5A92A

15k x-ray structure with cefotaxime: exploring the mechanism of beta- lactam ring protonation in the class a beta-lactamase acylation mechanism using neutron and x-ray crystallography
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
260
structure length
260
Chain Sequence
SVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE CTX-M-97
publication title Exploring the Mechanism of Beta-Lactam Ring Protonation in the Class a Beta-Lactamase Acylation Mechanism Using Neutron and X-Ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 92
structure length 260
sequence length 260
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5a92A00
3UE3A 1H5XA 4QY6A 4CPKA 5F1FA 3GQZA 5JYOA 1CEGA 1TDGA 4L0LA 1K54C 4MBKA 4IVIA 5D3OA 2WZZA 4WEJA 3HLDA 3P09A 3HUOA 4KG5A 3UPPA 1ZG4A 2QMIA 1MWTA 1PZOA 3N8RA 4X55A 1KE3A 3HLCA 4HBUA 4OPRA 5AQAA 3DWZA 4UA7A 3G32A 3W4OA 3ZDJA 5FI7A 3RJUA 1KE4A 5DVAA 1DJAA 2PU2A 4PM7A 3NDGA 3O87A 3PBQA 1W79A 5FATA 1MWSA 5CTMA 3VFHA 3A3IA 3PAEA 3PAGA 4WMCA 1L0GA 2Y2JA 4FH2A 2G2UA 1K57C 2JE5A 5TGFA 4E3IA 4S2KA 5FSRA 1NYYA 1N9BA 3BFCA 3PBNA 2R9XA 3NIAA 1CI9A 1ALQA 1KDSA 2EX9A 3AGEA 1KGGA 4QJGA 4DXBA 5CHJA 3IXGA 1IELA 3N6IA 1H8YA 1VM1A 2Y2NA 5A93A 4DKIA 4EV4A 4Y7PA 1G68A 3MXSA 3ZFZA 4OVDA 1LI0A 1ZKJA 1NYMA 1XP4A 2C5WB 2P9VA 5EOOA 3UPOA 4JXVA 2OLUA 3C4OA 4KZ7A 1L2SA 3GSGA 3WRTA 4C6YA 1XXMA 3S22A 4CJNA 4U3TA 1W5DA 3MXRA 3IHBA 4ZJ1A 2BG1A 5CGWA 3V50A 2XGNA 1GHIA 1K55C 3UDIA 5HAIA 3VSLA 1WE4A 1PI5A 3NI9A 2A3UA 5AQ9A 2ZQDA 5FQKA 4KZ4A 4S2OA 4OPQA 3UO9A 1IYPA 2ZQCA 2Y2IA 1JWVA 5F82A 3MBZA 2XFTA 3Q81A 3WS0A 4R4SA 3GTCA 4N9KA 3IF5A 5KSHA 4GOGA 3I7JA 5U47A 2V20A 3N8SA 4ZTKA 1NZUA 5FQIA 3IF6A 5FAPA 3VOYA 2JCHA 1ES5A 3JYIA 3UY6A 4LCMA 4BJPA 1FCNA 5FQQA 1YQSA 4UHUA 4FD8A 3ZNTA 3NCKA 4RYEA 1YT4A 2B5RA 3ITBA 5I94A 5CHMA 2WUQA 4OH0A 1FSWA 5AQ7A 1XA7A 1K56A 3IF6B 4KG2A 3V39A 3GV9A 4OOLA 3GMWA 3M2KA 4R0QA 4XUZA 5FI2A 3WRZA 4EWFA 4N92A 2XEPA 3OPPA 2ZM0A 2ZQAA 4GDNA 1KDWA 3HLWA 1XA1A 5EVLA 4IBRA 4JBFA 4PM6A 4S2PA 1SDEA 3ISGA 2Z2MB 5KMWA 1O7EA 3O86A 3ZNYA 1E3UA 2XQZA 1E3UD 3BFEA 4DF6A 1K4EA 4S2IA 1RCJA 3M6BA 3G30A 1K25A 4E3OA 1BULA 3NBLA 3G2ZA 5J8XA 1SKFA 4KZ8A 3OPLA 1MWRA 3IWIA 1LL9A 1O07A 3EQVA 3VMAA 4KQRA 3C7UA 2WADA 4GZBA 3IXDA 5EOEA 1K38A 1GCEA 4QB8A 5M18A 4N1XA 2XH9A 3BECA 3FYZA 2V2FF 4DE3A 1XPBA 2I72A 3IHAA 3PTEA 4Y0UA 5EE8A 3C4PA 2WAFA 1JWPA 5EUAA 4P87A 1FSYA 4EBLA 1YLWA 3UNWA 3W4PA 3WS4A 3N7WA 5CGXA 3G35A 4WYYA 4D2OA 2HPBA 2Y59A 4LCLA 1XGJA 5GHYA 1FR6A 4S2JA 1YMSA 4ZJ3A 4H8RA 4S2MA 2ZQ8A 5EECA 4F94A 4X53A 1JWZA 4OP5A 2DNSA 2HP6A 4EBPA 4FCFA 4DE2A 1MPLA 1IEMA 5GLCA 1BUEA 5TFQA 3V5MA 3UDXA 5HARA 2XF3A 3UPNA 3CG5A 3WS1A 4C75A 1HVBA 5HL1A 2FFYA 3BFDA 3HUMA 3WWXA 2Y2LA 1VQQA 1KGFA 1IYOA 1YMXA 1TVFA 5A91A 1SHVA 2WGWA 2ZC3B 3MKFA 2XD1A 2XDMA 5CRFA 5HFOA 2H0YA 4GB7A 5EVIA 2OLVA 4OOMA 5EVID 4R1GA 1NRFA 4KENB 4JKTA 3V3SA 3D4FA 3TG9A 4IBXA 1M6KA 4EBNA 5E2FA 1LLBA 3CJMA 2E8IA 3HLFA 5CEDA 2WGWB 4OP8A 1FCOA 4X56A 4LV0A 3HL9A 2J9PA 2WK0A 3EQUA 5EPHA 5EVIB 4OQ0A 2X02A 2EX2A 3BM6A 1SDNA 4XXRA 4RVAA 3GR2A 3SS3A 4OQIA 3W4QA 2A49A 1S6RA 2Y2KA 4B4XA 4QHCA 5FASA 2J8YA 3BFFA 5CEBA 1BZAA 5CGSA 3LY3A 1Q2PA 2Y2PA 1AXBA 4E3JA 4X6TA 4DDYA 3CZDA 1LI9A 3VP2A 3FKWA 4KZAA 4NK3A 2WYXA 1EI5A 3S4XA 5A92A 3HLEA 3DTMA 4IVKA 4R3JA 4DDSA 1RGZA 4BD0A 3PBOA 4JF6A 3V3RA 3HREA 3FKVA 5M1AA 4YINA 3E2LA 3ZG7B 3VP3A 3OCNA 3G31A 1XKZA 3A3FA 2EFUA 2WGVA 2QPNA 1M40A 1SCWA 3DW0A 4WZ4A 3IF6C 3Q1FA 4LV1A 3CMZA 5CXWA 3ZG5A 2WAEA 4BLMA 1L0EA 4MLLA 4QD4A 1JTGA 4BQMA 1IYQA 1Q2QA 1Y54A 4N1HA 4NETA 5HX9A 2Y55A 4FSFA 4QY5A 3HLBA 4DXCA 5FQMA 1KGEA 1YM1A 2ZMAA 3ZG0A 1I2SA 3ZVTA 3MFDA 5GLBA 1NXYA 2BLSA 1YLJA 1KVLA 4WELA 1BLHA 1L0DA 1CI8A 3SOIA 3ZCZA 1GHPA 1K6RA 5FQ9A 2JC7A 2ZQ7A 1ES2A 4BENA 4ZAMA 3ZGAB 1YLPA 3VSKA 3RXWA 4P0MA 4QU3A 5F83A 5DTTA 5HAQA 2DCFA 3IH8A 3TOIA 3AGDA 3TSGA 5M19A 2EXBA 3MZEA 3IXHA 3NC8A 4LENA 4U0TA 5AQBA 4WEKA 5CECA 2J9OA 1FOFA 4PPRA 1ES4A 3VP4A 2EX8A 3FWLA 4S2LA 4Y0TA 4PM5A 5E2GA 4MNRA 2XFSA 1CEFA 1MXOA 2EXAA 2ZM2A 3A3JA 3LY4A 4K0WA 2XD5A 2HDQA 2ZC4B 5HW3A 4BD1A 4XUXA 1PZPA 4E3NA 5E2HA 4OLDA 1DJCA 4IEDA 2ZJ9A 3N4IA 3UE1A 3LEZA 4WM9A 5FAOA 3W8KA 2XK1A 4E6WA 1ONHA 3WS2A 2X71A 2VGKA 1NZOA 1ES3A 1DY6A 2Q9MA 1ZG6A 1PWDA 2Y2OA 2ZC7A 3BEBA 3M6HA 3QHYA 1J9MA 3Q7VA 2ZC5B 3Q7ZA 1CK3A 1RGYA 4JXGA 3BLSA 5FAQA 1ESIA 3ZHHA 2IWDA 1FQGA 1EROA 4JF5A 5DF9A 3IWQA 3IXBA 1YLTA 3Q07A 4LV3A 1GA9A 4WZ5A 2H0TA 4B88A 3Q7VB 4JPMA 2Z2LB 3BRMA 2ZQ9A 2WKIA 1PI4A 3N8LA 2HDUA 1ERQA 1PWCA 2ZD8A 2R9WA 2EFXA 4KQOA 1PWGA 3HUNA 4LV2A 2RL3A 1K54A 1K6SA 1PYYA 1TEMA 2ZC6B 3BLMA 4ID4A 2RCXA 4R3BA 5IHVA 3UDFA 3HVFA 2G2WA 1GA0A 3MZFA 3VP1A 4KZBA 4JLFA 4HBTA 4A5RA 5DF8A 5GLDA 4UA6A 3C5AA 4OPYA 5EVIC 5CTNA 1NY0A 3ZG8B 3QNBA 3MKEA 4OPZA 1QMEA 1PW1A 1G6AA 3MZDA 3QNCA 4FH4A 1I5QA 1K57A 3B3XA 1H8ZA 1K4FA 4WMCD 2WKEA 1WYBA 2X01A 5BOHA 5KSCA 4PMAA 4RX3A 5A90A 1ONGA 2HP9A 4YFMA 1BSGA 1PIOA 2WKHA 3FV7A 3BYDA 3OPRA 4OOYA 4P85A 1MKIA 3HLGA 5KZHA 4OONA 1ZC2A 4B4ZA 4C3QA 3FZCA 1MY8A 2H10A 1YLZA 2PBYA 2Y2HA 2Y91A 3A3EA 3G2YA 1TDLA 3PBSA 5CHUA 1BTLA 1Z6FA 4KZ9A 4GN2A 3WS5A 3AGFA 2Q9NA 2WGIA 5DF7A 5FQJA 3G34A 1K55A 1ERMA 3P98A 2IWBA 4Q8IA 1C3BA 1E4DA 1MWUA 2C6WB 3RXXA 5HAPA 1IYSA 5GHZA 1E25A 1JVJA 4S2NA 4UAAA 4P6BA 3UE0A 1RP5A 4R23A 1KE0A 2P9VB 4JXWA 1W8QA 3VFFA 4M3KA 4S2NC 1BLPA 3M2JA 1ESUA 2HP5A 3SS5A 4N9LA 2XR0A 4OLGA 4MBFA 4DE1A 2CC1A 2OSUA 3IWOA 5E43A 1W8YA 1YLYA 2H5SA 4MEZA 4ZJ2A 2V1ZA 4R4RA 4EQIA 4OQGA 4DE0A 3UN7A 5CERA 1KVMA 3GRJA 3G4PA 4K0XA 2VGJA 4JF4A 3IH9A 1FCMA 3OZHA 5JYPA 3ZG9B 2WZXA 3DWKA 3A3DA 1JTDA 2FFFB 1OMEA 2EX6A 3GVBA 4GDBA 1HD8A 4KZ3A 2HDRA 1IKGA 4DRTA 5GHXA 4BL2A 2Y2QA 1HTZA 1BLSA 1S0WA 3S1YA 3VOZA 4E3MA 5FDHA 5GLAA 4E3KA 4Z9QA 1K56D 1LL5A 4GD6A 4K91A 2DRWA 3SH7A 1MBLA 2OV5A 4KQQA 2HDSA 4ZBEA 1XGIA 2GDNA 5E2EA 1EWZA 3SH9A 3O88A 1QMFA 1BT5A 3VP0A 2ZM8A 1BLCA 4E6XA 4PM9A 2QZ6A 2IWCA 2ZLYA 2XLNA 4KZ6A 4X68A 4GD8A 1WYCA 1W7FA 3Q82A 4HESA 5FI6A 1IKIA 3PBTA 4OKPA 4X69A 2Y2GA 3OC2A 4RA7A 3ITAA 1N4OA 5FA7A 1XX2A 4BL3A 4ZDXA 3HBRA 1GHMA 1HZOA 3BFGA 3LO7A 3PBRA 4KG6A 4OQHA 2UWXA 4HEFA 2Y2MA 4UA9A 4Y0OA 3SH8A 3SS4A 4PM8A 3O3VA 1DJBA 3ZVWA 4E3LA 5TR7A 3IQAA 1I2WA 3NDEA 4JXSA 1PW8A 2Y4AA 5DTSA 5L2FA 1L0FA 1U60A 1NJ4A 4KZ5A 3NY4A 4GNUA 2J7VA 4WBGA 4O7DA 3IT9A 5GL9A 3OPHA 4WZ5C 2P74A 4MBHA 5DTKA 3E2KA 3C7VA 4GKUA 3OCLA 4RX2A 4U0XA 4EUZA 2PU4A 5G18A 2JBFA 1LHYA 1FR1A 5F1GA 3LCEA
chains in the Genus database with same CATH superfamily
3S7OA 4QY6A 4MN7A 3A0VA 1CEGA 4IVIA 4WEJA 1EW0A 3UPPA 1ZG4A 4UA7A 3BQAA 5FI7A 1TS7A 1DJAA 3QP8A 1MWSA 1V9YA 2P08A 3QP1A 2Y2JA 4BBUA 2P7JA 4WF0A 4S2KA 5FSRA 1N9BA 3IX4A 2EX9A 3AGEA 3E0YA 3QP2A 2Y2NA 3LR0A 1SKOA 1G68A 3ZFZA 1ZKJA 2C5WB 2BASA 4JXVA 2OLUA 3C4OA 3UE6A 1L2SA 3GSGA 2Z6DA 4GLQA 4JGQA 3IHBA 3V50A 3KYZA 1GHIA 1TS8A 2GNXA 1WE4A 2V8CA 5AQ9A 1WA9A 3H82A 1P9WA 5AVEA 1IYPA 4L9GA 3LR4A 1W63M 5KSHA 1NRJA 4ZTKA 3IF6A 5J7EA 2CMNA 3KSHA 5FQQA 4UHUA 3VE4A 4PAUA 3NCKA 4RYEA 1YT4A 2V0WA 2WUQA 4KUKA 4HHDA 5AQ7A 4GHIA 4OOLA 3GMWA 4XUZA 3WRZA 1UWPX 1JNUA 3PYPA 4IBRA 3KX0X 1SDEA 2W3FA 3LIDA 2Z6CA 1E3UA 2XQZA 3F1NA 4DF6A 5FEFA 1K4EA 4S2IA 1RCJA 3NBLA 1XFQA 3G2ZA 1SKFA 4KZ8A 2L0WA 3IWIA 3VMAA 1A0KA 1O07A 2JHEA 3IXDA 1ODVA 4N1XA 2XH9A 3BECA 2I72A 3D3OA 4PHTA 3FC7A 1OTIA 3IS2B 1YLWA 4EBLA 3N7WA 5GHYA 4S2JA 5HWWA 4H8RA 4S2MA 3MF0A 4ME4A 4OP5A 3UB8A 1MPLA 3UDXA 3UPNA 3WS1A 5HL1A 2FFYA 3WWXA 3HUMA 2Y2LA 2QHKA 1TVFA 2ZC3B 2XDMA 5HFOA 1S1YA 2OLVA 4OOMA 4KENB 3V3SA 1KOUA 2QKPA 4EBNA 2XA7S 4OP8A 1S67L 2J9PA 4Y3IA 2X02A 3BM6A 3SS3A 3W4QA 2JKGA 2Y2KA 4GJ4A 4QHCA 4ARZB 4B4XA 1VEUB 1TS6A 5CGSA 2HJ9C 3IX3A 2Y2PA 1AXBA 4E3JA 3G6OA 3FKWA 3UMDA 1EI5A 3HLEA 4IVKA 3F1PB 3PBOA 4JF6A 3V3RA 3EEHA 3HREA 3OLOA 3LIEA 3TJZC 1XKZA 3LI8A 2JKFA 3DW0A 4YOFA 5CXWA 3CMZA 2WAEA 1Y4OA 1Y54A 5HX9A 2Y55A 1YSQA 4DJ2A 1YM1A 4YNRA 1N9NA 3CWFA 1YLJA 4X1LA 3ZCZA 1GHPA 1K6RA 3T4JA 2ZQ7A 4BENA 4ZAMA 3RXWA 4P0MA 3MQQA 3TOIA 3DTKA 5M19A 4LENA 3IXHA 2QJ5A 4PPRA 2VA0A 3FWLA 4Y0TA 2QJ7A 5E2GA 2ZM2A 3B47A 4K0WA 5HW3A 1PZPA 4OLDA 4IEDA 3LEZA 4E6WA 5TBMA 1N9LA 2X71A 3IBJA 2VGKA 4BMWA 2V9AA 3LGOA 3QHYA 1J9MA 3T4QA 1NWZA 4JXGA 5FAQA 1ESIA 3ZHHA 2IWDA 1FQGA 1G28A 3T1SA 5DF9A 3IXBA 4LV3A 3BW6A 4WZ5A 3CITA 2Z2LB 4JPMA 3BRMA 4PKYG 5HL6A 1TS0A 3FPVA 1K6SA 1TEMA 2ZC6B 4ID4A 3HVFA 1GA0A 5HWTA 3MZFA 4KZBA 4HBTA 5EVEA 5AJGA 5AVFA 1LSVA 3LEQA 2WKRA 1QMEA 4PKYA 3QNCA 4XT2A 1I5QA 1K57A 1H8ZA 2WKEA 2Y8HA 1PIOA 3JVVA 1ZC2A 4B4ZA 3FZCA 3G2YA 1YLZA 3PBSA 5CHUA 1Z6FA 4NG2A 2Q9NA 2WGIA 5DF7A 1K55A 1ERMA 4Q8IA 1C3BA 1E4DA 1MWUA 5HAPA 3TW8A 2VJWA 1JVJA 4UAAA 4UQIS 3UE0A 4Q0IA 4R23A 1KE0A 2MJ6A 4M3KA 4S2NC 3L9KA 1Y28A 3M2JA 1ESUA 3SS5A 4N9LA 2XR0A 4OLGA 2V0UA 4MBFA 1X0OA 1GSXA 2CC1A 2OSUA 3IWOA 1W8YA 4ZJ2A 4DE1A 3T1XA 4FTXA 2H28A 4DE0A 3UN7A 1KVMA 3G4PA 4JF4A 2WZXA 5TJJA 2EX6A 1GSVA 4GS9A 5FL3A 1IKGA 4DRTA 5FDHA 5FEGA 4Z9QA 4K91A 2DRWA 3T1QB 3D9YA 2HDSA 1EWZA 3SH9A 5MC7A 3VP0A 2QWSA 4PM9A 4X68A 4GD8A 1T19A 4Y13A 3Q82A 5FI6A 1LL8A 3PBTA 4RA7A 4ZDXA 4OQHA 4Y0OA 3ZVWA 3MFXA 5TR7A 4ZRRA 4IUKA 3RH8B 5CX7A 3F1OB 1U60A 3U2AA 3NY4A 5GL9A 5F68A 2D02A 4U0XA 4EUZA 4Y15A 4CPKA 1K54C 5D3OA 5HPIA 3DTEA 3P09A 4KG5A 1P0ZA 2QMIA 1PZOA 4X55A 4HBUA 5AQAA 1BYWA 1N9OA 3G32A 1KE4A 5DVAA 2PU2A 3A3IA 4FH2A 1SZVA 4HI4A 3BFCA 2R9XA 5HPFA 1ALQA 5G4ZA 4QJGA 3LICA 2L4RA 3QP4A 1IELA 2XSSA 1VM1A 5A93A 4EXOA 4EV4A 2PBDP 4OVDA 3UMEA 1XP4A 4NXEA 4C6YA 1XXMA 3W2ZA 3MXRA 2BG1A 1PFLA 5F69A 3KSIA 2P04A 3LIAA 2K31A 4KZ4A 4OPQA 2PR6A 3MBZA 3WS0A 2ZOIA 4EERA 2ZMFA 4GCZA 5U47A 1YKDA 3BWLA 1NZUA 2EWVA 1ES5A 2PD8A 2V8FA 4BJPA 3R4KA 2M1CA 3A0SA 5I94A 5CHMA 4OH0A 1FSWA 3P01A 3ZQ5A 1K56A 3CPTB 1UGUA 3IBRA 4EWFA 4N92A 1H8MA 1XJ3A 3MMHA 2ZM0A 4O01A 4S2PA 3ISGA 2Z2MB 5KMWA 3O86A 2VK3A 4I38A 3BFEA 1PRQA 1BULA 2J3WA 3IS2A 4Q0HA 2XROA 1GCEA 3KSFA 3T4OA 2V2FF 3PTEA 4Y0UA 5EE8A 3EGXC 3C4PA 2WAFA 2ACGA 2VGLM 3JVUA 5DFXA 5EUAA 1DP6A 1LSWA 3WS4A 3G35A 4D2OA 2HPBA 2JKTI 2O99A 1XGJA 3NHQA 4LCLA 1FR6A 4X1MA 1YMSA 4P6ZM 4X53A 2W3HA 3VE3A 2DNSA 1G6OA 4MMNA 4EBPA 1YPRA 2PYRA 4FCFA 4DE2A 1IEMA 1CQAA 3CG5A 3BFDA 3SZTA 3NJAA 1IYOA 4NKPA 5A91A 1SHVA 2HGVA 2H0YA 4EEUA 5EVID 1NRFA 3D4FA 2ZL1A 1LLBA 2PR5A 5CEDA 3CUEC 2WGWB 1FCOA 4LRXC 4X56A 2B95A 5EPHA 1OJGA 2EX2A 3LIBA 1S66L 3GR2A 2A49A 2INWA 1S6RA 4DN0A 1BZAA 5EFWA 1Q2PA 5DJTA 4DDYA 4KZAA 2WYXA 2I9VA 3NOPC 3DTMA 4R3JA 3MXQA 1T18A 2VGLS 5M1AA 3E2LA 2ZOHA 2EFUA 4WZ4A 2QPNA 1SCWA 5F6AA 3Q1FA 4LV1A 4WUJA 1DP9A 4MLLA 1FILA 4NETA 3MSHA 4QY5A 3HLBA 2ZMAA 1VETB 2JKRI 3ZVTA 3S7PA 3H7WA 3SOIA 3GECA 3VSKA 3IH8A 5EM1A 3AGDA 1F2KA 1V9ZA 3D72A 2EX8A 4O0PA 4S2LA 4PM5A 2EA9A 4MNRA 2FZ0A 1CEFA 2EXAA 3LY4A 2XD5A 2HDQA 4HY8A 2O9CA 2XK1A 2Q9MA 2Y2OA 1PWDA 2ZC5B 3Q7ZA 3PHYA 1T1CA 4NXGA 2A24B 2HJEA 4R3AA 2E8JA 1NLYA 5HSQA 3Q07A 2JN7A 3UB7A 3Q7VB 4F3LB 1PI4A 5L07A 2HDUA 4EEPA 4EUVA 2ZD8A 2R9WA 4KQOA 1PWGA 3HUNA 4LV2A 2RL3A 2KDKA 3C30A 3IX8A 3UDFA 2G2WA 4JLFA 4CLCA 5EVIC 3ZG8B 3QNBA 1P9RA 1PW1A 5IS1A 1D06A 3MZDA 3B3XA 1WYBA 2X01A 5DKLA 4I39A 4YFMA 2O0YA 1BSGA 2WKHA 1NLZA 5LBRA 2L1MA 1MKIA 4OONA 4I3JA 2Y91A 3LFVA 1BTLA 4GN2A 3WS5A 1OJ5A 4G3WA 3MS6A 4H6JB 2IWBA 4ETXA 4EW7A 3UB9A 3RXXA 3HCYA 2C6WB 1IYSA 1E25A 4G3KA 2H5SA 2PD7A 2V1ZA 4WL9A 1XFNA 5CERA 5L10A 3B42A 3T4TA 3MQ0A 4II7A 3TE8A 1FCMA 3OZHA 3H82B 3CLOA 1S4RA 2KX6A 4GDBA 1HD8A 1D7EA 4CQHA 1OT9A 2Y2QA 1HTZA 4KUOA 3S1YA 2FH5A 1K56D 4LFUA 3SH7A 1BT5A 2M7UA 5KIZA 3K3CA 2ZM8A 2ZLYA 3DBAA 4EETB 2K7SA 4GHIB 1W7FA 4HESA 4OKPA 4X69A 3OC2A 3ITAA 5FA7A 3F1OA 1XX2A 2VKSA 2KLIA 1HZOA 3BY9A 3LO7A 4KG6A 2UWXA 3F1NB 1I2WA 3T4SA 4LGWA 2Y4AA 5HDDA 1NJ4A 2D01A 2J80A 1H0MA 2XRNA 4HOIA 4RX2A 2W1TA 2PDRA 2JBFA 1LHYA 1FR1A 4HJ6A 2QYBA 5F1GA 5CTMA 3LCEA 3UE3A 4NXBA 5F1FA 5JYOA 4L0LA 3HLDA 3LI9A 2B18A 3R7WA 1MWTA 3LR5A 1KE3A 4OPRA 3DWZA 5DJUA 3W4OA 3PR6A 3NDGA 3O87A 3PBQA 2GZAA 3PAEA 4WMCA 1L0GA 2G2UA 2JE5A 5TGFA 1KGGA 4DXBA 4RQ9A 3IXGA 3VV4A 2JKRM 5J4EA 4Y7PA 2P9VA 3WRTA 4KZ7A 1XJ2A 4CJNA 4U3TA 1W5DA 4L9EA 4ZJ1A 2XGNA 3UDIA 2VV7A 4LRYC 3VSLA 3NI9A 2GX5A 2ZQDA 3BJNA 3PXPA 2PAVP 3E4QA 4S2OA 3UO9A 1JWVA 3Q81A 4R4SA 3IF5A 3I7JA 3T50A 3VOYA 3CPTA 2JCHA 3LUQA 3UY6A 2IA2A 4JGPA 4LCMA 1FCNA 4FD8A 2B5RA 1XJ6A 1XA7A 3GV9A 2R78A 4R0QA 4HP9A 5FI2A 2XEPA 3OPPA 3KYQA 2ZQAA 4GDNA 1OT6A 1XA1A 3HLWA 4JBFA 4PM6A 4NXFA 3UB6A 3ZNYA 5A8BA 1E3UD 2OWHA 4MN6A 1L3LA 1K25A 2OAP1 5I5LA 5J8XA 1LL9A 3C7UA 2WADA 1K38A 1F9IA 2PT7A 4QB8A 3IHAA 2V1AA 1OTAA 4P87A 4E04A 4ESPA 3UNWA 4FOFA 4WYYA 2Y59A 3RTYA 4I5SA 5EM0A 3LYXA 5FDSA 4ZJ3A 5EECA 2ZQ8A 4HH3A 4F94A 3MQOA 1JWZA 2HP6A 5TBMB 1BUEA 3V5MA 3NOTC 2VV6A 5HARA 4R6LA 4R38A 3ICYA 1KGFA 2LB9A 4EQ1A 2WGWA 3MKFA 2XD1A 3SW1A 3E4OA 1G5UA 2A2LA 4GB7A 4JKTA 3TG9A 4IBXA 1M6KA 5E2FA 5EV0A 2NUTC 4LV0A 3HL9A 1HLUP 3EQUA 5EVIB 4XXRA 1SDNA 2LB5A 4RVAA 4OQIA 4Z1WA 2J8YA 3BFFA 5CEBA 1LT0A 4R70A 1YSPA 4XT2B 3CZDA 1LI9A 4UEYA 4HJ4A 3VP2A 4NK3A 3S4XA 4DDSA 1DP8A 4X25A 3V67A 1VETA 3EGDC 3OCNA 1M40A 4Y2FA 3IF6C 4BLMA 1L0EA 1IYQA 3S7NA 3BY8A 4DXCA 5HDSA 2W3EA 3CI6A 5K5BA 1KGEA 3T4LA 2BLSA 3DAVA 2HF6A 1KVLA 1BLHA 1STZA 3NECA 2JC7A 3E98A 5F83A 2DCFA 1F5MA 3TSGA 3NC8A 3MZEA 2GJ3A 4BBTA 2G7UA 1ES4A 1IOUA 3K2NA 3QP5A 4WN5A 3VP4A 1T1BA 3EEAA 1MXOA 4GS9B 4QWOA 2ZC4B 4L9FA 5E2HA 3UE1A 4WM9A 3LIFA 2NUPC 1NZOA 1ES3A 2ZC7A 4MCWA 3Q7VA 4F3LA 2OWJA 1EROA 2OOLA 3IWQA 4AFIA 2H0TA 2YKHA 4B88A 2ZQ9A 1PNEA 1F98A 1ERQA 1PWCA 2EFXA 1D1JA 1K54A 3BLMA 4R3BA 2HV1A 3VP1A 2VZWA 5G4YA 4QPRA 4OPYA 4CLCC 4JGRA 4ARZA 1VEUA 3MKEA 4G3VA 4HJ3A 2W3DA 5DFYA 2WKQA 2K2NA 5IT5A 1K4FA 4WMCD 2PRFA 3T1RA 4PMAA 3JPUA 5A90A 3F1PA 3RFBA 4OOYA 4H6JA 3HLGA 1MY8A 2H10A 2PYPA 1GSWA 3A3EA 1TDLA 4WLAA 4KZ9A 5FQJA 3NULA 2W0NA 3KYEA 4IJGA 1UWNX 4HNBA 3P98A 3DTIA 4P6BA 5HDCA 4HP4A 4P6ZS 2V1BA 3FG8A 1BLPA 1MKMA 1YLYA 3C8CA 2AVXA 2VGJA 3ZG9B 2W3GA 1OMEA 4KZ3A 5GHXA 4BL2A 4E3MA 3VOZA 3B33A 1MBLA 2OV5A 4KQQA 4ZBEA 1XGIA 2XA7M 5E2EA 3O88A 1QMFA 2QZ6A 2XLNA 1IKIA 2ZMVA 4BL3A 3HBRA 3BFGA 3SH8A 3SS4A 4E3LA 1DJBA 3IQAA 3NDEA 4JXSA 2VV8A 5DTSA 2BTFP 1L0FA 2J3TD 4WBGA 4WZ5C 2P74A 4MBHA 5DTKA 3C38A 4BWIA 1CJFA 2PU4A 1FIKA 5G18A 1H5XA 3GQZA 1TDGA 3C2WA 4MBKA 2WZZA 3HUOA 3N8RA 2VEAA 3HLCA 3ZDJA 3RJUA 3MR0A 4PM7A 1AWIA 1W79A 5FATA 1W63Q 3VFHA 3O5YA 3PAGA 3TRCA 2HZ5A 2M7VA 1K57C 4E3IA 2EWWA 1NYYA 3PBNA 2WKPA 3NIAA 1CI9A 1KDSA 3CUEA 3N6IA 5CHJA 1H8YA 4LLOB 4DKIA 3VOLA 3MXSA 1LI0A 1NYMA 5EOOA 3UPOA 3S22A 1CF0A 2ZL1B 3CHWP 5CGWA 1K55C 4O8GA 1SKOB 5HAIA 2W27A 1YAXA 1PI5A 2A3UA 2O9AA 1LSXA 5FQKA 3OBFA 1ACFA 2ZQCA 2Y2IA 2O9BA 5F82A 2XFTA 3GTCA 4N9KA 2Q0OA 4GOGA 2V20A 3N8SA 4HQAA 1MZUA 5FQIA 3E4PA 5FAPA 3JYIA 2Y79A 1YQSA 2JKTM 3ZNTA 5HD3A 4GW9A 4LPZA 3ITBA 5HWVA 3NOUC 4BBVA 4JGOA 3IF6B 1H3QA 4KG2A 3V39A 3M2KA 1P97A 1KDWA 5EVLA 1J3WA 1O7EA 3BQ8A 3A0RA 3H7WB 3M6BA 3G30A 4DJ3A 4E3OA 3OPLA 1MWRA 3EQVA 4KQRA 4GZBA 3H9WA 5EOEA 3EOIA 5M18A 1OPXA 3EWKA 3FYZA 4HH2A 4DE3A 1XPBA 3T4KA 1JWPA 2OAQ1 1FSYA 1TF1A 2J3TC 4MN5A 3W4PA 5CGXA 5IU1A 3OOVA 4UQIM 5HD5A 3P7NA 5J3WA 5GLCA 5TFQA 5L09A 2XF3A 1DRMA 4C75A 1HVBA 3L7HA 1VQQA 1IFQA 1Z09A 1YMXA 5CRFA 4DMZA 5EVIA 4R1GA 5F5YA 2PHYA 4YWZA 3CJMA 2E8IA 3HLFA 1VHMA 2WK0A 4CLCB 4OQ0A 5FASA 1TD5A 3LY3A 4I3IA 4X6TA 3HJKA 4MDZA 4Q0JA 5A92A 1RGZA 4BD0A 3FKVA 4YINA 3ZG7B 3VP3A 4EESA 3G31A 3A3FA 2WGVA 3ZG5A 4BQMA 4QD4A 1JTGA 1Q2QA 4N1HA 4FSFA 4IHQA 5FQMA 3ZG0A 4LRZE 1I2SA 3MFDA 5GLBA 1NXYA 1S1ZA 4WELA 2ZBBA 1L0DA 1CI8A 1OTDA 4M4XA 5FQ9A 1ES2A 3ZGAB 1YLPA 2YKFA 4QU3A 5DTTA 5HAQA 2EXBA 5AQBA 4U0TA 4WEKA 5CECA 2J9OA 1FOFA 5HZHA 2XFSA 3A3JA 4BD1A 4XUXA 4E3NA 3K3DA 2VLGA 4I3AA 1DJCA 2ZJ9A 3N4IA 3W8KA 5FAOA 1ONHA 4HIAA 3WS2A 1DY6A 1ZG6A 3BEBA 3M6HA 3FPWA 1CK3A 4FUWA 1RGYA 3BLSA 2DMWA 4NEED 4JF5A 4D60A 3S7QA 1OTBA 1YLTA 3ZYTA 1GA9A 3KSGA 2WKIA 3N8LA 1PYYA 5IHVA 2RCXA 4A5RA 5DF8A 5GLDA 2W1TB 4CLCD 4B93A 1ZHHB 4UA6A 3C5AA 5CTNA 1NY0A 4OPZA 1K0KA 1G6AA 4FH4A 1S4SA 2W1RA 3R7WB 5KSCA 5BOHA 4RX3A 1ONGA 2HP9A 3U4LP 5DKKA 3FV7A 3HJIA 5C5KA 3BYDA 3OPRA 4P85A 5KZHA 4C3QA 2PBYA 2Y2HA 1MC0A 2UV0E 3AGFA 3G34A 5GHZA 4S2NA 1T1AA 1RP5A 3QP6A 2P9VB 4JXWA 1W8QA 3VFFA 2HP5A 4K08A 5E43A 4MEZA 4EQIA 4R4RA 4OQGA 4KQDA 3MJQA 3GRJA 3CAXA 4K0XA 3IH9A 3LR3A 5JYPA 3DWKA 2VX8A 3A3DA 1JTDA 2FFFB 3GVBA 2HDRA 1BLSA 1S0WA 5GLAA 4E3KA 1LL5A 4CLCE 4GD6A 4Y17A 1OTEA 4EU0A 2GDNA 1XJ4A 2A24A 1BLCA 4E6XA 2IWCA 3KO6A 4KZ6A 2KOIA 1WYCA 1ZTUA 2Y2GA 1N4OA 4Y5FA 3ULFA 1GHMA 3PBRA 4HEFA 2Y2MA 4UA9A 4PM8A 3O3VA 4ETZA 3UB5P 1PW8A 3T12B 5L8MA 4IUHA 5L2FA 4KZ5A 4GNUA 2J7VA 4O7DA 3IT9A 2B02A 3OPHA 3E2KA 3C7VA 4GKUA 3OCLA 1VB6A 3GDIA 4B9OA
chains in the Genus database with same CATH topology
3UE3A 1H5XA 4QY6A 4CPKA 5F1FA 3GQZA 5JYOA 1CEGA 1TDGA 4L0LA 1K54C 4MBKA 4IVIA 5D3OA 2WZZA 4WEJA 3HLDA 3P09A 3HUOA 4KG5A 3UPPA 1ZG4A 2QMIA 1MWTA 1PZOA 3N8RA 4X55A 1KE3A 3HLCA 4HBUA 4OPRA 5AQAA 3DWZA 4UA7A 3G32A 3W4OA 3ZDJA 5FI7A 3RJUA 1KE4A 5DVAA 1DJAA 2PU2A 4PM7A 3NDGA 3O87A 3PBQA 1W79A 5FATA 1MWSA 5CTMA 3VFHA 3A3IA 3PAEA 3PAGA 4WMCA 1L0GA 2Y2JA 4FH2A 2G2UA 1K57C 2JE5A 5TGFA 4E3IA 4S2KA 5FSRA 1NYYA 1N9BA 3BFCA 3PBNA 2R9XA 3NIAA 1CI9A 1ALQA 1KDSA 2EX9A 3AGEA 1KGGA 4QJGA 4DXBA 5CHJA 3IXGA 1IELA 3N6IA 1H8YA 1VM1A 2Y2NA 5A93A 4DKIA 4EV4A 4Y7PA 1G68A 3MXSA 3ZFZA 4OVDA 1LI0A 1ZKJA 1NYMA 1XP4A 2C5WB 2P9VA 5EOOA 3UPOA 4JXVA 2OLUA 3C4OA 4KZ7A 1L2SA 3GSGA 3WRTA 4C6YA 1XXMA 3S22A 4CJNA 4U3TA 1W5DA 3MXRA 3IHBA 4ZJ1A 2BG1A 5CGWA 3V50A 2XGNA 1GHIA 1K55C 3UDIA 5HAIA 3VSLA 1WE4A 1PI5A 3NI9A 2A3UA 5AQ9A 2ZQDA 5FQKA 4KZ4A 4S2OA 4OPQA 3UO9A 1IYPA 2ZQCA 2Y2IA 1JWVA 5F82A 3MBZA 2XFTA 3Q81A 3WS0A 4R4SA 3GTCA 4N9KA 3IF5A 5KSHA 4GOGA 3I7JA 5U47A 2V20A 3N8SA 4ZTKA 1NZUA 5FQIA 3IF6A 5FAPA 3VOYA 2JCHA 1ES5A 3JYIA 3UY6A 4LCMA 4BJPA 1FCNA 5FQQA 1YQSA 4UHUA 4FD8A 3ZNTA 3NCKA 4RYEA 1YT4A 2B5RA 3ITBA 5I94A 5CHMA 2WUQA 4OH0A 1FSWA 5AQ7A 1XA7A 1K56A 3IF6B 4KG2A 3V39A 3GV9A 4OOLA 3GMWA 3M2KA 4R0QA 4XUZA 5FI2A 3WRZA 4EWFA 4N92A 2XEPA 3OPPA 2ZM0A 2ZQAA 4GDNA 1KDWA 3HLWA 1XA1A 5EVLA 4IBRA 4JBFA 4PM6A 4S2PA 1SDEA 3ISGA 2Z2MB 5KMWA 1O7EA 3O86A 3ZNYA 1E3UA 2XQZA 1E3UD 3BFEA 4DF6A 1K4EA 4S2IA 1RCJA 3M6BA 3G30A 1K25A 4E3OA 1BULA 3NBLA 3G2ZA 5J8XA 1SKFA 4KZ8A 3OPLA 1MWRA 3IWIA 1LL9A 1O07A 3EQVA 3VMAA 4KQRA 3C7UA 2WADA 4GZBA 3IXDA 5EOEA 1K38A 1GCEA 4QB8A 5M18A 4N1XA 2XH9A 3BECA 3FYZA 2V2FF 4DE3A 1XPBA 2I72A 3IHAA 3PTEA 4Y0UA 5EE8A 3C4PA 2WAFA 1JWPA 5EUAA 4P87A 1FSYA 4EBLA 1YLWA 3UNWA 3W4PA 3WS4A 3N7WA 5CGXA 3G35A 4WYYA 4D2OA 2HPBA 2Y59A 4LCLA 1XGJA 5GHYA 1FR6A 4S2JA 1YMSA 4ZJ3A 4H8RA 4S2MA 2ZQ8A 5EECA 4F94A 4X53A 1JWZA 4OP5A 2DNSA 2HP6A 4EBPA 4FCFA 4DE2A 1MPLA 1IEMA 5GLCA 1BUEA 5TFQA 3V5MA 3UDXA 5HARA 2XF3A 3UPNA 3CG5A 3WS1A 4C75A 1HVBA 5HL1A 2FFYA 3BFDA 3HUMA 3WWXA 2Y2LA 1VQQA 1KGFA 1IYOA 1YMXA 1TVFA 5A91A 1SHVA 2WGWA 2ZC3B 3MKFA 2XD1A 2XDMA 5CRFA 5HFOA 2H0YA 4GB7A 5EVIA 2OLVA 4OOMA 5EVID 4R1GA 1NRFA 4KENB 4JKTA 3V3SA 3D4FA 3TG9A 4IBXA 1M6KA 4EBNA 5E2FA 1LLBA 3CJMA 2E8IA 3HLFA 5CEDA 2WGWB 4OP8A 1FCOA 4X56A 4LV0A 3HL9A 2J9PA 2WK0A 3EQUA 5EPHA 5EVIB 4OQ0A 2X02A 2EX2A 3BM6A 1SDNA 4XXRA 4RVAA 3GR2A 3SS3A 4OQIA 3W4QA 2A49A 1S6RA 2Y2KA 4B4XA 4QHCA 5FASA 2J8YA 3BFFA 5CEBA 1BZAA 5CGSA 3LY3A 1Q2PA 2Y2PA 1AXBA 4E3JA 4X6TA 4DDYA 3CZDA 1LI9A 3VP2A 3FKWA 4KZAA 4NK3A 2WYXA 1EI5A 3S4XA 5A92A 3HLEA 3DTMA 4IVKA 4R3JA 4DDSA 1RGZA 4BD0A 3PBOA 4JF6A 3V3RA 3HREA 3FKVA 5M1AA 4YINA 3E2LA 3ZG7B 3VP3A 3OCNA 3G31A 1XKZA 3A3FA 2EFUA 2WGVA 2QPNA 1M40A 1SCWA 3DW0A 4WZ4A 3IF6C 3Q1FA 4LV1A 3CMZA 5CXWA 3ZG5A 2WAEA 4BLMA 1L0EA 4MLLA 4QD4A 1JTGA 4BQMA 1IYQA 1Q2QA 1Y54A 4N1HA 4NETA 5HX9A 2Y55A 4FSFA 4QY5A 3HLBA 4DXCA 5FQMA 1KGEA 1YM1A 2ZMAA 3ZG0A 1I2SA 3ZVTA 3MFDA 5GLBA 1NXYA 2BLSA 1YLJA 1KVLA 4WELA 1BLHA 1L0DA 1CI8A 3SOIA 3ZCZA 1GHPA 1K6RA 5FQ9A 2JC7A 2ZQ7A 1ES2A 4BENA 4ZAMA 3ZGAB 1YLPA 3VSKA 3RXWA 4P0MA 4QU3A 5F83A 5DTTA 5HAQA 2DCFA 3IH8A 3TOIA 3AGDA 3TSGA 5M19A 2EXBA 3MZEA 3IXHA 3NC8A 4LENA 4U0TA 5AQBA 4WEKA 5CECA 2J9OA 1FOFA 4PPRA 1ES4A 3VP4A 2EX8A 3FWLA 4S2LA 4Y0TA 4PM5A 5E2GA 4MNRA 2XFSA 1CEFA 1MXOA 2EXAA 2ZM2A 3A3JA 3LY4A 4K0WA 2XD5A 2HDQA 2ZC4B 5HW3A 4BD1A 4XUXA 1PZPA 4E3NA 5E2HA 4OLDA 1DJCA 4IEDA 2ZJ9A 3N4IA 3UE1A 3LEZA 4WM9A 5FAOA 3W8KA 2XK1A 4E6WA 1ONHA 3WS2A 2X71A 2VGKA 1NZOA 1ES3A 1DY6A 2Q9MA 1ZG6A 1PWDA 2Y2OA 2ZC7A 3BEBA 3M6HA 3QHYA 1J9MA 3Q7VA 2ZC5B 3Q7ZA 1CK3A 1RGYA 4JXGA 3BLSA 5FAQA 1ESIA 3ZHHA 2IWDA 1FQGA 1EROA 4JF5A 5DF9A 3IWQA 3IXBA 1YLTA 3Q07A 4LV3A 1GA9A 4WZ5A 2H0TA 4B88A 3Q7VB 4JPMA 2Z2LB 3BRMA 2ZQ9A 2WKIA 1PI4A 3N8LA 2HDUA 1ERQA 1PWCA 2ZD8A 2R9WA 2EFXA 4KQOA 1PWGA 3HUNA 4LV2A 2RL3A 1K54A 1K6SA 1PYYA 1TEMA 2ZC6B 3BLMA 4ID4A 2RCXA 4R3BA 5IHVA 3UDFA 3HVFA 2G2WA 1GA0A 3MZFA 3VP1A 4KZBA 4JLFA 4HBTA 4A5RA 5DF8A 5GLDA 4UA6A 3C5AA 4OPYA 5EVIC 5CTNA 1NY0A 3ZG8B 3QNBA 3MKEA 4OPZA 1QMEA 1PW1A 1G6AA 3MZDA 3QNCA 4FH4A 1I5QA 1K57A 3B3XA 1H8ZA 1K4FA 4WMCD 2WKEA 1WYBA 2X01A 5BOHA 5KSCA 4PMAA 4RX3A 5A90A 1ONGA 2HP9A 4YFMA 1BSGA 1PIOA 2WKHA 3FV7A 3BYDA 3OPRA 4OOYA 4P85A 1MKIA 3HLGA 5KZHA 4OONA 1ZC2A 4B4ZA 4C3QA 3FZCA 1MY8A 2H10A 1YLZA 2PBYA 2Y2HA 2Y91A 3A3EA 3G2YA 1TDLA 3PBSA 5CHUA 1BTLA 1Z6FA 4KZ9A 4GN2A 3WS5A 3AGFA 2Q9NA 2WGIA 5DF7A 5FQJA 3G34A 1K55A 1ERMA 3P98A 2IWBA 4Q8IA 1C3BA 1E4DA 1MWUA 2C6WB 3RXXA 5HAPA 1IYSA 5GHZA 1E25A 1JVJA 4S2NA 4UAAA 4P6BA 3UE0A 1RP5A 4R23A 1KE0A 2P9VB 4JXWA 1W8QA 3VFFA 4M3KA 4S2NC 1BLPA 3M2JA 1ESUA 2HP5A 3SS5A 4N9LA 2XR0A 4OLGA 4MBFA 4DE1A 2CC1A 2OSUA 3IWOA 5E43A 1W8YA 1YLYA 2H5SA 4MEZA 4ZJ2A 2V1ZA 4R4RA 4EQIA 4OQGA 4DE0A 3UN7A 5CERA 1KVMA 3GRJA 3G4PA 4K0XA 2VGJA 4JF4A 3IH9A 1FCMA 3OZHA 5JYPA 3ZG9B 2WZXA 3DWKA 3A3DA 1JTDA 2FFFB 1OMEA 2EX6A 3GVBA 4GDBA 1HD8A 4KZ3A 2HDRA 1IKGA 4DRTA 5GHXA 4BL2A 2Y2QA 1HTZA 1BLSA 1S0WA 3S1YA 3VOZA 4E3MA 5FDHA 5GLAA 4E3KA 4Z9QA 1K56D 1LL5A 4GD6A 4K91A 2DRWA 3SH7A 1MBLA 2OV5A 4KQQA 2HDSA 4ZBEA 1XGIA 2GDNA 5E2EA 1EWZA 3SH9A 3O88A 1QMFA 1BT5A 3VP0A 2ZM8A 1BLCA 4E6XA 4PM9A 2QZ6A 2IWCA 2ZLYA 2XLNA 4KZ6A 4X68A 4GD8A 1WYCA 1W7FA 3Q82A 4HESA 5FI6A 1IKIA 3PBTA 4OKPA 4X69A 2Y2GA 3OC2A 4RA7A 3ITAA 1N4OA 5FA7A 1XX2A 4BL3A 4ZDXA 3HBRA 1GHMA 1HZOA 3BFGA 3LO7A 3PBRA 4KG6A 4OQHA 2UWXA 4HEFA 2Y2MA 4UA9A 4Y0OA 3SH8A 3SS4A 4PM8A 3O3VA 1DJBA 3ZVWA 4E3LA 5TR7A 3IQAA 1I2WA 3NDEA 4JXSA 1PW8A 2Y4AA 5DTSA 5L2FA 1L0FA 1U60A 1NJ4A 4KZ5A 3NY4A 4GNUA 2J7VA 4WBGA 4O7DA 3IT9A 5GL9A 3OPHA 4WZ5C 2P74A 4MBHA 5DTKA 3E2KA 3C7VA 4GKUA 3OCLA 4RX2A 4U0XA 4EUZA 2PU4A 5G18A 2JBFA 1LHYA 1FR1A 5F1GA 3LCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UE3 A;  1H5X A;  4QY6 A;  4CPK A;  5F1F A;  3GQZ A;  5JYO A;  1CEG A;  1TDG A;  4L0L A;  1K54 C;  4MBK A;  4IVI A;  5D3O A;  2WZZ A;  4WEJ A;  3HLD A;  3P09 A;  3HUO A;  4KG5 A;  3UPP A;  1ZG4 A;  2QMI A;  1MWT A;  1PZO A;  3N8R A;  4X55 A;  1KE3 A;  3HLC A;  4HBU A;  4OPR A;  5AQA A;  3DWZ A;  4UA7 A;  3G32 A;  3W4O A;  3ZDJ A;  5FI7 A;  3RJU A;  1KE4 A;  5DVA A;  1DJA A;  2PU2 A;  4PM7 A;  3NDG A;  3O87 A;  3PBQ A;  1W79 A;  5FAT A;  1MWS A;  5CTM A;  3VFH A;  3A3I A;  3PAE A;  3PAG A;  4WMC A;  1L0G A;  2Y2J A;  4FH2 A;  2G2U A;  1K57 C;  2JE5 A;  5TGF A;  4E3I A;  4S2K A;  5FSR A;  1NYY A;  1N9B A;  3BFC A;  3PBN A;  2R9X A;  3NIA A;  1CI9 A;  1ALQ A;  1KDS A;  2EX9 A;  3AGE A;  1KGG A;  4QJG A;  4DXB A;  5CHJ A;  3IXG A;  1IEL A;  3N6I A;  1H8Y A;  1VM1 A;  2Y2N A;  5A93 A;  4DKI A;  4EV4 A;  4Y7P A;  1G68 A;  3MXS A;  3ZFZ A;  4OVD A;  1LI0 A;  1ZKJ A;  1NYM A;  1XP4 A;  2C5W B;  2P9V A;  5EOO A;  3UPO A;  4JXV A;  2OLU A;  3C4O A;  4KZ7 A;  1L2S A;  3GSG A;  3WRT A;  4C6Y A;  1XXM A;  3S22 A;  4CJN A;  4U3T A;  1W5D A;  3MXR A;  3IHB A;  4ZJ1 A;  2BG1 A;  5CGW A;  3V50 A;  2XGN A;  1GHI A;  1K55 C;  3UDI A;  5HAI A;  3VSL A;  1WE4 A;  1PI5 A;  3NI9 A;  2A3U A;  5AQ9 A;  2ZQD A;  5FQK A;  4KZ4 A;  4S2O A;  4OPQ A;  3UO9 A;  1IYP A;  2ZQC A;  2Y2I A;  1JWV A;  5F82 A;  3MBZ A;  2XFT A;  3Q81 A;  3WS0 A;  4R4S A;  3GTC A;  4N9K A;  3IF5 A;  5KSH A;  4GOG A;  3I7J A;  5U47 A;  2V20 A;  3N8S A;  4ZTK A;  1NZU A;  5FQI A;  3IF6 A;  5FAP A;  3VOY A;  2JCH A;  1ES5 A;  3JYI A;  3UY6 A;  4LCM A;  4BJP A;  1FCN A;  5FQQ A;  1YQS A;  4UHU A;  4FD8 A;  3ZNT A;  3NCK A;  4RYE A;  1YT4 A;  2B5R A;  3ITB A;  5I94 A;  5CHM A;  2WUQ A;  4OH0 A;  1FSW A;  5AQ7 A;  1XA7 A;  1K56 A;  3IF6 B;  4KG2 A;  3V39 A;  3GV9 A;  4OOL A;  3GMW A;  3M2K A;  4R0Q A;  4XUZ A;  5FI2 A;  3WRZ A;  4EWF A;  4N92 A;  2XEP A;  3OPP A;  2ZM0 A;  2ZQA A;  4GDN A;  1KDW A;  3HLW A;  1XA1 A;  5EVL A;  4IBR A;  4JBF A;  4PM6 A;  4S2P A;  1SDE A;  3ISG A;  2Z2M B;  5KMW A;  1O7E A;  3O86 A;  3ZNY A;  1E3U A;  2XQZ A;  1E3U D;  3BFE A;  4DF6 A;  1K4E A;  4S2I A;  1RCJ A;  3M6B A;  3G30 A;  1K25 A;  4E3O A;  1BUL A;  3NBL A;  3G2Z A;  5J8X A;  1SKF A;  4KZ8 A;  3OPL A;  1MWR A;  3IWI A;  1LL9 A;  1O07 A;  3EQV A;  3VMA A;  4KQR A;  3C7U A;  2WAD A;  4GZB A;  3IXD A;  5EOE A;  1K38 A;  1GCE A;  4QB8 A;  5M18 A;  4N1X A;  2XH9 A;  3BEC A;  3FYZ A;  2V2F F;  4DE3 A;  1XPB A;  2I72 A;  3IHA A;  3PTE A;  4Y0U A;  5EE8 A;  3C4P A;  2WAF A;  1JWP A;  5EUA A;  4P87 A;  1FSY A;  4EBL A;  1YLW A;  3UNW A;  3W4P A;  3WS4 A;  3N7W A;  5CGX A;  3G35 A;  4WYY A;  4D2O A;  2HPB A;  2Y59 A;  4LCL A;  1XGJ A;  5GHY A;  1FR6 A;  4S2J A;  1YMS A;  4ZJ3 A;  4H8R A;  4S2M A;  2ZQ8 A;  5EEC A;  4F94 A;  4X53 A;  1JWZ A;  4OP5 A;  2DNS A;  2HP6 A;  4EBP A;  4FCF A;  4DE2 A;  1MPL A;  1IEM A;  5GLC A;  1BUE A;  5TFQ A;  3V5M A;  3UDX A;  5HAR A;  2XF3 A;  3UPN A;  3CG5 A;  3WS1 A;  4C75 A;  1HVB A;  5HL1 A;  2FFY A;  3BFD A;  3HUM A;  3WWX A;  2Y2L A;  1VQQ A;  1KGF A;  1IYO A;  1YMX A;  1TVF A;  5A91 A;  1SHV A;  2WGW A;  2ZC3 B;  3MKF A;  2XD1 A;  2XDM A;  5CRF A;  5HFO A;  2H0Y A;  4GB7 A;  5EVI A;  2OLV A;  4OOM A;  5EVI D;  4R1G A;  1NRF A;  4KEN B;  4JKT A;  3V3S A;  3D4F A;  3TG9 A;  4IBX A;  1M6K A;  4EBN A;  5E2F A;  1LLB A;  3CJM A;  2E8I A;  3HLF A;  5CED A;  2WGW B;  4OP8 A;  1FCO A;  4X56 A;  4LV0 A;  3HL9 A;  2J9P A;  2WK0 A;  3EQU A;  5EPH A;  5EVI B;  4OQ0 A;  2X02 A;  2EX2 A;  3BM6 A;  1SDN A;  4XXR A;  4RVA A;  3GR2 A;  3SS3 A;  4OQI A;  3W4Q A;  2A49 A;  1S6R A;  2Y2K A;  4B4X A;  4QHC A;  5FAS A;  2J8Y A;  3BFF A;  5CEB A;  1BZA A;  5CGS A;  3LY3 A;  1Q2P A;  2Y2P A;  1AXB A;  4E3J A;  4X6T A;  4DDY A;  3CZD A;  1LI9 A;  3VP2 A;  3FKW A;  4KZA A;  4NK3 A;  2WYX A;  1EI5 A;  3S4X A;  5A92 A;  3HLE A;  3DTM A;  4IVK A;  4R3J A;  4DDS A;  1RGZ A;  4BD0 A;  3PBO A;  4JF6 A;  3V3R A;  3HRE A;  3FKV A;  5M1A A;  4YIN A;  3E2L A;  3ZG7 B;  3VP3 A;  3OCN A;  3G31 A;  1XKZ A;  3A3F A;  2EFU A;  2WGV A;  2QPN A;  1M40 A;  1SCW A;  3DW0 A;  4WZ4 A;  3IF6 C;  3Q1F A;  4LV1 A;  3CMZ A;  5CXW A;  3ZG5 A;  2WAE A;  4BLM A;  1L0E A;  4MLL A;  4QD4 A;  1JTG A;  4BQM A;  1IYQ A;  1Q2Q A;  1Y54 A;  4N1H A;  4NET A;  5HX9 A;  2Y55 A;  4FSF A;  4QY5 A;  3HLB A;  4DXC A;  5FQM A;  1KGE A;  1YM1 A;  2ZMA A;  3ZG0 A;  1I2S A;  3ZVT A;  3MFD A;  5GLB A;  1NXY A;  2BLS A;  1YLJ A;  1KVL A;  4WEL A;  1BLH A;  1L0D A;  1CI8 A;  3SOI A;  3ZCZ A;  1GHP A;  1K6R A;  5FQ9 A;  2JC7 A;  2ZQ7 A;  1ES2 A;  4BEN A;  4ZAM A;  3ZGA B;  1YLP A;  3VSK A;  3RXW A;  4P0M A;  4QU3 A;  5F83 A;  5DTT A;  5HAQ A;  2DCF A;  3IH8 A;  3TOI A;  3AGD A;  3TSG A;  5M19 A;  2EXB A;  3MZE A;  3IXH A;  3NC8 A;  4LEN A;  4U0T A;  5AQB A;  4WEK A;  5CEC A;  2J9O A;  1FOF A;  4PPR A;  1ES4 A;  3VP4 A;  2EX8 A;  3FWL A;  4S2L A;  4Y0T A;  4PM5 A;  5E2G A;  4MNR A;  2XFS A;  1CEF A;  1MXO A;  2EXA A;  2ZM2 A;  3A3J A;  3LY4 A;  4K0W A;  2XD5 A;  2HDQ A;  2ZC4 B;  5HW3 A;  4BD1 A;  4XUX A;  1PZP A;  4E3N A;  5E2H A;  4OLD A;  1DJC A;  4IED A;  2ZJ9 A;  3N4I A;  3UE1 A;  3LEZ A;  4WM9 A;  5FAO A;  3W8K A;  2XK1 A;  4E6W A;  1ONH A;  3WS2 A;  2X71 A;  2VGK A;  1NZO A;  1ES3 A;  1DY6 A;  2Q9M A;  1ZG6 A;  1PWD A;  2Y2O A;  2ZC7 A;  3BEB A;  3M6H A;  3QHY A;  1J9M A;  3Q7V A;  2ZC5 B;  3Q7Z A;  1CK3 A;  1RGY A;  4JXG A;  3BLS A;  5FAQ A;  1ESI A;  3ZHH A;  2IWD A;  1FQG A;  1ERO A;  4JF5 A;  5DF9 A;  3IWQ A;  3IXB A;  1YLT A;  3Q07 A;  4LV3 A;  1GA9 A;  4WZ5 A;  2H0T A;  4B88 A;  3Q7V B;  4JPM A;  2Z2L B;  3BRM A;  2ZQ9 A;  2WKI A;  1PI4 A;  3N8L A;  2HDU A;  1ERQ A;  1PWC A;  2ZD8 A;  2R9W A;  2EFX A;  4KQO A;  1PWG A;  3HUN A;  4LV2 A;  2RL3 A;  1K54 A;  1K6S A;  1PYY A;  1TEM A;  2ZC6 B;  3BLM A;  4ID4 A;  2RCX A;  4R3B A;  5IHV A;  3UDF A;  3HVF A;  2G2W A;  1GA0 A;  3MZF A;  3VP1 A;  4KZB A;  4JLF A;  4HBT A;  4A5R A;  5DF8 A;  5GLD A;  4UA6 A;  3C5A A;  4OPY A;  5EVI C;  5CTN A;  1NY0 A;  3ZG8 B;  3QNB A;  3MKE A;  4OPZ A;  1QME A;  1PW1 A;  1G6A A;  3MZD A;  3QNC A;  4FH4 A;  1I5Q A;  1K57 A;  3B3X A;  1H8Z A;  1K4F A;  4WMC D;  2WKE A;  1WYB A;  2X01 A;  5BOH A;  5KSC A;  4PMA A;  4RX3 A;  5A90 A;  1ONG A;  2HP9 A;  4YFM A;  1BSG A;  1PIO A;  2WKH A;  3FV7 A;  3BYD A;  3OPR A;  4OOY A;  4P85 A;  1MKI A;  3HLG A;  5KZH A;  4OON A;  1ZC2 A;  4B4Z A;  4C3Q A;  3FZC A;  1MY8 A;  2H10 A;  1YLZ A;  2PBY A;  2Y2H A;  2Y91 A;  3A3E A;  3G2Y A;  1TDL A;  3PBS A;  5CHU A;  1BTL A;  1Z6F A;  4KZ9 A;  4GN2 A;  3WS5 A;  3AGF A;  2Q9N A;  2WGI A;  5DF7 A;  5FQJ A;  3G34 A;  1K55 A;  1ERM A;  3P98 A;  2IWB A;  4Q8I A;  1C3B A;  1E4D A;  1MWU A;  2C6W B;  3RXX A;  5HAP A;  1IYS A;  5GHZ A;  1E25 A;  1JVJ A;  4S2N A;  4UAA A;  4P6B A;  3UE0 A;  1RP5 A;  4R23 A;  1KE0 A;  2P9V B;  4JXW A;  1W8Q A;  3VFF A;  4M3K A;  4S2N C;  1BLP A;  3M2J A;  1ESU A;  2HP5 A;  3SS5 A;  4N9L A;  2XR0 A;  4OLG A;  4MBF A;  4DE1 A;  2CC1 A;  2OSU A;  3IWO A;  5E43 A;  1W8Y A;  1YLY A;  2H5S A;  4MEZ A;  4ZJ2 A;  2V1Z A;  4R4R A;  4EQI A;  4OQG A;  4DE0 A;  3UN7 A;  5CER A;  1KVM A;  3GRJ A;  3G4P A;  4K0X A;  2VGJ A;  4JF4 A;  3IH9 A;  1FCM A;  3OZH A;  5JYP A;  3ZG9 B;  2WZX A;  3DWK A;  3A3D A;  1JTD A;  2FFF B;  1OME A;  2EX6 A;  3GVB A;  4GDB A;  1HD8 A;  4KZ3 A;  2HDR A;  1IKG A;  4DRT A;  5GHX A;  4BL2 A;  2Y2Q A;  1HTZ A;  1BLS A;  1S0W A;  3S1Y A;  3VOZ A;  4E3M A;  5FDH A;  5GLA A;  4E3K A;  4Z9Q A;  1K56 D;  1LL5 A;  4GD6 A;  4K91 A;  2DRW A;  3SH7 A;  1MBL A;  2OV5 A;  4KQQ A;  2HDS A;  4ZBE A;  1XGI A;  2GDN A;  5E2E A;  1EWZ A;  3SH9 A;  3O88 A;  1QMF A;  1BT5 A;  3VP0 A;  2ZM8 A;  1BLC A;  4E6X A;  4PM9 A;  2QZ6 A;  2IWC A;  2ZLY A;  2XLN A;  4KZ6 A;  4X68 A;  4GD8 A;  1WYC A;  1W7F A;  3Q82 A;  4HES A;  5FI6 A;  1IKI A;  3PBT A;  4OKP A;  4X69 A;  2Y2G A;  3OC2 A;  4RA7 A;  3ITA A;  1N4O A;  5FA7 A;  1XX2 A;  4BL3 A;  4ZDX A;  3HBR A;  1GHM A;  1HZO A;  3BFG A;  3LO7 A;  3PBR A;  4KG6 A;  4OQH A;  2UWX A;  4HEF A;  2Y2M A;  4UA9 A;  4Y0O A;  3SH8 A;  3SS4 A;  4PM8 A;  3O3V A;  1DJB A;  3ZVW A;  4E3L A;  5TR7 A;  3IQA A;  1I2W A;  3NDE A;  4JXS A;  1PW8 A;  2Y4A A;  5DTS A;  5L2F A;  1L0F A;  1U60 A;  1NJ4 A;  4KZ5 A;  3NY4 A;  4GNU A;  2J7V A;  4WBG A;  4O7D A;  3IT9 A;  5GL9 A;  3OPH A;  4WZ5 C;  2P74 A;  4MBH A;  5DTK A;  3E2K A;  3C7V A;  4GKU A;  3OCL A;  4RX2 A;  4U0X A;  4EUZ A;  2PU4 A;  5G18 A;  2JBF A;  1LHY A;  1FR1 A;  5F1G A;  3LCE A; 
#chains in the Genus database with same CATH topology
 3S7O A;  4QY6 A;  4MN7 A;  3A0V A;  1CEG A;  4IVI A;  4WEJ A;  1EW0 A;  3UPP A;  1ZG4 A;  4UA7 A;  3BQA A;  5FI7 A;  1TS7 A;  1DJA A;  3QP8 A;  1MWS A;  1V9Y A;  2P08 A;  3QP1 A;  2Y2J A;  4BBU A;  2P7J A;  4WF0 A;  4S2K A;  5FSR A;  1N9B A;  3IX4 A;  2EX9 A;  3AGE A;  3E0Y A;  3QP2 A;  2Y2N A;  3LR0 A;  1SKO A;  1G68 A;  3ZFZ A;  1ZKJ A;  2C5W B;  2BAS A;  4JXV A;  2OLU A;  3C4O A;  3UE6 A;  1L2S A;  3GSG A;  2Z6D A;  4GLQ A;  4JGQ A;  3IHB A;  3V50 A;  3KYZ A;  1GHI A;  1TS8 A;  2GNX A;  1WE4 A;  2V8C A;  5AQ9 A;  1WA9 A;  3H82 A;  1P9W A;  5AVE A;  1IYP A;  4L9G A;  3LR4 A;  1W63 M;  5KSH A;  1NRJ A;  4ZTK A;  3IF6 A;  5J7E A;  2CMN A;  3KSH A;  5FQQ A;  4UHU A;  3VE4 A;  4PAU A;  3NCK A;  4RYE A;  1YT4 A;  2V0W A;  2WUQ A;  4KUK A;  4HHD A;  5AQ7 A;  4GHI A;  4OOL A;  3GMW A;  4XUZ A;  3WRZ A;  1UWP X;  1JNU A;  3PYP A;  4IBR A;  3KX0 X;  1SDE A;  2W3F A;  3LID A;  2Z6C A;  1E3U A;  2XQZ A;  3F1N A;  4DF6 A;  5FEF A;  1K4E A;  4S2I A;  1RCJ A;  3NBL A;  1XFQ A;  3G2Z A;  1SKF A;  4KZ8 A;  2L0W A;  3IWI A;  3VMA A;  1A0K A;  1O07 A;  2JHE A;  3IXD A;  1ODV A;  4N1X A;  2XH9 A;  3BEC A;  2I72 A;  3D3O A;  4PHT A;  3FC7 A;  1OTI A;  3IS2 B;  1YLW A;  4EBL A;  3N7W A;  5GHY A;  4S2J A;  5HWW A;  4H8R A;  4S2M A;  3MF0 A;  4ME4 A;  4OP5 A;  3UB8 A;  1MPL A;  3UDX A;  3UPN A;  3WS1 A;  5HL1 A;  2FFY A;  3WWX A;  3HUM A;  2Y2L A;  2QHK A;  1TVF A;  2ZC3 B;  2XDM A;  5HFO A;  1S1Y A;  2OLV A;  4OOM A;  4KEN B;  3V3S A;  1KOU A;  2QKP A;  4EBN A;  2XA7 S;  4OP8 A;  1S67 L;  2J9P A;  4Y3I A;  2X02 A;  3BM6 A;  3SS3 A;  3W4Q A;  2JKG A;  2Y2K A;  4GJ4 A;  4QHC A;  4ARZ B;  4B4X A;  1VEU B;  1TS6 A;  5CGS A;  2HJ9 C;  3IX3 A;  2Y2P A;  1AXB A;  4E3J A;  3G6O A;  3FKW A;  3UMD A;  1EI5 A;  3HLE A;  4IVK A;  3F1P B;  3PBO A;  4JF6 A;  3V3R A;  3EEH A;  3HRE A;  3OLO A;  3LIE A;  3TJZ C;  1XKZ A;  3LI8 A;  2JKF A;  3DW0 A;  4YOF A;  5CXW A;  3CMZ A;  2WAE A;  1Y4O A;  1Y54 A;  5HX9 A;  2Y55 A;  1YSQ A;  4DJ2 A;  1YM1 A;  4YNR A;  1N9N A;  3CWF A;  1YLJ A;  4X1L A;  3ZCZ A;  1GHP A;  1K6R A;  3T4J A;  2ZQ7 A;  4BEN A;  4ZAM A;  3RXW A;  4P0M A;  3MQQ A;  3TOI A;  3DTK A;  5M19 A;  4LEN A;  3IXH A;  2QJ5 A;  4PPR A;  2VA0 A;  3FWL A;  4Y0T A;  2QJ7 A;  5E2G A;  2ZM2 A;  3B47 A;  4K0W A;  5HW3 A;  1PZP A;  4OLD A;  4IED A;  3LEZ A;  4E6W A;  5TBM A;  1N9L A;  2X71 A;  3IBJ A;  2VGK A;  4BMW A;  2V9A A;  3LGO A;  3QHY A;  1J9M A;  3T4Q A;  1NWZ A;  4JXG A;  5FAQ A;  1ESI A;  3ZHH A;  2IWD A;  1FQG A;  1G28 A;  3T1S A;  5DF9 A;  3IXB A;  4LV3 A;  3BW6 A;  4WZ5 A;  3CIT A;  2Z2L B;  4JPM A;  3BRM A;  4PKY G;  5HL6 A;  1TS0 A;  3FPV A;  1K6S A;  1TEM A;  2ZC6 B;  4ID4 A;  3HVF A;  1GA0 A;  5HWT A;  3MZF A;  4KZB A;  4HBT A;  5EVE A;  5AJG A;  5AVF A;  1LSV A;  3LEQ A;  2WKR A;  1QME A;  4PKY A;  3QNC A;  4XT2 A;  1I5Q A;  1K57 A;  1H8Z A;  2WKE A;  2Y8H A;  1PIO A;  3JVV A;  1ZC2 A;  4B4Z A;  3FZC A;  3G2Y A;  1YLZ A;  3PBS A;  5CHU A;  1Z6F A;  4NG2 A;  2Q9N A;  2WGI A;  5DF7 A;  1K55 A;  1ERM A;  4Q8I A;  1C3B A;  1E4D A;  1MWU A;  5HAP A;  3TW8 A;  2VJW A;  1JVJ A;  4UAA A;  4UQI S;  3UE0 A;  4Q0I A;  4R23 A;  1KE0 A;  2MJ6 A;  4M3K A;  4S2N C;  3L9K A;  1Y28 A;  3M2J A;  1ESU A;  3SS5 A;  4N9L A;  2XR0 A;  4OLG A;  2V0U A;  4MBF A;  1X0O A;  1GSX A;  2CC1 A;  2OSU A;  3IWO A;  1W8Y A;  4ZJ2 A;  4DE1 A;  3T1X A;  4FTX A;  2H28 A;  4DE0 A;  3UN7 A;  1KVM A;  3G4P A;  4JF4 A;  2WZX A;  5TJJ A;  2EX6 A;  1GSV A;  4GS9 A;  5FL3 A;  1IKG A;  4DRT A;  5FDH A;  5FEG A;  4Z9Q A;  4K91 A;  2DRW A;  3T1Q B;  3D9Y A;  2HDS A;  1EWZ A;  3SH9 A;  5MC7 A;  3VP0 A;  2QWS A;  4PM9 A;  4X68 A;  4GD8 A;  1T19 A;  4Y13 A;  3Q82 A;  5FI6 A;  1LL8 A;  3PBT A;  4RA7 A;  4ZDX A;  4OQH A;  4Y0O A;  3ZVW A;  3MFX A;  5TR7 A;  4ZRR A;  4IUK A;  3RH8 B;  5CX7 A;  3F1O B;  1U60 A;  3U2A A;  3NY4 A;  5GL9 A;  5F68 A;  2D02 A;  4U0X A;  4EUZ A;  4Y15 A;  4CPK A;  1K54 C;  5D3O A;  5HPI A;  3DTE A;  3P09 A;  4KG5 A;  1P0Z A;  2QMI A;  1PZO A;  4X55 A;  4HBU A;  5AQA A;  1BYW A;  1N9O A;  3G32 A;  1KE4 A;  5DVA A;  2PU2 A;  3A3I A;  4FH2 A;  1SZV A;  4HI4 A;  3BFC A;  2R9X A;  5HPF A;  1ALQ A;  5G4Z A;  4QJG A;  3LIC A;  2L4R A;  3QP4 A;  1IEL A;  2XSS A;  1VM1 A;  5A93 A;  4EXO A;  4EV4 A;  2PBD P;  4OVD A;  3UME A;  1XP4 A;  4NXE A;  4C6Y A;  1XXM A;  3W2Z A;  3MXR A;  2BG1 A;  1PFL A;  5F69 A;  3KSI A;  2P04 A;  3LIA A;  2K31 A;  4KZ4 A;  4OPQ A;  2PR6 A;  3MBZ A;  3WS0 A;  2ZOI A;  4EER A;  2ZMF A;  4GCZ A;  5U47 A;  1YKD A;  3BWL A;  1NZU A;  2EWV A;  1ES5 A;  2PD8 A;  2V8F A;  4BJP A;  3R4K A;  2M1C A;  3A0S A;  5I94 A;  5CHM A;  4OH0 A;  1FSW A;  3P01 A;  3ZQ5 A;  1K56 A;  3CPT B;  1UGU A;  3IBR A;  4EWF A;  4N92 A;  1H8M A;  1XJ3 A;  3MMH A;  2ZM0 A;  4O01 A;  4S2P A;  3ISG A;  2Z2M B;  5KMW A;  3O86 A;  2VK3 A;  4I38 A;  3BFE A;  1PRQ A;  1BUL A;  2J3W A;  3IS2 A;  4Q0H A;  2XRO A;  1GCE A;  3KSF A;  3T4O A;  2V2F F;  3PTE A;  4Y0U A;  5EE8 A;  3EGX C;  3C4P A;  2WAF A;  2ACG A;  2VGL M;  3JVU A;  5DFX A;  5EUA A;  1DP6 A;  1LSW A;  3WS4 A;  3G35 A;  4D2O A;  2HPB A;  2JKT I;  2O99 A;  1XGJ A;  3NHQ A;  4LCL A;  1FR6 A;  4X1M A;  1YMS A;  4P6Z M;  4X53 A;  2W3H A;  3VE3 A;  2DNS A;  1G6O A;  4MMN A;  4EBP A;  1YPR A;  2PYR A;  4FCF A;  4DE2 A;  1IEM A;  1CQA A;  3CG5 A;  3BFD A;  3SZT A;  3NJA A;  1IYO A;  4NKP A;  5A91 A;  1SHV A;  2HGV A;  2H0Y A;  4EEU A;  5EVI D;  1NRF A;  3D4F A;  2ZL1 A;  1LLB A;  2PR5 A;  5CED A;  3CUE C;  2WGW B;  1FCO A;  4LRX C;  4X56 A;  2B95 A;  5EPH A;  1OJG A;  2EX2 A;  3LIB A;  1S66 L;  3GR2 A;  2A49 A;  2INW A;  1S6R A;  4DN0 A;  1BZA A;  5EFW A;  1Q2P A;  5DJT A;  4DDY A;  4KZA A;  2WYX A;  2I9V A;  3NOP C;  3DTM A;  4R3J A;  3MXQ A;  1T18 A;  2VGL S;  5M1A A;  3E2L A;  2ZOH A;  2EFU A;  4WZ4 A;  2QPN A;  1SCW A;  5F6A A;  3Q1F A;  4LV1 A;  4WUJ A;  1DP9 A;  4MLL A;  1FIL A;  4NET A;  3MSH A;  4QY5 A;  3HLB A;  2ZMA A;  1VET B;  2JKR I;  3ZVT A;  3S7P A;  3H7W A;  3SOI A;  3GEC A;  3VSK A;  3IH8 A;  5EM1 A;  3AGD A;  1F2K A;  1V9Z A;  3D72 A;  2EX8 A;  4O0P A;  4S2L A;  4PM5 A;  2EA9 A;  4MNR A;  2FZ0 A;  1CEF A;  2EXA A;  3LY4 A;  2XD5 A;  2HDQ A;  4HY8 A;  2O9C A;  2XK1 A;  2Q9M A;  2Y2O A;  1PWD A;  2ZC5 B;  3Q7Z A;  3PHY A;  1T1C A;  4NXG A;  2A24 B;  2HJE A;  4R3A A;  2E8J A;  1NLY A;  5HSQ A;  3Q07 A;  2JN7 A;  3UB7 A;  3Q7V B;  4F3L B;  1PI4 A;  5L07 A;  2HDU A;  4EEP A;  4EUV A;  2ZD8 A;  2R9W A;  4KQO A;  1PWG A;  3HUN A;  4LV2 A;  2RL3 A;  2KDK A;  3C30 A;  3IX8 A;  3UDF A;  2G2W A;  4JLF A;  4CLC A;  5EVI C;  3ZG8 B;  3QNB A;  1P9R A;  1PW1 A;  5IS1 A;  1D06 A;  3MZD A;  3B3X A;  1WYB A;  2X01 A;  5DKL A;  4I39 A;  4YFM A;  2O0Y A;  1BSG A;  2WKH A;  1NLZ A;  5LBR A;  2L1M A;  1MKI A;  4OON A;  4I3J A;  2Y91 A;  3LFV A;  1BTL A;  4GN2 A;  3WS5 A;  1OJ5 A;  4G3W A;  3MS6 A;  4H6J B;  2IWB A;  4ETX A;  4EW7 A;  3UB9 A;  3RXX A;  3HCY A;  2C6W B;  1IYS A;  1E25 A;  4G3K A;  2H5S A;  2PD7 A;  2V1Z A;  4WL9 A;  1XFN A;  5CER A;  5L10 A;  3B42 A;  3T4T A;  3MQ0 A;  4II7 A;  3TE8 A;  1FCM A;  3OZH A;  3H82 B;  3CLO A;  1S4R A;  2KX6 A;  4GDB A;  1HD8 A;  1D7E A;  4CQH A;  1OT9 A;  2Y2Q A;  1HTZ A;  4KUO A;  3S1Y A;  2FH5 A;  1K56 D;  4LFU A;  3SH7 A;  1BT5 A;  2M7U A;  5KIZ A;  3K3C A;  2ZM8 A;  2ZLY A;  3DBA A;  4EET B;  2K7S A;  4GHI B;  1W7F A;  4HES A;  4OKP A;  4X69 A;  3OC2 A;  3ITA A;  5FA7 A;  3F1O A;  1XX2 A;  2VKS A;  2KLI A;  1HZO A;  3BY9 A;  3LO7 A;  4KG6 A;  2UWX A;  3F1N B;  1I2W A;  3T4S A;  4LGW A;  2Y4A A;  5HDD A;  1NJ4 A;  2D01 A;  2J80 A;  1H0M A;  2XRN A;  4HOI A;  4RX2 A;  2W1T A;  2PDR A;  2JBF A;  1LHY A;  1FR1 A;  4HJ6 A;  2QYB A;  5F1G A;  5CTM A;  3LCE A;  3UE3 A;  4NXB A;  5F1F A;  5JYO A;  4L0L A;  3HLD A;  3LI9 A;  2B18 A;  3R7W A;  1MWT A;  3LR5 A;  1KE3 A;  4OPR A;  3DWZ A;  5DJU A;  3W4O A;  3PR6 A;  3NDG A;  3O87 A;  3PBQ A;  2GZA A;  3PAE A;  4WMC A;  1L0G A;  2G2U A;  2JE5 A;  5TGF A;  1KGG A;  4DXB A;  4RQ9 A;  3IXG A;  3VV4 A;  2JKR M;  5J4E A;  4Y7P A;  2P9V A;  3WRT A;  4KZ7 A;  1XJ2 A;  4CJN A;  4U3T A;  1W5D A;  4L9E A;  4ZJ1 A;  2XGN A;  3UDI A;  2VV7 A;  4LRY C;  3VSL A;  3NI9 A;  2GX5 A;  2ZQD A;  3BJN A;  3PXP A;  2PAV P;  3E4Q A;  4S2O A;  3UO9 A;  1JWV A;  3Q81 A;  4R4S A;  3IF5 A;  3I7J A;  3T50 A;  3VOY A;  3CPT A;  2JCH A;  3LUQ A;  3UY6 A;  2IA2 A;  4JGP A;  4LCM A;  1FCN A;  4FD8 A;  2B5R A;  1XJ6 A;  1XA7 A;  3GV9 A;  2R78 A;  4R0Q A;  4HP9 A;  5FI2 A;  2XEP A;  3OPP A;  3KYQ A;  2ZQA A;  4GDN A;  1OT6 A;  1XA1 A;  3HLW A;  4JBF A;  4PM6 A;  4NXF A;  3UB6 A;  3ZNY A;  5A8B A;  1E3U D;  2OWH A;  4MN6 A;  1L3L A;  1K25 A;  2OAP 1;  5I5L A;  5J8X A;  1LL9 A;  3C7U A;  2WAD A;  1K38 A;  1F9I A;  2PT7 A;  4QB8 A;  3IHA A;  2V1A A;  1OTA A;  4P87 A;  4E04 A;  4ESP A;  3UNW A;  4FOF A;  4WYY A;  2Y59 A;  3RTY A;  4I5S A;  5EM0 A;  3LYX A;  5FDS A;  4ZJ3 A;  5EEC A;  2ZQ8 A;  4HH3 A;  4F94 A;  3MQO A;  1JWZ A;  2HP6 A;  5TBM B;  1BUE A;  3V5M A;  3NOT C;  2VV6 A;  5HAR A;  4R6L A;  4R38 A;  3ICY A;  1KGF A;  2LB9 A;  4EQ1 A;  2WGW A;  3MKF A;  2XD1 A;  3SW1 A;  3E4O A;  1G5U A;  2A2L A;  4GB7 A;  4JKT A;  3TG9 A;  4IBX A;  1M6K A;  5E2F A;  5EV0 A;  2NUT C;  4LV0 A;  3HL9 A;  1HLU P;  3EQU A;  5EVI B;  4XXR A;  1SDN A;  2LB5 A;  4RVA A;  4OQI A;  4Z1W A;  2J8Y A;  3BFF A;  5CEB A;  1LT0 A;  4R70 A;  1YSP A;  4XT2 B;  3CZD A;  1LI9 A;  4UEY A;  4HJ4 A;  3VP2 A;  4NK3 A;  3S4X A;  4DDS A;  1DP8 A;  4X25 A;  3V67 A;  1VET A;  3EGD C;  3OCN A;  1M40 A;  4Y2F A;  3IF6 C;  4BLM A;  1L0E A;  1IYQ A;  3S7N A;  3BY8 A;  4DXC A;  5HDS A;  2W3E A;  3CI6 A;  5K5B A;  1KGE A;  3T4L A;  2BLS A;  3DAV A;  2HF6 A;  1KVL A;  1BLH A;  1STZ A;  3NEC A;  2JC7 A;  3E98 A;  5F83 A;  2DCF A;  1F5M A;  3TSG A;  3NC8 A;  3MZE A;  2GJ3 A;  4BBT A;  2G7U A;  1ES4 A;  1IOU A;  3K2N A;  3QP5 A;  4WN5 A;  3VP4 A;  1T1B A;  3EEA A;  1MXO A;  4GS9 B;  4QWO A;  2ZC4 B;  4L9F A;  5E2H A;  3UE1 A;  4WM9 A;  3LIF A;  2NUP C;  1NZO A;  1ES3 A;  2ZC7 A;  4MCW A;  3Q7V A;  4F3L A;  2OWJ A;  1ERO A;  2OOL A;  3IWQ A;  4AFI A;  2H0T A;  2YKH A;  4B88 A;  2ZQ9 A;  1PNE A;  1F98 A;  1ERQ A;  1PWC A;  2EFX A;  1D1J A;  1K54 A;  3BLM A;  4R3B A;  2HV1 A;  3VP1 A;  2VZW A;  5G4Y A;  4QPR A;  4OPY A;  4CLC C;  4JGR A;  4ARZ A;  1VEU A;  3MKE A;  4G3V A;  4HJ3 A;  2W3D A;  5DFY A;  2WKQ A;  2K2N A;  5IT5 A;  1K4F A;  4WMC D;  2PRF A;  3T1R A;  4PMA A;  3JPU A;  5A90 A;  3F1P A;  3RFB A;  4OOY A;  4H6J A;  3HLG A;  1MY8 A;  2H10 A;  2PYP A;  1GSW A;  3A3E A;  1TDL A;  4WLA A;  4KZ9 A;  5FQJ A;  3NUL A;  2W0N A;  3KYE A;  4IJG A;  1UWN X;  4HNB A;  3P98 A;  3DTI A;  4P6B A;  5HDC A;  4HP4 A;  4P6Z S;  2V1B A;  3FG8 A;  1BLP A;  1MKM A;  1YLY A;  3C8C A;  2AVX A;  2VGJ A;  3ZG9 B;  2W3G A;  1OME A;  4KZ3 A;  5GHX A;  4BL2 A;  4E3M A;  3VOZ A;  3B33 A;  1MBL A;  2OV5 A;  4KQQ A;  4ZBE A;  1XGI A;  2XA7 M;  5E2E A;  3O88 A;  1QMF A;  2QZ6 A;  2XLN A;  1IKI A;  2ZMV A;  4BL3 A;  3HBR A;  3BFG A;  3SH8 A;  3SS4 A;  4E3L A;  1DJB A;  3IQA A;  3NDE A;  4JXS A;  2VV8 A;  5DTS A;  2BTF P;  1L0F A;  2J3T D;  4WBG A;  4WZ5 C;  2P74 A;  4MBH A;  5DTK A;  3C38 A;  4BWI A;  1CJF A;  2PU4 A;  1FIK A;  5G18 A;  1H5X A;  3GQZ A;  1TDG A;  3C2W A;  4MBK A;  2WZZ A;  3HUO A;  3N8R A;  2VEA A;  3HLC A;  3ZDJ A;  3RJU A;  3MR0 A;  4PM7 A;  1AWI A;  1W79 A;  5FAT A;  1W63 Q;  3VFH A;  3O5Y A;  3PAG A;  3TRC A;  2HZ5 A;  2M7V A;  1K57 C;  4E3I A;  2EWW A;  1NYY A;  3PBN A;  2WKP A;  3NIA A;  1CI9 A;  1KDS A;  3CUE A;  3N6I A;  5CHJ A;  1H8Y A;  4LLO B;  4DKI A;  3VOL A;  3MXS A;  1LI0 A;  1NYM A;  5EOO A;  3UPO A;  3S22 A;  1CF0 A;  2ZL1 B;  3CHW P;  5CGW A;  1K55 C;  4O8G A;  1SKO B;  5HAI A;  2W27 A;  1YAX A;  1PI5 A;  2A3U A;  2O9A A;  1LSX A;  5FQK A;  3OBF A;  1ACF A;  2ZQC A;  2Y2I A;  2O9B A;  5F82 A;  2XFT A;  3GTC A;  4N9K A;  2Q0O A;  4GOG A;  2V20 A;  3N8S A;  4HQA A;  1MZU A;  5FQI A;  3E4P A;  5FAP A;  3JYI A;  2Y79 A;  1YQS A;  2JKT M;  3ZNT A;  5HD3 A;  4GW9 A;  4LPZ A;  3ITB A;  5HWV A;  3NOU C;  4BBV A;  4JGO A;  3IF6 B;  1H3Q A;  4KG2 A;  3V39 A;  3M2K A;  1P97 A;  1KDW A;  5EVL A;  1J3W A;  1O7E A;  3BQ8 A;  3A0R A;  3H7W B;  3M6B A;  3G30 A;  4DJ3 A;  4E3O A;  3OPL A;  1MWR A;  3EQV A;  4KQR A;  4GZB A;  3H9W A;  5EOE A;  3EOI A;  5M18 A;  1OPX A;  3EWK A;  3FYZ A;  4HH2 A;  4DE3 A;  1XPB A;  3T4K A;  1JWP A;  2OAQ 1;  1FSY A;  1TF1 A;  2J3T C;  4MN5 A;  3W4P A;  5CGX A;  5IU1 A;  3OOV A;  4UQI M;  5HD5 A;  3P7N A;  5J3W A;  5GLC A;  5TFQ A;  5L09 A;  2XF3 A;  1DRM A;  4C75 A;  1HVB A;  3L7H A;  1VQQ A;  1IFQ A;  1Z09 A;  1YMX A;  5CRF A;  4DMZ A;  5EVI A;  4R1G A;  5F5Y A;  2PHY A;  4YWZ A;  3CJM A;  2E8I A;  3HLF A;  1VHM A;  2WK0 A;  4CLC B;  4OQ0 A;  5FAS A;  1TD5 A;  3LY3 A;  4I3I A;  4X6T A;  3HJK A;  4MDZ A;  4Q0J A;  5A92 A;  1RGZ A;  4BD0 A;  3FKV A;  4YIN A;  3ZG7 B;  3VP3 A;  4EES A;  3G31 A;  3A3F A;  2WGV A;  3ZG5 A;  4BQM A;  4QD4 A;  1JTG A;  1Q2Q A;  4N1H A;  4FSF A;  4IHQ A;  5FQM A;  3ZG0 A;  4LRZ E;  1I2S A;  3MFD A;  5GLB A;  1NXY A;  1S1Z A;  4WEL A;  2ZBB A;  1L0D A;  1CI8 A;  1OTD A;  4M4X A;  5FQ9 A;  1ES2 A;  3ZGA B;  1YLP A;  2YKF A;  4QU3 A;  5DTT A;  5HAQ A;  2EXB A;  5AQB A;  4U0T A;  4WEK A;  5CEC A;  2J9O A;  1FOF A;  5HZH A;  2XFS A;  3A3J A;  4BD1 A;  4XUX A;  4E3N A;  3K3D A;  2VLG A;  4I3A A;  1DJC A;  2ZJ9 A;  3N4I A;  3W8K A;  5FAO A;  1ONH A;  4HIA A;  3WS2 A;  1DY6 A;  1ZG6 A;  3BEB A;  3M6H A;  3FPW A;  1CK3 A;  4FUW A;  1RGY A;  3BLS A;  2DMW A;  4NEE D;  4JF5 A;  4D60 A;  3S7Q A;  1OTB A;  1YLT A;  3ZYT A;  1GA9 A;  3KSG A;  2WKI A;  3N8L A;  1PYY A;  5IHV A;  2RCX A;  4A5R A;  5DF8 A;  5GLD A;  2W1T B;  4CLC D;  4B93 A;  1ZHH B;  4UA6 A;  3C5A A;  5CTN A;  1NY0 A;  4OPZ A;  1K0K A;  1G6A A;  4FH4 A;  1S4S A;  2W1R A;  3R7W B;  5KSC A;  5BOH A;  4RX3 A;  1ONG A;  2HP9 A;  3U4L P;  5DKK A;  3FV7 A;  3HJI A;  5C5K A;  3BYD A;  3OPR A;  4P85 A;  5KZH A;  4C3Q A;  2PBY A;  2Y2H A;  1MC0 A;  2UV0 E;  3AGF A;  3G34 A;  5GHZ A;  4S2N A;  1T1A A;  1RP5 A;  3QP6 A;  2P9V B;  4JXW A;  1W8Q A;  3VFF A;  2HP5 A;  4K08 A;  5E43 A;  4MEZ A;  4EQI A;  4R4R A;  4OQG A;  4KQD A;  3MJQ A;  3GRJ A;  3CAX A;  4K0X A;  3IH9 A;  3LR3 A;  5JYP A;  3DWK A;  2VX8 A;  3A3D A;  1JTD A;  2FFF B;  3GVB A;  2HDR A;  1BLS A;  1S0W A;  5GLA A;  4E3K A;  1LL5 A;  4CLC E;  4GD6 A;  4Y17 A;  1OTE A;  4EU0 A;  2GDN A;  1XJ4 A;  2A24 A;  1BLC A;  4E6X A;  2IWC A;  3KO6 A;  4KZ6 A;  2KOI A;  1WYC A;  1ZTU A;  2Y2G A;  1N4O A;  4Y5F A;  3ULF A;  1GHM A;  3PBR A;  4HEF A;  2Y2M A;  4UA9 A;  4PM8 A;  3O3V A;  4ETZ A;  3UB5 P;  1PW8 A;  3T12 B;  5L8M A;  4IUH A;  5L2F A;  4KZ5 A;  4GNU A;  2J7V A;  4O7D A;  3IT9 A;  2B02 A;  3OPH A;  3E2K A;  3C7V A;  4GKU A;  3OCL A;  1VB6 A;  3GDI A;  4B9O A; 
#chains in the Genus database with same CATH homology
 3UE3 A;  1H5X A;  4QY6 A;  4CPK A;  5F1F A;  3GQZ A;  5JYO A;  1CEG A;  1TDG A;  4L0L A;  1K54 C;  4MBK A;  4IVI A;  5D3O A;  2WZZ A;  4WEJ A;  3HLD A;  3P09 A;  3HUO A;  4KG5 A;  3UPP A;  1ZG4 A;  2QMI A;  1MWT A;  1PZO A;  3N8R A;  4X55 A;  1KE3 A;  3HLC A;  4HBU A;  4OPR A;  5AQA A;  3DWZ A;  4UA7 A;  3G32 A;  3W4O A;  3ZDJ A;  5FI7 A;  3RJU A;  1KE4 A;  5DVA A;  1DJA A;  2PU2 A;  4PM7 A;  3NDG A;  3O87 A;  3PBQ A;  1W79 A;  5FAT A;  1MWS A;  5CTM A;  3VFH A;  3A3I A;  3PAE A;  3PAG A;  4WMC A;  1L0G A;  2Y2J A;  4FH2 A;  2G2U A;  1K57 C;  2JE5 A;  5TGF A;  4E3I A;  4S2K A;  5FSR A;  1NYY A;  1N9B A;  3BFC A;  3PBN A;  2R9X A;  3NIA A;  1CI9 A;  1ALQ A;  1KDS A;  2EX9 A;  3AGE A;  1KGG A;  4QJG A;  4DXB A;  5CHJ A;  3IXG A;  1IEL A;  3N6I A;  1H8Y A;  1VM1 A;  2Y2N A;  5A93 A;  4DKI A;  4EV4 A;  4Y7P A;  1G68 A;  3MXS A;  3ZFZ A;  4OVD A;  1LI0 A;  1ZKJ A;  1NYM A;  1XP4 A;  2C5W B;  2P9V A;  5EOO A;  3UPO A;  4JXV A;  2OLU A;  3C4O A;  4KZ7 A;  1L2S A;  3GSG A;  3WRT A;  4C6Y A;  1XXM A;  3S22 A;  4CJN A;  4U3T A;  1W5D A;  3MXR A;  3IHB A;  4ZJ1 A;  2BG1 A;  5CGW A;  3V50 A;  2XGN A;  1GHI A;  1K55 C;  3UDI A;  5HAI A;  3VSL A;  1WE4 A;  1PI5 A;  3NI9 A;  2A3U A;  5AQ9 A;  2ZQD A;  5FQK A;  4KZ4 A;  4S2O A;  4OPQ A;  3UO9 A;  1IYP A;  2ZQC A;  2Y2I A;  1JWV A;  5F82 A;  3MBZ A;  2XFT A;  3Q81 A;  3WS0 A;  4R4S A;  3GTC A;  4N9K A;  3IF5 A;  5KSH A;  4GOG A;  3I7J A;  5U47 A;  2V20 A;  3N8S A;  4ZTK A;  1NZU A;  5FQI A;  3IF6 A;  5FAP A;  3VOY A;  2JCH A;  1ES5 A;  3JYI A;  3UY6 A;  4LCM A;  4BJP A;  1FCN A;  5FQQ A;  1YQS A;  4UHU A;  4FD8 A;  3ZNT A;  3NCK A;  4RYE A;  1YT4 A;  2B5R A;  3ITB A;  5I94 A;  5CHM A;  2WUQ A;  4OH0 A;  1FSW A;  5AQ7 A;  1XA7 A;  1K56 A;  3IF6 B;  4KG2 A;  3V39 A;  3GV9 A;  4OOL A;  3GMW A;  3M2K A;  4R0Q A;  4XUZ A;  5FI2 A;  3WRZ A;  4EWF A;  4N92 A;  2XEP A;  3OPP A;  2ZM0 A;  2ZQA A;  4GDN A;  1KDW A;  3HLW A;  1XA1 A;  5EVL A;  4IBR A;  4JBF A;  4PM6 A;  4S2P A;  1SDE A;  3ISG A;  2Z2M B;  5KMW A;  1O7E A;  3O86 A;  3ZNY A;  1E3U A;  2XQZ A;  1E3U D;  3BFE A;  4DF6 A;  1K4E A;  4S2I A;  1RCJ A;  3M6B A;  3G30 A;  1K25 A;  4E3O A;  1BUL A;  3NBL A;  3G2Z A;  5J8X A;  1SKF A;  4KZ8 A;  3OPL A;  1MWR A;  3IWI A;  1LL9 A;  1O07 A;  3EQV A;  3VMA A;  4KQR A;  3C7U A;  2WAD A;  4GZB A;  3IXD A;  5EOE A;  1K38 A;  1GCE A;  4QB8 A;  5M18 A;  4N1X A;  2XH9 A;  3BEC A;  3FYZ A;  2V2F F;  4DE3 A;  1XPB A;  2I72 A;  3IHA A;  3PTE A;  4Y0U A;  5EE8 A;  3C4P A;  2WAF A;  1JWP A;  5EUA A;  4P87 A;  1FSY A;  4EBL A;  1YLW A;  3UNW A;  3W4P A;  3WS4 A;  3N7W A;  5CGX A;  3G35 A;  4WYY A;  4D2O A;  2HPB A;  2Y59 A;  4LCL A;  1XGJ A;  5GHY A;  1FR6 A;  4S2J A;  1YMS A;  4ZJ3 A;  4H8R A;  4S2M A;  2ZQ8 A;  5EEC A;  4F94 A;  4X53 A;  1JWZ A;  4OP5 A;  2DNS A;  2HP6 A;  4EBP A;  4FCF A;  4DE2 A;  1MPL A;  1IEM A;  5GLC A;  1BUE A;  5TFQ A;  3V5M A;  3UDX A;  5HAR A;  2XF3 A;  3UPN A;  3CG5 A;  3WS1 A;  4C75 A;  1HVB A;  5HL1 A;  2FFY A;  3BFD A;  3HUM A;  3WWX A;  2Y2L A;  1VQQ A;  1KGF A;  1IYO A;  1YMX A;  1TVF A;  5A91 A;  1SHV A;  2WGW A;  2ZC3 B;  3MKF A;  2XD1 A;  2XDM A;  5CRF A;  5HFO A;  2H0Y A;  4GB7 A;  5EVI A;  2OLV A;  4OOM A;  5EVI D;  4R1G A;  1NRF A;  4KEN B;  4JKT A;  3V3S A;  3D4F A;  3TG9 A;  4IBX A;  1M6K A;  4EBN A;  5E2F A;  1LLB A;  3CJM A;  2E8I A;  3HLF A;  5CED A;  2WGW B;  4OP8 A;  1FCO A;  4X56 A;  4LV0 A;  3HL9 A;  2J9P A;  2WK0 A;  3EQU A;  5EPH A;  5EVI B;  4OQ0 A;  2X02 A;  2EX2 A;  3BM6 A;  1SDN A;  4XXR A;  4RVA A;  3GR2 A;  3SS3 A;  4OQI A;  3W4Q A;  2A49 A;  1S6R A;  2Y2K A;  4B4X A;  4QHC A;  5FAS A;  2J8Y A;  3BFF A;  5CEB A;  1BZA A;  5CGS A;  3LY3 A;  1Q2P A;  2Y2P A;  1AXB A;  4E3J A;  4X6T A;  4DDY A;  3CZD A;  1LI9 A;  3VP2 A;  3FKW A;  4KZA A;  4NK3 A;  2WYX A;  1EI5 A;  3S4X A;  5A92 A;  3HLE A;  3DTM A;  4IVK A;  4R3J A;  4DDS A;  1RGZ A;  4BD0 A;  3PBO A;  4JF6 A;  3V3R A;  3HRE A;  3FKV A;  5M1A A;  4YIN A;  3E2L A;  3ZG7 B;  3VP3 A;  3OCN A;  3G31 A;  1XKZ A;  3A3F A;  2EFU A;  2WGV A;  2QPN A;  1M40 A;  1SCW A;  3DW0 A;  4WZ4 A;  3IF6 C;  3Q1F A;  4LV1 A;  3CMZ A;  5CXW A;  3ZG5 A;  2WAE A;  4BLM A;  1L0E A;  4MLL A;  4QD4 A;  1JTG A;  4BQM A;  1IYQ A;  1Q2Q A;  1Y54 A;  4N1H A;  4NET A;  5HX9 A;  2Y55 A;  4FSF A;  4QY5 A;  3HLB A;  4DXC A;  5FQM A;  1KGE A;  1YM1 A;  2ZMA A;  3ZG0 A;  1I2S A;  3ZVT A;  3MFD A;  5GLB A;  1NXY A;  2BLS A;  1YLJ A;  1KVL A;  4WEL A;  1BLH A;  1L0D A;  1CI8 A;  3SOI A;  3ZCZ A;  1GHP A;  1K6R A;  5FQ9 A;  2JC7 A;  2ZQ7 A;  1ES2 A;  4BEN A;  4ZAM A;  3ZGA B;  1YLP A;  3VSK A;  3RXW A;  4P0M A;  4QU3 A;  5F83 A;  5DTT A;  5HAQ A;  2DCF A;  3IH8 A;  3TOI A;  3AGD A;  3TSG A;  5M19 A;  2EXB A;  3MZE A;  3IXH A;  3NC8 A;  4LEN A;  4U0T A;  5AQB A;  4WEK A;  5CEC A;  2J9O A;  1FOF A;  4PPR A;  1ES4 A;  3VP4 A;  2EX8 A;  3FWL A;  4S2L A;  4Y0T A;  4PM5 A;  5E2G A;  4MNR A;  2XFS A;  1CEF A;  1MXO A;  2EXA A;  2ZM2 A;  3A3J A;  3LY4 A;  4K0W A;  2XD5 A;  2HDQ A;  2ZC4 B;  5HW3 A;  4BD1 A;  4XUX A;  1PZP A;  4E3N A;  5E2H A;  4OLD A;  1DJC A;  4IED A;  2ZJ9 A;  3N4I A;  3UE1 A;  3LEZ A;  4WM9 A;  5FAO A;  3W8K A;  2XK1 A;  4E6W A;  1ONH A;  3WS2 A;  2X71 A;  2VGK A;  1NZO A;  1ES3 A;  1DY6 A;  2Q9M A;  1ZG6 A;  1PWD A;  2Y2O A;  2ZC7 A;  3BEB A;  3M6H A;  3QHY A;  1J9M A;  3Q7V A;  2ZC5 B;  3Q7Z A;  1CK3 A;  1RGY A;  4JXG A;  3BLS A;  5FAQ A;  1ESI A;  3ZHH A;  2IWD A;  1FQG A;  1ERO A;  4JF5 A;  5DF9 A;  3IWQ A;  3IXB A;  1YLT A;  3Q07 A;  4LV3 A;  1GA9 A;  4WZ5 A;  2H0T A;  4B88 A;  3Q7V B;  4JPM A;  2Z2L B;  3BRM A;  2ZQ9 A;  2WKI A;  1PI4 A;  3N8L A;  2HDU A;  1ERQ A;  1PWC A;  2ZD8 A;  2R9W A;  2EFX A;  4KQO A;  1PWG A;  3HUN A;  4LV2 A;  2RL3 A;  1K54 A;  1K6S A;  1PYY A;  1TEM A;  2ZC6 B;  3BLM A;  4ID4 A;  2RCX A;  4R3B A;  5IHV A;  3UDF A;  3HVF A;  2G2W A;  1GA0 A;  3MZF A;  3VP1 A;  4KZB A;  4JLF A;  4HBT A;  4A5R A;  5DF8 A;  5GLD A;  4UA6 A;  3C5A A;  4OPY A;  5EVI C;  5CTN A;  1NY0 A;  3ZG8 B;  3QNB A;  3MKE A;  4OPZ A;  1QME A;  1PW1 A;  1G6A A;  3MZD A;  3QNC A;  4FH4 A;  1I5Q A;  1K57 A;  3B3X A;  1H8Z A;  1K4F A;  4WMC D;  2WKE A;  1WYB A;  2X01 A;  5BOH A;  5KSC A;  4PMA A;  4RX3 A;  5A90 A;  1ONG A;  2HP9 A;  4YFM A;  1BSG A;  1PIO A;  2WKH A;  3FV7 A;  3BYD A;  3OPR A;  4OOY A;  4P85 A;  1MKI A;  3HLG A;  5KZH A;  4OON A;  1ZC2 A;  4B4Z A;  4C3Q A;  3FZC A;  1MY8 A;  2H10 A;  1YLZ A;  2PBY A;  2Y2H A;  2Y91 A;  3A3E A;  3G2Y A;  1TDL A;  3PBS A;  5CHU A;  1BTL A;  1Z6F A;  4KZ9 A;  4GN2 A;  3WS5 A;  3AGF A;  2Q9N A;  2WGI A;  5DF7 A;  5FQJ A;  3G34 A;  1K55 A;  1ERM A;  3P98 A;  2IWB A;  4Q8I A;  1C3B A;  1E4D A;  1MWU A;  2C6W B;  3RXX A;  5HAP A;  1IYS A;  5GHZ A;  1E25 A;  1JVJ A;  4S2N A;  4UAA A;  4P6B A;  3UE0 A;  1RP5 A;  4R23 A;  1KE0 A;  2P9V B;  4JXW A;  1W8Q A;  3VFF A;  4M3K A;  4S2N C;  1BLP A;  3M2J A;  1ESU A;  2HP5 A;  3SS5 A;  4N9L A;  2XR0 A;  4OLG A;  4MBF A;  4DE1 A;  2CC1 A;  2OSU A;  3IWO A;  5E43 A;  1W8Y A;  1YLY A;  2H5S A;  4MEZ A;  4ZJ2 A;  2V1Z A;  4R4R A;  4EQI A;  4OQG A;  4DE0 A;  3UN7 A;  5CER A;  1KVM A;  3GRJ A;  3G4P A;  4K0X A;  2VGJ A;  4JF4 A;  3IH9 A;  1FCM A;  3OZH A;  5JYP A;  3ZG9 B;  2WZX A;  3DWK A;  3A3D A;  1JTD A;  2FFF B;  1OME A;  2EX6 A;  3GVB A;  4GDB A;  1HD8 A;  4KZ3 A;  2HDR A;  1IKG A;  4DRT A;  5GHX A;  4BL2 A;  2Y2Q A;  1HTZ A;  1BLS A;  1S0W A;  3S1Y A;  3VOZ A;  4E3M A;  5FDH A;  5GLA A;  4E3K A;  4Z9Q A;  1K56 D;  1LL5 A;  4GD6 A;  4K91 A;  2DRW A;  3SH7 A;  1MBL A;  2OV5 A;  4KQQ A;  2HDS A;  4ZBE A;  1XGI A;  2GDN A;  5E2E A;  1EWZ A;  3SH9 A;  3O88 A;  1QMF A;  1BT5 A;  3VP0 A;  2ZM8 A;  1BLC A;  4E6X A;  4PM9 A;  2QZ6 A;  2IWC A;  2ZLY A;  2XLN A;  4KZ6 A;  4X68 A;  4GD8 A;  1WYC A;  1W7F A;  3Q82 A;  4HES A;  5FI6 A;  1IKI A;  3PBT A;  4OKP A;  4X69 A;  2Y2G A;  3OC2 A;  4RA7 A;  3ITA A;  1N4O A;  5FA7 A;  1XX2 A;  4BL3 A;  4ZDX A;  3HBR A;  1GHM A;  1HZO A;  3BFG A;  3LO7 A;  3PBR A;  4KG6 A;  4OQH A;  2UWX A;  4HEF A;  2Y2M A;  4UA9 A;  4Y0O A;  3SH8 A;  3SS4 A;  4PM8 A;  3O3V A;  1DJB A;  3ZVW A;  4E3L A;  5TR7 A;  3IQA A;  1I2W A;  3NDE A;  4JXS A;  1PW8 A;  2Y4A A;  5DTS A;  5L2F A;  1L0F A;  1U60 A;  1NJ4 A;  4KZ5 A;  3NY4 A;  4GNU A;  2J7V A;  4WBG A;  4O7D A;  3IT9 A;  5GL9 A;  3OPH A;  4WZ5 C;  2P74 A;  4MBH A;  5DTK A;  3E2K A;  3C7V A;  4GKU A;  3OCL A;  4RX2 A;  4U0X A;  4EUZ A;  2PU4 A;  5G18 A;  2JBF A;  1LHY A;  1FR1 A;  5F1G A;  3LCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...