5A9GA

Manganese superoxide dismutase from sphingobacterium sp. t2
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
206
structure length
206
Chain Sequence
DPFTQFKQTPLPYAYDALEGAIDAKTMEIHYSKHAAGYTANLNKAIAGTPAEKESIENILAKVSQYSDAVRNNAGGHYNHELFWSILTPNKGTKPSAALQKAIDETFGSLDALKEKINAAGAARFGSGWAWLIVDNGGKLQVTSTPNQDNPLMDFTKEKGTPILGIDVWEHAYYLRYQNKRADYLTTIWDVINWEEVSARYEKALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Identification of Manganese Superoxide Dismutase from Sphingobacterium Sp. T2 as a Novel Bacterial Enzyme for Lignin Oxidation.
pubmed doi rcsb
source organism Sphingobacterium spiritivorum
molecule tags Oxidoreductase
total genus 76
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 5a9gA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 5a9gA02
1BS3A 4JZGA 1JR9A 3MDSA 1XILA 3K9SA 2ADPA 5A9GA 1ZSPA 1GN3A 1QNMA 2CDYA 1N0NA 4BR6A 3TJTA 3DC5A 1XDCA 4X9QA 1IDSA 1KKCA 1MA1A 1LUWA 1WB7A 1EN6A 3EVKA 2QKCA 3RN4A 1D5NA 1GN6A 3KKYA 1AR5A 1MSDA 2QKAA 4E4EA 4F6EA 4FFKA 4YIPA 1ZLZA 1B06A 2CE4A 1EN4A 4C7UA 1BSMA 2AW9A 1ZUQA 1LUVA 1WB8A 1VARA 2P4KA 2GDSA 2ADQB 1SZXA 1XUQA 1GN2A 1P7GA 1XREA 1IXBA 5AG2A 3BFRA 1I08A 1JA8A 1MMMA 1AR4A 3CEIA 1EN5A 3AK2A 1AVMA 1N0JA 1AP6A 4JYYA 1ZTEA 1VEWA 3C3SA 1BT8A 3IC9A 1PL4A 1GN4A 4YIOA 1Y67A 2RCVA 3AK3A 3AK1A 4JZ2A 4GUNA 1PM9A 3C3TA 3OT7A 3LSUA 1MNGA 3QVNA 3DC6A 1EM1A 1AP5A 1IX9A 1I0HA
chains in the Genus database with same CATH superfamily
4X1KB 5IY5B 3JATB 5IE9A 2VRZA 4NXMO 2N74A 3MDSA 3ZMVA 3KDRA 2EZOA 3WG7C 2CH7A 2FL4A 4UV8A 3CCVV 4ZBMA 3VQXA 3FKSG 3HKEB 1IDSA 1KKCA 2Q0AA 1MA1A 2QWPB 3TK1A 1FXVA 4JI1B 3L73H 1YITV 2NLJC 5IYBO 5EBMC 2UXXA 4UVCA 2EBOA 2L35A 2FMLA 1L8DA 3E83A 3QG5A 5DECA 4B7KA 3KKYA 3U0ZA 4LF9B 2Q67A 3K5MA 4ASUG 3RYCB 3VOUA 3RYIA 1B06A 4WFEA 3N2KB 3FAVA 2LP7A 2ZDIA 4OX9O 1BSMA 4EEQA 3QO7A 2DWEC 1N33B 1Q8IA 2ADQB 4ZI7B 2BOCC 1VQ8V 4MVRA 2QA4V 1V54C 1KU9A 1SQPH 2D3OW 1FJGB 1UJWB 4LF7B 2N04A 4JTCB 5EYPA 2WLLA 1NR7A 3ZEDA 3DXRB 1JNBA 2QE7G 4DR7B 1QLEC 3LDDA 4LF8B 4IYIA 1Y67A 2YEVA 2DOSA 2WA4A 1B6QA 4DR1B 1HP8A 3S3WA 4R7CA 1BQZA 2HKOA 2DYRB 1KKDA 2X6BA 3ABTA 4J80A 4CH5A 4NR1A 3K06A 3IJ4A 3JARA 5BZBA 2OT5A 1QR8A 3M7MX 2Q7HA 2JEUA 3RGBA 1DGSA 3DTUB 1GM7A 4HNAA 1FKAO 4JI8O 3QO5A 1H8HG 3SPJA 4IL6Z 3X2QB 4DXWA 1KD1W 2NNUA 4JYCA 2YIBA 1GMGA 2IH3C 4DV4B 3IC7A 4PDVA 1E1RG 3ZRXA 5JQGA 2F4VB 4B3RO 2IBZH 1AR5A 1MSDA 5H6RA 3KCXA 2R9AA 1P4RA 2ZQMA 4R6ZA 3JAKB 3AG4B 2XUMA 1YHQV 3FB8C 3G67A 4DV6O 1OCRC 4IIJA 4K35A 5KAFZ 4X1IB 2CE4A 4NKGB 5LMNO 1YTFD 4D7TA 5LGNA 1SQXH 5GTIZ 1H2GA 5LHIA 3TXSA 4JTDB 4CH6A 1IBLO 4FZ0A 4LWSB 1GAXA 4BWAA 4D7SA 3CP1A 5C8YA 3OEEG 1KC8W 1BHAA 2WWWA 4K8XA 4FFBA 2BSKA 5GONA 1VF7A 2F1MA 4DYLA 2Q69A 3BHPA 5FPRA 2HJFC 4GZRB 4X8AA 1PNLA 4KXRA 3ABKB 1FPOA 4JF3A 4CS4A 3HKBB 3QTCA 1F4MA 3CRRA 1NVPB 3N27A 3OMNB 1R6KA 3OR6C 1FS0G 1Q81W 1M57B 4O2AB 3ABLB 3LSUA 1FYJA 3QVNA 4RUFA 5EC2C 4WBNB 3CCJV 1G4YB 3WB1A 1AJQA 2P7TC 2KG7A 1Z2GA 2HVJC 4UCSA 5C93A 3SJQC 4LFCB 1JVMA 2OIGA 3WB0A 3NXSA 3K9SA 4H0LB 2FKXA 3E8BA 4I0XA 1PP9H 4Z2WA 4JI7O 4B3MB 3G71V 2UXBO 3TETA 1H5WA 1SA0B 1M4UA 1WB7A 1HWYA 4O2BB 4FM2A 3ASNC 2LGWA 1P84F 2A3QA 2WLKA 3CCRV 1FAFA 1GN6A 1A32A 5IY5C 2HP8A 4KUMA 4DV7O 1PL0A 5TISZ 5H9CA 1S76D 4MT8A 3BPZA 1O9GA 5B1BB 1SQQH 3STZC 4MVQA 1VQKV 1MABG 1MSWD 4BIUA 3CCMV 4PA9A 3QF7A 4U7OA 1JMKC 1AJPA 4DR3O 4JI5O 4MSWC 1N34O 1S5JA 1WPBA 1GN2A 4CBCA 2IJHA 4NXNB 1R73A 2RJZA 1AVMA 3IFXA 4PA7A 5B5EZ 1AP6A 4JYYA 2F23A 3K0DA 5KMGA 4LFBB 5KX5A 2IJKA 4Q6GA 2QDOA 1Y6XA 4G2KA 2UXCO 3SJBC 4UXNA 1EBOA 4I4TB 4JZ2A 4GUNA 5FNVA 2QWRB 4DRXA 5LP6A 1XNQO 2XAGA 4J7ZA 3JALA 4LP8A 2OYQA 3S3XA 2EIMB 4MTGA 1HR0O 5LHGA 2EILC 4TT3G 4WFAV 4QE9A 4NYKA 3Q4HB 3AG3B 2ZIOA 2HHHB 2XNDG 3B77A 3OFNG 4DUZB 4Z1VA 1VF6C 2EIKB 4FLVA 1TGOA 1EN6A 2EJRA 3JSNA 4I50A 5LXTB 4JYAO 1YXBA 1AROP 5JVDA 4ZKIA 4UVAA 4X1YB 2YIDA 1D5NA 3CSXA 4IHJA 5B1OA 3JD0A 2YC0A 2CH7B 5DM6V 4K0KO 4L8JA 1Y76A 3G4SV 1I94B 1HDJA 4DR5B 4O4HA 2DQ3A 1I7FA 3K58A 1WAZA 4O4LA 5A2QN 5K1PA 1P49A 1QHTA 4LF6B 1EN4A 2HEPA 3CCEV 5JCOA 4X20B 4PHZA 4LC1A 4UB6Z 4CC5A 1K8AW 2H8PC 2GDSA 2ATKC 2LO1A 2CK3G 5EZYA 3L74H 3CRAA 3RYIB 3AK2A 3QO8A 2VQEO 3OAAG 2JJ1G 2Y48A 1HNZO 3B8MA 4FIPC 1CXZB 2CGNA 4JI2B 4ZIBA 4PV1B 2X0LA 3C3TA 1SQBH 4GX1A 5KHIA 2JS3A 4DV3B 3HB3B 2CUGA 1R3KC 3L9DA 3RVZA 1OCOB 3JYCA 1I0HA 4RQFA 3D3QA 4XBFA 2UUAB 3LNMB 3JAWA 3ABKC 3SYPA 4DR6O 1KMIZ 1M57C 4U3JB 1BZKA 3ABLC 4BIOA 3CJHB 3EVKA 3ZBHA 1ZL8B 3RN4A 2RMKB 1SRYA 3JARB 1NH2D 4LNUB 4X66B 5IJ9B 3CD6V 4O4IA 5JJJB 4HNAB 2ARHA 1XEQA 1K4CC 1TVKA 2IU0A 4NB5A 1WP8A 3BABA 1BGYH 4B3TB 3E35A 2UXDO 1YJ9V 5CN0A 3CRCA 3KG2A 1YJNV 1JX9A 2AW9A 3CCLV 1LR1A 1U96A 1VIBA 5LGTA 3OTFA 3CB2A 2JS5A 4EB6B 2QJ1A 1XREA 4IIJB 5LOVB 4AI8A 1SQVH 3U10A 1NZ6A 2EINC 5KHKA 3OD4A 1J5EB 5LA6A 1RFYA 2ZM6O 5BXZA 1G6UA 1RSOB 3BEHA 5H6QA 3ZRWA 2OCCB 4QIWF 2R72A 1ORQC 3E8HA 3ETDA 3SYCA 3OW2U 5E1AC 3WFVA 3ZHVA 3C3SA 5CB4A 1N32O 4LBEC 5CBFA 1R3IC 5CA1A 1R6TA 1Q6UA 1RPRA 1JFFA 3ABMC 1XMOB 4DV0O 1GRJA 2Y0IA 4TQDA 1GO3F 2B1GA 4FLXA 1AR1B 4GT1A 5CBHA 3CRMA 3RYFA 3G6EV 3ZS8C 2ZT9B 2HR3A 2ZNJA 4JV5B 3OR7C 4P9OA 1VF5B 2FB5A 5IYDO 1W59A 1YEWA 2GUZA 2CDYA 3W7XA 3IAYA 3TJTA 3N2GA 1PNKA 3CXHF 2KG7B 1LUWA 4PI2A 3W7WA 4KL1A 3BRCA 3GWOA 2EIMC 2QKCA 4GKJB 2A06H 3ZN1A 4YHHO 4I0XB 4O4JA 4DW1A 2ZE8A 1YCIA 3I56V 4WFHA 3AG3C 2KQXA 2HJDA 2PI4A 2VWJA 4RQEA 2UU9O 2DQ0A 2F95B 2UUCB 2IU3A 4FK5C 2EIKC 2LJ2A 5J2UA 1PKXA 1VMGA 3F5TA 1M93A 1S77D 1Y74B 3SGIA 4MTOA 4X65B 4QPJA 1R6NA 4JAAA 4X62B 3ETGA 1OHHG 3ZIAG 2WLHA 1H2MA 1WP7A 3U11A 1SZXA 2X6CA 1P7GA 1IXBA 4EFBA 2OWOA 2HG5C 2ZD9A 4JI1O 4PDLA 1EN5A 2Q5ZA 1N0JA 2ZKOA 5IYZB 4AILC 2PF4E 2JIZG 4LF9O 3E22A 1XMQB 2XAFA 3ABUA 2ZR3A 3B8NA 4X88A 3AK1A 2LW7A 3JD2A 3E8GA 3W7UA 1IURA 3K0GA 1XNRB 2YIAA 4TUYA 5CA3A 2BTQB 3ZJZA 5L3FA 1AB3A 3FYEB 4AQYB 3CC2V 5LMUB 5KMGB 4RO2A 2QWNB 5F2VO 5KX5B 5L3BA 3UO3A 3P30A 1HW7A 4PDMA 1ZX3A 1SZTA 3DC5A 1M56B 1FJGO 2IH1C 4LF7O 1YTFB 3PJSK 3BVOA 4YJ2B 2DYSB 2K9PA 1FXKA 3K03A 1OCOC 4L87A 4YJ3A 1WPXA 5JH7A 3CPWU 1FXKC 4X89A 4TOIA 4DR7O 3I5DA 3KCYA 4LF8O 1VQPV 1B04A 1DTOA 2WLIA 5BMVB 4MVUA 1TAEA 1S0VA 4LR3A 4DR1O 4GX5A 4I9QA 2JGDA 3E89A 4PDRA 1PV0A 3MD0A 4LFAB 1NI8A 3HKDA 1WJZA 1Y76B 2PUSA 4H37A 3MAQA 1AJNA 4I5SA 5EC1C 4O4LB 2ZXWB 3JCZA 4I55A 5J9PC 2PI5A 2X7RB 1H38A 1W0KG 1K34A 4KHPB 4DV4O 2F4VO 3F7VC 3OMAB 1NR1A 3H1JH 5LYJA 1O9HA 1F7YA 1W0JG 1SKVA 5KA5A 2CTRA 1K7DA 2RNBA 1Y4MA 1K92A 1SQGA 1FFXB 2BTOA 3UCSC 4GKKB 1S3JA 2V4DA 1E1QG 3BA8A 4UCTA 3K3WA 1WA8A 1KYOF 2EJ7A 3SR2C 3AG1B 1IX9A 2XAQA 4DR2B 1J95A 4PELA 2OCCC 2GTSA 2ADPA 2XTAA 3DGEA 4LF5B 3JD1A 5LL6Y 2RN9A 3CHXA 1SESA 1GTOA 4UCRA 2GHYA 2XASA 3SDLA 1XDCA 1IBMB 4FLZA 4RUEA 1XOUA 2IJIA 2KSDA 1KB9F 1VQOV 3H1HH 2E5LB 2BOBC 4J11A 3UQ8A 2Z5UA 1AI7A 1KP3A 3B40A 2OCHA 4U3FH 4CH3A 3M99B 1N36B 4FLWA 2RDCA 1K9MW 5CA0B 4YIPA 4K3AA 1BL8A 1NU1H 4PA3A 4DV5B 2Q68A 3HKCB 5BR8O 4JI4B 2UUBO 4W4KA 2P90A 3SPGA 3K5NA 4X1KA 3ASOB 3JATA 4LFCO 3K5LA 1WB8A 1YI2V 1XQ8A 2P4KA 4HYOA 5IJ0B 4B3MO 1TVKB 2E75B 1MMMA 2XOKG 2FYUH 3HKEA 4FM1A 1TA8A 5ITZB 1T5EA 4F4LA 3L70H 1JJOA 2QSAA 3OUSA 5B1NA 5KHGA 1V55B 3HR0A 5L3GA 2Z3YA 4OXSA 1IJGA 4FM0A 4A5UB 4JI5B 4MVSA 1GN4A 4XDJA 4ZOLA 3JASB 3FX7A 3RYCA 1YJWV 2DW4A 3OT7A 1Q7YW 1OJHA 4YXWG 4E2LA 3N2KA 4J10A 1X59A 4EKWA 2ZNIA 5FL7G 4JYBA 3T4ZA 4G28B 4UVBA 5J2TB 3B2EE 4YY3B 5CA1B 1K5QA 3T1HB 1ZSPA 4ZI7A 2JGUA 1F4NA 3RT3C 1UPGA 1OV9A 1NKDA 4NXNO 4F6RB 1K73W 2MW2B 1HNWB 2Y4TA 2QM8A 2LFRA 5L3DA 4JI6B 3DXRA 4LCUC 2W6JG 4TV8B 3RYHB 4AHCA 4LFBO 1TUBA 1JPXA 4W4LA 1ZAUA 4ZHQB 4E4EA 5B1AB 2H3OA 4H13B 3VQYA 5GTHZ 1VF6A 2KKWA 4WFFA 2Q4PA 2ETNA 3VQVA 1UFIA 1M56C 1L0LH 4JPRA 3AG2B 4DR4B 3O65A 3ZMSA 3OE7G 4IGGA 2DYRC 2HHHO 1NJIW 1QR9A 1BHBA 5JJNB 3W7TA 3P3PA 1XHXA 1XL6A 3JCUZ 5K1XA 3APOA 5J2UB 2HVKC 4QNHB 2P6JA 3X2QC 3FB7C 1L0NH 1IZ3A 4JAUA 4PI0A 5FPOA 1ZTEA 1BT8A 3MHHC 2QTSA 1PL4A 5EIBD 4UV9A 4YIOA 1I94O 3JAKA 4DR5O 3FD9A 1QVFU 3AG4C 2A0LA 4BW5A 4LF6O 3FAVB 2ZXWC 1S5LZ 1M9NA 1TUEB 2Y4UA 3FYIB 4QGPA 4JZGA 3UT5A 1NH2B 2KB1A 1HNZB 4LWSA 2GSMB 4GX2A 3SYAA 1AI5A 2XT9A 5LHHA 4J7JA 2AHYA 1BQ0A 2M7WA 1VQMV 1PNMA 4P30A 2MK3A 3ZRSA 2A9HA 2GV9A 2A7WA 3D3IA 5EYPB 2P4VA 2CTQA 2WLLB 1LNQA 3UKMA 3AG1C 1BCCH 2YXHA 1QLEB 1R3LC 2WLMA 5GW7A 4TV9A 2F43G 4JI2O 4X64B 2YEVB 4BIZA 4TWKA 4F6EA 2Y0PA 3T1YB 4FFKA 3HKBA 1I5YA 4IYHA 3R66A 3ZMTA 2VQFB 4DUYB 4EFEA 3F5WC 2WSSG 1ZLZA 4DV3O 4NVPA 5B3SB 4WBNA 1VQNV 3CRQA 1L1FA 2VS0A 4DV1O 3OGIB 2DE0X 3EHBB 2E74B 2Q9LA 4K8ZA 2UUAO 3OUFA 1Q6HA 2ZE5A 3E8FA 4J9YB 1GM9A 4N23A 3B4SA 2B5UA 1W2BU 2Q8VA 1OCZB 4DO2A 5JQGB 3H1LH 3LNNA 1VEWA 3OTOB 4X66O 1XI1A 4B3SB 3ASOC 1K4DC 4HAMA 5KLVH 4LF4O 1OCRB 2E76B 4J7KA 1PPJH 3TXQA 5IWAB 4B3TO 1BMFG 2CTWA 3H1IH 1R3JC 2M6YA 3R65A 3L71H 4UCUA 5B1BC 5LYJB 4DV2B 3RFRA 4QPKA 3SYQA 5CBGA 1M90W 1V55C 5H5NA 5A9GA 1YF2A 2DMXA 4OPHA 2QR4A 2ILMA 5C8YB 1QNMA 3B09A 4N21A 1MZFA 2FTKA 5EBWC 1YSCA 1CP9A 1H2NA 3ZX6A 1J5EO 4JI3B 4DV0B 4FFBB 1HNXB 2BSKB 5GONB 2IM9A 4J41A 3FFQA 2O57A 4CH4A 1IBKB 4G27B 2P22C 2LFSA 5KHJA 1XBLA 3LDCA 1JCHA 4JI0B 2JRIA 1XMOO 4I4TA 3ZHTA 3CS5A 3STLC 4FVMA 3ZCCA 4C7UA 4DK0A 1NTZH 1QBZA 1GKFA 4JV5O 2OTLV 3Q4HA 4NXMB 2PYLA 3CCQV 1Q6IA 2EZPA 3D36C 3PN1A 5AG2A 1KP2A 2P06A 4XDLA 5B1AC 1RM1B 4QE7A 2RQ6A 2JDIG 5LXTA 3F7YC 4RWUA 4GKJO 1KBHA 3CC7V 4FMTA 1Q43A 1JOYA 1IXMA 4X1YA 4H44B 3WU2Z 1Q3EA 1SS3A 3RW0A 1QLNA 4P2ZA 3GWKC 1N4CA 2UUCO 4FZ1A 2XHBA 3DC6A 1DLBA 4IT5A 4JGSA 3RBZA 4X65O 1SETA 3J7AU 4OGQB 1BS3A 4OX9B 4GYCB 3SJCC 1JR9A 4X20A 3THOA 4X62O 4NTWA 2OTJV 4ZOLB 2HFEC 2W0XA 3BCCH 1N0NA 2P5OA 2W0FC 1YVWA 3M8AA 1SQFA 1MOFA 2EX3A 5DN6G 4NTXA 1K33A 3RVYA 4FLTA 2D2CB 2QWQB 4WFBV 2ZDIC 3H01A 1XMQO 1N33O 3IGAC 1OZ0A 4BAYA 2Z0AA 1OCCB 1FFTB 5D5QA 5FNVB 4DRXB 5LP6B 5IYCO 1XNRO 4CZZA 2PZSA 2YXYA 3JALB 2DWDC 4HZ3A 2YS8A 1COWG 1B3QA 2EILB 3VBBA 2DJVA 3OM3B 4AQYO 2WLJA 1K97A 3ZHSA 1NTKH 2V1DA 5LMUO 1M5IA 1M1KW 4GLXA 4PD4F 1LUVA 1TUBB 2NN4A 1VARA 4MTXA 4FLYA 3T1CA 4TSFG 4PA6A 2PY5A 1THZA 1ENVA 4RAIA 3BFRA 4JI8B 2IW5A 1DF5A 1AR4A 4U3JA 3H9VA 4I50B 4PJ0Z 2NR5A 5B3SC 3CJHA 5JVDB 2C2AA 1ZL8A 2LQTA 4IHJB 2CGOA 3JAMN 3E2EA 4B3RB 1Y66A 4WFGA 5KUKA 4LNUA 3DSQA 5IJ9A 2L6LA 5L3EA 5IT9N 2AHZA 4O4HB 1XHZA 1CPYA 3LSQA 1MNGA 1URFA 4DV6B 4WCEV 2XAHA 1NT2B 1YDXA 1AP5A 4LH7A 2PTMA 5JJEB 1SF9A 5LMNB 4LFAO 1OCZC 1JJ2U 4J9ZB 5LGUA 3GVMA 3NR7A 4DK1A 1QU7A 1QVGU 1IBLB 4DW0A 3A0BZ 1H2KA 2CTPA 1GN3A 5EZYB 1DF4A 2QTOA 3CCUV 1I5XA 4EB6A 3K5OA 5LOVA 3EXAA 2AXTZ 3BA9A 3ICXA 1ZWIC 4KHPO 3P32A 4UUJC 2Q7EA 1RSOA 3UT5B 1PD3A 3ZMZA 3OEHG 4UFZA 3UO2A 2F93B 3KZIZ 3CC4V 4GKKO 4U7NA 3T4DA 1US6A 3TGUH 3OMIB 4UCVA 3SPHA 3ZRVA 4OPAA 3P3NA 2Y69B 4DR2O 3D8CA 1Z5VA 4TV9B 3VQWA 4LF5O 2YXLA 3JAWB 4MVMA 2Q0OC 3GB7C 4JI7B 4FPPA 4JAVA 2UXBB 2H94A 3K08A 1IBMO 4FJCC 3LSSA 4KFMA 4CC6A 1H2SB 5BR8B 2AZ2A 2UUBB 2E5LO 5IDJA 4Q20A 1WNSA 2B9ZA 1P7BA 2X6AA 2JVDA 3IC9A 1VQ7V 4O4IB 1N36O 4DV7B 4GX0A 3AK3A 3QNEA 5LBQA 2A79B 5KAIZ 1F23A 3C90A 1PM9A 1RPOA 1V9PA 2PGGA 1VQ6V 3JD3A 4B7EA 4DV5O 3A8TA 2ZR2A 4JI4O 1RM1C 1Y74A 1S72V 2LGQA 1FXHA 1FD9A 2IJJA 5JWPA 1G8MA 4DR3B 3H1KH 3CMEV 1N34B 1N8RW 4MS2A 2ZINA 1GM8A 4UB8Z 4BR6A 1NVPD 2EINB 3A2FA 2Q7GA 2YUAA 5HFMA 5LA6B 2ZE7A 3ZRWB 2QKSA 1Q86W 2WAMA 3ZHRA 2ZCEA 5IYZA 3CXCU 5CB4B 2EIJB 3BY6A 3APQA 1WN7A 2CAZC 3ABMB 1MZEA 2QEXV 3FB6C 1JFFB 2UXCB 1XNQB 2YDEA 1RP3B 2BTQA 2QWOB 1Z5WA 3RYFB 3G80A 1HR0B 1Q5OA 2WA3A 5EBLC 3TCUA 4YY3O 3J81N 3T1HO 4NTYA 4MTFA 4TQFA 3G6BA 2GUZB 1VQ5V 2Q6AA 2K1EA 1OCCC 3N2GB 1E79G 1HNWO 1I08A 5LP6C 3CEIA 3L75H 1H8EG 4YJ2A 1FOUA 4JI6O 1MG1A 4R50A 4JYAB 2DYSC 5E79Z 1JQ0A 1AI6A 4CS2A 4O4JB 3WG7B 1Q90D 1ROPA 1VQ4V 4CS3A 4K0KB 4DUZO 2HLDG 2RCVA 2ODMA 2AGAA 5BMVA 4R8CA 4DR4O 3J80N 2QGNA 2UXNA 3CX5F 4PA4A 2W6IG 4MVZA 1NBMG 1YZBA 1XILA 3ML0A 3K79A 2G38A 3ZMUA 4Z1MG 2F66C 5BY1A 2JK5C 5KHHA 4X9QA 3ZHQA 2R9RB 1G1XB 4X1IA 5H2FZ 3SPIA 1VQ9V 2VQEB 2ITCC 2YI9A 3HPLC 2E3CA 5JCOC 3K59A 3E22B 2QKAA 1VP7A 1FFXA 2V7QG 1BE3H 1V54B 3AEIA 4D6TH 4QJFB 4TUYB 3ZHUA 3K04A 3AG7A 4MW8A 3SJAC 3L72H 3LDEA 2QM4A 1D5AA 3FB5C 4MW3A 4JTAB 2GTAA 2BCCH 2B1IA 3CCSV 3W7SA 1CEZA 3RWRD 3O9OA 4P9PA 1GH6A 3ETEA 4O2AA 1KECA 4DR6B 4KP4A 1XL4A 3ETQA 3UM7A 5EK0A 2YSUB 1FXKB 2EULA 2Y69C 4YJ3B 1S5HC 5JH7B 4DV1B 1QCEA 2ZIMA 1EZVH 5DEDA 4MVOA 3CWBH 3K9AA 4X64O 2R70A 3T1YO 1KQSU 2WLIB 1GK9A 1AILA 2VQFO 4DUYO 3CYOA 1F51A 4I9WA 5CA0A 2JJ2G 1KUQA 3EFFK 5KA6A 1SA0A 2JGDB 4LH6A 1SERA 3HKCA 5FLXN 2UXDB 3ZN0A 1D2DA 4O2BA 4BW9A 1H2LA 3HKDB 4ICGA 2ZE6A 4H33A 5IJ0A 3BAAA 5D5PA 2GBOA 4LF4B 3CMAV 2XAJA 1QQCA 4I55B 4XDKA 1R1BA 2LW1A 4J42A 2VWKA 1YIJV 5ITZA 1U97A 3SPCA 4B08A 3I55V 2ZM6B 4HBNA 5B66Z 3OTOO 4B3SO 5KUMA 4WF9V 1N32B 3CE2A 3A0RA 3LUTB 3JD4A 3JASA 1X4TA 5IWAO 1K5SA 3T2MA 3SYOA 1WA8B 4UCOA 4GCZA 4DV2O 2WPDG 3JSLA 1ZUQA 1WLEA 2WLNA 5J2TA 5HFLA 1NTMH 2P67A 2EIJC 3A0HZ 1K3EA 1NS1A 1XUQA 2AZ0A 4JASA 2BE3A 3MHSC 2ITDC 3OGCC 2DN9A 3K57A 4JI3O 4F6RA 1JA8A 1AI4A 5L3CA 3WB2A 1HNXO 2YIBD 3E86A 2JEXA 4ABMA 2N05A 2R9IA 1EFRG 2YI8A 1IBKO 1VQLV 2Q73A 4TV8A 3RYHA 4FLUA 4YHHB 4JI0O 2QM7A 1NQTA 2YICA 4ZHQA 3D36A 5CMUA 5EIBC 1IVSA 2OIEA 1Q82W 1DK1A 2UU9B 1EZJA 1SC5B 1EM1A 2PYJA 3ASNB 4I7ZB 3AG2C
chains in the Genus database with same CATH topology
1BS3A 4JZGA 1JR9A 3MDSA 3KDRA 1XILA 3K9SA 2ADPA 5A9GA 1ZSPA 1GN3A 1QNMA 2CDYA 1N0NA 4BR6A 3TJTA 3DC5A 1XDCA 4X9QA 1IDSA 1KKCA 1MA1A 1LUWA 1WB7A 1EN6A 3EVKA 2QKCA 3RN4A 1D5NA 1GN6A 3KKYA 1AR5A 1MSDA 2QKAA 4E4EA 4F6EA 4FFKA 4YIPA 1ZLZA 1B06A 2CE4A 1EN4A 4C7UA 1BSMA 2AW9A 1ZUQA 1LUVA 1WB8A 1VARA 2P4KA 2GDSA 2ADQB 1SZXA 1XUQA 1GN2A 1P7GA 1XREA 1IXBA 5AG2A 3BFRA 1I08A 1JA8A 1MMMA 1AR4A 3CEIA 1EN5A 3AK2A 1AVMA 1N0JA 1AP6A 4JYYA 1ZTEA 1VEWA 3C3SA 1BT8A 3IC9A 1PL4A 1GN4A 4YIOA 1Y67A 2RCVA 3AK3A 3AK1A 4JZ2A 4GUNA 1PM9A 3C3TA 3OT7A 3LSUA 1MNGA 3QVNA 3DC6A 1EM1A 1AP5A 1IX9A 1I0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BS3 A;  4JZG A;  1JR9 A;  3MDS A;  1XIL A;  3K9S A;  2ADP A;  5A9G A;  1ZSP A;  1GN3 A;  1QNM A;  2CDY A;  1N0N A;  4BR6 A;  3TJT A;  3DC5 A;  1XDC A;  4X9Q A;  1IDS A;  1KKC A;  1MA1 A;  1LUW A;  1WB7 A;  1EN6 A;  3EVK A;  2QKC A;  3RN4 A;  1D5N A;  1GN6 A;  3KKY A;  1AR5 A;  1MSD A;  2QKA A;  4E4E A;  4F6E A;  4FFK A;  4YIP A;  1ZLZ A;  1B06 A;  2CE4 A;  1EN4 A;  4C7U A;  1BSM A;  2AW9 A;  1ZUQ A;  1LUV A;  1WB8 A;  1VAR A;  2P4K A;  2GDS A;  2ADQ B;  1SZX A;  1XUQ A;  1GN2 A;  1P7G A;  1XRE A;  1IXB A;  5AG2 A;  3BFR A;  1I08 A;  1JA8 A;  1MMM A;  1AR4 A;  3CEI A;  1EN5 A;  3AK2 A;  1AVM A;  1N0J A;  1AP6 A;  4JYY A;  1ZTE A;  1VEW A;  3C3S A;  1BT8 A;  3IC9 A;  1PL4 A;  1GN4 A;  4YIO A;  1Y67 A;  2RCV A;  3AK3 A;  3AK1 A;  4JZ2 A;  4GUN A;  1PM9 A;  3C3T A;  3OT7 A;  3LSU A;  1MNG A;  3QVN A;  3DC6 A;  1EM1 A;  1AP5 A;  1IX9 A;  1I0H A; 
#chains in the Genus database with same CATH topology
 4X1K B;  5IY5 B;  3JAT B;  5IE9 A;  2VRZ A;  4NXM O;  2N74 A;  3MDS A;  3ZMV A;  3KDR A;  2EZO A;  3WG7 C;  2CH7 A;  2FL4 A;  4UV8 A;  3CCV V;  4ZBM A;  3VQX A;  3FKS G;  3HKE B;  1IDS A;  1KKC A;  2Q0A A;  1MA1 A;  2QWP B;  3TK1 A;  1FXV A;  4JI1 B;  3L73 H;  1YIT V;  2NLJ C;  5IYB O;  5EBM C;  2UXX A;  4UVC A;  2EBO A;  2L35 A;  2FML A;  1L8D A;  3E83 A;  3QG5 A;  5DEC A;  4B7K A;  3KKY A;  3U0Z A;  4LF9 B;  2Q67 A;  3K5M A;  4ASU G;  3RYC B;  3VOU A;  3RYI A;  1B06 A;  4WFE A;  3N2K B;  3FAV A;  2LP7 A;  2ZDI A;  4OX9 O;  1BSM A;  4EEQ A;  3QO7 A;  2DWE C;  1N33 B;  1Q8I A;  2ADQ B;  4ZI7 B;  2BOC C;  1VQ8 V;  4MVR A;  2QA4 V;  1V54 C;  1KU9 A;  1SQP H;  2D3O W;  1FJG B;  1UJW B;  4LF7 B;  2N04 A;  4JTC B;  5EYP A;  2WLL A;  1NR7 A;  3ZED A;  3DXR B;  1JNB A;  2QE7 G;  4DR7 B;  1QLE C;  3LDD A;  4LF8 B;  4IYI A;  1Y67 A;  2YEV A;  2DOS A;  2WA4 A;  1B6Q A;  4DR1 B;  1HP8 A;  3S3W A;  4R7C A;  1BQZ A;  2HKO A;  2DYR B;  1KKD A;  2X6B A;  3ABT A;  4J80 A;  4CH5 A;  4NR1 A;  3K06 A;  3IJ4 A;  3JAR A;  5BZB A;  2OT5 A;  1QR8 A;  3M7M X;  2Q7H A;  2JEU A;  3RGB A;  1DGS A;  3DTU B;  1GM7 A;  4HNA A;  1FKA O;  4JI8 O;  3QO5 A;  1H8H G;  3SPJ A;  4IL6 Z;  3X2Q B;  4DXW A;  1KD1 W;  2NNU A;  4JYC A;  2YIB A;  1GMG A;  2IH3 C;  4DV4 B;  3IC7 A;  4PDV A;  1E1R G;  3ZRX A;  5JQG A;  2F4V B;  4B3R O;  2IBZ H;  1AR5 A;  1MSD A;  5H6R A;  3KCX A;  2R9A A;  1P4R A;  2ZQM A;  4R6Z A;  3JAK B;  3AG4 B;  2XUM A;  1YHQ V;  3FB8 C;  3G67 A;  4DV6 O;  1OCR C;  4IIJ A;  4K35 A;  5KAF Z;  4X1I B;  2CE4 A;  4NKG B;  5LMN O;  1YTF D;  4D7T A;  5LGN A;  1SQX H;  5GTI Z;  1H2G A;  5LHI A;  3TXS A;  4JTD B;  4CH6 A;  1IBL O;  4FZ0 A;  4LWS B;  1GAX A;  4BWA A;  4D7S A;  3CP1 A;  5C8Y A;  3OEE G;  1KC8 W;  1BHA A;  2WWW A;  4K8X A;  4FFB A;  2BSK A;  5GON A;  1VF7 A;  2F1M A;  4DYL A;  2Q69 A;  3BHP A;  5FPR A;  2HJF C;  4GZR B;  4X8A A;  1PNL A;  4KXR A;  3ABK B;  1FPO A;  4JF3 A;  4CS4 A;  3HKB B;  3QTC A;  1F4M A;  3CRR A;  1NVP B;  3N27 A;  3OMN B;  1R6K A;  3OR6 C;  1FS0 G;  1Q81 W;  1M57 B;  4O2A B;  3ABL B;  3LSU A;  1FYJ A;  3QVN A;  4RUF A;  5EC2 C;  4WBN B;  3CCJ V;  1G4Y B;  3WB1 A;  1AJQ A;  2P7T C;  2KG7 A;  1Z2G A;  2HVJ C;  4UCS A;  5C93 A;  3SJQ C;  4LFC B;  1JVM A;  2OIG A;  3WB0 A;  3NXS A;  3K9S A;  4H0L B;  2FKX A;  3E8B A;  4I0X A;  1PP9 H;  4Z2W A;  4JI7 O;  4B3M B;  3G71 V;  2UXB O;  3TET A;  1H5W A;  1SA0 B;  1M4U A;  1WB7 A;  1HWY A;  4O2B B;  4FM2 A;  3ASN C;  2LGW A;  1P84 F;  2A3Q A;  2WLK A;  3CCR V;  1FAF A;  1GN6 A;  1A32 A;  5IY5 C;  2HP8 A;  4KUM A;  4DV7 O;  1PL0 A;  5TIS Z;  5H9C A;  1S76 D;  4MT8 A;  3BPZ A;  1O9G A;  5B1B B;  1SQQ H;  3STZ C;  4MVQ A;  1VQK V;  1MAB G;  1MSW D;  4BIU A;  3CCM V;  4PA9 A;  3QF7 A;  4U7O A;  1JMK C;  1AJP A;  4DR3 O;  4JI5 O;  4MSW C;  1N34 O;  1S5J A;  1WPB A;  1GN2 A;  4CBC A;  2IJH A;  4NXN B;  1R73 A;  2RJZ A;  1AVM A;  3IFX A;  4PA7 A;  5B5E Z;  1AP6 A;  4JYY A;  2F23 A;  3K0D A;  5KMG A;  4LFB B;  5KX5 A;  2IJK A;  4Q6G A;  2QDO A;  1Y6X A;  4G2K A;  2UXC O;  3SJB C;  4UXN A;  1EBO A;  4I4T B;  4JZ2 A;  4GUN A;  5FNV A;  2QWR B;  4DRX A;  5LP6 A;  1XNQ O;  2XAG A;  4J7Z A;  3JAL A;  4LP8 A;  2OYQ A;  3S3X A;  2EIM B;  4MTG A;  1HR0 O;  5LHG A;  2EIL C;  4TT3 G;  4WFA V;  4QE9 A;  4NYK A;  3Q4H B;  3AG3 B;  2ZIO A;  2HHH B;  2XND G;  3B77 A;  3OFN G;  4DUZ B;  4Z1V A;  1VF6 C;  2EIK B;  4FLV A;  1TGO A;  1EN6 A;  2EJR A;  3JSN A;  4I50 A;  5LXT B;  4JYA O;  1YXB A;  1ARO P;  5JVD A;  4ZKI A;  4UVA A;  4X1Y B;  2YID A;  1D5N A;  3CSX A;  4IHJ A;  5B1O A;  3JD0 A;  2YC0 A;  2CH7 B;  5DM6 V;  4K0K O;  4L8J A;  1Y76 A;  3G4S V;  1I94 B;  1HDJ A;  4DR5 B;  4O4H A;  2DQ3 A;  1I7F A;  3K58 A;  1WAZ A;  4O4L A;  5A2Q N;  5K1P A;  1P49 A;  1QHT A;  4LF6 B;  1EN4 A;  2HEP A;  3CCE V;  5JCO A;  4X20 B;  4PHZ A;  4LC1 A;  4UB6 Z;  4CC5 A;  1K8A W;  2H8P C;  2GDS A;  2ATK C;  2LO1 A;  2CK3 G;  5EZY A;  3L74 H;  3CRA A;  3RYI B;  3AK2 A;  3QO8 A;  2VQE O;  3OAA G;  2JJ1 G;  2Y48 A;  1HNZ O;  3B8M A;  4FIP C;  1CXZ B;  2CGN A;  4JI2 B;  4ZIB A;  4PV1 B;  2X0L A;  3C3T A;  1SQB H;  4GX1 A;  5KHI A;  2JS3 A;  4DV3 B;  3HB3 B;  2CUG A;  1R3K C;  3L9D A;  3RVZ A;  1OCO B;  3JYC A;  1I0H A;  4RQF A;  3D3Q A;  4XBF A;  2UUA B;  3LNM B;  3JAW A;  3ABK C;  3SYP A;  4DR6 O;  1KMI Z;  1M57 C;  4U3J B;  1BZK A;  3ABL C;  4BIO A;  3CJH B;  3EVK A;  3ZBH A;  1ZL8 B;  3RN4 A;  2RMK B;  1SRY A;  3JAR B;  1NH2 D;  4LNU B;  4X66 B;  5IJ9 B;  3CD6 V;  4O4I A;  5JJJ B;  4HNA B;  2ARH A;  1XEQ A;  1K4C C;  1TVK A;  2IU0 A;  4NB5 A;  1WP8 A;  3BAB A;  1BGY H;  4B3T B;  3E35 A;  2UXD O;  1YJ9 V;  5CN0 A;  3CRC A;  3KG2 A;  1YJN V;  1JX9 A;  2AW9 A;  3CCL V;  1LR1 A;  1U96 A;  1VIB A;  5LGT A;  3OTF A;  3CB2 A;  2JS5 A;  4EB6 B;  2QJ1 A;  1XRE A;  4IIJ B;  5LOV B;  4AI8 A;  1SQV H;  3U10 A;  1NZ6 A;  2EIN C;  5KHK A;  3OD4 A;  1J5E B;  5LA6 A;  1RFY A;  2ZM6 O;  5BXZ A;  1G6U A;  1RSO B;  3BEH A;  5H6Q A;  3ZRW A;  2OCC B;  4QIW F;  2R72 A;  1ORQ C;  3E8H A;  3ETD A;  3SYC A;  3OW2 U;  5E1A C;  3WFV A;  3ZHV A;  3C3S A;  5CB4 A;  1N32 O;  4LBE C;  5CBF A;  1R3I C;  5CA1 A;  1R6T A;  1Q6U A;  1RPR A;  1JFF A;  3ABM C;  1XMO B;  4DV0 O;  1GRJ A;  2Y0I A;  4TQD A;  1GO3 F;  2B1G A;  4FLX A;  1AR1 B;  4GT1 A;  5CBH A;  3CRM A;  3RYF A;  3G6E V;  3ZS8 C;  2ZT9 B;  2HR3 A;  2ZNJ A;  4JV5 B;  3OR7 C;  4P9O A;  1VF5 B;  2FB5 A;  5IYD O;  1W59 A;  1YEW A;  2GUZ A;  2CDY A;  3W7X A;  3IAY A;  3TJT A;  3N2G A;  1PNK A;  3CXH F;  2KG7 B;  1LUW A;  4PI2 A;  3W7W A;  4KL1 A;  3BRC A;  3GWO A;  2EIM C;  2QKC A;  4GKJ B;  2A06 H;  3ZN1 A;  4YHH O;  4I0X B;  4O4J A;  4DW1 A;  2ZE8 A;  1YCI A;  3I56 V;  4WFH A;  3AG3 C;  2KQX A;  2HJD A;  2PI4 A;  2VWJ A;  4RQE A;  2UU9 O;  2DQ0 A;  2F95 B;  2UUC B;  2IU3 A;  4FK5 C;  2EIK C;  2LJ2 A;  5J2U A;  1PKX A;  1VMG A;  3F5T A;  1M93 A;  1S77 D;  1Y74 B;  3SGI A;  4MTO A;  4X65 B;  4QPJ A;  1R6N A;  4JAA A;  4X62 B;  3ETG A;  1OHH G;  3ZIA G;  2WLH A;  1H2M A;  1WP7 A;  3U11 A;  1SZX A;  2X6C A;  1P7G A;  1IXB A;  4EFB A;  2OWO A;  2HG5 C;  2ZD9 A;  4JI1 O;  4PDL A;  1EN5 A;  2Q5Z A;  1N0J A;  2ZKO A;  5IYZ B;  4AIL C;  2PF4 E;  2JIZ G;  4LF9 O;  3E22 A;  1XMQ B;  2XAF A;  3ABU A;  2ZR3 A;  3B8N A;  4X88 A;  3AK1 A;  2LW7 A;  3JD2 A;  3E8G A;  3W7U A;  1IUR A;  3K0G A;  1XNR B;  2YIA A;  4TUY A;  5CA3 A;  2BTQ B;  3ZJZ A;  5L3F A;  1AB3 A;  3FYE B;  4AQY B;  3CC2 V;  5LMU B;  5KMG B;  4RO2 A;  2QWN B;  5F2V O;  5KX5 B;  5L3B A;  3UO3 A;  3P30 A;  1HW7 A;  4PDM A;  1ZX3 A;  1SZT A;  3DC5 A;  1M56 B;  1FJG O;  2IH1 C;  4LF7 O;  1YTF B;  3PJS K;  3BVO A;  4YJ2 B;  2DYS B;  2K9P A;  1FXK A;  3K03 A;  1OCO C;  4L87 A;  4YJ3 A;  1WPX A;  5JH7 A;  3CPW U;  1FXK C;  4X89 A;  4TOI A;  4DR7 O;  3I5D A;  3KCY A;  4LF8 O;  1VQP V;  1B04 A;  1DTO A;  2WLI A;  5BMV B;  4MVU A;  1TAE A;  1S0V A;  4LR3 A;  4DR1 O;  4GX5 A;  4I9Q A;  2JGD A;  3E89 A;  4PDR A;  1PV0 A;  3MD0 A;  4LFA B;  1NI8 A;  3HKD A;  1WJZ A;  1Y76 B;  2PUS A;  4H37 A;  3MAQ A;  1AJN A;  4I5S A;  5EC1 C;  4O4L B;  2ZXW B;  3JCZ A;  4I55 A;  5J9P C;  2PI5 A;  2X7R B;  1H38 A;  1W0K G;  1K34 A;  4KHP B;  4DV4 O;  2F4V O;  3F7V C;  3OMA B;  1NR1 A;  3H1J H;  5LYJ A;  1O9H A;  1F7Y A;  1W0J G;  1SKV A;  5KA5 A;  2CTR A;  1K7D A;  2RNB A;  1Y4M A;  1K92 A;  1SQG A;  1FFX B;  2BTO A;  3UCS C;  4GKK B;  1S3J A;  2V4D A;  1E1Q G;  3BA8 A;  4UCT A;  3K3W A;  1WA8 A;  1KYO F;  2EJ7 A;  3SR2 C;  3AG1 B;  1IX9 A;  2XAQ A;  4DR2 B;  1J95 A;  4PEL A;  2OCC C;  2GTS A;  2ADP A;  2XTA A;  3DGE A;  4LF5 B;  3JD1 A;  5LL6 Y;  2RN9 A;  3CHX A;  1SES A;  1GTO A;  4UCR A;  2GHY A;  2XAS A;  3SDL A;  1XDC A;  1IBM B;  4FLZ A;  4RUE A;  1XOU A;  2IJI A;  2KSD A;  1KB9 F;  1VQO V;  3H1H H;  2E5L B;  2BOB C;  4J11 A;  3UQ8 A;  2Z5U A;  1AI7 A;  1KP3 A;  3B40 A;  2OCH A;  4U3F H;  4CH3 A;  3M99 B;  1N36 B;  4FLW A;  2RDC A;  1K9M W;  5CA0 B;  4YIP A;  4K3A A;  1BL8 A;  1NU1 H;  4PA3 A;  4DV5 B;  2Q68 A;  3HKC B;  5BR8 O;  4JI4 B;  2UUB O;  4W4K A;  2P90 A;  3SPG A;  3K5N A;  4X1K A;  3ASO B;  3JAT A;  4LFC O;  3K5L A;  1WB8 A;  1YI2 V;  1XQ8 A;  2P4K A;  4HYO A;  5IJ0 B;  4B3M O;  1TVK B;  2E75 B;  1MMM A;  2XOK G;  2FYU H;  3HKE A;  4FM1 A;  1TA8 A;  5ITZ B;  1T5E A;  4F4L A;  3L70 H;  1JJO A;  2QSA A;  3OUS A;  5B1N A;  5KHG A;  1V55 B;  3HR0 A;  5L3G A;  2Z3Y A;  4OXS A;  1IJG A;  4FM0 A;  4A5U B;  4JI5 B;  4MVS A;  1GN4 A;  4XDJ A;  4ZOL A;  3JAS B;  3FX7 A;  3RYC A;  1YJW V;  2DW4 A;  3OT7 A;  1Q7Y W;  1OJH A;  4YXW G;  4E2L A;  3N2K A;  4J10 A;  1X59 A;  4EKW A;  2ZNI A;  5FL7 G;  4JYB A;  3T4Z A;  4G28 B;  4UVB A;  5J2T B;  3B2E E;  4YY3 B;  5CA1 B;  1K5Q A;  3T1H B;  1ZSP A;  4ZI7 A;  2JGU A;  1F4N A;  3RT3 C;  1UPG A;  1OV9 A;  1NKD A;  4NXN O;  4F6R B;  1K73 W;  2MW2 B;  1HNW B;  2Y4T A;  2QM8 A;  2LFR A;  5L3D A;  4JI6 B;  3DXR A;  4LCU C;  2W6J G;  4TV8 B;  3RYH B;  4AHC A;  4LFB O;  1TUB A;  1JPX A;  4W4L A;  1ZAU A;  4ZHQ B;  4E4E A;  5B1A B;  2H3O A;  4H13 B;  3VQY A;  5GTH Z;  1VF6 A;  2KKW A;  4WFF A;  2Q4P A;  2ETN A;  3VQV A;  1UFI A;  1M56 C;  1L0L H;  4JPR A;  3AG2 B;  4DR4 B;  3O65 A;  3ZMS A;  3OE7 G;  4IGG A;  2DYR C;  2HHH O;  1NJI W;  1QR9 A;  1BHB A;  5JJN B;  3W7T A;  3P3P A;  1XHX A;  1XL6 A;  3JCU Z;  5K1X A;  3APO A;  5J2U B;  2HVK C;  4QNH B;  2P6J A;  3X2Q C;  3FB7 C;  1L0N H;  1IZ3 A;  4JAU A;  4PI0 A;  5FPO A;  1ZTE A;  1BT8 A;  3MHH C;  2QTS A;  1PL4 A;  5EIB D;  4UV9 A;  4YIO A;  1I94 O;  3JAK A;  4DR5 O;  3FD9 A;  1QVF U;  3AG4 C;  2A0L A;  4BW5 A;  4LF6 O;  3FAV B;  2ZXW C;  1S5L Z;  1M9N A;  1TUE B;  2Y4U A;  3FYI B;  4QGP A;  4JZG A;  3UT5 A;  1NH2 B;  2KB1 A;  1HNZ B;  4LWS A;  2GSM B;  4GX2 A;  3SYA A;  1AI5 A;  2XT9 A;  5LHH A;  4J7J A;  2AHY A;  1BQ0 A;  2M7W A;  1VQM V;  1PNM A;  4P30 A;  2MK3 A;  3ZRS A;  2A9H A;  2GV9 A;  2A7W A;  3D3I A;  5EYP B;  2P4V A;  2CTQ A;  2WLL B;  1LNQ A;  3UKM A;  3AG1 C;  1BCC H;  2YXH A;  1QLE B;  1R3L C;  2WLM A;  5GW7 A;  4TV9 A;  2F43 G;  4JI2 O;  4X64 B;  2YEV B;  4BIZ A;  4TWK A;  4F6E A;  2Y0P A;  3T1Y B;  4FFK A;  3HKB A;  1I5Y A;  4IYH A;  3R66 A;  3ZMT A;  2VQF B;  4DUY B;  4EFE A;  3F5W C;  2WSS G;  1ZLZ A;  4DV3 O;  4NVP A;  5B3S B;  4WBN A;  1VQN V;  3CRQ A;  1L1F A;  2VS0 A;  4DV1 O;  3OGI B;  2DE0 X;  3EHB B;  2E74 B;  2Q9L A;  4K8Z A;  2UUA O;  3OUF A;  1Q6H A;  2ZE5 A;  3E8F A;  4J9Y B;  1GM9 A;  4N23 A;  3B4S A;  2B5U A;  1W2B U;  2Q8V A;  1OCZ B;  4DO2 A;  5JQG B;  3H1L H;  3LNN A;  1VEW A;  3OTO B;  4X66 O;  1XI1 A;  4B3S B;  3ASO C;  1K4D C;  4HAM A;  5KLV H;  4LF4 O;  1OCR B;  2E76 B;  4J7K A;  1PPJ H;  3TXQ A;  5IWA B;  4B3T O;  1BMF G;  2CTW A;  3H1I H;  1R3J C;  2M6Y A;  3R65 A;  3L71 H;  4UCU A;  5B1B C;  5LYJ B;  4DV2 B;  3RFR A;  4QPK A;  3SYQ A;  5CBG A;  1M90 W;  1V55 C;  5H5N A;  5A9G A;  1YF2 A;  2DMX A;  4OPH A;  2QR4 A;  2ILM A;  5C8Y B;  1QNM A;  3B09 A;  4N21 A;  1MZF A;  2FTK A;  5EBW C;  1YSC A;  1CP9 A;  1H2N A;  3ZX6 A;  1J5E O;  4JI3 B;  4DV0 B;  4FFB B;  1HNX B;  2BSK B;  5GON B;  2IM9 A;  4J41 A;  3FFQ A;  2O57 A;  4CH4 A;  1IBK B;  4G27 B;  2P22 C;  2LFS A;  5KHJ A;  1XBL A;  3LDC A;  1JCH A;  4JI0 B;  2JRI A;  1XMO O;  4I4T A;  3ZHT A;  3CS5 A;  3STL C;  4FVM A;  3ZCC A;  4C7U A;  4DK0 A;  1NTZ H;  1QBZ A;  1GKF A;  4JV5 O;  2OTL V;  3Q4H A;  4NXM B;  2PYL A;  3CCQ V;  1Q6I A;  2EZP A;  3D36 C;  3PN1 A;  5AG2 A;  1KP2 A;  2P06 A;  4XDL A;  5B1A C;  1RM1 B;  4QE7 A;  2RQ6 A;  2JDI G;  5LXT A;  3F7Y C;  4RWU A;  4GKJ O;  1KBH A;  3CC7 V;  4FMT A;  1Q43 A;  1JOY A;  1IXM A;  4X1Y A;  4H44 B;  3WU2 Z;  1Q3E A;  1SS3 A;  3RW0 A;  1QLN A;  4P2Z A;  3GWK C;  1N4C A;  2UUC O;  4FZ1 A;  2XHB A;  3DC6 A;  1DLB A;  4IT5 A;  4JGS A;  3RBZ A;  4X65 O;  1SET A;  3J7A U;  4OGQ B;  1BS3 A;  4OX9 B;  4GYC B;  3SJC C;  1JR9 A;  4X20 A;  3THO A;  4X62 O;  4NTW A;  2OTJ V;  4ZOL B;  2HFE C;  2W0X A;  3BCC H;  1N0N A;  2P5O A;  2W0F C;  1YVW A;  3M8A A;  1SQF A;  1MOF A;  2EX3 A;  5DN6 G;  4NTX A;  1K33 A;  3RVY A;  4FLT A;  2D2C B;  2QWQ B;  4WFB V;  2ZDI C;  3H01 A;  1XMQ O;  1N33 O;  3IGA C;  1OZ0 A;  4BAY A;  2Z0A A;  1OCC B;  1FFT B;  5D5Q A;  5FNV B;  4DRX B;  5LP6 B;  5IYC O;  1XNR O;  4CZZ A;  2PZS A;  2YXY A;  3JAL B;  2DWD C;  4HZ3 A;  2YS8 A;  1COW G;  1B3Q A;  2EIL B;  3VBB A;  2DJV A;  3OM3 B;  4AQY O;  2WLJ A;  1K97 A;  3ZHS A;  1NTK H;  2V1D A;  5LMU O;  1M5I A;  1M1K W;  4GLX A;  4PD4 F;  1LUV A;  1TUB B;  2NN4 A;  1VAR A;  4MTX A;  4FLY A;  3T1C A;  4TSF G;  4PA6 A;  2PY5 A;  1THZ A;  1ENV A;  4RAI A;  3BFR A;  4JI8 B;  2IW5 A;  1DF5 A;  1AR4 A;  4U3J A;  3H9V A;  4I50 B;  4PJ0 Z;  2NR5 A;  5B3S C;  3CJH A;  5JVD B;  2C2A A;  1ZL8 A;  2LQT A;  4IHJ B;  2CGO A;  3JAM N;  3E2E A;  4B3R B;  1Y66 A;  4WFG A;  5KUK A;  4LNU A;  3DSQ A;  5IJ9 A;  2L6L A;  5L3E A;  5IT9 N;  2AHZ A;  4O4H B;  1XHZ A;  1CPY A;  3LSQ A;  1MNG A;  1URF A;  4DV6 B;  4WCE V;  2XAH A;  1NT2 B;  1YDX A;  1AP5 A;  4LH7 A;  2PTM A;  5JJE B;  1SF9 A;  5LMN B;  4LFA O;  1OCZ C;  1JJ2 U;  4J9Z B;  5LGU A;  3GVM A;  3NR7 A;  4DK1 A;  1QU7 A;  1QVG U;  1IBL B;  4DW0 A;  3A0B Z;  1H2K A;  2CTP A;  1GN3 A;  5EZY B;  1DF4 A;  2QTO A;  3CCU V;  1I5X A;  4EB6 A;  3K5O A;  5LOV A;  3EXA A;  2AXT Z;  3BA9 A;  3ICX A;  1ZWI C;  4KHP O;  3P32 A;  4UUJ C;  2Q7E A;  1RSO A;  3UT5 B;  1PD3 A;  3ZMZ A;  3OEH G;  4UFZ A;  3UO2 A;  2F93 B;  3KZI Z;  3CC4 V;  4GKK O;  4U7N A;  3T4D A;  1US6 A;  3TGU H;  3OMI B;  4UCV A;  3SPH A;  3ZRV A;  4OPA A;  3P3N A;  2Y69 B;  4DR2 O;  3D8C A;  1Z5V A;  4TV9 B;  3VQW A;  4LF5 O;  2YXL A;  3JAW B;  4MVM A;  2Q0O C;  3GB7 C;  4JI7 B;  4FPP A;  4JAV A;  2UXB B;  2H94 A;  3K08 A;  1IBM O;  4FJC C;  3LSS A;  4KFM A;  4CC6 A;  1H2S B;  5BR8 B;  2AZ2 A;  2UUB B;  2E5L O;  5IDJ A;  4Q20 A;  1WNS A;  2B9Z A;  1P7B A;  2X6A A;  2JVD A;  3IC9 A;  1VQ7 V;  4O4I B;  1N36 O;  4DV7 B;  4GX0 A;  3AK3 A;  3QNE A;  5LBQ A;  2A79 B;  5KAI Z;  1F23 A;  3C90 A;  1PM9 A;  1RPO A;  1V9P A;  2PGG A;  1VQ6 V;  3JD3 A;  4B7E A;  4DV5 O;  3A8T A;  2ZR2 A;  4JI4 O;  1RM1 C;  1Y74 A;  1S72 V;  2LGQ A;  1FXH A;  1FD9 A;  2IJJ A;  5JWP A;  1G8M A;  4DR3 B;  3H1K H;  3CME V;  1N34 B;  1N8R W;  4MS2 A;  2ZIN A;  1GM8 A;  4UB8 Z;  4BR6 A;  1NVP D;  2EIN B;  3A2F A;  2Q7G A;  2YUA A;  5HFM A;  5LA6 B;  2ZE7 A;  3ZRW B;  2QKS A;  1Q86 W;  2WAM A;  3ZHR A;  2ZCE A;  5IYZ A;  3CXC U;  5CB4 B;  2EIJ B;  3BY6 A;  3APQ A;  1WN7 A;  2CAZ C;  3ABM B;  1MZE A;  2QEX V;  3FB6 C;  1JFF B;  2UXC B;  1XNQ B;  2YDE A;  1RP3 B;  2BTQ A;  2QWO B;  1Z5W A;  3RYF B;  3G80 A;  1HR0 B;  1Q5O A;  2WA3 A;  5EBL C;  3TCU A;  4YY3 O;  3J81 N;  3T1H O;  4NTY A;  4MTF A;  4TQF A;  3G6B A;  2GUZ B;  1VQ5 V;  2Q6A A;  2K1E A;  1OCC C;  3N2G B;  1E79 G;  1HNW O;  1I08 A;  5LP6 C;  3CEI A;  3L75 H;  1H8E G;  4YJ2 A;  1FOU A;  4JI6 O;  1MG1 A;  4R50 A;  4JYA B;  2DYS C;  5E79 Z;  1JQ0 A;  1AI6 A;  4CS2 A;  4O4J B;  3WG7 B;  1Q90 D;  1ROP A;  1VQ4 V;  4CS3 A;  4K0K B;  4DUZ O;  2HLD G;  2RCV A;  2ODM A;  2AGA A;  5BMV A;  4R8C A;  4DR4 O;  3J80 N;  2QGN A;  2UXN A;  3CX5 F;  4PA4 A;  2W6I G;  4MVZ A;  1NBM G;  1YZB A;  1XIL A;  3ML0 A;  3K79 A;  2G38 A;  3ZMU A;  4Z1M G;  2F66 C;  5BY1 A;  2JK5 C;  5KHH A;  4X9Q A;  3ZHQ A;  2R9R B;  1G1X B;  4X1I A;  5H2F Z;  3SPI A;  1VQ9 V;  2VQE B;  2ITC C;  2YI9 A;  3HPL C;  2E3C A;  5JCO C;  3K59 A;  3E22 B;  2QKA A;  1VP7 A;  1FFX A;  2V7Q G;  1BE3 H;  1V54 B;  3AEI A;  4D6T H;  4QJF B;  4TUY B;  3ZHU A;  3K04 A;  3AG7 A;  4MW8 A;  3SJA C;  3L72 H;  3LDE A;  2QM4 A;  1D5A A;  3FB5 C;  4MW3 A;  4JTA B;  2GTA A;  2BCC H;  2B1I A;  3CCS V;  3W7S A;  1CEZ A;  3RWR D;  3O9O A;  4P9P A;  1GH6 A;  3ETE A;  4O2A A;  1KEC A;  4DR6 B;  4KP4 A;  1XL4 A;  3ETQ A;  3UM7 A;  5EK0 A;  2YSU B;  1FXK B;  2EUL A;  2Y69 C;  4YJ3 B;  1S5H C;  5JH7 B;  4DV1 B;  1QCE A;  2ZIM A;  1EZV H;  5DED A;  4MVO A;  3CWB H;  3K9A A;  4X64 O;  2R70 A;  3T1Y O;  1KQS U;  2WLI B;  1GK9 A;  1AIL A;  2VQF O;  4DUY O;  3CYO A;  1F51 A;  4I9W A;  5CA0 A;  2JJ2 G;  1KUQ A;  3EFF K;  5KA6 A;  1SA0 A;  2JGD B;  4LH6 A;  1SER A;  3HKC A;  5FLX N;  2UXD B;  3ZN0 A;  1D2D A;  4O2B A;  4BW9 A;  1H2L A;  3HKD B;  4ICG A;  2ZE6 A;  4H33 A;  5IJ0 A;  3BAA A;  5D5P A;  2GBO A;  4LF4 B;  3CMA V;  2XAJ A;  1QQC A;  4I55 B;  4XDK A;  1R1B A;  2LW1 A;  4J42 A;  2VWK A;  1YIJ V;  5ITZ A;  1U97 A;  3SPC A;  4B08 A;  3I55 V;  2ZM6 B;  4HBN A;  5B66 Z;  3OTO O;  4B3S O;  5KUM A;  4WF9 V;  1N32 B;  3CE2 A;  3A0R A;  3LUT B;  3JD4 A;  3JAS A;  1X4T A;  5IWA O;  1K5S A;  3T2M A;  3SYO A;  1WA8 B;  4UCO A;  4GCZ A;  4DV2 O;  2WPD G;  3JSL A;  1ZUQ A;  1WLE A;  2WLN A;  5J2T A;  5HFL A;  1NTM H;  2P67 A;  2EIJ C;  3A0H Z;  1K3E A;  1NS1 A;  1XUQ A;  2AZ0 A;  4JAS A;  2BE3 A;  3MHS C;  2ITD C;  3OGC C;  2DN9 A;  3K57 A;  4JI3 O;  4F6R A;  1JA8 A;  1AI4 A;  5L3C A;  3WB2 A;  1HNX O;  2YIB D;  3E86 A;  2JEX A;  4ABM A;  2N05 A;  2R9I A;  1EFR G;  2YI8 A;  1IBK O;  1VQL V;  2Q73 A;  4TV8 A;  3RYH A;  4FLU A;  4YHH B;  4JI0 O;  2QM7 A;  1NQT A;  2YIC A;  4ZHQ A;  3D36 A;  5CMU A;  5EIB C;  1IVS A;  2OIE A;  1Q82 W;  1DK1 A;  2UU9 B;  1EZJ A;  1SC5 B;  1EM1 A;  2PYJ A;  3ASN B;  4I7Z B;  3AG2 C; 
#chains in the Genus database with same CATH homology
 1BS3 A;  4JZG A;  1JR9 A;  3MDS A;  3KDR A;  1XIL A;  3K9S A;  2ADP A;  5A9G A;  1ZSP A;  1GN3 A;  1QNM A;  2CDY A;  1N0N A;  4BR6 A;  3TJT A;  3DC5 A;  1XDC A;  4X9Q A;  1IDS A;  1KKC A;  1MA1 A;  1LUW A;  1WB7 A;  1EN6 A;  3EVK A;  2QKC A;  3RN4 A;  1D5N A;  1GN6 A;  3KKY A;  1AR5 A;  1MSD A;  2QKA A;  4E4E A;  4F6E A;  4FFK A;  4YIP A;  1ZLZ A;  1B06 A;  2CE4 A;  1EN4 A;  4C7U A;  1BSM A;  2AW9 A;  1ZUQ A;  1LUV A;  1WB8 A;  1VAR A;  2P4K A;  2GDS A;  2ADQ B;  1SZX A;  1XUQ A;  1GN2 A;  1P7G A;  1XRE A;  1IXB A;  5AG2 A;  3BFR A;  1I08 A;  1JA8 A;  1MMM A;  1AR4 A;  3CEI A;  1EN5 A;  3AK2 A;  1AVM A;  1N0J A;  1AP6 A;  4JYY A;  1ZTE A;  1VEW A;  3C3S A;  1BT8 A;  3IC9 A;  1PL4 A;  1GN4 A;  4YIO A;  1Y67 A;  2RCV A;  3AK3 A;  3AK1 A;  4JZ2 A;  4GUN A;  1PM9 A;  3C3T A;  3OT7 A;  3LSU A;  1MNG A;  3QVN A;  3DC6 A;  1EM1 A;  1AP5 A;  1IX9 A;  1I0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...