA 1JWVA 1XX2A 3VV4A 3NDEA 1TD5A 3UDIA 4X1MA 3Q7VA 1AXBA 3A0RA 1K6SA 5DF9A 4RVAA 2G2WA 2Y8HA 4CLCD 4O0PA 2X71A 4MMNA 1LI9A 2QZ6A 4PM8A 4FH2A 1ESUA 4E3MA 4Y13A 2W3FA 1A0KA 1HVBA 4LV2A 2PR5A 2B5RA 4GDBA 4YFMA 4GNUA 4MN6A 3GSGA 1W79A 5FQIA 1I2SA 5FDHA 1K56D 4LENA 2QJ7A 4E6WA 2OV5A 3BY9A 3U2AA 4HJ6A 1DY6A 4F3LA 3ZG5A 3E98A 3LI8A 4MN5A 3G2YA 1EW0A 3SZTA 1RGYA 1OTIA 3VFHA 1XGIA 1SKOA 1PW1A 2PD8A 1MKMA 3EEAA 4BBUA 3OPHA 3OZHA 3GRJA 2ZOHA 4IEDA 2W1TB 5HSQA 3BFEA 1JTDA 1EI5A 4P87A 4U0XA 3NCKA 3IS2B 3LIBA 3Q82A 2YKHA 4Y0OA 2Z6DA 1XKZA 1S67L 5A8BA 1G6OA 1DJBA 4R3BA 3EEHA 5EFWA 3G6OA 5L8MA 2Q9MA 2FFFB 1RCJA 2DNSA 1PI5A 4WZ5C 2JHEA 2A24A 4EBPA 4PHTA 2WGWA 2VV7A 4HHDA 3A0VA 3ZFZA 2PAVP 4GJ4A 5FA7A 3MQ0A 3FKVA 1I5QA 4EUZA 2XA7S 4BBVA 2WKQA 2WKHA 1XJ4A 2ZQ8A 1WYCA 3PBRA 1Q2PA 3K2NA 4Y0UA 1LL9A 4P6ZS 1Y4OA 4C3QA 4QD4A 4X25A 3QP8A 1OT6A 3DWZA 1LSVA 3O87A 4ZDXA 4HP9A 2PT7A 4R3JA 4NG2A 1ZC2A 1N9BA 3VMAA 3IQAA 2BTFP 2A2LA 5IT5A 5HPIA 3OPRA 3IWQA 3IF5A 4KENB 3HLWA 1K0KA 4E3LA 1BLPA 3BFGA 3LCEA 1IYSA 3LY4A 4HESA 1ZHHB 2NUPC 4HQAA 3IX4A 4WUJA 5IS1A 1TS0A 1OJ5A 4BD1A 2K7SA 3Q07A 1KE4A 3T4QA 5EV0A 3UE6A 5A93A 3FG8A 2HP6A 2Y2IA 1YPRA 5HD5A 3SS5A 1O07A 4JF6A 4KZAA 4DJ2A 4YNRA 4S2KA 4EEPA 5FEGA 3G32A 2J9OA 3EWKA 4GDNA 3SS4A 2LB5A 2HZ5A 3NI9A 3G35A 3WS4A 2ZQ9A 4JGOA 4OQ0A 3SOIA 4JF5A 2ZOIA 3F1NA 3UE1A 3VE3A 3FC7A 4NEED 1PRQA 4S2PA 4XUZA 4Y15A 1SKOB 1TDGA 2J7VA 2DRWA 3HJKA 1SDEA 2EWWA 4DMZA 1KGGA 2WAEA 2Y2HA 2INWA 1E3UA 4MBFA 2G7UA 1H5XA 3Q7ZA 1TEMA 2O0YA 5D3OA 2V0UA 3N8RA 5CTMA 3N8SA 4EW7A 3HLBA 5AJGA 3IXBA 5K5BA 3FYZA 4WEJA 3HL9A 1K6RA 4ID4A 1V9ZA 4WMCA 1SKFA 3RJUA 4GW9A 2QWSA 2H28A 3F1OA 3T1SA 1XJ6A 2A24B 2A3UA 3KYZA 4B4ZA 3UB7A 3LEQA 4M4XA 3HCYA 3M2JA 4S2IA 4Q0HA 1GSVA 3C30A 3W4QA 1F98A 3UE3A 5G4ZA 1GHMA 5HDSA 5AQ9A 4WF0A 4EUVA 3MQOA 1ZG6A 4EBNA 1PIOA 5HW3A 4ETXA 1W8QA 1GA9A 3H82A 3B33A 3S7QA 4GB7A 3QP6A 4PKYG 1ES5A 3TE8A 3KO6A 4DRTA 3WS2A 2VV6A 1K4EA 2JCHA 2Y2KA 1MY8A 1S4RA 5DJTA 1ESIA 2WK0A 4JBFA 1NRJA 1LSWA 4OVDA 3T1RA 2V8CA 4IBRA 4E04A 3FPVA 5TBMB 1SDNA 1ACFA 1STZA 3D9YA 3U4LP 4ESPA 2V1AA 1MC0A 2VJWA 4O7DA 1KVMA 1PWCA 1S1ZA 3OLOA 5FI6A 5JYPA 5EECA 4E6XA 1RGZA 1W63Q 4G3VA 3E4PA 3EGXC 5A91A 2P08A 2WKEA 4ZJ2A 3P01A 2OSUA 1Y54A 2ZC7A 3PBOA 5EM0A 2B02A 4I5SA 4KZ4A 3NOTC 2Y79A 2C5WB 1GSWA 3F1NB 3NOPC 1OPXA 3HLDA 4OOYA 2K2NA 4LFUA 1S0WA 4OKPA 2HJ9C 2Z2LB 4S2MA 5J4EA 1HZOA 1JWZA 2J3TD 3C2WA 4ARZB 2ZC4B 5CGWA 1EWZA 5F5YA 4WZ5A 4KQRA 3W8KA 2OWJA 2VEAA 4ZBEA 5FI2A 3MKFA 2UV0E 2IA2A 3JVVA 4MNRA 1H3QA 5F1GA 2HV1A 3IX8A 3G31A 2PHYA 2O9CA 3VP1A 3ULFA 2HDQA 1KE0A 4GHIA 5CEDA 1P9WA 3C5AA 2OWHA 5CHJA 3O5YA 4IUKA 1BULA 3K3DA 5EPHA 4Q0JA 5IHVA 5FAOA 1KDWA 5E43A 2Y91A 2ZMAA 3PR6A 4OPRA 4FD8A 3H7WA 3A3EA 3WS5A 3QP5A 2W3HA 4HBUA 2HP9A 3CUEC 1GSXA 3H82B 2V2FF 3SW1A 1BSGA 4IJGA 1NXYA 2H10A 5J3WA 1E4DA 1N9LA 4RQ9A 1MPLA 4UAAA 5FAPA 4LV1A 1WYBA 3FZCA 5L10A 2VGLM 1ZKJA 1MWRA 4XT2A 3V39A 4BL3A 1IOUA 3NECA 4Y2FA 3C7VA 3TRCA 4UEYA 2XGNA 3ZNYA 3MZFA 5FQKA 3ZCZA 3OPPA 4DXCA 4F94A 2VK3A 3PBTA 4CLCE 3MFXA 4H8RA 3N6IA 4KQQA 3KSFA 1L0GA 2EX6A 3ZNTA 2PD7A 1NYMA 4R0QA 4YWZA 1FIKA 1D06A 1L0FA 4WEKA 1X0OA 1M40A 4RX2A 1VETB 3ZQ5A 3EQVA 4MLLA 4QU3A 3ISGA 5HL1A 1Y28A 2ZMFA 2J9PA 4IBXA 5DF8A 1FCNA 5HAQA 3A3IA 2XEPA 4OQHA 3P7NA 4AFIA 4KG5A 3E2LA 3CWFA 3S4XA 3VSKA 5U47A 2VGJA 2B95A 4CQHA 5AVEA 5DJUA 1T18A 2ZC6B 3BLSA 5KSHA 1SZVA 5GHZA 1E3UD 3OOVA 4ZRRA 4FSFA 3LI9A 1ZTUA 4NKPA 2P7JA 3GV9A 4GD6A 4DF6A 4I3JA 1PWGA 4K0XA 5EVIA 3B47A 2HDSA 5FI7A 1UWNX 1TS7A 2GX5A 1F9IA 3T50A 1YMXA 4JXGA 4WMCD 1HD8A 4U0TA 1VQQA 4I39A 3A3JA 4FOFA 4GHIB 3WRTA 1H0MA 4OLDA 2VLGA 2W3EA 3NIAA 4OPQA 3LFVA 2Y2MA 4LV0A 3P09A 4ZTKA 2Y2PA 3NJAA 2VZWA 1Z09A 4NXFA 4EXOA 3IF6C 5DFXA 1LT0A 3F1PA 2WZZA 4HJ3A 1MBLA 1EROA 5KZHA 4LRXC 3H7WB 3IBJA 4G3WA 3R7WB 1W63M 4DXBA 4QPRA 4HI4A 3WS0A 3RH8B 5AQBA 2Y2GA 3IWIA 4EU0A 1FQGA 5HL6A 4UA7A 4Z9QA 3O86A 3HLCA 3PBQA 4XT2B 1MXOA 3MF0A 2QMIA 1CEGA 1K57C 5GLAA 4PMAA 2ZL1B 3HUOA 5HAIA 3ZG0A 2V9AA 2Y2OA 1S6RA 5F82A 4LGWA 1K54A 3QP2A 4PM7A 4OLGA 2W27A 3IXHA 1ES4A 2DCFA 4KG6A 1PW8A 2LB9A 4EWFA 2JKTI 5GLDA 4BD0A 1DP9A 3T4KA 4IHQA 1OTDA 1CF0A 3SH9A 4QY6A 3M6BA 5HWVA 4L9FA 4R4RA 1V9YA 3HVFA 3HJIA 3T4SA 5EVEA 2PYPA 2V0WA 4R1GA 5EVLA 3M6HA 4E3OA 1FILA 3C4PA 4BLMA 4NETA 1IYQA 4R6LA 3LR5A 2OLVA 3Q7VB 3RXXA 4BL2A 4KZ6A 1VB6A 1MZUA 4WELA 4E3JA 3PBSA 4JXVA 3MS6A 1BT5A 2O9AA 1YLZA 2A49A 3B3XA 1BUEA 3A0SA 1XFQA 2PU4A 3BWLA 4KZBA 1OTBA 5F69A 1OTAA 4ZJ3A 4X56A 1PNEA 2ZC5B 3L7HA 4D2OA 2HDRA 4DE0A 4C6YA 4LRYC 4CPKA 3KYQA 3BEBA 3HLGA 4FTXA 1BYWA 4QB8A 2JN7A 4F3LB 2OAQ1 1JNUA 2H5SA 3ICYA 4LV3A 2P9VA 3CMZA 2BASA 4EQIA 4IVKA 4P0MA 4HOIA 2Y2JA 1FCMA
chains in the Genus database with same CATH topology
1NYYA 3O3VA 2V1ZA 2ZQ7A 3RXWA 1HTZA 5GLCA 2OSUA 1J9MA 1IKIA 4A5RA 1G6AA 4EBLA 4ZAMA 3AGEA 1Y54A 2C6WB 2ZC7A 3BFCA 3PBOA 4WBGA 4Y7PA 2WUQA 4JF4A 4K91A 4S2JA 1FOFA 2BG1A 5F1FA 4OQGA 1IYPA 3HLEA 1CI9A 4JKTA 4KZ4A 1K25A 3ZG8B 3Q1FA 4DDSA 2C5WB 2V20A 1JVJA 3W4OA 1XXMA 5CGSA 2IWDA 3S22A 4OP5A 3O88A 1ES2A 4RA7A 4HBTA 1GHIA 2H0TA 4MBKA 3HLDA 4BQMA 5FASA 4JXSA 1BZAA 4OOYA 3ZGAB 3BYDA 5CEBA 2ZLYA 5KMWA 1S0WA 3OCLA 4OKPA 5FQQA 2HP5A 2Z2LB 3E2KA 4S2MA 2GDNA 3VP0A 1C3BA 1HZOA 1KDSA 3MXSA 1K55A 1JWZA 4X68A 4DKIA 4EV4A 4E3NA 3UN7A 1MKIA 1LI0A 3P98A 1ERQA 2ZC4B 4OP8A 4KG2A 3IH9A 3BFFA 1EWZA 5CGWA 1NZOA 3BRMA 4FH4A 4DE2A 3C7UA 5EVIC 1VM1A 2WGWB 3MZEA 1JWVA 1LL5A 2Y59A 4KZ3A 4MEZA 5HAPA 3SH7A 4OH0A 3FWLA 1XX2A 3G4PA 2XR0A 1PZPA 1NJ4A 1BTLA 1YLWA 3NDEA 1IEMA 3PAGA 4WZ5A 4KQRA 2H0YA 3W8KA 3UDIA 1FR1A 3Q7VA 1AXBA 3S1YA 1K6SA 5DF9A 4ZBEA 5FI2A 3UE0A 4B88A 3IWOA 2ZM2A 3MKFA 2WKIA 3GMWA 5G18A 4RVAA 1ZG4A 4MNRA 2XD5A 5F1GA 1FR6A 3CZDA 2G2WA 4PM5A 1W7FA 3NDGA 3C4OA 4KZ9A 5M1AA 2JE5A 1OMEA 2X71A 3G31A 3VP1A 1LI9A 2QZ6A 4WYYA 3JYIA 2HDQA 4PM8A 4FH2A 1ESUA 4GOGA 4E3MA 1KE0A 1BLHA 5CEDA 5HX9A 1HVBA 4LV2A 2EXBA 1MWUA 4OONA 2B5RA 2ZQCA 3MFDA 3C5AA 1FSWA 3MZDA 4GDBA 2Y55A 2WAFA 3GVBA 4GNUA 4YFMA 1KGFA 5CHJA 3GSGA 4PM6A 1TDLA 1W79A 5FQIA 4C75A 1BULA 4S2NA 3TOIA 1I2SA 5FDHA 1K56D 5EPHA 5IHVA 4LENA 4E3KA 3WRZA 2XFSA 1QMFA 3D4FA 5FAOA 2EFXA 3N7WA 1KDWA 4E6WA 5E43A 2OV5A 2Y91A 2ZMAA 3IXGA 2JC7A 4OPRA 4BJPA 4FD8A 1CK3A 1DY6A 3ZG5A 3TG9A 3A3EA 2XD1A 3G2YA 4N1HA 3WS5A 4HBUA 2HP9A 1RGYA 2Y2NA 3VFHA 1XP4A 1XGIA 1ONGA 1CEFA 1PW1A 3UO9A 1SHVA 5HFOA 2V2FF 5A90A 3G2ZA 1BSGA 5EVIB 1U60A 1NXYA 3VP4A 2H10A 3OPHA 3SS3A 4DE1A 4XXRA 1E4DA 4NK3A 3OZHA 3GRJA 2QPNA 4IEDA 1ALQA 4GD8A 1MPLA 4UAAA 5FAPA 4LV1A 3VP2A 1WYBA 1YQSA 1M6KA 4KQOA 3VFFA 1K54C 3FZCA 4N9KA 2P74A 1ZKJA 3PAEA 1MWRA 5FQMA 3BM6A 3BFEA 3V39A 2Q9NA 5DF7A 4BL3A 1JTDA 1L0EA 1JTGA 1EI5A 4P87A 4U0XA 3NCKA 5DVAA 3BFDA 3C7VA 2Y4AA 2XGNA 3ZNYA 5GHXA 3MZFA 4P85A 3Q82A 4Y0OA 1K55C 5FQKA 3SH8A 3ZCZA 3OPPA 1XKZA 1N4OA 4IVIA 3G30A 4DXCA 1DJBA 4F94A 3BECA 4R3BA 3PBTA 3DTMA 3QNBA 2Q9MA 2FFFB 3N6IA 1RCJA 2DNSA 2E8IA 2X02A 2WZXA 4H8RA 1DJCA 4KQQA 1PI5A 4YINA 4WZ5C 1L0GA 3QNCA 2OLUA 5CRFA 2EX6A 3LO7A 3ZNTA 4PPRA 1Z6FA 3OPLA 1NYMA 4R0QA 1JWPA 4EBPA 4LCMA 2XDMA 5CERA 2WGWA 5GL9A 1ONHA 1L0FA 4DDYA 3DW0A 1W8YA 3IF6A 1PYYA 1LLBA 3ZFZA 1YLYA 3IHAA 4GZBA 4WEKA 5E2EA 1K56A 3ZHHA 1M40A 4RX2A 3HUMA 2J8YA 3VP3A 1K38A 1MWSA 5CTNA 3EQUA 3V50A 2XLNA 2PU2A 2HDUA 4X6TA 4B4XA 3EQVA 2WADA 5FAQA 4MLLA 4X69A 5M19A 5DTSA 4S2LA 5FA7A 3FKVA 1NY0A 4QU3A 5DTTA 3GR2A 1I5QA 3ISGA 4KZ7A 4EUZA 2J9PA 5HL1A 4IBXA 5DF8A 1O7EA 2WKHA 1FSYA 3OC2A 2ZQ8A 4FCFA 1WYCA 1FCNA 4OQIA 5FSRA 5HAQA 3WS1A 3PBRA 4S2NC 4UA9A 3A3IA 4KZ8A 1Q2PA 2XF3A 2XEPA 1GHPA 1LL9A 2RL3A 4GN2A 4OQHA 4Y0UA 4C3QA 4KG5A 4QD4A 3ZVWA 3E2LA 3S4XA 3VSKA 5U47A 3DWZA 1E25A 3O87A 1YMSA 2VGJA 1PWDA 3A3FA 4CJNA 5E2FA 4ZDXA 1K57A 4QJGA 3VSLA 5J8XA 1YM1A 4R3JA 1LHYA 1ZC2A 1N9BA 2ZC6B 4JLFA 3BLSA 3IQAA 3VMAA 5KSHA 4M3KA 5GHZA 1E3UD 3OPRA 3IWQA 2Z2MB 3IF5A 3IH8A 1XPBA 4KENB 3HLWA 5A92A 4E3LA 1BLPA 4FSFA 5TGFA 3BFGA 3LCEA 1IYSA 1XGJA 3LY4A 1H8YA 2HPBA 4HESA 3GV9A 4GD6A 4DF6A 1KVLA 1PI4A 1XA1A 5EUAA 5L2FA 3UNWA 1PWGA 1QMEA 2XH9A 3GTCA 3FV7A 4K0XA 5EVIA 5TFQA 2Y2QA 2HDSA 5FI7A 1GCEA 4BD1A 3IXDA 3Q07A 5CHUA 1KE4A 3LY3A 4KZ5A 1FCOA 5A93A 2HP6A 2Y2IA 1YMXA 2XK1A 4JXGA 3SS5A 4WMCD 2ZM8A 1HD8A 1O07A 3QHYA 4JF6A 4KZAA 4U0TA 1VQQA 1CI8A 3A3DA 4S2KA 3A3JA 3CJMA 3G32A 3NY4A 3PBNA 2J9OA 3UPPA 3VOYA 1YT4A 3WRTA 5TR7A 4OLDA 2FFYA 3TSGA 2EX8A 4GDNA 3SS4A 3V5MA 3NIAA 3HUNA 4R23A 1TVFA 4OPQA 3AGFA 4QHCA 2Y2MA 4LV0A 3P09A 3NI9A 4ZTKA 2WYXA 1YLJA 2Y2PA 3G35A 4N9LA 3IHBA 3WS4A 5E2GA 3IF6C 2ZQ9A 1BLCA 4OQ0A 3DWKA 1ES3A 3NC8A 1BLSA 3SOIA 5FQ9A 2WZZA 4JF5A 2ZQDA 1MBLA 1KGEA 1EROA 5KZHA 3UE1A 3HBRA 5EE8A 3UY6A 2ZM0A 1W5DA 1YLTA 4S2PA 4DXBA 3UPOA 1IKGA 4XUZA 3ZDJA 1TDGA 2J7VA 2DRWA 5EOOA 5FQJA 5EVID 2CC1A 1SDEA 4GKUA 3WS0A 1KGGA 3NBLA 5AQBA 2Y2GA 3IWIA 5CGXA 1FQGA 2WAEA 2Y2HA 5F83A 1E3UA 1WE4A 2EXAA 4MBFA 4UA7A 4Z9QA 5EOEA 1RP5A 2PBYA 1H5XA 2R9WA 3O86A 3Q7ZA 4RYEA 5E2HA 3HLCA 1TEMA 3PBQA 3I7JA 3HREA 5CXWA 4UHUA 2P9VB 3G34A 5D3OA 5M18A 3HLFA 4PM9A 1MXOA 3ITBA 3N8RA 2QMIA 1CEGA 1DJAA 5CTMA 2I72A 1K57C 5GHYA 5GLAA 3N8SA 4PMAA 3HUOA 5HAIA 3ZG0A 3ZVTA 3HLBA 2Y2OA 1S6RA 3IXBA 5F82A 1K54A 5BOHA 3FYZA 2EX9A 4RX3A 2Y2JA 4WEJA 1MWTA 5I94A 5DTKA 3WWXA 3HL9A 1K6RA 4PM7A 4ID4A 1SCWA 4OLGA 4X55A 5FATA 3V3SA 3IXHA 3UPNA 4WMCA 1ES4A 1SKFA 5KSCA 2DCFA 4P6BA 2UWXA 3RJUA 1L2SA 2EX2A 4KG6A 3UDFA 1PW8A 4EWFA 3N8LA 5GLDA 4BD0A 4WZ4A 4LCLA 2A3UA 4B4ZA 4Q8IA 1IYOA 4OOLA 3BLMA 3W4PA 3SH9A 4QY6A 3M6BA 4DE3A 3M2JA 4R4RA 1IELA 3IF6B 4S2IA 5AQ7A 5AQAA 2JBFA 3W4QA 3HVFA 4X53A 1ERMA 3UE3A 2VGKA 1GHMA 5AQ9A 4R1GA 5EVLA 3M6HA 4E3OA 3C4PA 4BLMA 1NZUA 4NETA 1IYQA 1ZG6A 4EBNA 1PIOA 5HW3A 3MXRA 4OPYA 1W8QA 1H8ZA 4UA6A 4Y0TA 2OLVA 4N1XA 1GA9A 3Q7VB 5CECA 3RXXA 4BL2A 4KZ6A 1XA7A 4BENA 3PTEA 4GB7A 5GLBA 4WELA 4JPMA 2IWBA 4E3JA 3PBSA 3MBZA 1ES5A 4JXVA 2G2UA 4U3TA 3OCNA 1I2WA 4DRTA 3WS2A 1BT5A 3ITAA 1K4EA 2JCHA 1L0DA 2Y2KA 1MY8A 3LEZA 3AGDA 4JXWA 1G68A 3N4IA 1YLZA 2A49A 3V3RA 3B3XA 2ZD8A 1ESIA 4K0WA 4OPZA 5JYOA 1BUEA 2WK0A 2XQZA 4JBFA 2PU4A 4OVDA 1GA0A 1Q2QA 2X01A 3Q81A 3GQZA 4KZBA 5HARA 3FKWA 4ZJ3A 4IBRA 4X56A 2R9XA 4QY5A 2ZC5B 2ZJ9A 1NRFA 1SDNA 4D2OA 2XFTA 2RCXA 4R4SA 1KE3A 2HDRA 2WGIA 4N92A 4DE0A 4O7DA 4ZJ1A 4C6YA 4CPKA 4HEFA 3BEBA 3HLGA 1KVMA 5CHMA 1PWCA 1PZOA 3MKEA 4OOMA 4MBHA 3UDXA 4QB8A 3VOZA 5FI6A 3ZG9B 4E3IA 2BLSA 5JYPA 3M2KA 5EECA 2EFUA 1YLPA 2H5SA 2ZQAA 4LV3A 4E6XA 1RGZA 3IT9A 2Y2LA 2P9VA 3CMZA 4WM9A 4EQIA 4XUXA 3ZG7B 4L0LA 4IVKA 3CG5A 4S2OA 4P0MA 2ZC3B 5A91A 2WGVA 2IWCA 1K4FA 1FCMA 2WKEA 4ZJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NYY A;  3O3V A;  2V1Z A;  2ZQ7 A;  3RXW A;  1HTZ A;  5GLC A;  2OSU A;  1J9M A;  1IKI A;  4A5R A;  1G6A A;  4EBL A;  4ZAM A;  3AGE A;  1Y54 A;  2C6W B;  2ZC7 A;  3BFC A;  3PBO A;  4WBG A;  4Y7P A;  2WUQ A;  4JF4 A;  4K91 A;  4S2J A;  1FOF A;  2BG1 A;  5F1F A;  4OQG A;  1IYP A;  3HLE A;  1CI9 A;  4JKT A;  4KZ4 A;  1K25 A;  3ZG8 B;  3Q1F A;  4DDS A;  2C5W B;  2V20 A;  1JVJ A;  3W4O A;  1XXM A;  5CGS A;  2IWD A;  3S22 A;  4OP5 A;  3O88 A;  1ES2 A;  4RA7 A;  4HBT A;  1GHI A;  2H0T A;  4MBK A;  3HLD A;  4BQM A;  5FAS A;  4JXS A;  1BZA A;  4OOY A;  3ZGA B;  3BYD A;  5CEB A;  2ZLY A;  5KMW A;  1S0W A;  3OCL A;  4OKP A;  5FQQ A;  2HP5 A;  2Z2L B;  3E2K A;  4S2M A;  2GDN A;  3VP0 A;  1C3B A;  1HZO A;  1KDS A;  3MXS A;  1K55 A;  1JWZ A;  4X68 A;  4DKI A;  4EV4 A;  4E3N A;  3UN7 A;  1MKI A;  1LI0 A;  3P98 A;  1ERQ A;  2ZC4 B;  4OP8 A;  4KG2 A;  3IH9 A;  3BFF A;  1EWZ A;  5CGW A;  1NZO A;  3BRM A;  4FH4 A;  4DE2 A;  3C7U A;  5EVI C;  1VM1 A;  2WGW B;  3MZE A;  1JWV A;  1LL5 A;  2Y59 A;  4KZ3 A;  4MEZ A;  5HAP A;  3SH7 A;  4OH0 A;  3FWL A;  1XX2 A;  3G4P A;  2XR0 A;  1PZP A;  1NJ4 A;  1BTL A;  1YLW A;  3NDE A;  1IEM A;  3PAG A;  4WZ5 A;  4KQR A;  2H0Y A;  3W8K A;  3UDI A;  1FR1 A;  3Q7V A;  1AXB A;  3S1Y A;  1K6S A;  5DF9 A;  4ZBE A;  5FI2 A;  3UE0 A;  4B88 A;  3IWO A;  2ZM2 A;  3MKF A;  2WKI A;  3GMW A;  5G18 A;  4RVA A;  1ZG4 A;  4MNR A;  2XD5 A;  5F1G A;  1FR6 A;  3CZD A;  2G2W A;  4PM5 A;  1W7F A;  3NDG A;  3C4O A;  4KZ9 A;  5M1A A;  2JE5 A;  1OME A;  2X71 A;  3G31 A;  3VP1 A;  1LI9 A;  2QZ6 A;  4WYY A;  3JYI A;  2HDQ A;  4PM8 A;  4FH2 A;  1ESU A;  4GOG A;  4E3M A;  1KE0 A;  1BLH A;  5CED A;  5HX9 A;  1HVB A;  4LV2 A;  2EXB A;  1MWU A;  4OON A;  2B5R A;  2ZQC A;  3MFD A;  3C5A A;  1FSW A;  3MZD A;  4GDB A;  2Y55 A;  2WAF A;  3GVB A;  4GNU A;  4YFM A;  1KGF A;  5CHJ A;  3GSG A;  4PM6 A;  1TDL A;  1W79 A;  5FQI A;  4C75 A;  1BUL A;  4S2N A;  3TOI A;  1I2S A;  5FDH A;  1K56 D;  5EPH A;  5IHV A;  4LEN A;  4E3K A;  3WRZ A;  2XFS A;  1QMF A;  3D4F A;  5FAO A;  2EFX A;  3N7W A;  1KDW A;  4E6W A;  5E43 A;  2OV5 A;  2Y91 A;  2ZMA A;  3IXG A;  2JC7 A;  4OPR A;  4BJP A;  4FD8 A;  1CK3 A;  1DY6 A;  3ZG5 A;  3TG9 A;  3A3E A;  2XD1 A;  3G2Y A;  4N1H A;  3WS5 A;  4HBU A;  2HP9 A;  1RGY A;  2Y2N A;  3VFH A;  1XP4 A;  1XGI A;  1ONG A;  1CEF A;  1PW1 A;  3UO9 A;  1SHV A;  5HFO A;  2V2F F;  5A90 A;  3G2Z A;  1BSG A;  5EVI B;  1U60 A;  1NXY A;  3VP4 A;  2H10 A;  3OPH A;  3SS3 A;  4DE1 A;  4XXR A;  1E4D A;  4NK3 A;  3OZH A;  3GRJ A;  2QPN A;  4IED A;  1ALQ A;  4GD8 A;  1MPL A;  4UAA A;  5FAP A;  4LV1 A;  3VP2 A;  1WYB A;  1YQS A;  1M6K A;  4KQO A;  3VFF A;  1K54 C;  3FZC A;  4N9K A;  2P74 A;  1ZKJ A;  3PAE A;  1MWR A;  5FQM A;  3BM6 A;  3BFE A;  3V39 A;  2Q9N A;  5DF7 A;  4BL3 A;  1JTD A;  1L0E A;  1JTG A;  1EI5 A;  4P87 A;  4U0X A;  3NCK A;  5DVA A;  3BFD A;  3C7V A;  2Y4A A;  2XGN A;  3ZNY A;  5GHX A;  3MZF A;  4P85 A;  3Q82 A;  4Y0O A;  1K55 C;  5FQK A;  3SH8 A;  3ZCZ A;  3OPP A;  1XKZ A;  1N4O A;  4IVI A;  3G30 A;  4DXC A;  1DJB A;  4F94 A;  3BEC A;  4R3B A;  3PBT A;  3DTM A;  3QNB A;  2Q9M A;  2FFF B;  3N6I A;  1RCJ A;  2DNS A;  2E8I A;  2X02 A;  2WZX A;  4H8R A;  1DJC A;  4KQQ A;  1PI5 A;  4YIN A;  4WZ5 C;  1L0G A;  3QNC A;  2OLU A;  5CRF A;  2EX6 A;  3LO7 A;  3ZNT A;  4PPR A;  1Z6F A;  3OPL A;  1NYM A;  4R0Q A;  1JWP A;  4EBP A;  4LCM A;  2XDM A;  5CER A;  2WGW A;  5GL9 A;  1ONH A;  1L0F A;  4DDY A;  3DW0 A;  1W8Y A;  3IF6 A;  1PYY A;  1LLB A;  3ZFZ A;  1YLY A;  3IHA A;  4GZB A;  4WEK A;  5E2E A;  1K56 A;  3ZHH A;  1M40 A;  4RX2 A;  3HUM A;  2J8Y A;  3VP3 A;  1K38 A;  1MWS A;  5CTN A;  3EQU A;  3V50 A;  2XLN A;  2PU2 A;  2HDU A;  4X6T A;  4B4X A;  3EQV A;  2WAD A;  5FAQ A;  4MLL A;  4X69 A;  5M19 A;  5DTS A;  4S2L A;  5FA7 A;  3FKV A;  1NY0 A;  4QU3 A;  5DTT A;  3GR2 A;  1I5Q A;  3ISG A;  4KZ7 A;  4EUZ A;  2J9P A;  5HL1 A;  4IBX A;  5DF8 A;  1O7E A;  2WKH A;  1FSY A;  3OC2 A;  2ZQ8 A;  4FCF A;  1WYC A;  1FCN A;  4OQI A;  5FSR A;  5HAQ A;  3WS1 A;  3PBR A;  4S2N C;  4UA9 A;  3A3I A;  4KZ8 A;  1Q2P A;  2XF3 A;  2XEP A;  1GHP A;  1LL9 A;  2RL3 A;  4GN2 A;  4OQH A;  4Y0U A;  4C3Q A;  4KG5 A;  4QD4 A;  3ZVW A;  3E2L A;  3S4X A;  3VSK A;  5U47 A;  3DWZ A;  1E25 A;  3O87 A;  1YMS A;  2VGJ A;  1PWD A;  3A3F A;  4CJN A;  5E2F A;  4ZDX A;  1K57 A;  4QJG A;  3VSL A;  5J8X A;  1YM1 A;  4R3J A;  1LHY A;  1ZC2 A;  1N9B A;  2ZC6 B;  4JLF A;  3BLS A;  3IQA A;  3VMA A;  5KSH A;  4M3K A;  5GHZ A;  1E3U D;  3OPR A;  3IWQ A;  2Z2M B;  3IF5 A;  3IH8 A;  1XPB A;  4KEN B;  3HLW A;  5A92 A;  4E3L A;  1BLP A;  4FSF A;  5TGF A;  3BFG A;  3LCE A;  1IYS A;  1XGJ A;  3LY4 A;  1H8Y A;  2HPB A;  4HES A;  3GV9 A;  4GD6 A;  4DF6 A;  1KVL A;  1PI4 A;  1XA1 A;  5EUA A;  5L2F A;  3UNW A;  1PWG A;  1QME A;  2XH9 A;  3GTC A;  3FV7 A;  4K0X A;  5EVI A;  5TFQ A;  2Y2Q A;  2HDS A;  5FI7 A;  1GCE A;  4BD1 A;  3IXD A;  3Q07 A;  5CHU A;  1KE4 A;  3LY3 A;  4KZ5 A;  1FCO A;  5A93 A;  2HP6 A;  2Y2I A;  1YMX A;  2XK1 A;  4JXG A;  3SS5 A;  4WMC D;  2ZM8 A;  1HD8 A;  1O07 A;  3QHY A;  4JF6 A;  4KZA A;  4U0T A;  1VQQ A;  1CI8 A;  3A3D A;  4S2K A;  3A3J A;  3CJM A;  3G32 A;  3NY4 A;  3PBN A;  2J9O A;  3UPP A;  3VOY A;  1YT4 A;  3WRT A;  5TR7 A;  4OLD A;  2FFY A;  3TSG A;  2EX8 A;  4GDN A;  3SS4 A;  3V5M A;  3NIA A;  3HUN A;  4R23 A;  1TVF A;  4OPQ A;  3AGF A;  4QHC A;  2Y2M A;  4LV0 A;  3P09 A;  3NI9 A;  4ZTK A;  2WYX A;  1YLJ A;  2Y2P A;  3G35 A;  4N9L A;  3IHB A;  3WS4 A;  5E2G A;  3IF6 C;  2ZQ9 A;  1BLC A;  4OQ0 A;  3DWK A;  1ES3 A;  3NC8 A;  1BLS A;  3SOI A;  5FQ9 A;  2WZZ A;  4JF5 A;  2ZQD A;  1MBL A;  1KGE A;  1ERO A;  5KZH A;  3UE1 A;  3HBR A;  5EE8 A;  3UY6 A;  2ZM0 A;  1W5D A;  1YLT A;  4S2P A;  4DXB A;  3UPO A;  1IKG A;  4XUZ A;  3ZDJ A;  1TDG A;  2J7V A;  2DRW A;  5EOO A;  5FQJ A;  5EVI D;  2CC1 A;  1SDE A;  4GKU A;  3WS0 A;  1KGG A;  3NBL A;  5AQB A;  2Y2G A;  3IWI A;  5CGX A;  1FQG A;  2WAE A;  2Y2H A;  5F83 A;  1E3U A;  1WE4 A;  2EXA A;  4MBF A;  4UA7 A;  4Z9Q A;  5EOE A;  1RP5 A;  2PBY A;  1H5X A;  2R9W A;  3O86 A;  3Q7Z A;  4RYE A;  5E2H A;  3HLC A;  1TEM A;  3PBQ A;  3I7J A;  3HRE A;  5CXW A;  4UHU A;  2P9V B;  3G34 A;  5D3O A;  5M18 A;  3HLF A;  4PM9 A;  1MXO A;  3ITB A;  3N8R A;  2QMI A;  1CEG A;  1DJA A;  5CTM A;  2I72 A;  1K57 C;  5GHY A;  5GLA A;  3N8S A;  4PMA A;  3HUO A;  5HAI A;  3ZG0 A;  3ZVT A;  3HLB A;  2Y2O A;  1S6R A;  3IXB A;  5F82 A;  1K54 A;  5BOH A;  3FYZ A;  2EX9 A;  4RX3 A;  2Y2J A;  4WEJ A;  1MWT A;  5I94 A;  5DTK A;  3WWX A;  3HL9 A;  1K6R A;  4PM7 A;  4ID4 A;  1SCW A;  4OLG A;  4X55 A;  5FAT A;  3V3S A;  3IXH A;  3UPN A;  4WMC A;  1ES4 A;  1SKF A;  5KSC A;  2DCF A;  4P6B A;  2UWX A;  3RJU A;  1L2S A;  2EX2 A;  4KG6 A;  3UDF A;  1PW8 A;  4EWF A;  3N8L A;  5GLD A;  4BD0 A;  4WZ4 A;  4LCL A;  2A3U A;  4B4Z A;  4Q8I A;  1IYO A;  4OOL A;  3BLM A;  3W4P A;  3SH9 A;  4QY6 A;  3M6B A;  4DE3 A;  3M2J A;  4R4R A;  1IEL A;  3IF6 B;  4S2I A;  5AQ7 A;  5AQA A;  2JBF A;  3W4Q A;  3HVF A;  4X53 A;  1ERM A;  3UE3 A;  2VGK A;  1GHM A;  5AQ9 A;  4R1G A;  5EVL A;  3M6H A;  4E3O A;  3C4P A;  4BLM A;  1NZU A;  4NET A;  1IYQ A;  1ZG6 A;  4EBN A;  1PIO A;  5HW3 A;  3MXR A;  4OPY A;  1W8Q A;  1H8Z A;  4UA6 A;  4Y0T A;  2OLV A;  4N1X A;  1GA9 A;  3Q7V B;  5CEC A;  3RXX A;  4BL2 A;  4KZ6 A;  1XA7 A;  4BEN A;  3PTE A;  4GB7 A;  5GLB A;  4WEL A;  4JPM A;  2IWB A;  4E3J A;  3PBS A;  3MBZ A;  1ES5 A;  4JXV A;  2G2U A;  4U3T A;  3OCN A;  1I2W A;  4DRT A;  3WS2 A;  1BT5 A;  3ITA A;  1K4E A;  2JCH A;  1L0D A;  2Y2K A;  1MY8 A;  3LEZ A;  3AGD A;  4JXW A;  1G68 A;  3N4I A;  1YLZ A;  2A49 A;  3V3R A;  3B3X A;  2ZD8 A;  1ESI A;  4K0W A;  4OPZ A;  5JYO A;  1BUE A;  2WK0 A;  2XQZ A;  4JBF A;  2PU4 A;  4OVD A;  1GA0 A;  1Q2Q A;  2X01 A;  3Q81 A;  3GQZ A;  4KZB A;  5HAR A;  3FKW A;  4ZJ3 A;  4IBR A;  4X56 A;  2R9X A;  4QY5 A;  2ZC5 B;  2ZJ9 A;  1NRF A;  1SDN A;  4D2O A;  2XFT A;  2RCX A;  4R4S A;  1KE3 A;  2HDR A;  2WGI A;  4N92 A;  4DE0 A;  4O7D A;  4ZJ1 A;  4C6Y A;  4CPK A;  4HEF A;  3BEB A;  3HLG A;  1KVM A;  5CHM A;  1PWC A;  1PZO A;  3MKE A;  4OOM A;  4MBH A;  3UDX A;  4QB8 A;  3VOZ A;  5FI6 A;  3ZG9 B;  4E3I A;  2BLS A;  5JYP A;  3M2K A;  5EEC A;  2EFU A;  1YLP A;  2H5S A;  2ZQA A;  4LV3 A;  4E6X A;  1RGZ A;  3IT9 A;  2Y2L A;  2P9V A;  3CMZ A;  4WM9 A;  4EQI A;  4XUX A;  3ZG7 B;  4L0L A;  4IVK A;  3CG5 A;  4S2O A;  4P0M A;  2ZC3 B;  5A91 A;  2WGV A;  2IWC A;  1K4F A;  1FCM A;  2WKE A;  4ZJ2 A; 
#chains in the Genus database with same CATH topology
 5I5L A;  4H6J A;  3CUE A;  5GLC A;  3BQA A;  4BMW A;  4EBL A;  4HIA A;  3R4K A;  4Y7P A;  4K91 A;  4CLC A;  1FOF A;  3HLE A;  1CI9 A;  3ZYT A;  3Q1F A;  1JVJ A;  3W4O A;  5CGS A;  3DBA A;  4HBT A;  1GHI A;  3E0Y A;  3UB9 A;  5FAS A;  1BZA A;  5FDS A;  2ZLY A;  3UB8 A;  1DP6 A;  3OCL A;  5FQQ A;  2HP5 A;  3E2K A;  3VP0 A;  1C3B A;  3DTK A;  2PR6 A;  4EV4 A;  4E3N A;  1MKI A;  1LI0 A;  4KG2 A;  5EVI C;  1VM1 A;  2WGW B;  2Y59 A;  4KZ3 A;  5DFY A;  1LL8 A;  2VA0 A;  3FWL A;  3G4P A;  1PZP A;  1NJ4 A;  1BTL A;  1YLW A;  2GZA A;  3NOU C;  1ODV A;  3UE0 A;  4B88 A;  5HWW A;  3GMW A;  5G18 A;  1ZG4 A;  1FR6 A;  3CZD A;  4YOF A;  1W7F A;  3NDG A;  3C4O A;  4KZ9 A;  5M1A A;  4WL9 A;  1OME A;  3QP4 A;  4WYY A;  3JYI A;  5G4Y A;  4O01 A;  1NLZ A;  4GOG A;  1BLH A;  5HX9 A;  3UMD A;  3BY8 A;  1MWU A;  4OON A;  1CJF A;  2ZQC A;  1FSW A;  3CIT A;  3GVB A;  4EEU A;  4PM6 A;  1TDL A;  3E4Q A;  4C75 A;  1S4S A;  1UGU A;  3TW8 A;  2EFX A;  3N7W A;  4JGP A;  3LIE A;  1AWI A;  1CK3 A;  4B9O A;  1XP4 A;  5FL3 A;  1ONG A;  1SHV A;  4HY8 A;  3G2Z A;  3E4O A;  4XXR A;  3CPT A;  4DE1 A;  4NK3 A;  2QPN A;  1ALQ A;  2GNX A;  4GD8 A;  4X1L A;  3VP2 A;  3IX3 A;  3VFF A;  1K54 C;  4N9K A;  3DTI A;  1T19 A;  2P74 A;  5FQM A;  5J7E A;  2W3G A;  2Q9N A;  3CAX A;  3RFB A;  2Y4A A;  4DN0 A;  1K55 C;  1YSP A;  5HWT A;  4I38 A;  3KX0 X;  3BEC A;  3DTM A;  3QNB A;  2E8I A;  1DJC A;  3QNC A;  2OLU A;  2OAP 1;  3V67 A;  4PPR A;  1TS6 A;  4DDY A;  3IF6 A;  1PYY A;  3LR4 A;  2XRN A;  1G5U A;  3IHA A;  2HGV A;  3ZHH A;  1UWP X;  2Q0O A;  2J8Y A;  3CI6 A;  1K38 A;  3V50 A;  2XLN A;  4B4X A;  2HDU A;  5FAQ A;  4X69 A;  2KDK A;  5DTS A;  4S2L A;  5DTT A;  1NY0 A;  4KZ7 A;  1O7E A;  1FSY A;  3OC2 A;  4NXE A;  4S2N C;  4UA9 A;  3JVU A;  4KZ8 A;  2XF3 A;  4WN5 A;  1NLY A;  5IU1 A;  4JGR A;  3ZVW A;  3UB5 P;  2I9V A;  1PWD A;  3A3F A;  4GS9 A;  4CJN A;  5E2F A;  1K57 A;  4QJG A;  3VSL A;  5J8X A;  1YM1 A;  4JLF A;  4M3K A;  3F1O B;  3BJN A;  1XPB A;  3PYP A;  5TGF A;  1XGJ A;  5F6A A;  1WA9 A;  4I3I A;  1XA1 A;  4D60 A;  2KLI A;  1OTE A;  1QME A;  4KUK A;  2XH9 A;  3GTC A;  3FV7 A;  5TFQ A;  3PHY A;  4HH2 A;  1GCE A;  3IXD A;  3MSH A;  3LY3 A;  1XFN A;  3LGO A;  2XK1 A;  1PFL A;  2ZM8 A;  3QHY A;  3CJM A;  3NY4 A;  4HP4 A;  4CLC C;  3PBN A;  3VOY A;  3IS2 A;  5TR7 A;  4MCW A;  2EX8 A;  3V5M A;  4R23 A;  3HUN A;  1TVF A;  3AGF A;  3LID A;  4QHC A;  3K3C A;  2R78 A;  2XA7 M;  5E2G A;  4LPZ A;  4UQI M;  3DWK A;  3NC8 A;  1BLS A;  2W3D A;  2EWV A;  4P6Z M;  3LR0 A;  3HBR A;  3B42 A;  2HJE A;  2ZM0 A;  1W5D A;  1YLT A;  2JKT M;  1YAX A;  3UPO A;  1IKG A;  3LUQ A;  3ZDJ A;  4BWI A;  5EOO A;  5FQJ A;  3NBL A;  5F83 A;  1YSQ A;  1WE4 A;  3NHQ A;  5EOE A;  1RP5 A;  2PBY A;  2QJ5 A;  3I7J A;  3HRE A;  2QYB A;  4EET B;  3H9W A;  3G34 A;  3HLF A;  3ITB A;  2JKR I;  1DJA A;  3W2Z A;  2OOL A;  1VEU A;  3L9K A;  5HZH A;  4EQ1 A;  2VKS A;  4K08 A;  2EX9 A;  1MWT A;  5I94 A;  3WWX A;  4X55 A;  4PAU A;  3BQ8 A;  3UB6 A;  2UWX A;  1L2S A;  2EX2 A;  3DAV A;  3UDF A;  3N8L A;  4EES A;  4WZ4 A;  4LCL A;  4R70 A;  4OOL A;  4JGQ A;  1N9N A;  4DE3 A;  1IEL A;  3IF6 B;  5AQ7 A;  3LIA A;  5AQA A;  4GCZ A;  4X53 A;  4L9E A;  2PBD P;  2VGK A;  1F2K A;  2AVX A;  2WKR A;  4WLA A;  3KSH A;  1NZU A;  3EGD C;  3MXR A;  1H8Z A;  4UA6 A;  4Y0T A;  4N1X A;  5CEC A;  4II7 A;  1XA7 A;  4BEN A;  3PTE A;  5GLB A;  5MC7 A;  3MBZ A;  3UME A;  2G2U A;  3OCN A;  1I2W A;  5C5K A;  4ETZ A;  3ITA A;  1L0D A;  5F68 A;  4GS9 B;  2MJ6 A;  1Q2Q A;  3GQZ A;  5HAR A;  3D3O A;  2JKG A;  2R9X A;  4QY5 A;  2HF6 A;  2XFT A;  1CQA A;  2VV8 A;  4ZJ1 A;  1NWZ A;  4HEF A;  1P0Z A;  5CHM A;  3MKE A;  4MBH A;  3UDX A;  3T4L A;  2ZBB A;  3ZG9 B;  2NUT C;  4ME4 A;  3IT9 A;  2WGV A;  4XUX A;  4L0L A;  2ZC3 B;  1DP8 A;  1D1J A;  2K31 A;  3T4J A;  3O3V A;  3RXW A;  4Y3I A;  1J9M A;  1IKI A;  4R3A A;  2V8F A;  3AGE A;  2C6W B;  4HH3 A;  4WBG A;  3UY6 A;  5HPF A;  4GLQ A;  2J80 A;  2WUQ A;  2BG1 A;  1IYP A;  2KOI A;  3T4T A;  2E8J A;  3S22 A;  2W1R A;  1ES2 A;  1P9R A;  4RA7 A;  4MBK A;  4BQM A;  3BYD A;  3T4O A;  1H8M A;  1OJG A;  1K55 A;  4Z1W A;  4DKI A;  3UN7 A;  1NZO A;  1LL5 A;  4MEZ A;  3SH7 A;  2VGL S;  4OH0 A;  2XR0 A;  4QWO A;  3T1Q B;  1IEM A;  3PAG A;  3T12 B;  2H0Y A;  1FR1 A;  3FPW A;  4LRZ E;  4UQI S;  3S1Y A;  4B93 A;  1VEU B;  3IWO A;  2ZM2 A;  2WKI A;  2XD5 A;  2CMN A;  5TJJ A;  4PM5 A;  1T1B A;  1S1Y A;  4I3A A;  2JE5 A;  4HJ4 A;  4Q0I A;  2YKF A;  2D02 A;  2EXB A;  3LIC A;  3MFD A;  3MZD A;  2Y55 A;  5TBM A;  2WAF A;  1KGF A;  4Y5F A;  2O99 A;  4S2N A;  3TOI A;  2B18 A;  5LBR A;  4E3K A;  1D7E A;  3WRZ A;  2XFS A;  1QMF A;  3D4F A;  1T1A A;  3T1X A;  3IXG A;  2JC7 A;  4BJP A;  3MR0 A;  1VHM A;  3TG9 A;  3MJQ A;  2XD1 A;  4N1H A;  2Y2N A;  3PXP A;  4NXG A;  4EER A;  1CEF A;  3UO9 A;  3VOL A;  5HFO A;  5A90 A;  2V1B A;  3VP4 A;  5EVI B;  1U60 A;  3SS3 A;  1OT9 A;  1YQS A;  1M6K A;  4KQO A;  4BBT A;  5FEF A;  3PAE A;  3BM6 A;  3LYX A;  5DF7 A;  1L0E A;  1JTG A;  2O9B A;  5DVA A;  3BFD A;  5GHX A;  4P85 A;  3SH8 A;  4IVI A;  1N4O A;  3G30 A;  1IFQ A;  1KOU A;  2X02 A;  2WZX A;  4YIN A;  5CRF A;  4ARZ A;  3LO7 A;  3F1P B;  4O8G A;  1Z6F A;  3OPL A;  2PYR A;  1JWP A;  4LCM A;  2XDM A;  5L07 A;  5CER A;  5GL9 A;  1ONH A;  5DKL A;  1YKD A;  3DW0 A;  1W8Y A;  3GEC A;  1LLB A;  1YLY A;  3KSG A;  4GZB A;  5E2E A;  1K56 A;  3HUM A;  3MQQ A;  3VP3 A;  1MWS A;  5CTN A;  3EQU A;  4PKY A;  2PU2 A;  4X6T A;  2WAD A;  3CLO A;  5M19 A;  5DKK A;  2ZMV A;  2KX6 A;  3BW6 A;  3GR2 A;  4FUW A;  4FCF A;  4OQI A;  5FSR A;  3WS1 A;  3KSI A;  1DRM A;  1GHP A;  2RL3 A;  4GN2 A;  1E25 A;  1YMS A;  5AVF A;  3OBF A;  1LHY A;  3IBR A;  3C38 A;  2L0W A;  2Z2M B;  3IH8 A;  5CX7 A;  5A92 A;  2FH5 A;  2J3T C;  2M7V A;  2XSS A;  1H8Y A;  2HPB A;  1KVL A;  1PI4 A;  5EUA A;  5L2F A;  3UNW A;  2Y2Q A;  5CHU A;  4KZ5 A;  1FCO A;  3KYE A;  3RTY A;  4NXB A;  5HD3 A;  3D72 A;  2Z6C A;  1CI8 A;  3A3D A;  3UPP A;  1YT4 A;  2FFY A;  3TSG A;  2JKR M;  3TJZ C;  2WYX A;  1YLJ A;  4N9L A;  3IHB A;  1TS8 A;  1XJ2 A;  3VE4 A;  3DTE A;  1BLC A;  1ES3 A;  4HNB A;  5FQ9 A;  2ZQD A;  1KGE A;  2JKF A;  2J3W A;  5EE8 A;  5L09 A;  5KIZ A;  5EVI D;  2CC1 A;  4GKU A;  2M1C A;  5CGX A;  1VET A;  4LLO B;  4R38 A;  2EXA A;  2EA9 A;  2R9W A;  4RYE A;  5E2H A;  1XJ3 A;  1N9O A;  2XRO A;  5CXW A;  4UHU A;  2P9V B;  5M18 A;  4PM9 A;  2I72 A;  5GHY A;  4KQD A;  3ZVT A;  4G3K A;  2QKP A;  4H6J B;  5BOH A;  4RX3 A;  5DTK A;  3NUL A;  1SCW A;  5FAT A;  3V3S A;  3UPN A;  4CLC B;  1F5M A;  5KSC A;  4P6B A;  2PRF A;  4Q8I A;  1IYO A;  3BLM A;  3W4P A;  2JBF A;  3S7N A;  1ERM A;  2P04 A;  1HLU P;  4OPY A;  4Y17 A;  2D01 A;  2M7U A;  3JPU A;  2PDR A;  1T1C A;  4JPM A;  2IWB A;  2GJ3 A;  4U3T A;  2W1T A;  3LEZ A;  3AGD A;  4JXW A;  1G68 A;  3N4I A;  2L1M A;  3V3R A;  2ZD8 A;  4K0W A;  4OPZ A;  5JYO A;  2XQZ A;  3MXQ A;  1GA0 A;  2X01 A;  3Q81 A;  2ACG A;  3FKW A;  4IUH A;  2ZJ9 A;  3CHW P;  1NRF A;  1J3W A;  2RCX A;  1S66 L;  3R7W A;  4R4S A;  1KE3 A;  2WGI A;  4N92 A;  4DJ3 A;  2FZ0 A;  3MMH A;  1PZO A;  4OOM A;  5EM1 A;  3VOZ A;  4E3I A;  2BLS A;  3M2K A;  3EOI A;  2EFU A;  1YLP A;  2ZQA A;  3LIF A;  2Y2L A;  3S7P A;  4WM9 A;  1TF1 A;  3GDI A;  3ZG7 B;  1L3L A;  2ZL1 A;  5HDC A;  3CG5 A;  4S2O A;  3CPT B;  2IWC A;  1K4F A;  3S7O A;  4JXS A;  1NYY A;  3LR3 A;  2V1Z A;  2ZQ7 A;  1HTZ A;  4A5R A;  2DMW A;  1G6A A;  4ZAM A;  1P97 A;  2L4R A;  3BFC A;  4MN7 A;  4JF4 A;  4KUO A;  4S2J A;  5F1F A;  4OQG A;  2WKP A;  4JKT A;  4L9G A;  1K25 A;  1G28 A;  2VX8 A;  3ZG8 B;  4DDS A;  2V20 A;  3QP1 A;  1XXM A;  2W0N A;  2IWD A;  4OP5 A;  3O88 A;  3C8C A;  2H0T A;  3ZGA B;  5CEB A;  5KMW A;  4MDZ A;  2GDN A;  2QHK A;  1KDS A;  3MXS A;  5HDD A;  4X68 A;  3P98 A;  1ERQ A;  4OP8 A;  3IH9 A;  1LSX A;  3BFF A;  3BRM A;  4FH4 A;  4DE2 A;  3C7U A;  3MZE A;  5HAP A;  1JWV A;  1XX2 A;  3VV4 A;  3NDE A;  1TD5 A;  3UDI A;  4X1M A;  3Q7V A;  1AXB A;  3A0R A;  1K6S A;  5DF9 A;  4RVA A;  2G2W A;  2Y8H A;  4CLC D;  4O0P A;  2X71 A;  4MMN A;  1LI9 A;  2QZ6 A;  4PM8 A;  4FH2 A;  1ESU A;  4E3M A;  4Y13 A;  2W3F A;  1A0K A;  1HVB A;  4LV2 A;  2PR5 A;  2B5R A;  4GDB A;  4YFM A;  4GNU A;  4MN6 A;  3GSG A;  1W79 A;  5FQI A;  1I2S A;  5FDH A;  1K56 D;  4LEN A;  2QJ7 A;  4E6W A;  2OV5 A;  3BY9 A;  3U2A A;  4HJ6 A;  1DY6 A;  4F3L A;  3ZG5 A;  3E98 A;  3LI8 A;  4MN5 A;  3G2Y A;  1EW0 A;  3SZT A;  1RGY A;  1OTI A;  3VFH A;  1XGI A;  1SKO A;  1PW1 A;  2PD8 A;  1MKM A;  3EEA A;  4BBU A;  3OPH A;  3OZH A;  3GRJ A;  2ZOH A;  4IED A;  2W1T B;  5HSQ A;  3BFE A;  1JTD A;  1EI5 A;  4P87 A;  4U0X A;  3NCK A;  3IS2 B;  3LIB A;  3Q82 A;  2YKH A;  4Y0O A;  2Z6D A;  1XKZ A;  1S67 L;  5A8B A;  1G6O A;  1DJB A;  4R3B A;  3EEH A;  5EFW A;  3G6O A;  5L8M A;  2Q9M A;  2FFF B;  1RCJ A;  2DNS A;  1PI5 A;  4WZ5 C;  2JHE A;  2A24 A;  4EBP A;  4PHT A;  2WGW A;  2VV7 A;  4HHD A;  3A0V A;  3ZFZ A;  2PAV P;  4GJ4 A;  5FA7 A;  3MQ0 A;  3FKV A;  1I5Q A;  4EUZ A;  2XA7 S;  4BBV A;  2WKQ A;  2WKH A;  1XJ4 A;  2ZQ8 A;  1WYC A;  3PBR A;  1Q2P A;  3K2N A;  4Y0U A;  1LL9 A;  4P6Z S;  1Y4O A;  4C3Q A;  4QD4 A;  4X25 A;  3QP8 A;  1OT6 A;  3DWZ A;  1LSV A;  3O87 A;  4ZDX A;  4HP9 A;  2PT7 A;  4R3J A;  4NG2 A;  1ZC2 A;  1N9B A;  3VMA A;  3IQA A;  2BTF P;  2A2L A;  5IT5 A;  5HPI A;  3OPR A;  3IWQ A;  3IF5 A;  4KEN B;  3HLW A;  1K0K A;  4E3L A;  1BLP A;  3BFG A;  3LCE A;  1IYS A;  3LY4 A;  4HES A;  1ZHH B;  2NUP C;  4HQA A;  3IX4 A;  4WUJ A;  5IS1 A;  1TS0 A;  1OJ5 A;  4BD1 A;  2K7S A;  3Q07 A;  1KE4 A;  3T4Q A;  5EV0 A;  3UE6 A;  5A93 A;  3FG8 A;  2HP6 A;  2Y2I A;  1YPR A;  5HD5 A;  3SS5 A;  1O07 A;  4JF6 A;  4KZA A;  4DJ2 A;  4YNR A;  4S2K A;  4EEP A;  5FEG A;  3G32 A;  2J9O A;  3EWK A;  4GDN A;  3SS4 A;  2LB5 A;  2HZ5 A;  3NI9 A;  3G35 A;  3WS4 A;  2ZQ9 A;  4JGO A;  4OQ0 A;  3SOI A;  4JF5 A;  2ZOI A;  3F1N A;  3UE1 A;  3VE3 A;  3FC7 A;  4NEE D;  1PRQ A;  4S2P A;  4XUZ A;  4Y15 A;  1SKO B;  1TDG A;  2J7V A;  2DRW A;  3HJK A;  1SDE A;  2EWW A;  4DMZ A;  1KGG A;  2WAE A;  2Y2H A;  2INW A;  1E3U A;  4MBF A;  2G7U A;  1H5X A;  3Q7Z A;  1TEM A;  2O0Y A;  5D3O A;  2V0U A;  3N8R A;  5CTM A;  3N8S A;  4EW7 A;  3HLB A;  5AJG A;  3IXB A;  5K5B A;  3FYZ A;  4WEJ A;  3HL9 A;  1K6R A;  4ID4 A;  1V9Z A;  4WMC A;  1SKF A;  3RJU A;  4GW9 A;  2QWS A;  2H28 A;  3F1O A;  3T1S A;  1XJ6 A;  2A24 B;  2A3U A;  3KYZ A;  4B4Z A;  3UB7 A;  3LEQ A;  4M4X A;  3HCY A;  3M2J A;  4S2I A;  4Q0H A;  1GSV A;  3C30 A;  3W4Q A;  1F98 A;  3UE3 A;  5G4Z A;  1GHM A;  5HDS A;  5AQ9 A;  4WF0 A;  4EUV A;  3MQO A;  1ZG6 A;  4EBN A;  1PIO A;  5HW3 A;  4ETX A;  1W8Q A;  1GA9 A;  3H82 A;  3B33 A;  3S7Q A;  4GB7 A;  3QP6 A;  4PKY G;  1ES5 A;  3TE8 A;  3KO6 A;  4DRT A;  3WS2 A;  2VV6 A;  1K4E A;  2JCH A;  2Y2K A;  1MY8 A;  1S4R A;  5DJT A;  1ESI A;  2WK0 A;  4JBF A;  1NRJ A;  1LSW A;  4OVD A;  3T1R A;  2V8C A;  4IBR A;  4E04 A;  3FPV A;  5TBM B;  1SDN A;  1ACF A;  1STZ A;  3D9Y A;  3U4L P;  4ESP A;  2V1A A;  1MC0 A;  2VJW A;  4O7D A;  1KVM A;  1PWC A;  1S1Z A;  3OLO A;  5FI6 A;  5JYP A;  5EEC A;  4E6X A;  1RGZ A;  1W63 Q;  4G3V A;  3E4P A;  3EGX C;  5A91 A;  2P08 A;  2WKE A;  4ZJ2 A;  3P01 A;  2OSU A;  1Y54 A;  2ZC7 A;  3PBO A;  5EM0 A;  2B02 A;  4I5S A;  4KZ4 A;  3NOT C;  2Y79 A;  2C5W B;  1GSW A;  3F1N B;  3NOP C;  1OPX A;  3HLD A;  4OOY A;  2K2N A;  4LFU A;  1S0W A;  4OKP A;  2HJ9 C;  2Z2L B;  4S2M A;  5J4E A;  1HZO A;  1JWZ A;  2J3T D;  3C2W A;  4ARZ B;  2ZC4 B;  5CGW A;  1EWZ A;  5F5Y A;  4WZ5 A;  4KQR A;  3W8K A;  2OWJ A;  2VEA A;  4ZBE A;  5FI2 A;  3MKF A;  2UV0 E;  2IA2 A;  3JVV A;  4MNR A;  1H3Q A;  5F1G A;  2HV1 A;  3IX8 A;  3G31 A;  2PHY A;  2O9C A;  3VP1 A;  3ULF A;  2HDQ A;  1KE0 A;  4GHI A;  5CED A;  1P9W A;  3C5A A;  2OWH A;  5CHJ A;  3O5Y A;  4IUK A;  1BUL A;  3K3D A;  5EPH A;  4Q0J A;  5IHV A;  5FAO A;  1KDW A;  5E43 A;  2Y91 A;  2ZMA A;  3PR6 A;  4OPR A;  4FD8 A;  3H7W A;  3A3E A;  3WS5 A;  3QP5 A;  2W3H A;  4HBU A;  2HP9 A;  3CUE C;  1GSX A;  3H82 B;  2V2F F;  3SW1 A;  1BSG A;  4IJG A;  1NXY A;  2H10 A;  5J3W A;  1E4D A;  1N9L A;  4RQ9 A;  1MPL A;  4UAA A;  5FAP A;  4LV1 A;  1WYB A;  3FZC A;  5L10 A;  2VGL M;  1ZKJ A;  1MWR A;  4XT2 A;  3V39 A;  4BL3 A;  1IOU A;  3NEC A;  4Y2F A;  3C7V A;  3TRC A;  4UEY A;  2XGN A;  3ZNY A;  3MZF A;  5FQK A;  3ZCZ A;  3OPP A;  4DXC A;  4F94 A;  2VK3 A;  3PBT A;  4CLC E;  3MFX A;  4H8R A;  3N6I A;  4KQQ A;  3KSF A;  1L0G A;  2EX6 A;  3ZNT A;  2PD7 A;  1NYM A;  4R0Q A;  4YWZ A;  1FIK A;  1D06 A;  1L0F A;  4WEK A;  1X0O A;  1M40 A;  4RX2 A;  1VET B;  3ZQ5 A;  3EQV A;  4MLL A;  4QU3 A;  3ISG A;  5HL1 A;  1Y28 A;  2ZMF A;  2J9P A;  4IBX A;  5DF8 A;  1FCN A;  5HAQ A;  3A3I A;  2XEP A;  4OQH A;  3P7N A;  4AFI A;  4KG5 A;  3E2L A;  3CWF A;  3S4X A;  3VSK A;  5U47 A;  2VGJ A;  2B95 A;  4CQH A;  5AVE A;  5DJU A;  1T18 A;  2ZC6 B;  3BLS A;  5KSH A;  1SZV A;  5GHZ A;  1E3U D;  3OOV A;  4ZRR A;  4FSF A;  3LI9 A;  1ZTU A;  4NKP A;  2P7J A;  3GV9 A;  4GD6 A;  4DF6 A;  4I3J A;  1PWG A;  4K0X A;  5EVI A;  3B47 A;  2HDS A;  5FI7 A;  1UWN X;  1TS7 A;  2GX5 A;  1F9I A;  3T50 A;  1YMX A;  4JXG A;  4WMC D;  1HD8 A;  4U0T A;  1VQQ A;  4I39 A;  3A3J A;  4FOF A;  4GHI B;  3WRT A;  1H0M A;  4OLD A;  2VLG A;  2W3E A;  3NIA A;  4OPQ A;  3LFV A;  2Y2M A;  4LV0 A;  3P09 A;  4ZTK A;  2Y2P A;  3NJA A;  2VZW A;  1Z09 A;  4NXF A;  4EXO A;  3IF6 C;  5DFX A;  1LT0 A;  3F1P A;  2WZZ A;  4HJ3 A;  1MBL A;  1ERO A;  5KZH A;  4LRX C;  3H7W B;  3IBJ A;  4G3W A;  3R7W B;  1W63 M;  4DXB A;  4QPR A;  4HI4 A;  3WS0 A;  3RH8 B;  5AQB A;  2Y2G A;  3IWI A;  4EU0 A;  1FQG A;  5HL6 A;  4UA7 A;  4Z9Q A;  3O86 A;  3HLC A;  3PBQ A;  4XT2 B;  1MXO A;  3MF0 A;  2QMI A;  1CEG A;  1K57 C;  5GLA A;  4PMA A;  2ZL1 B;  3HUO A;  5HAI A;  3ZG0 A;  2V9A A;  2Y2O A;  1S6R A;  5F82 A;  4LGW A;  1K54 A;  3QP2 A;  4PM7 A;  4OLG A;  2W27 A;  3IXH A;  1ES4 A;  2DCF A;  4KG6 A;  1PW8 A;  2LB9 A;  4EWF A;  2JKT I;  5GLD A;  4BD0 A;  1DP9 A;  3T4K A;  4IHQ A;  1OTD A;  1CF0 A;  3SH9 A;  4QY6 A;  3M6B A;  5HWV A;  4L9F A;  4R4R A;  1V9Y A;  3HVF A;  3HJI A;  3T4S A;  5EVE A;  2PYP A;  2V0W A;  4R1G A;  5EVL A;  3M6H A;  4E3O A;  1FIL A;  3C4P A;  4BLM A;  4NET A;  1IYQ A;  4R6L A;  3LR5 A;  2OLV A;  3Q7V B;  3RXX A;  4BL2 A;  4KZ6 A;  1VB6 A;  1MZU A;  4WEL A;  4E3J A;  3PBS A;  4JXV A;  3MS6 A;  1BT5 A;  2O9A A;  1YLZ A;  2A49 A;  3B3X A;  1BUE A;  3A0S A;  1XFQ A;  2PU4 A;  3BWL A;  4KZB A;  1OTB A;  5F69 A;  1OTA A;  4ZJ3 A;  4X56 A;  1PNE A;  2ZC5 B;  3L7H A;  4D2O A;  2HDR A;  4DE0 A;  4C6Y A;  4LRY C;  4CPK A;  3KYQ A;  3BEB A;  3HLG A;  4FTX A;  1BYW A;  4QB8 A;  2JN7 A;  4F3L B;  2OAQ 1;  1JNU A;  2H5S A;  3ICY A;  4LV3 A;  2P9V A;  3CMZ A;  2BAS A;  4EQI A;  4IVK A;  4P0M A;  4HOI A;  2Y2J A;  1FCM A; 
#chains in the Genus database with same CATH homology
 1NYY A;  3O3V A;  2V1Z A;  2ZQ7 A;  3RXW A;  1HTZ A;  5GLC A;  2OSU A;  1J9M A;  1IKI A;  4A5R A;  1G6A A;  4EBL A;  4ZAM A;  3AGE A;  1Y54 A;  2C6W B;  2ZC7 A;  3BFC A;  3PBO A;  4WBG A;  4Y7P A;  2WUQ A;  4JF4 A;  4K91 A;  4S2J A;  1FOF A;  2BG1 A;  5F1F A;  4OQG A;  1IYP A;  3HLE A;  1CI9 A;  4JKT A;  4KZ4 A;  1K25 A;  3ZG8 B;  3Q1F A;  4DDS A;  2C5W B;  2V20 A;  1JVJ A;  3W4O A;  1XXM A;  5CGS A;  2IWD A;  3S22 A;  4OP5 A;  3O88 A;  1ES2 A;  4RA7 A;  4HBT A;  1GHI A;  2H0T A;  4MBK A;  3HLD A;  4BQM A;  5FAS A;  4JXS A;  1BZA A;  4OOY A;  3ZGA B;  3BYD A;  5CEB A;  2ZLY A;  5KMW A;  1S0W A;  3OCL A;  4OKP A;  5FQQ A;  2HP5 A;  2Z2L B;  3E2K A;  4S2M A;  2GDN A;  3VP0 A;  1C3B A;  1HZO A;  1KDS A;  3MXS A;  1K55 A;  1JWZ A;  4X68 A;  4DKI A;  4EV4 A;  4E3N A;  3UN7 A;  1MKI A;  1LI0 A;  3P98 A;  1ERQ A;  2ZC4 B;  4OP8 A;  4KG2 A;  3IH9 A;  3BFF A;  1EWZ A;  5CGW A;  1NZO A;  3BRM A;  4FH4 A;  4DE2 A;  3C7U A;  5EVI C;  1VM1 A;  2WGW B;  3MZE A;  1JWV A;  1LL5 A;  2Y59 A;  4KZ3 A;  4MEZ A;  5HAP A;  3SH7 A;  4OH0 A;  3FWL A;  1XX2 A;  3G4P A;  2XR0 A;  1PZP A;  1NJ4 A;  1BTL A;  1YLW A;  3NDE A;  1IEM A;  3PAG A;  4WZ5 A;  4KQR A;  2H0Y A;  3W8K A;  3UDI A;  1FR1 A;  3Q7V A;  1AXB A;  3S1Y A;  1K6S A;  5DF9 A;  4ZBE A;  5FI2 A;  3UE0 A;  4B88 A;  3IWO A;  2ZM2 A;  3MKF A;  2WKI A;  3GMW A;  5G18 A;  4RVA A;  1ZG4 A;  4MNR A;  2XD5 A;  5F1G A;  1FR6 A;  3CZD A;  2G2W A;  4PM5 A;  1W7F A;  3NDG A;  3C4O A;  4KZ9 A;  5M1A A;  2JE5 A;  1OME A;  2X71 A;  3G31 A;  3VP1 A;  1LI9 A;  2QZ6 A;  4WYY A;  3JYI A;  2HDQ A;  4PM8 A;  4FH2 A;  1ESU A;  4GOG A;  4E3M A;  1KE0 A;  1BLH A;  5CED A;  5HX9 A;  1HVB A;  4LV2 A;  2EXB A;  1MWU A;  4OON A;  2B5R A;  2ZQC A;  3MFD A;  3C5A A;  1FSW A;  3MZD A;  4GDB A;  2Y55 A;  2WAF A;  3GVB A;  4GNU A;  4YFM A;  1KGF A;  5CHJ A;  3GSG A;  4PM6 A;  1TDL A;  1W79 A;  5FQI A;  4C75 A;  1BUL A;  4S2N A;  3TOI A;  1I2S A;  5FDH A;  1K56 D;  5EPH A;  5IHV A;  4LEN A;  4E3K A;  3WRZ A;  2XFS A;  1QMF A;  3D4F A;  5FAO A;  2EFX A;  3N7W A;  1KDW A;  4E6W A;  5E43 A;  2OV5 A;  2Y91 A;  2ZMA A;  3IXG A;  2JC7 A;  4OPR A;  4BJP A;  4FD8 A;  1CK3 A;  1DY6 A;  3ZG5 A;  3TG9 A;  3A3E A;  2XD1 A;  3G2Y A;  4N1H A;  3WS5 A;  4HBU A;  2HP9 A;  1RGY A;  2Y2N A;  3VFH A;  1XP4 A;  1XGI A;  1ONG A;  1CEF A;  1PW1 A;  3UO9 A;  1SHV A;  5HFO A;  2V2F F;  5A90 A;  3G2Z A;  1BSG A;  5EVI B;  1U60 A;  1NXY A;  3VP4 A;  2H10 A;  3OPH A;  3SS3 A;  4DE1 A;  4XXR A;  1E4D A;  4NK3 A;  3OZH A;  3GRJ A;  2QPN A;  4IED A;  1ALQ A;  4GD8 A;  1MPL A;  4UAA A;  5FAP A;  4LV1 A;  3VP2 A;  1WYB A;  1YQS A;  1M6K A;  4KQO A;  3VFF A;  1K54 C;  3FZC A;  4N9K A;  2P74 A;  1ZKJ A;  3PAE A;  1MWR A;  5FQM A;  3BM6 A;  3BFE A;  3V39 A;  2Q9N A;  5DF7 A;  4BL3 A;  1JTD A;  1L0E A;  1JTG A;  1EI5 A;  4P87 A;  4U0X A;  3NCK A;  5DVA A;  3BFD A;  3C7V A;  2Y4A A;  2XGN A;  3ZNY A;  5GHX A;  3MZF A;  4P85 A;  3Q82 A;  4Y0O A;  1K55 C;  5FQK A;  3SH8 A;  3ZCZ A;  3OPP A;  1XKZ A;  1N4O A;  4IVI A;  3G30 A;  4DXC A;  1DJB A;  4F94 A;  3BEC A;  4R3B A;  3PBT A;  3DTM A;  3QNB A;  2Q9M A;  2FFF B;  3N6I A;  1RCJ A;  2DNS A;  2E8I A;  2X02 A;  2WZX A;  4H8R A;  1DJC A;  4KQQ A;  1PI5 A;  4YIN A;  4WZ5 C;  1L0G A;  3QNC A;  2OLU A;  5CRF A;  2EX6 A;  3LO7 A;  3ZNT A;  4PPR A;  1Z6F A;  3OPL A;  1NYM A;  4R0Q A;  1JWP A;  4EBP A;  4LCM A;  2XDM A;  5CER A;  2WGW A;  5GL9 A;  1ONH A;  1L0F A;  4DDY A;  3DW0 A;  1W8Y A;  3IF6 A;  1PYY A;  1LLB A;  3ZFZ A;  1YLY A;  3IHA A;  4GZB A;  4WEK A;  5E2E A;  1K56 A;  3ZHH A;  1M40 A;  4RX2 A;  3HUM A;  2J8Y A;  3VP3 A;  1K38 A;  1MWS A;  5CTN A;  3EQU A;  3V50 A;  2XLN A;  2PU2 A;  2HDU A;  4X6T A;  4B4X A;  3EQV A;  2WAD A;  5FAQ A;  4MLL A;  4X69 A;  5M19 A;  5DTS A;  4S2L A;  5FA7 A;  3FKV A;  1NY0 A;  4QU3 A;  5DTT A;  3GR2 A;  1I5Q A;  3ISG A;  4KZ7 A;  4EUZ A;  2J9P A;  5HL1 A;  4IBX A;  5DF8 A;  1O7E A;  2WKH A;  1FSY A;  3OC2 A;  2ZQ8 A;  4FCF A;  1WYC A;  1FCN A;  4OQI A;  5FSR A;  5HAQ A;  3WS1 A;  3PBR A;  4S2N C;  4UA9 A;  3A3I A;  4KZ8 A;  1Q2P A;  2XF3 A;  2XEP A;  1GHP A;  1LL9 A;  2RL3 A;  4GN2 A;  4OQH A;  4Y0U A;  4C3Q A;  4KG5 A;  4QD4 A;  3ZVW A;  3E2L A;  3S4X A;  3VSK A;  5U47 A;  3DWZ A;  1E25 A;  3O87 A;  1YMS A;  2VGJ A;  1PWD A;  3A3F A;  4CJN A;  5E2F A;  4ZDX A;  1K57 A;  4QJG A;  3VSL A;  5J8X A;  1YM1 A;  4R3J A;  1LHY A;  1ZC2 A;  1N9B A;  2ZC6 B;  4JLF A;  3BLS A;  3IQA A;  3VMA A;  5KSH A;  4M3K A;  5GHZ A;  1E3U D;  3OPR A;  3IWQ A;  2Z2M B;  3IF5 A;  3IH8 A;  1XPB A;  4KEN B;  3HLW A;  5A92 A;  4E3L A;  1BLP A;  4FSF A;  5TGF A;  3BFG A;  3LCE A;  1IYS A;  1XGJ A;  3LY4 A;  1H8Y A;  2HPB A;  4HES A;  3GV9 A;  4GD6 A;  4DF6 A;  1KVL A;  1PI4 A;  1XA1 A;  5EUA A;  5L2F A;  3UNW A;  1PWG A;  1QME A;  2XH9 A;  3GTC A;  3FV7 A;  4K0X A;  5EVI A;  5TFQ A;  2Y2Q A;  2HDS A;  5FI7 A;  1GCE A;  4BD1 A;  3IXD A;  3Q07 A;  5CHU A;  1KE4 A;  3LY3 A;  4KZ5 A;  1FCO A;  5A93 A;  2HP6 A;  2Y2I A;  1YMX A;  2XK1 A;  4JXG A;  3SS5 A;  4WMC D;  2ZM8 A;  1HD8 A;  1O07 A;  3QHY A;  4JF6 A;  4KZA A;  4U0T A;  1VQQ A;  1CI8 A;  3A3D A;  4S2K A;  3A3J A;  3CJM A;  3G32 A;  3NY4 A;  3PBN A;  2J9O A;  3UPP A;  3VOY A;  1YT4 A;  3WRT A;  5TR7 A;  4OLD A;  2FFY A;  3TSG A;  2EX8 A;  4GDN A;  3SS4 A;  3V5M A;  3NIA A;  3HUN A;  4R23 A;  1TVF A;  4OPQ A;  3AGF A;  4QHC A;  2Y2M A;  4LV0 A;  3P09 A;  3NI9 A;  4ZTK A;  2WYX A;  1YLJ A;  2Y2P A;  3G35 A;  4N9L A;  3IHB A;  3WS4 A;  5E2G A;  3IF6 C;  2ZQ9 A;  1BLC A;  4OQ0 A;  3DWK A;  1ES3 A;  3NC8 A;  1BLS A;  3SOI A;  5FQ9 A;  2WZZ A;  4JF5 A;  2ZQD A;  1MBL A;  1KGE A;  1ERO A;  5KZH A;  3UE1 A;  3HBR A;  5EE8 A;  3UY6 A;  2ZM0 A;  1W5D A;  1YLT A;  4S2P A;  4DXB A;  3UPO A;  1IKG A;  4XUZ A;  3ZDJ A;  1TDG A;  2J7V A;  2DRW A;  5EOO A;  5FQJ A;  5EVI D;  2CC1 A;  1SDE A;  4GKU A;  3WS0 A;  1KGG A;  3NBL A;  5AQB A;  2Y2G A;  3IWI A;  5CGX A;  1FQG A;  2WAE A;  2Y2H A;  5F83 A;  1E3U A;  1WE4 A;  2EXA A;  4MBF A;  4UA7 A;  4Z9Q A;  5EOE A;  1RP5 A;  2PBY A;  1H5X A;  2R9W A;  3O86 A;  3Q7Z A;  4RYE A;  5E2H A;  3HLC A;  1TEM A;  3PBQ A;  3I7J A;  3HRE A;  5CXW A;  4UHU A;  2P9V B;  3G34 A;  5D3O A;  5M18 A;  3HLF A;  4PM9 A;  1MXO A;  3ITB A;  3N8R A;  2QMI A;  1CEG A;  1DJA A;  5CTM A;  2I72 A;  1K57 C;  5GHY A;  5GLA A;  3N8S A;  4PMA A;  3HUO A;  5HAI A;  3ZG0 A;  3ZVT A;  3HLB A;  2Y2O A;  1S6R A;  3IXB A;  5F82 A;  1K54 A;  5BOH A;  3FYZ A;  2EX9 A;  4RX3 A;  2Y2J A;  4WEJ A;  1MWT A;  5I94 A;  5DTK A;  3WWX A;  3HL9 A;  1K6R A;  4PM7 A;  4ID4 A;  1SCW A;  4OLG A;  4X55 A;  5FAT A;  3V3S A;  3IXH A;  3UPN A;  4WMC A;  1ES4 A;  1SKF A;  5KSC A;  2DCF A;  4P6B A;  2UWX A;  3RJU A;  1L2S A;  2EX2 A;  4KG6 A;  3UDF A;  1PW8 A;  4EWF A;  3N8L A;  5GLD A;  4BD0 A;  4WZ4 A;  4LCL A;  2A3U A;  4B4Z A;  4Q8I A;  1IYO A;  4OOL A;  3BLM A;  3W4P A;  3SH9 A;  4QY6 A;  3M6B A;  4DE3 A;  3M2J A;  4R4R A;  1IEL A;  3IF6 B;  4S2I A;  5AQ7 A;  5AQA A;  2JBF A;  3W4Q A;  3HVF A;  4X53 A;  1ERM A;  3UE3 A;  2VGK A;  1GHM A;  5AQ9 A;  4R1G A;  5EVL A;  3M6H A;  4E3O A;  3C4P A;  4BLM A;  1NZU A;  4NET A;  1IYQ A;  1ZG6 A;  4EBN A;  1PIO A;  5HW3 A;  3MXR A;  4OPY A;  1W8Q A;  1H8Z A;  4UA6 A;  4Y0T A;  2OLV A;  4N1X A;  1GA9 A;  3Q7V B;  5CEC A;  3RXX A;  4BL2 A;  4KZ6 A;  1XA7 A;  4BEN A;  3PTE A;  4GB7 A;  5GLB A;  4WEL A;  4JPM A;  2IWB A;  4E3J A;  3PBS A;  3MBZ A;  1ES5 A;  4JXV A;  2G2U A;  4U3T A;  3OCN A;  1I2W A;  4DRT A;  3WS2 A;  1BT5 A;  3ITA A;  1K4E A;  2JCH A;  1L0D A;  2Y2K A;  1MY8 A;  3LEZ A;  3AGD A;  4JXW A;  1G68 A;  3N4I A;  1YLZ A;  2A49 A;  3V3R A;  3B3X A;  2ZD8 A;  1ESI A;  4K0W A;  4OPZ A;  5JYO A;  1BUE A;  2WK0 A;  2XQZ A;  4JBF A;  2PU4 A;  4OVD A;  1GA0 A;  1Q2Q A;  2X01 A;  3Q81 A;  3GQZ A;  4KZB A;  5HAR A;  3FKW A;  4ZJ3 A;  4IBR A;  4X56 A;  2R9X A;  4QY5 A;  2ZC5 B;  2ZJ9 A;  1NRF A;  1SDN A;  4D2O A;  2XFT A;  2RCX A;  4R4S A;  1KE3 A;  2HDR A;  2WGI A;  4N92 A;  4DE0 A;  4O7D A;  4ZJ1 A;  4C6Y A;  4CPK A;  4HEF A;  3BEB A;  3HLG A;  1KVM A;  5CHM A;  1PWC A;  1PZO A;  3MKE A;  4OOM A;  4MBH A;  3UDX A;  4QB8 A;  3VOZ A;  5FI6 A;  3ZG9 B;  4E3I A;  2BLS A;  5JYP A;  3M2K A;  5EEC A;  2EFU A;  1YLP A;  2H5S A;  2ZQA A;  4LV3 A;  4E6X A;  1RGZ A;  3IT9 A;  2Y2L A;  2P9V A;  3CMZ A;  4WM9 A;  4EQI A;  4XUX A;  3ZG7 B;  4L0L A;  4IVK A;  3CG5 A;  4S2O A;  4P0M A;  2ZC3 B;  5A91 A;  2WGV A;  2IWC A;  1K4F A;  1FCM A;  2WKE A;  4ZJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...