5AA4A

Crystal structure of mltf from pseudomonas aeruginosa in complex with cell-wall tetrapeptide
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
418
structure length
418
Chain Sequence
EGVLRVITRNSPATYFQDRNGETGFEYELAKRFAERLGVELKIETADNLDDLYAQLSREGGPALAAAGLTPGREDDASVRYSHTYLDVTPQIIYRNGQQRPTRPEDLVGKRIMVLKGSSHAEQLAELKKQYPELKYEESDAVEVVDLLRMVDVGDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLAWALPGGDDDSLMNEVNAFLDQAKKEGLLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPRYESHFKQSGKQKDTDWRLLAAIGYQESLWQPGATSKTGVRGLMMLTNRTAQAMGVSNRLDPKQSIQGGSKYFVQIRSELPESIKEPDRSWFALAAYNIGGAHLEDARKMAEKEGLNPNKWLDVKKMLPRLAQKQWYAKTRYGYARGGETVHFVQNVRRYYDILTWVTQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MEMBRANE-BOUND LYTIC MUREIN TRANSGLYCOSYLASE F
publication title Activation by Allostery in Cell-Wall Remodeling by a Modular Membrane-Bound Lytic Transglycosylase from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Lyase
total genus 142
structure length 418
sequence length 418
chains with identical sequence C
ec nomenclature ec 4.2.2.-:
pdb deposition date 2015-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5aa4A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5aa4A02
4POXA 1UQWA 1MPBA 2F35A 3H03A 1AL3A 2QRYA 3C35A 1SW2A 3UP9A 1B3EA 5CMMA 2B3BA 4H6DA 1MQJA 5FTIA 2Z22A 2XD2A 4ESXA 3H6UA 1CB6A 3TAJA 3UK4A 4C1TA 1ZU0A 2PYYA 3PMWA 1TFDA 3ZSFA 2F36A 1YAEA 1S7YA 2DE3A 1SYIA 1N76A 2DWJA 4XKQA 4LONB 1LFHA 1NH8A 5CMBA 2F6GA 2REGA 1R9LA 1B5JA 1N7WA 1POY1 4DE8A 3QYTA 4JDFA 1GTKA 3B7DA 5EYFA 4JWXA 2I6EA 2ZYNA 3IO6A 2YLNA 4QRZA 1OQHA 5DEXA 3DP6A 2VOZA 4QSEA 1TT1A 2PMSA 4ELPA 4X48A 4YU0A 5I58A 1N84A 4LVQA 1Y3PA 2AL5A 4OXVA 3QXMA 3TCFA 4AQ4A 2AIXA 4F3SA 4IO5A 5H8NB 1Y1MA 1MY1A 5KDTB 3RUMA 1LFIA 1DMBA 3OELA 4YB5A 1AIVA 1LB9A 4BDMA 4FATA 1MY3A 4RNSA 1SD3A 4FAJA 5I2KA 4OEVA 4DXUA 1QKBA 1KWHA 2FYIA 2OZZA 1IXCA 1H45A 4NF4A 4ZEDA 4ESWA 1B3GA 1DOTA 2E0SA 5H8FA 3IAZA 3KGCA 3S2VA 1FTMA 1D9YA 2OJTA 2XXWA 1UTHB 1LCFA 2R71A 1NKXA 3DELB 4F22A 3OO8A 4BLAA 5FTHA 3THIA 4QF9A 2NXOA 2XXYA 4UACA 3FXRA 1QUJA 3VVFA 2F8DA 3N94A 5DVFA 2ABHA 3K00A 1N04A 4TLLB 5FHOA 3C33A 4F3GA 3KN3A 4OETA 3TPAA 3V89B 1LGBC 1ANFA 2O7UA 1M5EA 2ZYKA 4KCCA 1A8EA 4NF6A 3S9LC 1MY4A 2O84X 3TQLA 2A5TA 2DP8A 2QJEA 2I0CA 4EXLA 3Q28A 3RLFE 2H5YA 5F1QA 3FUZA 1N0TA 4F39A 4ZEIA 3E4RA 2Q8JA 4U21A 3FVGA 3RT6B 4G4PA 4ONYA 4EF1A 2I3WA 4HW8A 3G3KA 1ZLQA 2ZMBA 1QUKA 3G3HA 4R2BA 1ATGA 1PBPA 3MJNA 3RGYA 5JTYB 1A7LA 4RK9A 4HS7A 2VD3A 4G77A 4JSOA 5L8DA 1URDA 3B6QA 2ZNUA 2M8CA 3QAXA 1Y1ZA 4GVOA 3OMBA 3PPOA 2V3QA 4UA8A 4DXBA 3OD7A 2FA7A 3HV1A 4U2RA 3CIJA 3FV2A 1A40A 4NF8B 3VVDA 3IOUA 5EHMA 1EU8A 3OO6A 3VXCA 1ZIUA 1Q1KA 1XS5A 2GHAA 2DE2A 1MXXA 4DCYA 3B6TA 1NH7A 3CSBA 3SERA 3SEVA 1WDNA 2XX9A 3VLVA 3L6GA 4DZ1A 5F7VA 4H67A 2V93A 1B5IA 2DOJA 3TKDA 1MXWA 4R9FA 1MPDA 1JEUA 3PMXA 1FQBA 5A5XB 4IGRA 3Q29A 4FE8A 4MLVA 2GH9A 1YTVA 3OXNA 1NMUA 3IR1A 5I57A 4X9TA 4TQUQ 1IIWA 5DVJA 1QJMA 1T0KA 3U94A 2Y7RA 2I4CA 1P1NA 5I84A 4OMBA 3FZVA 1Y4TA 5IKBA 4MH5A 2PVUA 3RQTA 1B7UA 2ZYOA 4G68A 3TODA 1Y20A 1SW4A 2CZLA 4F1UA 3F11A 1UTHA 2Q89A 2BJJX 2Z8EA 2RINA 3PPNA 4PFYA 1H44A 4EQBA 3RTFB 3V5AA 1MXZA 3CG3A 1USYE 3MZBA 4QFKA 1LLSA 2F5XA 3PPQA 1S50A 1ZJLA 3QUFA 2HFBA 5DEXB 4XXUA 3FJMA 3TTNA 1ZTYA 1B6HA 4GLIA 4FJPA 1M5BA 2QMWA 5I58B 1QUIA 4O3BA 3UN6A 5I56A 1I6AA 3VFJA 1JQFA 3R7XA 1OLCA 3FASA 2F7BA 3JV9A 5CMCA 5DYHA 1IXIA 4R2FA 4NF5A 3SDFA 4LQ5A 3VXBA 5TP9A 4IO4A 3S9EA 4C0RA 3W9VA 4KPTA 5K2XA 2REJA 4BDOA 3BKIB 4KI0E 1LCTA 1EZ9A 5CC2A 1JVYA 4NF4B 3G7WA 4G8NA 2UYEA 5H8FB 3T9HB 3FXUA 1MM6A 2Y84A 3VLUA 2Y7IA 5H8SA 4ZE9A 4HTGA 4KQPA 4F29A 1OQGA 2DWHA 4BDQA 2XXRA 3H6VA 4IO6A 4DXCA 4TLMB 4ZS9A 2YPNA 1N3XA 4IO2A 1B2HA 4QFPA 5L9OA 1ELJA 3O29A 3KEIA 3DM0A 3TCGA 4YKPA 3M3LA 3PPPA 3LSWA 3IB1A 3MW0A 3H6TA 2I0BA 4RJZA 4M4GA 4I62A 4JWYA 4R6YA 1R9QA 2DYXA 5HBCA 4RK2A 4WKMA 1DTGA 2D5WA 4IGTA 2A5TB 4OERA 2XX7A 2P0SA 1URGA 3D4GA 1D3KA 3LUYA 3PUZE 3PU5A 3TUSA 1P1WA 5DTBA 4ISUA 1JEVA 4ZECA 4BDRA 1SYHA 3K01A 2WKYA 3PV0E 1VSOA 4Q0CA 1I6QA 4KYEA 2DXYA 2RCBA 1B58A 1OVTA 2HEUA 4GIZA 3K0VA 3OO7A 2NUVA 5DVIA 2PT2A 1PB8A 4Q5TA 4H0WA 1MH3A 1WVJA 3Q26A 2X7PA 3MC2A 4XIGQ 1MQDA 3B6WA 3O97A 2ESNA 2E1SA 2OCUA 4KCDA 2R6GE 5ELVA 3TYHA 3FXQA 3PD9A 3MBPA 3KN8A 4QFNA 1TFAA 5DT6A 4HCWA 1B51A 5HM4B 3TZAA 3TQWA 4KR5A 4HCYA 4H8JA 1HSLA 1FQFA 3EHSA 2QPQA 4LQ2A 3IOWA 1LAXA 5AE4A 3HHFA 1JW1A 1LBBA 3JYRA 2OWTA 1H3DA 3E13X 5H8HB 2Y7PA 3OEKA 2QS3A 5H8QA 4GF8A 5I57B 3ECRA 1XOCA 2VHAA 3ZKKA 5AA3A 4KYSA 4ELOA 3T66A 4RPOA 2QS1A 3MPKA 3H4ZA 1FTLA 1SQYA 2Z23A 3CRBA 3PMVA 1GGGA 1B0HA 2UVHA 4X1DA 3GLBA 1Z7ME 4G68B 1AMFA 4YMBA 1M5DA 3O6IA 4OEUA 3LR1A 4OFOA 2H9BA 4P0IA 4ZDMA 2F7AA 4F2OA 1MQIA 5JK4A 1B3HA 1RKMA 5ICTA 3TTLA 4DCXA 1MDP1 3FVKA 4OESA 3I6VA 4I8CA 1USYH 1MH4A 1FQDA 3C34A 1FTJA 3PGFA 3ODBA 5CI5A 3IL1B 3LSLA 3CSGA 1QULA 4QFOA 5I56B 5IAIA 3FVNA 4G2ZA 5KCJA 3N5LA 2DWAA 3O6HA 1MG1A 4NF5B 2O7IA 2Y7WA 5TP9B 3K1NA 1I6BA 4QSDA 3U93A 2Z8DA 4NMYA 3S9MC 1XVYA 2B65A 1DSNA 2XXTA 4P0GA 2ZNTA 3G3IA 4O3CA 4RPNA 3MP6A 3CVGA 1DPPA 3M3FA 5ICQA 1B46A 4PP0A 2IEEA 3RNNA 1Q35A 2P2AA 3I5OA 5TPAA 4U4XA 4U1OA 2P1SA 5ITPA 1SBPA 3DP8A 4R9GA 5AA2A 3W9WA 1EZPA 4KYDA 3QK6A 5L9MA 3HN0A 1P1UA 2UVJA 4ECFA 2DVZA 3ZS6A 4H1XA 3TELA 1O64A 1B5HA 4GWOA 1N7XA 3R26A 4BDLA 1ZBMA 2VD2A 1JNFA 3RN8A 1NNTA 4U4SA 3N6TA 3MZ9A 1QW0A 4QSCA 5LOMA 5AA2D 3FVOA 3LSXA 1UTBB 2HZKA 3ILTB 2QL3A 2AL4A 3TEPA 2XXQA 5H8HA 3CFZA 3K1PA 1LAHE 3U72A 3K6UA 3EQ1A 1R1NA 4THIA 2V84A 3UGWA 2DWIA 1B3FA 1D9VA 1F9BA 2V25A 1LAFE 1A55A 1VE4A 1SI0A 5FHNA 1HSJA 3HPIA 2PX1A 4G8MA 2H25A 3V8XB 1M5CA 2XXUA 2V3UA 3CR9A 3O2AA 4FIMA 4OZ9A 4EQ7A 3A3CA 3MVZA 1FTOA 2UVIA 1NFTA 2Z8FA 5J1DA 3MQ9A 1MDQA 4YKJA 3T93B 5B70A 4IO3A 1P1OA 2X7QA 3MWBA 1AOVA 3E3KA 1FQCA 3RT8A 4RY1A 2O68A 3OENA 2O1LA 4NWCA 3H7MA 4OVJA 3C32A 1OLAA 5L9SA 3WAFA 4JSDA 1NNPA 4YKKA 2D3IA 1US5A 3QUJA 4XKPA 2X26A 4NE4A 2W7YA 1PB7A 1I69A 3VE1B 4ZE8A 5H8QB 1Y9UA 1XHYA 5CRYA 4WEDA 4F3PA 4O3AA 2PBWA 4IY6A 3Q25A 1VFEA 1B4ZA 1GR2A 1II5A 3T9UA 1MQGA 4K3FA 3MVWA 1MM7A 2F7CA 3KSJA 3ONMA 1ZMGA 1JW4A 2ONSA 3KJ7A 4AB5A 4MFIA 3FIRA 1DPEA 2OWSA 3K6VA 4G68C 3OOAA 3O66A 4EUOA 3VVEA 3PUWE 4E0WA 3HO7A 4JXIA 1N3WA 2XX8A 1B1HA 2XD3A 2UYFA 4RXLA 1YCJA 1OVBA 3U8QA 3G3JA 1SDXA 1Y4CA 4OFLA 4N07A 3GBAA 3IJXB 3KN7A 4R6HA 4F3BA 3KOSA 3D4CA 1NL5A 2PT1A 3EHUA 1LAGE 2Q88A 4F1YA 2D21A 3PUXE 5AA1A 4GL0A 4GFRA 1L5TA 4F31B 3R6UA 4F2QA 4LA9A 1P99A 1MQHA 3MP1A 4PFUA 2DVCA 4U22A 5KCJB 3KFMA 4BDNA 1UTBA 4I9DA 3MVYA 4R6KA 5HPQA 2XHDA 1B0LA 3EHTA 3WAEA 4C1UA 3FATA 3JZJA 2O69A 2I49A 1JETA 1A99A 3ZKLA 4G8HA 4JWOA 2UXAA 5BUUA 4EF2A 3G3FA 1PB9A 5AA4A 1H76A 3IOVA 2DSFA 1P1QA 5JEIA 4FEDA 3KBRA 4Z7EA 1B1XA 4KHZE 5TPAB 3TDJA 5CBSA 1GV8A 3H6WA 2I58A 4EDPA 3GBBA 5AA2B 4PE5B 3K2DA 4NTLA 3KSXA 3T9XB 4NWDA 1PDAA 4LATA 1Z7NE 1TXFA 3KOTA 2XXPA 2V3TA 3T9VA 3M8UA 2I4BA 3W15C 2H98A 2O6AA 5ISUA 2GRVA 1MXYA 3K02A 3PUVE 3LSFB 1FQEA 1FW0A 4LZ8A 3C36A 1XVXA 4QHQA 4LP2B 1IEJA 3K6XA 1IXGA 4OTEA 4MBPA 3HCQA 1IXHA 4JBZA 3U1OA 1FTKA 4I1DA 1QVSA 3T96B 2F78A 1A8FA 5ITOA 5I59A 3T22A 2H99A 4U1ZA 4H5GA 1HSEA 1EZOA 2GHBA 3CFLA 4GQOA 1Y3NA 4DLDA 1B7HA 3FGSA 3FV1A 3TTKA 3P7IA 4F18A 4ZEFA 4GRKA 3HSTA 4R72A 4XKNA 3A09A 3VLWA 1MS7A 2Y7KA 1DTZA 3C31A 4FEBA 1EH3A 4GL8A 2XXVA 1A54A 4KD5A 4PETA 3QSLA 3HHGA 4YB6A 4POWA 3OSRA 3BFTA 2I3VA 1BIYA 4DDDA 3RY3A 3N6UA 3MZ1A 1NNFA 3IK6B 2I48A 1UIVA 3OO9A 4LUBA 4GOTA 1UIUA 1O63A 3UA8A 4MF3A 4MLQA 1PC3A 3SEUA 1JW5A 1BTJA 3SETA 1B4HA 3A3UA 4M1VA 4OENA 2XXXA 3E9XA 3MPLA 1AH5A 2QSXA 1BP5A 3I3VA 3OSQA 4R74A 2RF1A 1Y3QA 3O28A 3O6GA 2IA4A 1OIBA 2G93A 3TFLA 2ONRA 3SEXA 4P11A 1YPNA 4EXKA 2ZNSA 3MP8A 2R9JA 1US4A 1GVCA 3VV5A 5I2NA 4E0XA 4ZEBA 2O1MA 2F6PA 3C9HA 4OHNA 4LZ7A 1SW1A 5K2YA 4Q8RA 4AB6A 2RC9A 3SEWA 2DE4A 4YAHX 4R73A 2ZYMA 4TOZA 4WEPA 2DS9A 3GXAA 3PPRA 1IUDA 4U23A 4H8IA 4WXJA 4H5FA 5TU0A 2Q9TA 1SI1A 3O9PA 3CG1A 2OK2A 3PD8A 3PUYE 2QMXA 2VP1A 4N13A 2Q2AA 3LBSA 2ANJA 4GXSB 1M5FA 2NOOA 2HQ0A 4ZZAA 4RYAA 3K1MA 1SW5A 3OEMA 4ELRA 3S4UA 3IORA 3SESA 1CE2A 1XC1A 3ILUB 4Q30B 1O7TA 3GZGA 3SEYA 3MAMA 3N26A 3AXFA 3H06B 3CFXA 4N6PA 1LB8A 3U92A 3C4MA 1TWYA 1B40A 2YJPA 2QS2A 5KZTA 3DLNA 3LC8A 4YMAA 1IITA 1MPCA 3FJ7A 4OYVA 1B7ZA 5FHMA 3VDFA 1IZ1A 2LAOA 2XXIA 1D4NA 1BKAA 4NEDA 4DIGA 4FORA 1B52A 2HAVA 4EQ9A 1FQAA 2CMOA 2H4IA 5H8NA 4RA1A 2HXWA 5KDTA 2KLFA 5AA4B 1B9JA 4H65A 4KFQA 4OWDA 2G29A 1B05A 4XTCQ 1J1NA 1NNKA 2ZXTA 2UVGA 3V83A 2FNCA 1RYXA 1MXVA 3IJOB 3BFUA 4QFLA 2NWJA 1PBQA 1S9TA 1FCKA 3BBRA 4OFJA 2VGQA 3USDA 1OMPA 2HCAA 2AYSA 3EPEA 1PEBA 4PFTA 3TMGA 1R6ZA 1H43A 3RPWA 1URSA 3KZGA 3TTRA 3EF7A 2QS4A 4IY5A 1LSTA 2HAUA 2F34A 4FECA 3TCHA 4GD5A 2ONKE 3S9NC 1B3LA 2DQVA 1WODA 2OBGA 3Q27A 2Q2CA 1JVXA 3RTWB 2DXRA 4PFWA 4R75A 3G3GA 4F19A 3K4UA 5I59B 3IB0A 4YZZA 1VFDA 1ZKBA 4IB2A 4PQJA 3H3GA 4OQOA 3UIFA 2ALUA 4ZZEA 2THIA 3CI8A 3MUQA 5M2VA 3KG2A 3FJGA 1B32A 3IB2A 4YB7A 2RC8A 3KJTA 4LZ5A 4F1VA 2XXHA 5BWJA 2RC7A 5I2KB 1MXUA 3K6WA 1LBCA 1BLFA 2B3FA 1MY0A 3UORA 3MVXA 4ZEKA 4YICA 2RKMA 3L6HA 1LFGA 4JB7A 4XKRA 1SVXB 5CMKA 4L17A 5CBRA 5JTYA 5B7DA 3FD3A 3IX1A 3IOTA 5CM6A 1XT8A 4ND9A 4YKIA 2OLBA 4ELQA 2NVUB 4X1BA 4NF8A 4Z0IA 1IQ7A 3EN3A 2GFEA 1MRPA 2A5SA 4IO7A 1RYOA 3QIMA 3IO4A 5EHSA 1VR5A 2O51A 1MY2A 1POTA 2F97A 2RCAA 3SKPA 3M3KA 2HZLA 3TTMA 4GXAA 5I2NB 4NF6B 3DP4A 1QKAA 5A5XA
chains in the Genus database with same CATH superfamily
4HE1A 4POXA 1UQWA 1MPBA 2F35A 3H03A 1AL3A 2QRYA 3C35A 1SW2A 3UP9A 1B3EA 5CMMA 2B3BA 4H6DA 1MQJA 5FTIA 2Z22A 2XD2A 4H46A 4ESXA 3H6UA 1CB6A 3TAJA 3UK4A 4C1TA 1ZU0A 2PYYA 2FIXA 3PMWA 1TFDA 5IZ3A 3ZSFA 1CNQA 2F36A 1YAEA 4OANA 1S7YA 2DE3A 1SYIA 1N76A 2DWJA 4XKQA 4LONB 1LFHA 1NH8A 5CMBA 2F6GA 2REGA 1R9LA 1FPGA 1B5JA 1N7WA 1POY1 4DE8A 3QYTA 4JDFA 1GTKA 3B7DA 5EYFA 4JWXA 2I6EA 2ZYNA 3IO6A 2YLNA 4QRZA 1OQHA 5DEXA 3DP6A 2VOZA 4QSEA 1TT1A 2PMSA 4ELPA 4X48A 4YU0A 1KZ8A 4NX1A 5I58A 1N84A 4LVQA 1Y3PA 2AL5A 4OXVA 3QXMA 3TCFA 3BIHA 4AQ4A 2AIXA 4F3SA 4IO5A 5H8NB 1Y1MA 1FTAA 1FPKA 1MY1A 5KDTB 4NAPA 4H45A 3RUMA 1LFIA 1DMBA 3OELA 4YB5A 1IMBA 1AIVA 1LB9A 5EYGA 4BDMA 2WYKA 4PF6A 4FATA 1MY3A 4RNSA 1SD3A 4FAJA 1IMFA 5I2KA 4OEVA 4DXUA 1QKBA 1KWHA 2FYIA 4GWUA 2OZZA 4JVCA 1EYKA 1IXCA 1H45A 4NF4A 4ZEDA 4ESWA 1B3GA 4N91A 1DOTA 2E0SA 4P56A 5H8FA 3IAZA 3KGCA 3S2VA 1FTMA 4PBQA 1D9YA 2OJTA 2XXWA 1UTHB 1LCFA 2R71A 5I5PA 1NKXA 3DELB 4F22A 2CZHA 3OO8A 4BLAA 5FTHA 3THIA 4QF9A 2NXOA 2XXYA 3A29A 4UACA 3FXRA 1QUJA 3VVFA 2F8DA 3N94A 5DVFA 2ABHA 3K00A 1N04A 4TLLB 5FHOA 3C33A 4F3GA 3KN3A 4OETA 3TPAA 3V89B 1LGBC 2WEFA 1ANFA 2O7UA 1M5EA 2ZYKA 4KCCA 1A8EA 4NF6A 3S9LC 5EQ8A 1MY4A 2BJIA 2O84X 2QFLA 3TQLA 2XWKA 2A5TA 2DP8A 2QJEA 2I0CA 4EXLA 3Q28A 3RLFE 2H5YA 5F1QA 3FUZA 1NV5A 1N0TA 4F39A 2QVVA 4ZEIA 3E4RA 2FBPA 2Q8JA 4U21A 4GX3A 1LBZA 3FVGA 4NHBA 3RT6B 4G4PA 4ONYA 4EF1A 1FPIA 2I3WA 4HW8A 5ET5A 3G3KA 1ZLQA 2ZMBA 1QUKA 3G3HA 4R2BA 1ATGA 2KQZA 1PBPA 3MJNA 2VPNA 3RGYA 5JTYB 1A7LA 4RK9A 4HS7A 2VD3A 4G77A 4JSOA 5L8DA 1URDA 3B6QA 2ZNUA 2M8CA 3QAXA 1Y1ZA 4GVOA 3OMBA 3PPOA 2V3QA 4UA8A 4DXBA 3OD7A 2FA7A 3HV1A 4U2RA 3CIJA 3FV2A 1A40A 4NF8B 3VVDA 3IOUA 5EHMA 1EU8A 4KXPA 3OO6A 3VXCA 4PAIA 1ZIUA 1Q1KA 1XS5A 2GHAA 2DE2A 2VPOA 1MXXA 4DCYA 3B6TA 1NH7A 3CSBA 3SERA 3SEVA 1LBWA 1FJ6A 1WDNA 2XX9A 2CEXA 3VLVA 3L6GA 3RYDA 4DZ1A 5F7VA 2XWOA 3EKIA 4H67A 2V93A 1B5IA 2DOJA 3TKDA 1MXWA 4R9FA 1MPDA 4N4UA 1JEUA 3PMXA 1FQBA 5A5XB 4IGRA 4PBHA 3Q29A 4FE8A 4MLVA 2GH9A 1YTVA 3OXNA 1NMUA 3IR1A 2Q74A 5I57A 4X9TA 4TQUQ 1IIWA 5DVJA 1Q9DA 1QJMA 4GBVA 3U94A 1T0KA 2Y7RA 1NV7A 2I4CA 1P1NA 5I84A 4OMBA 3FZVA 1Y4TA 5IKBA 2F3DA 4MH5A 2PVUA 3RQTA 4HE2A 5IZ3B 1B7UA 2ZYOA 4G68A 4IR8A 3TODA 4I40A 1Y20A 1SW4A 2CZLA 2QVUA 4F1UA 3F11A 1UTHA 1XI6A 2Q89A 2FIEA 2BJJX 2Z8EA 2RINA 3PPNA 4PFYA 1H44A 4EQBA 3RTFB 3V5AA 1MXZA 4MNIA 3CG3A 1USYE 3MZBA 4QFKA 1LLSA 2F5XA 3PPQA 1S50A 4P1EA 1ZJLA 3QUFA 2HFBA 3ROJA 5DEXB 4XXUA 3FJMA 3TTNA 1ZTYA 1B6HA 4GLIA 2WYPA 5A5LA 4FJPA 1M5BA 2QMWA 5I58B 1QUIA 4O3BA 3UN6A 5I56A 1I6AA 3VFJA 1JQFA 3R7XA 1OLCA 3FASA 2F7BA 3JV9A 4NGUA 5CMCA 5DYHA 1IXIA 4R2FA 4PE3A 3ISPA 4NF5A 3SDFA 4LQ5A 1SPIA 3VXBA 3MYUA 5TP9A 4IO4A 5IZ1A 3S9EA 4C0RA 3W9VA 4KPTA 5K2XA 2REJA 4BDOA 4JVDA 3BKIB 4KI0E 1FPBA 4PGNA 1LCTA 1EZ9A 5T3JA 5CC2A 4PF8A 1JVYA 1IMAA 4NF4B 3G7WA 4G8NA 2UYEA 5H8FB 3T9HB 5IZZA 3FXUA 1MM6A 2Y84A 3VLUA 2Y7IA 4NG7A 5H8SA 4HTGA 4KQPA 4ZE9A 4MAGA 4F29A 1OQGA 2DWHA 4BDQA 2XXRA 3H6VA 4IO6A 4DXCA 4TLMB 4ZS9A 4DI4B 2YPNA 4PCDA 1N3XA 4IO2A 1B2HA 1LBXA 4QFPA 5L9OA 4MJOA 1ELJA 3O29A 3KEIA 4PGPA 3DM0A 3TCGA 4YKPA 3M3LA 4PDHA 3PPPA 3LSWA 3IB1A 3MW0A 3H6TA 2I0BA 1IMEA 3BIGA 3E79A 4RJZA 4M4GA 4I62A 4JWYA 4P9KA 4R6YA 4X04A 1R9QA 2DYXA 5HBCA 4RK2A 4WKMA 1DTGA 2D5WA 4IGTA 2A5TB 4OERA 2XX7A 1LEVA 2P0SA 1FPDA 1URGA 3D4GA 1D3KA 3LUYA 3PUZE 3PU5A 3TUSA 1P1WA 5DTBA 4ISUA 1AWBA 1JEVA 4BDRA 4ZECA 1SYHA 3K01A 2WKYA 3PV0E 1VSOA 4Q0CA 1I6QA 4KYEA 2DXYA 2RCBA 1FSAA 1B58A 4MMPA 1OVTA 2HEUA 4GIZA 3K0VA 3OO7A 2NUVA 5DVIA 1IMCA 2PT2A 1PB8A 4Q5TA 4QBAA 3RPLA 4H0WA 1MH3A 4OVPA 4QXDA 1WVJA 3Q26A 2X7PA 3MC2A 4XIGQ 1MQDA 2WBDA 3B6WA 3O97A 2ESNA 2E1SA 2OCUA 4KCDA 2R6GE 5ELVA 3TYHA 3FXQA 3PD9A 4N6DA 3MBPA 3MSTA 2GQ1A 3KN8A 5I7IA 3D1RA 4QFNA 1TFAA 5DT6A 4HCWA 4OA4A 1B51A 2ZZXA 5HM4B 3TZAA 3TQWA 4KR5A 4HCYA 1IMDA 4H8JA 1HSLA 2ZZWA 1FQFA 2P3VA 3EHSA 2QPQA 4LQ2A 3IOWA 1LAXA 5AE4A 4N81A 3HHFA 4GWYA 1JW1A 4PAKA 1LBBA 3JYRA 2OWTA 1H3DA 3E13X 5H8HB 4FBPA 2Y7PA 3OEKA 2QS3A 5H8QA 4GF8A 5I57B 3ECRA 1XOCA 2VHAA 3ZKKA 2FVZA 5AA3A 4KYSA 3KC1A 4ELOA 3T66A 4RPOA 5I3SA 2QS1A 1INPA 3MPKA 3H4ZA 1FTLA 1SQYA 2Z23A 1NV6A 3CRBA 3PMVA 1GGGA 1B0HA 2UVHA 4X1DA 3GLBA 1Z7ME 4G68B 4N6KA 1AMFA 4YMBA 2Q8MA 1M5DA 3O6IA 4OEUA 3LR1A 4OFOA 2H9BA 4P0IA 4ZDMA 2F7AA 4F2OA 2Y5KA 1MQIA 5JK4A 1B3HA 2WBBA 1RKMA 5ICTA 3TTLA 4DCXA 1MDP1 3FVKA 1NV4A 4OESA 3IFAA 3I6VA 4I8CA 2DDKA 4PDDA 1USYH 1MH4A 1RDYA 2R8TA 1FQDA 3C34A 1FTJA 2PFYA 3PGFA 3ODBA 5CI5A 3IL1B 3LSLA 3CSGA 1QULA 4QFOA 5I56B 5IAIA 3FVNA 4G2ZA 5KCJA 3N5LA 2DWAA 3O6HA 1MG1A 4NF5B 2O7IA 1DK4A 2Y7WA 5TP9B 3K1NA 1I6BA 4QSDA 1FBHA 3U93A 2Z8DA 4NMYA 3KBZA 3S9MC 1XVYA 1YZ0A 2B65A 1DSNA 2XXTA 2XXKA 4P0GA 2ZNTA 3G3IA 4O3CA 4RPNA 4P8BA 2OWZA 3MP6A 3CVGA 1NUXA 1VDWA 1DPPA 3M3FA 5ICQA 1B46A 4PP0A 2IEEA 4OVRA 3RNNA 1Q35A 1DBZA 2P2AA 3I5OA 5TPAA 4U4XA 3SZPA 4U1OA 2P1SA 5ITPA 1SBPA 3FXBA 3DP8A 4R9GA 5AA2A 3W9WA 1EZPA 4KYDA 3QK6A 5L9MA 1NUYA 3HN0A 1P1UA 2UVJA 1KA0A 4ECFA 2DVZA 1NUWA 4H1XA 3ZS6A 3TELA 1O64A 4O7IA 1B5HA 5EQ9A 4GWOA 1N7XA 3R26A 4BDLA 1ZBMA 2VD2A 4OVSA 1JNFA 4XFEA 3RN8A 1NNTA 2CZIA 4U4SA 1NI9A 3N6TA 1QW0A 3MZ9A 4QSCA 5LOMA 5AA2D 3FVOA 3LSXA 1UTBB 2HZKA 1BK4A 3ILTB 2QL3A 2AL4A 3TEPA 2XXQA 4GX4A 4MHFA 5H8HA 3CFZA 3K1PA 1LAHE 3LUZA 3U72A 3K6UA 3EQ1A 1R1NA 4THIA 2V84A 3UGWA 2DWIA 1B3FA 1D9VA 1F9BA 2V25A 1LAFE 4LN5A 2CEYA 1A55A 1VE4A 1SI0A 4GBWA 5FHNA 1HSJA 3HPIA 2PX1A 4G8MA 2H25A 3V8XB 1M5CA 3RPLB 2XXUA 2V3UA 3CR9A 1FPLA 1K9ZA 3O2AA 4FIMA 4OZ9A 3T0JA 4EQ7A 3A3CA 3MVZA 3FBPA 1FTOA 2UVIA 1NFTA 2Z8FA 1FBDA 5J1DA 3MQ9A 1MDQA 4YKJA 3T93B 4GWZA 5B70A 4IO3A 1P1OA 2X7QA 3MWBA 1NUZA 1AOVA 3E3KA 1FQCA 3RT8A 4RY1A 4MIJA 1LBYA 2O68A 3OENA 2O1LA 4NWCA 3H7MA 4OVJA 3C32A 1OLAA 5L9SA 3WAFA 4JSDA 4AS5A 1NNPA 4YKKA 2D3IA 1US5A 3QUJA 4XKPA 4GWWA 2X26A 4NE4A 2W7YA 1YYZA 1PB7A 1I69A 3VE1B 4ZE8A 5H8QB 1Y9UA 1FRPA 1XHYA 5CRYA 5ESYA 4WEDA 4F3PA 4O3AA 2PBWA 1FBEA 4IY6A 3Q25A 1VFEA 1B4ZA 1GR2A 1II5A 3T9UA 1MQGA 4K3FA 3MVWA 1MM7A 2F7CA 3KSJA 3ONMA 4HE0A 1ZMGA 1JW4A 2ONSA 3KJ7A 4AB5A 5IM2A 4MFIA 3FIRA 1DPEA 2OWSA 3K6VA 4G68C 2WX9A 1G0IA 3OOAA 4N17A 3O66A 4EUOA 1RDZA 3VVEA 3PUWE 4MNPA 4E0WA 4NQ8A 3HO7A 4JXIA 1N3WA 2XX8A 1B1HA 2XD3A 2UYFA 4RXLA 1YCJA 1OVBA 2JJKA 4JVIA 3U8QA 3G3JA 1SDXA 1Y4CA 4NF0A 4OFLA 4N07A 3GBAA 3IJXB 1LBVA 3KN7A 4MEVA 4R6HA 4F3BA 3KOSA 3D4CA 1FBGA 1NL5A 2PT1A 3EHUA 1LAGE 2Q88A 4F1YA 2D21A 3PUXE 5AA1A 4GL0A 4GFRA 1L5TA 4F31B 3R6UA 4F2QA 4LA9A 4P47A 1P99A 4PC9A 1MQHA 3MP1A 4PFUA 2DVCA 4U22A 5KCJB 3KFMA 4BDNA 1UTBA 4I9DA 3MVYA 4R6KA 5HPQA 4NN3A 2XHDA 1B0LA 3EHTA 5J16A 3WAEA 4C1UA 3FATA 3JZJA 2O69A 2I49A 1JETA 5ET8A 1A99A 3ZKLA 5EYHA 4G8HA 4JWOA 2UXAA 5BUUA 4EF2A 2XWIA 3G3FA 1PB9A 5AA4A 1H76A 3IOVA 4MX6A 2DSFA 1P1QA 5JEIA 4FEDA 2ZZVA 3KBRA 4Z7EA 1B1XA 4KHZE 1G0HA 5TPAB 3TDJA 5CBSA 1GV8A 3H6WA 2I58A 4EDPA 3GBBA 5AA2B 4PE5B 3K2DA 3PTYA 1FBFA 4NTLA 3KSXA 3T9XB 4NWDA 5ET6A 1PDAA 4LATA 1Z7NE 1TXFA 3KOTA 2XXPA 2V3TA 3M8UA 3T9VA 2I4BA 3W15C 5IGAA 2H98A 2O6AA 5ISUA 2GRVA 1MXYA 3K02A 4PFRA 3PUVE 3LSFB 2P3NA 1FQEA 1FW0A 4LZ8A 3C36A 1XVXA 4QHQA 4LP2B 1IEJA 4O8MA 3K6XA 1IXGA 4OTEA 4MBPA 3HCQA 1IXHA 4JBZA 3U1OA 1FTKA 4I1DA 4O7MA 1QVSA 3T96B 2F78A 1A8FA 5ITOA 5I59A 3T22A 2H99A 4U1ZA 4UABA 4H5GA 2CZKA 1HSEA 1EZOA 2GHBA 3CFLA 4GQOA 3GYYA 1Y3NA 4DLDA 1B7HA 3FGSA 1RDXA 3FV1A 3TTKA 2PCRA 3P7IA 4F18A 4ZEFA 4GRKA 4R72A 3HSTA 4XKNA 5FBPA 4N15A 3A09A 3VLWA 1MS7A 2Y7KA 1DTZA 4GX6A 3C31A 4FEBA 1EH3A 4GL8A 2XXVA 1A54A 4KD5A 4PETA 3QSLA 3HHGA 4YB6A 4POWA 3OSRA 3BFTA 2I3VA 4O94A 1BIYA 4XF5A 4DDDA 3RY3A 2B4MA 3MZ1A 3N6UA 1NNFA 3IK6B 4GWXA 2I48A 5LTCA 2HPGA 1UIVA 2VT5A 3OO9A 4LUBA 4GOTA 3E78A 1UIUA 3T1BA 1O63A 2MKZA 3UA8A 4MF3A 4MLQA 1PC3A 3SEUA 1JW5A 1BTJA 4I3YA 4MNCA 3SETA 4G61A 1B4HA 3A3UA 4M1VA 4OENA 4X8RA 2XXXA 3E9XA 3MPLA 1AH5A 2QSXA 1BP5A 1EYJA 3I3VA 3OSQA 4R74A 2HXRA 2RF1A 1Y3QA 3O28A 3O6GA 2IA4A 1OIBA 2G93A 3TFLA 2ONRA 3SEXA 4P11A 1YPNA 4EXKA 4PFBA 2ZNSA 3MP8A 2R9JA 5LDZA 1US4A 1GVCA 3VV5A 5I2NA 4E0XA 4ZEBA 3B50A 2O1MA 2F6PA 3C9HA 4OHNA 5EQ7A 4AS4A 4LZ7A 1SW1A 5K2YA 3KC0A 4Q8RA 1K9YA 4AB6A 2RC9A 3SEWA 1NV1A 2DE4A 4YAHX 5ET7A 4R73A 2ZYMA 4TOZA 4WEPA 2DS9A 3GXAA 1JP4A 3PPRA 1IUDA 2F3BA 4U23A 1YXIA 4H8IA 1FBCA 4WXJA 4H5FA 5TU0A 2Q9TA 1SI1A 3O9PA 3CG1A 2OK2A 3PD8A 3PUYE 2QMXA 2VP1A 4N13A 2Q2AA 3LBSA 2ANJA 4GXSB 1M5FA 4PAFA 2NOOA 2HQ0A 4ZZAA 4RYAA 3K1MA 1SW5A 3OEMA 4ELRA 3S4UA 3IORA 3SESA 4OVQA 1CE2A 1XC1A 3ILUB 4Q30B 1O7TA 3GZGA 3SEYA 3MAMA 3N26A 3AXFA 3H06B 3CFXA 1NV0A 4N6PA 1LB8A 3U92A 3C4MA 1TWYA 1B40A 2YJPA 2QS2A 5KZTA 3DLNA 3LC8A 2Y5LA 4YMAA 1IITA 1MPCA 3FJ7A 4OYVA 5DW8A 1B7ZA 3U65A 5FHMA 3VDFA 1IZ1A 2LAOA 2XXIA 1FJ9A 1D4NA 1BKAA 4NEDA 4DIGA 4FORA 1B52A 2HAVA 4EQ9A 1FQAA 2CMOA 2H4IA 5H8NA 3NOHA 4MCOA 4RA1A 2HXWA 4N8GA 5KDTA 2KLFA 5AA4B 1B9JA 4H65A 4KFQA 4OWDA 2G29A 1B05A 4P1LA 4XTCQ 1J1NA 1NNKA 2ZXTA 2UVGA 3V83A 1FPEA 2FNCA 1RYXA 1MXVA 3IJOB 1EYIA 3BFUA 4QFLA 3CHGA 1PBQA 2NWJA 1S9TA 1FCKA 1FPJA 3BBRA 4I3EA 4GWSA 4OFJA 2VGQA 3USDA 2OX3A 3IFCA 1FBPA 1NV3A 1OMPA 2HCAA 2AYSA 3EPEA 2XA5A 1PEBA 4PFTA 3TMGA 1R6ZA 1H43A 4N8YA 3RPWA 1URSA 3KZGA 3QMFA 3TTRA 3EF7A 2QS4A 1NV2A 4IY5A 1LSTA 2HAUA 4PTKA 2F34A 5F24A 4FECA 4HXVA 3TCHA 4GD5A 2ONKE 3S9NC 1B3LA 2DQVA 2FHYA 4XEQA 1WODA 2OBGA 3HFUA 3Q27A 1DCUA 2Q2CA 1JVXA 3RTWB 2DXRA 4PFWA 4R75A 3G3GA 4F19A 3K4UA 4DI3D 2V4CA 5I59B 3IB0A 4YZZA 1VFDA 1ZKBA 4IB2A 4PQJA 3H3GA 4OQOA 2XWVA 2L5VA 3UIFA 2ALUA 4ZZEA 2THIA 3CI8A 3MUQA 5M2VA 3KG2A 3FJGA 1B32A 3IB2A 1D9QA 4YB7A 2RC8A 3KJTA 4LZ5A 4F1VA 2XXHA 5BWJA 2RC7A 5I2KB 1MXUA 3K6WA 1LBCA 1BLFA 2B3FA 1MY0A 3UORA 3MVXA 4ZEKA 4YICA 2RKMA 3L6HA 1LFGA 4JB7A 4XKRA 1SVXB 5CMKA 5EQAA 4L17A 5CBRA 5JTYA 5B7DA 3FD3A 3IX1A 1FPFA 3IOTA 5CM6A 1XT8A 4ND9A 4YKIA 2OLBA 2PFZA 4PFIA 4ELQA 2NVUB 4X1BA 2KR0A 4NF8A 4Z0IA 1IQ7A 3EN3A 2GFEA 1MRPA 2A5SA 3B8BA 2HHMA 4IO7A 1RYOA 3QIMA 3IO4A 4OVTA 5EHSA 1VR5A 2O51A 3LV0A 1QGXA 1KA1A 1MY2A 1POTA 2F97A 2RCAA 3SKPA 3M3KA 2HZLA 3TTMA 4GXAA 5I2NB 4NF6B 3DP4A 2B4LA 2QVRA 4P3LA 1QKAA 5A5XA
chains in the Genus database with same CATH topology
4POXA 1UQWA 1MPBA 2F35A 3H03A 1AL3A 2QRYA 3C35A 1SW2A 3UP9A 1B3EA 5CMMA 2B3BA 4H6DA 1MQJA 5FTIA 2Z22A 2XD2A 4ESXA 3H6UA 1CB6A 3TAJA 3UK4A 4C1TA 1ZU0A 2PYYA 3PMWA 1TFDA 3ZSFA 2F36A 1YAEA 1S7YA 2DE3A 1SYIA 1N76A 2DWJA 4XKQA 4LONB 1LFHA 1NH8A 5CMBA 2F6GA 2REGA 1R9LA 1B5JA 1N7WA 1POY1 4DE8A 3QYTA 4JDFA 1GTKA 3B7DA 5EYFA 4JWXA 2I6EA 2ZYNA 3IO6A 2YLNA 4QRZA 1OQHA 5DEXA 3DP6A 2VOZA 4QSEA 1TT1A 2PMSA 4ELPA 4X48A 4YU0A 5I58A 1N84A 4LVQA 1Y3PA 2AL5A 4OXVA 3QXMA 3TCFA 4AQ4A 2AIXA 4F3SA 4IO5A 5H8NB 1Y1MA 1MY1A 5KDTB 3RUMA 1LFIA 1DMBA 3OELA 4YB5A 1AIVA 1LB9A 4BDMA 4FATA 1MY3A 4RNSA 1SD3A 4FAJA 5I2KA 4OEVA 4DXUA 1QKBA 1KWHA 2FYIA 2OZZA 1IXCA 1H45A 4NF4A 4ZEDA 4ESWA 1B3GA 1DOTA 2E0SA 5H8FA 3IAZA 3KGCA 3S2VA 1FTMA 1D9YA 2OJTA 2XXWA 1UTHB 1LCFA 2R71A 1NKXA 3DELB 4F22A 3OO8A 4BLAA 5FTHA 3THIA 4QF9A 2NXOA 2XXYA 4UACA 3FXRA 1QUJA 3VVFA 2F8DA 3N94A 5DVFA 2ABHA 3K00A 1N04A 4TLLB 5FHOA 3C33A 4F3GA 3KN3A 4OETA 3TPAA 3V89B 1LGBC 1ANFA 2O7UA 1M5EA 2ZYKA 4KCCA 1A8EA 4NF6A 3S9LC 1MY4A 2O84X 3TQLA 2A5TA 2DP8A 2QJEA 2I0CA 4EXLA 3Q28A 3RLFE 2H5YA 5F1QA 3FUZA 1N0TA 4F39A 4ZEIA 3E4RA 2Q8JA 4U21A 3FVGA 3RT6B 4G4PA 4ONYA 4EF1A 2I3WA 4HW8A 3G3KA 1ZLQA 2ZMBA 1QUKA 3G3HA 4R2BA 1ATGA 1PBPA 3MJNA 3RGYA 5JTYB 1A7LA 4RK9A 4HS7A 2VD3A 4G77A 4JSOA 5L8DA 1URDA 3B6QA 2ZNUA 2M8CA 3QAXA 1Y1ZA 4GVOA 3OMBA 3PPOA 2V3QA 4UA8A 4DXBA 3OD7A 2FA7A 3HV1A 4U2RA 3CIJA 3FV2A 1A40A 4NF8B 3VVDA 3IOUA 5EHMA 1EU8A 3OO6A 3VXCA 1ZIUA 1Q1KA 1XS5A 2GHAA 2DE2A 1MXXA 4DCYA 3B6TA 1NH7A 3CSBA 3SERA 3SEVA 1WDNA 2XX9A 3VLVA 3L6GA 4DZ1A 5F7VA 4H67A 2V93A 1B5IA 2DOJA 3TKDA 1MXWA 4R9FA 1MPDA 1JEUA 3PMXA 1FQBA 5A5XB 4IGRA 3Q29A 4FE8A 4MLVA 2GH9A 1YTVA 3OXNA 1NMUA 3IR1A 5I57A 4X9TA 4TQUQ 1IIWA 5DVJA 1QJMA 1T0KA 3U94A 2Y7RA 2I4CA 1P1NA 5I84A 4OMBA 3FZVA 1Y4TA 5IKBA 4MH5A 2PVUA 3RQTA 1B7UA 2ZYOA 4G68A 3TODA 1Y20A 1SW4A 2CZLA 4F1UA 3F11A 1UTHA 2Q89A 2BJJX 2Z8EA 2RINA 3PPNA 4PFYA 1H44A 4EQBA 3RTFB 3V5AA 1MXZA 3CG3A 1USYE 3MZBA 4QFKA 1LLSA 2F5XA 3PPQA 1S50A 1ZJLA 3QUFA 2HFBA 5DEXB 4XXUA 3FJMA 3TTNA 1ZTYA 1B6HA 4GLIA 4FJPA 1M5BA 2QMWA 5I58B 1QUIA 4O3BA 3UN6A 5I56A 1I6AA 3VFJA 1JQFA 3R7XA 1OLCA 3FASA 2F7BA 3JV9A 5CMCA 5DYHA 1IXIA 4R2FA 4NF5A 3SDFA 4LQ5A 3VXBA 5TP9A 4IO4A 3S9EA 4C0RA 3W9VA 4KPTA 5K2XA 2REJA 4BDOA 3BKIB 4KI0E 1LCTA 1EZ9A 5CC2A 1JVYA 4NF4B 3G7WA 4G8NA 2UYEA 5H8FB 3T9HB 3FXUA 1MM6A 2Y84A 3VLUA 2Y7IA 5H8SA 4ZE9A 4HTGA 4KQPA 4F29A 1OQGA 2DWHA 4BDQA 2XXRA 3H6VA 4IO6A 4DXCA 4TLMB 4ZS9A 2YPNA 1N3XA 4IO2A 1B2HA 4QFPA 5L9OA 1ELJA 3O29A 3KEIA 3DM0A 3TCGA 4YKPA 3M3LA 3PPPA 3LSWA 3IB1A 3MW0A 3H6TA 2I0BA 4RJZA 4M4GA 4I62A 4JWYA 4R6YA 1R9QA 2DYXA 5HBCA 4RK2A 4WKMA 1DTGA 2D5WA 4IGTA 2A5TB 4OERA 2XX7A 2P0SA 1URGA 3D4GA 1D3KA 3LUYA 3PUZE 3PU5A 3TUSA 1P1WA 5DTBA 4ISUA 1JEVA 4ZECA 4BDRA 1SYHA 3K01A 2WKYA 3PV0E 1VSOA 4Q0CA 1I6QA 4KYEA 2DXYA 2RCBA 1B58A 1OVTA 2HEUA 4GIZA 3K0VA 3OO7A 2NUVA 5DVIA 2PT2A 1PB8A 4Q5TA 4H0WA 1MH3A 1WVJA 3Q26A 2X7PA 3MC2A 4XIGQ 1MQDA 3B6WA 3O97A 2ESNA 2E1SA 2OCUA 4KCDA 2R6GE 5ELVA 3TYHA 3FXQA 3PD9A 3MBPA 3KN8A 4QFNA 1TFAA 5DT6A 4HCWA 1B51A 5HM4B 3TZAA 3TQWA 4KR5A 4HCYA 4H8JA 1HSLA 1FQFA 3EHSA 2QPQA 4LQ2A 3IOWA 1LAXA 5AE4A 3HHFA 1JW1A 1LBBA 3JYRA 2OWTA 1H3DA 3E13X 5H8HB 2Y7PA 3OEKA 2QS3A 5H8QA 4GF8A 5I57B 3ECRA 1XOCA 2VHAA 3ZKKA 5AA3A 4KYSA 4ELOA 3T66A 4RPOA 2QS1A 3MPKA 3H4ZA 1FTLA 1SQYA 2Z23A 3CRBA 3PMVA 1GGGA 1B0HA 2UVHA 4X1DA 3GLBA 1Z7ME 4G68B 1AMFA 4YMBA 1M5DA 3O6IA 4OEUA 3LR1A 4OFOA 2H9BA 4P0IA 4ZDMA 2F7AA 4F2OA 1MQIA 5JK4A 1B3HA 1RKMA 5ICTA 3TTLA 4DCXA 1MDP1 3FVKA 4OESA 3I6VA 4I8CA 1USYH 1MH4A 1FQDA 3C34A 1FTJA 3PGFA 3ODBA 5CI5A 3IL1B 3LSLA 3CSGA 1QULA 4QFOA 5I56B 5IAIA 3FVNA 4G2ZA 5KCJA 3N5LA 2DWAA 3O6HA 1MG1A 4NF5B 2O7IA 2Y7WA 5TP9B 3K1NA 1I6BA 4QSDA 3U93A 2Z8DA 4NMYA 3S9MC 1XVYA 2B65A 1DSNA 2XXTA 4P0GA 2ZNTA 3G3IA 4O3CA 4RPNA 3MP6A 3CVGA 1DPPA 3M3FA 5ICQA 1B46A 4PP0A 2IEEA 3RNNA 1Q35A 2P2AA 3I5OA 5TPAA 4U4XA 4U1OA 2P1SA 5ITPA 1SBPA 3DP8A 4R9GA 5AA2A 3W9WA 1EZPA 4KYDA 3QK6A 5L9MA 3HN0A 1P1UA 2UVJA 4ECFA 2DVZA 3ZS6A 4H1XA 3TELA 1O64A 1B5HA 4GWOA 1N7XA 3R26A 4BDLA 1ZBMA 2VD2A 1JNFA 3RN8A 1NNTA 4U4SA 3N6TA 3MZ9A 1QW0A 4QSCA 5LOMA 5AA2D 3FVOA 3LSXA 1UTBB 2HZKA 3ILTB 2QL3A 2AL4A 3TEPA 2XXQA 5H8HA 3CFZA 3K1PA 1LAHE 3U72A 3K6UA 3EQ1A 1R1NA 4THIA 2V84A 3UGWA 2DWIA 1B3FA 1D9VA 1F9BA 2V25A 1LAFE 1A55A 1VE4A 1SI0A 5FHNA 1HSJA 3HPIA 2PX1A 4G8MA 2H25A 3V8XB 1M5CA 2XXUA 2V3UA 3CR9A 3O2AA 4FIMA 4OZ9A 4EQ7A 3A3CA 3MVZA 1FTOA 2UVIA 1NFTA 2Z8FA 5J1DA 3MQ9A 1MDQA 4YKJA 3T93B 5B70A 4IO3A 1P1OA 2X7QA 3MWBA 1AOVA 3E3KA 1FQCA 3RT8A 4RY1A 2O68A 3OENA 2O1LA 4NWCA 3H7MA 4OVJA 3C32A 1OLAA 5L9SA 3WAFA 4JSDA 1NNPA 4YKKA 2D3IA 1US5A 3QUJA 4XKPA 2X26A 4NE4A 2W7YA 1PB7A 1I69A 3VE1B 4ZE8A 5H8QB 1Y9UA 1XHYA 5CRYA 4WEDA 4F3PA 4O3AA 2PBWA 4IY6A 3Q25A 1VFEA 1B4ZA 1GR2A 1II5A 3T9UA 1MQGA 4K3FA 3MVWA 1MM7A 2F7CA 3KSJA 3ONMA 1ZMGA 1JW4A 2ONSA 3KJ7A 4AB5A 4MFIA 3FIRA 1DPEA 2OWSA 3K6VA 4G68C 3OOAA 3O66A 4EUOA 3VVEA 3PUWE 4E0WA 3HO7A 4JXIA 1N3WA 2XX8A 1B1HA 2XD3A 2UYFA 4RXLA 1YCJA 1OVBA 3U8QA 3G3JA 1SDXA 1Y4CA 4OFLA 4N07A 3GBAA 3IJXB 3KN7A 4R6HA 4F3BA 3KOSA 3D4CA 1NL5A 2PT1A 3EHUA 1LAGE 2Q88A 4F1YA 2D21A 3PUXE 5AA1A 4GL0A 4GFRA 1L5TA 4F31B 3R6UA 4F2QA 4LA9A 1P99A 1MQHA 3MP1A 4PFUA 2DVCA 4U22A 5KCJB 3KFMA 4BDNA 1UTBA 4I9DA 3MVYA 4R6KA 5HPQA 2XHDA 1B0LA 3EHTA 3WAEA 4C1UA 3FATA 3JZJA 2O69A 2I49A 1JETA 1A99A 3ZKLA 4G8HA 4JWOA 2UXAA 5BUUA 4EF2A 3G3FA 1PB9A 5AA4A 1H76A 3IOVA 2DSFA 1P1QA 5JEIA 4FEDA 3KBRA 4Z7EA 1B1XA 4KHZE 5TPAB 3TDJA 5CBSA 1GV8A 3H6WA 2I58A 4EDPA 3GBBA 5AA2B 4PE5B 3K2DA 4NTLA 3KSXA 3T9XB 4NWDA 1PDAA 4LATA 1Z7NE 1TXFA 3KOTA 2XXPA 2V3TA 3T9VA 3M8UA 2I4BA 3W15C 2H98A 2O6AA 5ISUA 2GRVA 1MXYA 3K02A 3PUVE 3LSFB 1FQEA 1FW0A 4LZ8A 3C36A 1XVXA 4QHQA 4LP2B 1IEJA 3K6XA 1IXGA 4OTEA 4MBPA 3HCQA 1IXHA 4JBZA 3U1OA 1FTKA 4I1DA 1QVSA 3T96B 2F78A 1A8FA 5ITOA 5I59A 3T22A 2H99A 4U1ZA 4H5GA 1HSEA 1EZOA 2GHBA 3CFLA 4GQOA 1Y3NA 4DLDA 1B7HA 3FGSA 3FV1A 3TTKA 3P7IA 4F18A 4ZEFA 4GRKA 3HSTA 4R72A 4XKNA 3A09A 3VLWA 1MS7A 2Y7KA 1DTZA 3C31A 4FEBA 1EH3A 4GL8A 2XXVA 1A54A 4KD5A 4PETA 3QSLA 3HHGA 4YB6A 4POWA 3OSRA 3BFTA 2I3VA 1BIYA 4DDDA 3RY3A 3N6UA 3MZ1A 1NNFA 3IK6B 2I48A 1UIVA 3OO9A 4LUBA 4GOTA 1UIUA 1O63A 3UA8A 4MF3A 4MLQA 1PC3A 3SEUA 1JW5A 1BTJA 3SETA 1B4HA 3A3UA 4M1VA 4OENA 2XXXA 3E9XA 3MPLA 1AH5A 2QSXA 1BP5A 3I3VA 3OSQA 4R74A 2RF1A 1Y3QA 3O28A 3O6GA 2IA4A 1OIBA 2G93A 3TFLA 2ONRA 3SEXA 4P11A 1YPNA 4EXKA 2ZNSA 3MP8A 2R9JA 1US4A 1GVCA 3VV5A 5I2NA 4E0XA 4ZEBA 2O1MA 2F6PA 3C9HA 4OHNA 4LZ7A 1SW1A 5K2YA 4Q8RA 4AB6A 2RC9A 3SEWA 2DE4A 4YAHX 4R73A 2ZYMA 4TOZA 4WEPA 2DS9A 3GXAA 3PPRA 1IUDA 4U23A 4H8IA 4WXJA 4H5FA 5TU0A 2Q9TA 1SI1A 3O9PA 3CG1A 2OK2A 3PD8A 3PUYE 2QMXA 2VP1A 4N13A 2Q2AA 3LBSA 2ANJA 4GXSB 1M5FA 2NOOA 2HQ0A 4ZZAA 4RYAA 3K1MA 1SW5A 3OEMA 4ELRA 3S4UA 3IORA 3SESA 1CE2A 1XC1A 3ILUB 4Q30B 1O7TA 3GZGA 3SEYA 3MAMA 3N26A 3AXFA 3H06B 3CFXA 4N6PA 1LB8A 3U92A 3C4MA 1TWYA 1B40A 2YJPA 2QS2A 5KZTA 3DLNA 3LC8A 4YMAA 1IITA 1MPCA 3FJ7A 4OYVA 1B7ZA 5FHMA 3VDFA 1IZ1A 2LAOA 2XXIA 1D4NA 1BKAA 4NEDA 4DIGA 4FORA 1B52A 2HAVA 4EQ9A 1FQAA 2CMOA 2H4IA 5H8NA 4RA1A 2HXWA 5KDTA 2KLFA 5AA4B 1B9JA 4H65A 4KFQA 4OWDA 2G29A 1B05A 4XTCQ 1J1NA 1NNKA 2ZXTA 2UVGA 3V83A 2FNCA 1RYXA 1MXVA 3IJOB 3BFUA 4QFLA 2NWJA 1PBQA 1S9TA 1FCKA 3BBRA 4OFJA 2VGQA 3USDA 1OMPA 2HCAA 2AYSA 3EPEA 1PEBA 4PFTA 3TMGA 1R6ZA 1H43A 3RPWA 1URSA 3KZGA 3TTRA 3EF7A 2QS4A 4IY5A 1LSTA 2HAUA 2F34A 4FECA 3TCHA 4GD5A 2ONKE 3S9NC 1B3LA 2DQVA 1WODA 2OBGA 3Q27A 2Q2CA 1JVXA 3RTWB 2DXRA 4PFWA 4R75A 3G3GA 4F19A 3K4UA 5I59B 3IB0A 4YZZA 1VFDA 1ZKBA 4IB2A 4PQJA 3H3GA 4OQOA 3UIFA 2ALUA 4ZZEA 2THIA 3CI8A 3MUQA 5M2VA 3KG2A 3FJGA 1B32A 3IB2A 4YB7A 2RC8A 3KJTA 4LZ5A 4F1VA 2XXHA 5BWJA 2RC7A 5I2KB 1MXUA 3K6WA 1LBCA 1BLFA 2B3FA 1MY0A 3UORA 3MVXA 4ZEKA 4YICA 2RKMA 3L6HA 1LFGA 4JB7A 4XKRA 1SVXB 5CMKA 4L17A 5CBRA 5JTYA 5B7DA 3FD3A 3IX1A 3IOTA 5CM6A 1XT8A 4ND9A 4YKIA 2OLBA 4ELQA 2NVUB 4X1BA 4NF8A 4Z0IA 1IQ7A 3EN3A 2GFEA 1MRPA 2A5SA 4IO7A 1RYOA 3QIMA 3IO4A 5EHSA 1VR5A 2O51A 1MY2A 1POTA 2F97A 2RCAA 3SKPA 3M3KA 2HZLA 3TTMA 4GXAA 5I2NB 4NF6B 3DP4A 1QKAA 5A5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4POX A;  1UQW A;  1MPB A;  2F35 A;  3H03 A;  1AL3 A;  2QRY A;  3C35 A;  1SW2 A;  3UP9 A;  1B3E A;  5CMM A;  2B3B A;  4H6D A;  1MQJ A;  5FTI A;  2Z22 A;  2XD2 A;  4ESX A;  3H6U A;  1CB6 A;  3TAJ A;  3UK4 A;  4C1T A;  1ZU0 A;  2PYY A;  3PMW A;  1TFD A;  3ZSF A;  2F36 A;  1YAE A;  1S7Y A;  2DE3 A;  1SYI A;  1N76 A;  2DWJ A;  4XKQ A;  4LON B;  1LFH A;  1NH8 A;  5CMB A;  2F6G A;  2REG A;  1R9L A;  1B5J A;  1N7W A;  1POY 1;  4DE8 A;  3QYT A;  4JDF A;  1GTK A;  3B7D A;  5EYF A;  4JWX A;  2I6E A;  2ZYN A;  3IO6 A;  2YLN A;  4QRZ A;  1OQH A;  5DEX A;  3DP6 A;  2VOZ A;  4QSE A;  1TT1 A;  2PMS A;  4ELP A;  4X48 A;  4YU0 A;  5I58 A;  1N84 A;  4LVQ A;  1Y3P A;  2AL5 A;  4OXV A;  3QXM A;  3TCF A;  4AQ4 A;  2AIX A;  4F3S A;  4IO5 A;  5H8N B;  1Y1M A;  1MY1 A;  5KDT B;  3RUM A;  1LFI A;  1DMB A;  3OEL A;  4YB5 A;  1AIV A;  1LB9 A;  4BDM A;  4FAT A;  1MY3 A;  4RNS A;  1SD3 A;  4FAJ A;  5I2K A;  4OEV A;  4DXU A;  1QKB A;  1KWH A;  2FYI A;  2OZZ A;  1IXC A;  1H45 A;  4NF4 A;  4ZED A;  4ESW A;  1B3G A;  1DOT A;  2E0S A;  5H8F A;  3IAZ A;  3KGC A;  3S2V A;  1FTM A;  1D9Y A;  2OJT A;  2XXW A;  1UTH B;  1LCF A;  2R71 A;  1NKX A;  3DEL B;  4F22 A;  3OO8 A;  4BLA A;  5FTH A;  3THI A;  4QF9 A;  2NXO A;  2XXY A;  4UAC A;  3FXR A;  1QUJ A;  3VVF A;  2F8D A;  3N94 A;  5DVF A;  2ABH A;  3K00 A;  1N04 A;  4TLL B;  5FHO A;  3C33 A;  4F3G A;  3KN3 A;  4OET A;  3TPA A;  3V89 B;  1LGB C;  1ANF A;  2O7U A;  1M5E A;  2ZYK A;  4KCC A;  1A8E A;  4NF6 A;  3S9L C;  1MY4 A;  2O84 X;  3TQL A;  2A5T A;  2DP8 A;  2QJE A;  2I0C A;  4EXL A;  3Q28 A;  3RLF E;  2H5Y A;  5F1Q A;  3FUZ A;  1N0T A;  4F39 A;  4ZEI A;  3E4R A;  2Q8J A;  4U21 A;  3FVG A;  3RT6 B;  4G4P A;  4ONY A;  4EF1 A;  2I3W A;  4HW8 A;  3G3K A;  1ZLQ A;  2ZMB A;  1QUK A;  3G3H A;  4R2B A;  1ATG A;  1PBP A;  3MJN A;  3RGY A;  5JTY B;  1A7L A;  4RK9 A;  4HS7 A;  2VD3 A;  4G77 A;  4JSO A;  5L8D A;  1URD A;  3B6Q A;  2ZNU A;  2M8C A;  3QAX A;  1Y1Z A;  4GVO A;  3OMB A;  3PPO A;  2V3Q A;  4UA8 A;  4DXB A;  3OD7 A;  2FA7 A;  3HV1 A;  4U2R A;  3CIJ A;  3FV2 A;  1A40 A;  4NF8 B;  3VVD A;  3IOU A;  5EHM A;  1EU8 A;  3OO6 A;  3VXC A;  1ZIU A;  1Q1K A;  1XS5 A;  2GHA A;  2DE2 A;  1MXX A;  4DCY A;  3B6T A;  1NH7 A;  3CSB A;  3SER A;  3SEV A;  1WDN A;  2XX9 A;  3VLV A;  3L6G A;  4DZ1 A;  5F7V A;  4H67 A;  2V93 A;  1B5I A;  2DOJ A;  3TKD A;  1MXW A;  4R9F A;  1MPD A;  1JEU A;  3PMX A;  1FQB A;  5A5X B;  4IGR A;  3Q29 A;  4FE8 A;  4MLV A;  2GH9 A;  1YTV A;  3OXN A;  1NMU A;  3IR1 A;  5I57 A;  4X9T A;  4TQU Q;  1IIW A;  5DVJ A;  1QJM A;  1T0K A;  3U94 A;  2Y7R A;  2I4C A;  1P1N A;  5I84 A;  4OMB A;  3FZV A;  1Y4T A;  5IKB A;  4MH5 A;  2PVU A;  3RQT A;  1B7U A;  2ZYO A;  4G68 A;  3TOD A;  1Y20 A;  1SW4 A;  2CZL A;  4F1U A;  3F11 A;  1UTH A;  2Q89 A;  2BJJ X;  2Z8E A;  2RIN A;  3PPN A;  4PFY A;  1H44 A;  4EQB A;  3RTF B;  3V5A A;  1MXZ A;  3CG3 A;  1USY E;  3MZB A;  4QFK A;  1LLS A;  2F5X A;  3PPQ A;  1S50 A;  1ZJL A;  3QUF A;  2HFB A;  5DEX B;  4XXU A;  3FJM A;  3TTN A;  1ZTY A;  1B6H A;  4GLI A;  4FJP A;  1M5B A;  2QMW A;  5I58 B;  1QUI A;  4O3B A;  3UN6 A;  5I56 A;  1I6A A;  3VFJ A;  1JQF A;  3R7X A;  1OLC A;  3FAS A;  2F7B A;  3JV9 A;  5CMC A;  5DYH A;  1IXI A;  4R2F A;  4NF5 A;  3SDF A;  4LQ5 A;  3VXB A;  5TP9 A;  4IO4 A;  3S9E A;  4C0R A;  3W9V A;  4KPT A;  5K2X A;  2REJ A;  4BDO A;  3BKI B;  4KI0 E;  1LCT A;  1EZ9 A;  5CC2 A;  1JVY A;  4NF4 B;  3G7W A;  4G8N A;  2UYE A;  5H8F B;  3T9H B;  3FXU A;  1MM6 A;  2Y84 A;  3VLU A;  2Y7I A;  5H8S A;  4ZE9 A;  4HTG A;  4KQP A;  4F29 A;  1OQG A;  2DWH A;  4BDQ A;  2XXR A;  3H6V A;  4IO6 A;  4DXC A;  4TLM B;  4ZS9 A;  2YPN A;  1N3X A;  4IO2 A;  1B2H A;  4QFP A;  5L9O A;  1ELJ A;  3O29 A;  3KEI A;  3DM0 A;  3TCG A;  4YKP A;  3M3L A;  3PPP A;  3LSW A;  3IB1 A;  3MW0 A;  3H6T A;  2I0B A;  4RJZ A;  4M4G A;  4I62 A;  4JWY A;  4R6Y A;  1R9Q A;  2DYX A;  5HBC A;  4RK2 A;  4WKM A;  1DTG A;  2D5W A;  4IGT A;  2A5T B;  4OER A;  2XX7 A;  2P0S A;  1URG A;  3D4G A;  1D3K A;  3LUY A;  3PUZ E;  3PU5 A;  3TUS A;  1P1W A;  5DTB A;  4ISU A;  1JEV A;  4ZEC A;  4BDR A;  1SYH A;  3K01 A;  2WKY A;  3PV0 E;  1VSO A;  4Q0C A;  1I6Q A;  4KYE A;  2DXY A;  2RCB A;  1B58 A;  1OVT A;  2HEU A;  4GIZ A;  3K0V A;  3OO7 A;  2NUV A;  5DVI A;  2PT2 A;  1PB8 A;  4Q5T A;  4H0W A;  1MH3 A;  1WVJ A;  3Q26 A;  2X7P A;  3MC2 A;  4XIG Q;  1MQD A;  3B6W A;  3O97 A;  2ESN A;  2E1S A;  2OCU A;  4KCD A;  2R6G E;  5ELV A;  3TYH A;  3FXQ A;  3PD9 A;  3MBP A;  3KN8 A;  4QFN A;  1TFA A;  5DT6 A;  4HCW A;  1B51 A;  5HM4 B;  3TZA A;  3TQW A;  4KR5 A;  4HCY A;  4H8J A;  1HSL A;  1FQF A;  3EHS A;  2QPQ A;  4LQ2 A;  3IOW A;  1LAX A;  5AE4 A;  3HHF A;  1JW1 A;  1LBB A;  3JYR A;  2OWT A;  1H3D A;  3E13 X;  5H8H B;  2Y7P A;  3OEK A;  2QS3 A;  5H8Q A;  4GF8 A;  5I57 B;  3ECR A;  1XOC A;  2VHA A;  3ZKK A;  5AA3 A;  4KYS A;  4ELO A;  3T66 A;  4RPO A;  2QS1 A;  3MPK A;  3H4Z A;  1FTL A;  1SQY A;  2Z23 A;  3CRB A;  3PMV A;  1GGG A;  1B0H A;  2UVH A;  4X1D A;  3GLB A;  1Z7M E;  4G68 B;  1AMF A;  4YMB A;  1M5D A;  3O6I A;  4OEU A;  3LR1 A;  4OFO A;  2H9B A;  4P0I A;  4ZDM A;  2F7A A;  4F2O A;  1MQI A;  5JK4 A;  1B3H A;  1RKM A;  5ICT A;  3TTL A;  4DCX A;  1MDP 1;  3FVK A;  4OES A;  3I6V A;  4I8C A;  1USY H;  1MH4 A;  1FQD A;  3C34 A;  1FTJ A;  3PGF A;  3ODB A;  5CI5 A;  3IL1 B;  3LSL A;  3CSG A;  1QUL A;  4QFO A;  5I56 B;  5IAI A;  3FVN A;  4G2Z A;  5KCJ A;  3N5L A;  2DWA A;  3O6H A;  1MG1 A;  4NF5 B;  2O7I A;  2Y7W A;  5TP9 B;  3K1N A;  1I6B A;  4QSD A;  3U93 A;  2Z8D A;  4NMY A;  3S9M C;  1XVY A;  2B65 A;  1DSN A;  2XXT A;  4P0G A;  2ZNT A;  3G3I A;  4O3C A;  4RPN A;  3MP6 A;  3CVG A;  1DPP A;  3M3F A;  5ICQ A;  1B46 A;  4PP0 A;  2IEE A;  3RNN A;  1Q35 A;  2P2A A;  3I5O A;  5TPA A;  4U4X A;  4U1O A;  2P1S A;  5ITP A;  1SBP A;  3DP8 A;  4R9G A;  5AA2 A;  3W9W A;  1EZP A;  4KYD A;  3QK6 A;  5L9M A;  3HN0 A;  1P1U A;  2UVJ A;  4ECF A;  2DVZ A;  3ZS6 A;  4H1X A;  3TEL A;  1O64 A;  1B5H A;  4GWO A;  1N7X A;  3R26 A;  4BDL A;  1ZBM A;  2VD2 A;  1JNF A;  3RN8 A;  1NNT A;  4U4S A;  3N6T A;  3MZ9 A;  1QW0 A;  4QSC A;  5LOM A;  5AA2 D;  3FVO A;  3LSX A;  1UTB B;  2HZK A;  3ILT B;  2QL3 A;  2AL4 A;  3TEP A;  2XXQ A;  5H8H A;  3CFZ A;  3K1P A;  1LAH E;  3U72 A;  3K6U A;  3EQ1 A;  1R1N A;  4THI A;  2V84 A;  3UGW A;  2DWI A;  1B3F A;  1D9V A;  1F9B A;  2V25 A;  1LAF E;  1A55 A;  1VE4 A;  1SI0 A;  5FHN A;  1HSJ A;  3HPI A;  2PX1 A;  4G8M A;  2H25 A;  3V8X B;  1M5C A;  2XXU A;  2V3U A;  3CR9 A;  3O2A A;  4FIM A;  4OZ9 A;  4EQ7 A;  3A3C A;  3MVZ A;  1FTO A;  2UVI A;  1NFT A;  2Z8F A;  5J1D A;  3MQ9 A;  1MDQ A;  4YKJ A;  3T93 B;  5B70 A;  4IO3 A;  1P1O A;  2X7Q A;  3MWB A;  1AOV A;  3E3K A;  1FQC A;  3RT8 A;  4RY1 A;  2O68 A;  3OEN A;  2O1L A;  4NWC A;  3H7M A;  4OVJ A;  3C32 A;  1OLA A;  5L9S A;  3WAF A;  4JSD A;  1NNP A;  4YKK A;  2D3I A;  1US5 A;  3QUJ A;  4XKP A;  2X26 A;  4NE4 A;  2W7Y A;  1PB7 A;  1I69 A;  3VE1 B;  4ZE8 A;  5H8Q B;  1Y9U A;  1XHY A;  5CRY A;  4WED A;  4F3P A;  4O3A A;  2PBW A;  4IY6 A;  3Q25 A;  1VFE A;  1B4Z A;  1GR2 A;  1II5 A;  3T9U A;  1MQG A;  4K3F A;  3MVW A;  1MM7 A;  2F7C A;  3KSJ A;  3ONM A;  1ZMG A;  1JW4 A;  2ONS A;  3KJ7 A;  4AB5 A;  4MFI A;  3FIR A;  1DPE A;  2OWS A;  3K6V A;  4G68 C;  3OOA A;  3O66 A;  4EUO A;  3VVE A;  3PUW E;  4E0W A;  3HO7 A;  4JXI A;  1N3W A;  2XX8 A;  1B1H A;  2XD3 A;  2UYF A;  4RXL A;  1YCJ A;  1OVB A;  3U8Q A;  3G3J A;  1SDX A;  1Y4C A;  4OFL A;  4N07 A;  3GBA A;  3IJX B;  3KN7 A;  4R6H A;  4F3B A;  3KOS A;  3D4C A;  1NL5 A;  2PT1 A;  3EHU A;  1LAG E;  2Q88 A;  4F1Y A;  2D21 A;  3PUX E;  5AA1 A;  4GL0 A;  4GFR A;  1L5T A;  4F31 B;  3R6U A;  4F2Q A;  4LA9 A;  1P99 A;  1MQH A;  3MP1 A;  4PFU A;  2DVC A;  4U22 A;  5KCJ B;  3KFM A;  4BDN A;  1UTB A;  4I9D A;  3MVY A;  4R6K A;  5HPQ A;  2XHD A;  1B0L A;  3EHT A;  3WAE A;  4C1U A;  3FAT A;  3JZJ A;  2O69 A;  2I49 A;  1JET A;  1A99 A;  3ZKL A;  4G8H A;  4JWO A;  2UXA A;  5BUU A;  4EF2 A;  3G3F A;  1PB9 A;  5AA4 A;  1H76 A;  3IOV A;  2DSF A;  1P1Q A;  5JEI A;  4FED A;  3KBR A;  4Z7E A;  1B1X A;  4KHZ E;  5TPA B;  3TDJ A;  5CBS A;  1GV8 A;  3H6W A;  2I58 A;  4EDP A;  3GBB A;  5AA2 B;  4PE5 B;  3K2D A;  4NTL A;  3KSX A;  3T9X B;  4NWD A;  1PDA A;  4LAT A;  1Z7N E;  1TXF A;  3KOT A;  2XXP A;  2V3T A;  3T9V A;  3M8U A;  2I4B A;  3W15 C;  2H98 A;  2O6A A;  5ISU A;  2GRV A;  1MXY A;  3K02 A;  3PUV E;  3LSF B;  1FQE A;  1FW0 A;  4LZ8 A;  3C36 A;  1XVX A;  4QHQ A;  4LP2 B;  1IEJ A;  3K6X A;  1IXG A;  4OTE A;  4MBP A;  3HCQ A;  1IXH A;  4JBZ A;  3U1O A;  1FTK A;  4I1D A;  1QVS A;  3T96 B;  2F78 A;  1A8F A;  5ITO A;  5I59 A;  3T22 A;  2H99 A;  4U1Z A;  4H5G A;  1HSE A;  1EZO A;  2GHB A;  3CFL A;  4GQO A;  1Y3N A;  4DLD A;  1B7H A;  3FGS A;  3FV1 A;  3TTK A;  3P7I A;  4F18 A;  4ZEF A;  4GRK A;  3HST A;  4R72 A;  4XKN A;  3A09 A;  3VLW A;  1MS7 A;  2Y7K A;  1DTZ A;  3C31 A;  4FEB A;  1EH3 A;  4GL8 A;  2XXV A;  1A54 A;  4KD5 A;  4PET A;  3QSL A;  3HHG A;  4YB6 A;  4POW A;  3OSR A;  3BFT A;  2I3V A;  1BIY A;  4DDD A;  3RY3 A;  3N6U A;  3MZ1 A;  1NNF A;  3IK6 B;  2I48 A;  1UIV A;  3OO9 A;  4LUB A;  4GOT A;  1UIU A;  1O63 A;  3UA8 A;  4MF3 A;  4MLQ A;  1PC3 A;  3SEU A;  1JW5 A;  1BTJ A;  3SET A;  1B4H A;  3A3U A;  4M1V A;  4OEN A;  2XXX A;  3E9X A;  3MPL A;  1AH5 A;  2QSX A;  1BP5 A;  3I3V A;  3OSQ A;  4R74 A;  2RF1 A;  1Y3Q A;  3O28 A;  3O6G A;  2IA4 A;  1OIB A;  2G93 A;  3TFL A;  2ONR A;  3SEX A;  4P11 A;  1YPN A;  4EXK A;  2ZNS A;  3MP8 A;  2R9J A;  1US4 A;  1GVC A;  3VV5 A;  5I2N A;  4E0X A;  4ZEB A;  2O1M A;  2F6P A;  3C9H A;  4OHN A;  4LZ7 A;  1SW1 A;  5K2Y A;  4Q8R A;  4AB6 A;  2RC9 A;  3SEW A;  2DE4 A;  4YAH X;  4R73 A;  2ZYM A;  4TOZ A;  4WEP A;  2DS9 A;  3GXA A;  3PPR A;  1IUD A;  4U23 A;  4H8I A;  4WXJ A;  4H5F A;  5TU0 A;  2Q9T A;  1SI1 A;  3O9P A;  3CG1 A;  2OK2 A;  3PD8 A;  3PUY E;  2QMX A;  2VP1 A;  4N13 A;  2Q2A A;  3LBS A;  2ANJ A;  4GXS B;  1M5F A;  2NOO A;  2HQ0 A;  4ZZA A;  4RYA A;  3K1M A;  1SW5 A;  3OEM A;  4ELR A;  3S4U A;  3IOR A;  3SES A;  1CE2 A;  1XC1 A;  3ILU B;  4Q30 B;  1O7T A;  3GZG A;  3SEY A;  3MAM A;  3N26 A;  3AXF A;  3H06 B;  3CFX A;  4N6P A;  1LB8 A;  3U92 A;  3C4M A;  1TWY A;  1B40 A;  2YJP A;  2QS2 A;  5KZT A;  3DLN A;  3LC8 A;  4YMA A;  1IIT A;  1MPC A;  3FJ7 A;  4OYV A;  1B7Z A;  5FHM A;  3VDF A;  1IZ1 A;  2LAO A;  2XXI A;  1D4N A;  1BKA A;  4NED A;  4DIG A;  4FOR A;  1B52 A;  2HAV A;  4EQ9 A;  1FQA A;  2CMO A;  2H4I A;  5H8N A;  4RA1 A;  2HXW A;  5KDT A;  2KLF A;  5AA4 B;  1B9J A;  4H65 A;  4KFQ A;  4OWD A;  2G29 A;  1B05 A;  4XTC Q;  1J1N A;  1NNK A;  2ZXT A;  2UVG A;  3V83 A;  2FNC A;  1RYX A;  1MXV A;  3IJO B;  3BFU A;  4QFL A;  2NWJ A;  1PBQ A;  1S9T A;  1FCK A;  3BBR A;  4OFJ A;  2VGQ A;  3USD A;  1OMP A;  2HCA A;  2AYS A;  3EPE A;  1PEB A;  4PFT A;  3TMG A;  1R6Z A;  1H43 A;  3RPW A;  1URS A;  3KZG A;  3TTR A;  3EF7 A;  2QS4 A;  4IY5 A;  1LST A;  2HAU A;  2F34 A;  4FEC A;  3TCH A;  4GD5 A;  2ONK E;  3S9N C;  1B3L A;  2DQV A;  1WOD A;  2OBG A;  3Q27 A;  2Q2C A;  1JVX A;  3RTW B;  2DXR A;  4PFW A;  4R75 A;  3G3G A;  4F19 A;  3K4U A;  5I59 B;  3IB0 A;  4YZZ A;  1VFD A;  1ZKB A;  4IB2 A;  4PQJ A;  3H3G A;  4OQO A;  3UIF A;  2ALU A;  4ZZE A;  2THI A;  3CI8 A;  3MUQ A;  5M2V A;  3KG2 A;  3FJG A;  1B32 A;  3IB2 A;  4YB7 A;  2RC8 A;  3KJT A;  4LZ5 A;  4F1V A;  2XXH A;  5BWJ A;  2RC7 A;  5I2K B;  1MXU A;  3K6W A;  1LBC A;  1BLF A;  2B3F A;  1MY0 A;  3UOR A;  3MVX A;  4ZEK A;  4YIC A;  2RKM A;  3L6H A;  1LFG A;  4JB7 A;  4XKR A;  1SVX B;  5CMK A;  4L17 A;  5CBR A;  5JTY A;  5B7D A;  3FD3 A;  3IX1 A;  3IOT A;  5CM6 A;  1XT8 A;  4ND9 A;  4YKI A;  2OLB A;  4ELQ A;  2NVU B;  4X1B A;  4NF8 A;  4Z0I A;  1IQ7 A;  3EN3 A;  2GFE A;  1MRP A;  2A5S A;  4IO7 A;  1RYO A;  3QIM A;  3IO4 A;  5EHS A;  1VR5 A;  2O51 A;  1MY2 A;  1POT A;  2F97 A;  2RCA A;  3SKP A;  3M3K A;  2HZL A;  3TTM A;  4GXA A;  5I2N B;  4NF6 B;  3DP4 A;  1QKA A;  5A5X A; 
#chains in the Genus database with same CATH topology
 4HE1 A;  4POX A;  1UQW A;  1MPB A;  2F35 A;  3H03 A;  1AL3 A;  2QRY A;  3C35 A;  1SW2 A;  3UP9 A;  1B3E A;  5CMM A;  2B3B A;  4H6D A;  1MQJ A;  5FTI A;  2Z22 A;  2XD2 A;  4H46 A;  4ESX A;  3H6U A;  1CB6 A;  3TAJ A;  3UK4 A;  4C1T A;  1ZU0 A;  2PYY A;  2FIX A;  3PMW A;  1TFD A;  5IZ3 A;  3ZSF A;  1CNQ A;  2F36 A;  1YAE A;  4OAN A;  1S7Y A;  2DE3 A;  1SYI A;  1N76 A;  2DWJ A;  4XKQ A;  4LON B;  1LFH A;  1NH8 A;  5CMB A;  2F6G A;  2REG A;  1R9L A;  1FPG A;  1B5J A;  1N7W A;  1POY 1;  4DE8 A;  3QYT A;  4JDF A;  1GTK A;  3B7D A;  5EYF A;  4JWX A;  2I6E A;  2ZYN A;  3IO6 A;  2YLN A;  4QRZ A;  1OQH A;  5DEX A;  3DP6 A;  2VOZ A;  4QSE A;  1TT1 A;  2PMS A;  4ELP A;  4X48 A;  4YU0 A;  1KZ8 A;  4NX1 A;  5I58 A;  1N84 A;  4LVQ A;  1Y3P A;  2AL5 A;  4OXV A;  3QXM A;  3TCF A;  3BIH A;  4AQ4 A;  2AIX A;  4F3S A;  4IO5 A;  5H8N B;  1Y1M A;  1FTA A;  1FPK A;  1MY1 A;  5KDT B;  4NAP A;  4H45 A;  3RUM A;  1LFI A;  1DMB A;  3OEL A;  4YB5 A;  1IMB A;  1AIV A;  1LB9 A;  5EYG A;  4BDM A;  2WYK A;  4PF6 A;  4FAT A;  1MY3 A;  4RNS A;  1SD3 A;  4FAJ A;  1IMF A;  5I2K A;  4OEV A;  4DXU A;  1QKB A;  1KWH A;  2FYI A;  4GWU A;  2OZZ A;  4JVC A;  1EYK A;  1IXC A;  1H45 A;  4NF4 A;  4ZED A;  4ESW A;  1B3G A;  4N91 A;  1DOT A;  2E0S A;  4P56 A;  5H8F A;  3IAZ A;  3KGC A;  3S2V A;  1FTM A;  4PBQ A;  1D9Y A;  2OJT A;  2XXW A;  1UTH B;  1LCF A;  2R71 A;  5I5P A;  1NKX A;  3DEL B;  4F22 A;  2CZH A;  3OO8 A;  4BLA A;  5FTH A;  3THI A;  4QF9 A;  2NXO A;  2XXY A;  3A29 A;  4UAC A;  3FXR A;  1QUJ A;  3VVF A;  2F8D A;  3N94 A;  5DVF A;  2ABH A;  3K00 A;  1N04 A;  4TLL B;  5FHO A;  3C33 A;  4F3G A;  3KN3 A;  4OET A;  3TPA A;  3V89 B;  1LGB C;  2WEF A;  1ANF A;  2O7U A;  1M5E A;  2ZYK A;  4KCC A;  1A8E A;  4NF6 A;  3S9L C;  5EQ8 A;  1MY4 A;  2BJI A;  2O84 X;  2QFL A;  3TQL A;  2XWK A;  2A5T A;  2DP8 A;  2QJE A;  2I0C A;  4EXL A;  3Q28 A;  3RLF E;  2H5Y A;  5F1Q A;  3FUZ A;  1NV5 A;  1N0T A;  4F39 A;  2QVV A;  4ZEI A;  3E4R A;  2FBP A;  2Q8J A;  4U21 A;  4GX3 A;  1LBZ A;  3FVG A;  4NHB A;  3RT6 B;  4G4P A;  4ONY A;  4EF1 A;  1FPI A;  2I3W A;  4HW8 A;  5ET5 A;  3G3K A;  1ZLQ A;  2ZMB A;  1QUK A;  3G3H A;  4R2B A;  1ATG A;  2KQZ A;  1PBP A;  3MJN A;  2VPN A;  3RGY A;  5JTY B;  1A7L A;  4RK9 A;  4HS7 A;  2VD3 A;  4G77 A;  4JSO A;  5L8D A;  1URD A;  3B6Q A;  2ZNU A;  2M8C A;  3QAX A;  1Y1Z A;  4GVO A;  3OMB A;  3PPO A;  2V3Q A;  4UA8 A;  4DXB A;  3OD7 A;  2FA7 A;  3HV1 A;  4U2R A;  3CIJ A;  3FV2 A;  1A40 A;  4NF8 B;  3VVD A;  3IOU A;  5EHM A;  1EU8 A;  4KXP A;  3OO6 A;  3VXC A;  4PAI A;  1ZIU A;  1Q1K A;  1XS5 A;  2GHA A;  2DE2 A;  2VPO A;  1MXX A;  4DCY A;  3B6T A;  1NH7 A;  3CSB A;  3SER A;  3SEV A;  1LBW A;  1FJ6 A;  1WDN A;  2XX9 A;  2CEX A;  3VLV A;  3L6G A;  3RYD A;  4DZ1 A;  5F7V A;  2XWO A;  3EKI A;  4H67 A;  2V93 A;  1B5I A;  2DOJ A;  3TKD A;  1MXW A;  4R9F A;  1MPD A;  4N4U A;  1JEU A;  3PMX A;  1FQB A;  5A5X B;  4IGR A;  4PBH A;  3Q29 A;  4FE8 A;  4MLV A;  2GH9 A;  1YTV A;  3OXN A;  1NMU A;  3IR1 A;  2Q74 A;  5I57 A;  4X9T A;  4TQU Q;  1IIW A;  5DVJ A;  1Q9D A;  1QJM A;  4GBV A;  3U94 A;  1T0K A;  2Y7R A;  1NV7 A;  2I4C A;  1P1N A;  5I84 A;  4OMB A;  3FZV A;  1Y4T A;  5IKB A;  2F3D A;  4MH5 A;  2PVU A;  3RQT A;  4HE2 A;  5IZ3 B;  1B7U A;  2ZYO A;  4G68 A;  4IR8 A;  3TOD A;  4I40 A;  1Y20 A;  1SW4 A;  2CZL A;  2QVU A;  4F1U A;  3F11 A;  1UTH A;  1XI6 A;  2Q89 A;  2FIE A;  2BJJ X;  2Z8E A;  2RIN A;  3PPN A;  4PFY A;  1H44 A;  4EQB A;  3RTF B;  3V5A A;  1MXZ A;  4MNI A;  3CG3 A;  1USY E;  3MZB A;  4QFK A;  1LLS A;  2F5X A;  3PPQ A;  1S50 A;  4P1E A;  1ZJL A;  3QUF A;  2HFB A;  3ROJ A;  5DEX B;  4XXU A;  3FJM A;  3TTN A;  1ZTY A;  1B6H A;  4GLI A;  2WYP A;  5A5L A;  4FJP A;  1M5B A;  2QMW A;  5I58 B;  1QUI A;  4O3B A;  3UN6 A;  5I56 A;  1I6A A;  3VFJ A;  1JQF A;  3R7X A;  1OLC A;  3FAS A;  2F7B A;  3JV9 A;  4NGU A;  5CMC A;  5DYH A;  1IXI A;  4R2F A;  4PE3 A;  3ISP A;  4NF5 A;  3SDF A;  4LQ5 A;  1SPI A;  3VXB A;  3MYU A;  5TP9 A;  4IO4 A;  5IZ1 A;  3S9E A;  4C0R A;  3W9V A;  4KPT A;  5K2X A;  2REJ A;  4BDO A;  4JVD A;  3BKI B;  4KI0 E;  1FPB A;  4PGN A;  1LCT A;  1EZ9 A;  5T3J A;  5CC2 A;  4PF8 A;  1JVY A;  1IMA A;  4NF4 B;  3G7W A;  4G8N A;  2UYE A;  5H8F B;  3T9H B;  5IZZ A;  3FXU A;  1MM6 A;  2Y84 A;  3VLU A;  2Y7I A;  4NG7 A;  5H8S A;  4HTG A;  4KQP A;  4ZE9 A;  4MAG A;  4F29 A;  1OQG A;  2DWH A;  4BDQ A;  2XXR A;  3H6V A;  4IO6 A;  4DXC A;  4TLM B;  4ZS9 A;  4DI4 B;  2YPN A;  4PCD A;  1N3X A;  4IO2 A;  1B2H A;  1LBX A;  4QFP A;  5L9O A;  4MJO A;  1ELJ A;  3O29 A;  3KEI A;  4PGP A;  3DM0 A;  3TCG A;  4YKP A;  3M3L A;  4PDH A;  3PPP A;  3LSW A;  3IB1 A;  3MW0 A;  3H6T A;  2I0B A;  1IME A;  3BIG A;  3E79 A;  4RJZ A;  4M4G A;  4I62 A;  4JWY A;  4P9K A;  4R6Y A;  4X04 A;  1R9Q A;  2DYX A;  5HBC A;  4RK2 A;  4WKM A;  1DTG A;  2D5W A;  4IGT A;  2A5T B;  4OER A;  2XX7 A;  1LEV A;  2P0S A;  1FPD A;  1URG A;  3D4G A;  1D3K A;  3LUY A;  3PUZ E;  3PU5 A;  3TUS A;  1P1W A;  5DTB A;  4ISU A;  1AWB A;  1JEV A;  4BDR A;  4ZEC A;  1SYH A;  3K01 A;  2WKY A;  3PV0 E;  1VSO A;  4Q0C A;  1I6Q A;  4KYE A;  2DXY A;  2RCB A;  1FSA A;  1B58 A;  4MMP A;  1OVT A;  2HEU A;  4GIZ A;  3K0V A;  3OO7 A;  2NUV A;  5DVI A;  1IMC A;  2PT2 A;  1PB8 A;  4Q5T A;  4QBA A;  3RPL A;  4H0W A;  1MH3 A;  4OVP A;  4QXD A;  1WVJ A;  3Q26 A;  2X7P A;  3MC2 A;  4XIG Q;  1MQD A;  2WBD A;  3B6W A;  3O97 A;  2ESN A;  2E1S A;  2OCU A;  4KCD A;  2R6G E;  5ELV A;  3TYH A;  3FXQ A;  3PD9 A;  4N6D A;  3MBP A;  3MST A;  2GQ1 A;  3KN8 A;  5I7I A;  3D1R A;  4QFN A;  1TFA A;  5DT6 A;  4HCW A;  4OA4 A;  1B51 A;  2ZZX A;  5HM4 B;  3TZA A;  3TQW A;  4KR5 A;  4HCY A;  1IMD A;  4H8J A;  1HSL A;  2ZZW A;  1FQF A;  2P3V A;  3EHS A;  2QPQ A;  4LQ2 A;  3IOW A;  1LAX A;  5AE4 A;  4N81 A;  3HHF A;  4GWY A;  1JW1 A;  4PAK A;  1LBB A;  3JYR A;  2OWT A;  1H3D A;  3E13 X;  5H8H B;  4FBP A;  2Y7P A;  3OEK A;  2QS3 A;  5H8Q A;  4GF8 A;  5I57 B;  3ECR A;  1XOC A;  2VHA A;  3ZKK A;  2FVZ A;  5AA3 A;  4KYS A;  3KC1 A;  4ELO A;  3T66 A;  4RPO A;  5I3S A;  2QS1 A;  1INP A;  3MPK A;  3H4Z A;  1FTL A;  1SQY A;  2Z23 A;  1NV6 A;  3CRB A;  3PMV A;  1GGG A;  1B0H A;  2UVH A;  4X1D A;  3GLB A;  1Z7M E;  4G68 B;  4N6K A;  1AMF A;  4YMB A;  2Q8M A;  1M5D A;  3O6I A;  4OEU A;  3LR1 A;  4OFO A;  2H9B A;  4P0I A;  4ZDM A;  2F7A A;  4F2O A;  2Y5K A;  1MQI A;  5JK4 A;  1B3H A;  2WBB A;  1RKM A;  5ICT A;  3TTL A;  4DCX A;  1MDP 1;  3FVK A;  1NV4 A;  4OES A;  3IFA A;  3I6V A;  4I8C A;  2DDK A;  4PDD A;  1USY H;  1MH4 A;  1RDY A;  2R8T A;  1FQD A;  3C34 A;  1FTJ A;  2PFY A;  3PGF A;  3ODB A;  5CI5 A;  3IL1 B;  3LSL A;  3CSG A;  1QUL A;  4QFO A;  5I56 B;  5IAI A;  3FVN A;  4G2Z A;  5KCJ A;  3N5L A;  2DWA A;  3O6H A;  1MG1 A;  4NF5 B;  2O7I A;  1DK4 A;  2Y7W A;  5TP9 B;  3K1N A;  1I6B A;  4QSD A;  1FBH A;  3U93 A;  2Z8D A;  4NMY A;  3KBZ A;  3S9M C;  1XVY A;  1YZ0 A;  2B65 A;  1DSN A;  2XXT A;  2XXK A;  4P0G A;  2ZNT A;  3G3I A;  4O3C A;  4RPN A;  4P8B A;  2OWZ A;  3MP6 A;  3CVG A;  1NUX A;  1VDW A;  1DPP A;  3M3F A;  5ICQ A;  1B46 A;  4PP0 A;  2IEE A;  4OVR A;  3RNN A;  1Q35 A;  1DBZ A;  2P2A A;  3I5O A;  5TPA A;  4U4X A;  3SZP A;  4U1O A;  2P1S A;  5ITP A;  1SBP A;  3FXB A;  3DP8 A;  4R9G A;  5AA2 A;  3W9W A;  1EZP A;  4KYD A;  3QK6 A;  5L9M A;  1NUY A;  3HN0 A;  1P1U A;  2UVJ A;  1KA0 A;  4ECF A;  2DVZ A;  1NUW A;  4H1X A;  3ZS6 A;  3TEL A;  1O64 A;  4O7I A;  1B5H A;  5EQ9 A;  4GWO A;  1N7X A;  3R26 A;  4BDL A;  1ZBM A;  2VD2 A;  4OVS A;  1JNF A;  4XFE A;  3RN8 A;  1NNT A;  2CZI A;  4U4S A;  1NI9 A;  3N6T A;  1QW0 A;  3MZ9 A;  4QSC A;  5LOM A;  5AA2 D;  3FVO A;  3LSX A;  1UTB B;  2HZK A;  1BK4 A;  3ILT B;  2QL3 A;  2AL4 A;  3TEP A;  2XXQ A;  4GX4 A;  4MHF A;  5H8H A;  3CFZ A;  3K1P A;  1LAH E;  3LUZ A;  3U72 A;  3K6U A;  3EQ1 A;  1R1N A;  4THI A;  2V84 A;  3UGW A;  2DWI A;  1B3F A;  1D9V A;  1F9B A;  2V25 A;  1LAF E;  4LN5 A;  2CEY A;  1A55 A;  1VE4 A;  1SI0 A;  4GBW A;  5FHN A;  1HSJ A;  3HPI A;  2PX1 A;  4G8M A;  2H25 A;  3V8X B;  1M5C A;  3RPL B;  2XXU A;  2V3U A;  3CR9 A;  1FPL A;  1K9Z A;  3O2A A;  4FIM A;  4OZ9 A;  3T0J A;  4EQ7 A;  3A3C A;  3MVZ A;  3FBP A;  1FTO A;  2UVI A;  1NFT A;  2Z8F A;  1FBD A;  5J1D A;  3MQ9 A;  1MDQ A;  4YKJ A;  3T93 B;  4GWZ A;  5B70 A;  4IO3 A;  1P1O A;  2X7Q A;  3MWB A;  1NUZ A;  1AOV A;  3E3K A;  1FQC A;  3RT8 A;  4RY1 A;  4MIJ A;  1LBY A;  2O68 A;  3OEN A;  2O1L A;  4NWC A;  3H7M A;  4OVJ A;  3C32 A;  1OLA A;  5L9S A;  3WAF A;  4JSD A;  4AS5 A;  1NNP A;  4YKK A;  2D3I A;  1US5 A;  3QUJ A;  4XKP A;  4GWW A;  2X26 A;  4NE4 A;  2W7Y A;  1YYZ A;  1PB7 A;  1I69 A;  3VE1 B;  4ZE8 A;  5H8Q B;  1Y9U A;  1FRP A;  1XHY A;  5CRY A;  5ESY A;  4WED A;  4F3P A;  4O3A A;  2PBW A;  1FBE A;  4IY6 A;  3Q25 A;  1VFE A;  1B4Z A;  1GR2 A;  1II5 A;  3T9U A;  1MQG A;  4K3F A;  3MVW A;  1MM7 A;  2F7C A;  3KSJ A;  3ONM A;  4HE0 A;  1ZMG A;  1JW4 A;  2ONS A;  3KJ7 A;  4AB5 A;  5IM2 A;  4MFI A;  3FIR A;  1DPE A;  2OWS A;  3K6V A;  4G68 C;  2WX9 A;  1G0I A;  3OOA A;  4N17 A;  3O66 A;  4EUO A;  1RDZ A;  3VVE A;  3PUW E;  4MNP A;  4E0W A;  4NQ8 A;  3HO7 A;  4JXI A;  1N3W A;  2XX8 A;  1B1H A;  2XD3 A;  2UYF A;  4RXL A;  1YCJ A;  1OVB A;  2JJK A;  4JVI A;  3U8Q A;  3G3J A;  1SDX A;  1Y4C A;  4NF0 A;  4OFL A;  4N07 A;  3GBA A;  3IJX B;  1LBV A;  3KN7 A;  4MEV A;  4R6H A;  4F3B A;  3KOS A;  3D4C A;  1FBG A;  1NL5 A;  2PT1 A;  3EHU A;  1LAG E;  2Q88 A;  4F1Y A;  2D21 A;  3PUX E;  5AA1 A;  4GL0 A;  4GFR A;  1L5T A;  4F31 B;  3R6U A;  4F2Q A;  4LA9 A;  4P47 A;  1P99 A;  4PC9 A;  1MQH A;  3MP1 A;  4PFU A;  2DVC A;  4U22 A;  5KCJ B;  3KFM A;  4BDN A;  1UTB A;  4I9D A;  3MVY A;  4R6K A;  5HPQ A;  4NN3 A;  2XHD A;  1B0L A;  3EHT A;  5J16 A;  3WAE A;  4C1U A;  3FAT A;  3JZJ A;  2O69 A;  2I49 A;  1JET A;  5ET8 A;  1A99 A;  3ZKL A;  5EYH A;  4G8H A;  4JWO A;  2UXA A;  5BUU A;  4EF2 A;  2XWI A;  3G3F A;  1PB9 A;  5AA4 A;  1H76 A;  3IOV A;  4MX6 A;  2DSF A;  1P1Q A;  5JEI A;  4FED A;  2ZZV A;  3KBR A;  4Z7E A;  1B1X A;  4KHZ E;  1G0H A;  5TPA B;  3TDJ A;  5CBS A;  1GV8 A;  3H6W A;  2I58 A;  4EDP A;  3GBB A;  5AA2 B;  4PE5 B;  3K2D A;  3PTY A;  1FBF A;  4NTL A;  3KSX A;  3T9X B;  4NWD A;  5ET6 A;  1PDA A;  4LAT A;  1Z7N E;  1TXF A;  3KOT A;  2XXP A;  2V3T A;  3M8U A;  3T9V A;  2I4B A;  3W15 C;  5IGA A;  2H98 A;  2O6A A;  5ISU A;  2GRV A;  1MXY A;  3K02 A;  4PFR A;  3PUV E;  3LSF B;  2P3N A;  1FQE A;  1FW0 A;  4LZ8 A;  3C36 A;  1XVX A;  4QHQ A;  4LP2 B;  1IEJ A;  4O8M A;  3K6X A;  1IXG A;  4OTE A;  4MBP A;  3HCQ A;  1IXH A;  4JBZ A;  3U1O A;  1FTK A;  4I1D A;  4O7M A;  1QVS A;  3T96 B;  2F78 A;  1A8F A;  5ITO A;  5I59 A;  3T22 A;  2H99 A;  4U1Z A;  4UAB A;  4H5G A;  2CZK A;  1HSE A;  1EZO A;  2GHB A;  3CFL A;  4GQO A;  3GYY A;  1Y3N A;  4DLD A;  1B7H A;  3FGS A;  1RDX A;  3FV1 A;  3TTK A;  2PCR A;  3P7I A;  4F18 A;  4ZEF A;  4GRK A;  4R72 A;  3HST A;  4XKN A;  5FBP A;  4N15 A;  3A09 A;  3VLW A;  1MS7 A;  2Y7K A;  1DTZ A;  4GX6 A;  3C31 A;  4FEB A;  1EH3 A;  4GL8 A;  2XXV A;  1A54 A;  4KD5 A;  4PET A;  3QSL A;  3HHG A;  4YB6 A;  4POW A;  3OSR A;  3BFT A;  2I3V A;  4O94 A;  1BIY A;  4XF5 A;  4DDD A;  3RY3 A;  2B4M A;  3MZ1 A;  3N6U A;  1NNF A;  3IK6 B;  4GWX A;  2I48 A;  5LTC A;  2HPG A;  1UIV A;  2VT5 A;  3OO9 A;  4LUB A;  4GOT A;  3E78 A;  1UIU A;  3T1B A;  1O63 A;  2MKZ A;  3UA8 A;  4MF3 A;  4MLQ A;  1PC3 A;  3SEU A;  1JW5 A;  1BTJ A;  4I3Y A;  4MNC A;  3SET A;  4G61 A;  1B4H A;  3A3U A;  4M1V A;  4OEN A;  4X8R A;  2XXX A;  3E9X A;  3MPL A;  1AH5 A;  2QSX A;  1BP5 A;  1EYJ A;  3I3V A;  3OSQ A;  4R74 A;  2HXR A;  2RF1 A;  1Y3Q A;  3O28 A;  3O6G A;  2IA4 A;  1OIB A;  2G93 A;  3TFL A;  2ONR A;  3SEX A;  4P11 A;  1YPN A;  4EXK A;  4PFB A;  2ZNS A;  3MP8 A;  2R9J A;  5LDZ A;  1US4 A;  1GVC A;  3VV5 A;  5I2N A;  4E0X A;  4ZEB A;  3B50 A;  2O1M A;  2F6P A;  3C9H A;  4OHN A;  5EQ7 A;  4AS4 A;  4LZ7 A;  1SW1 A;  5K2Y A;  3KC0 A;  4Q8R A;  1K9Y A;  4AB6 A;  2RC9 A;  3SEW A;  1NV1 A;  2DE4 A;  4YAH X;  5ET7 A;  4R73 A;  2ZYM A;  4TOZ A;  4WEP A;  2DS9 A;  3GXA A;  1JP4 A;  3PPR A;  1IUD A;  2F3B A;  4U23 A;  1YXI A;  4H8I A;  1FBC A;  4WXJ A;  4H5F A;  5TU0 A;  2Q9T A;  1SI1 A;  3O9P A;  3CG1 A;  2OK2 A;  3PD8 A;  3PUY E;  2QMX A;  2VP1 A;  4N13 A;  2Q2A A;  3LBS A;  2ANJ A;  4GXS B;  1M5F A;  4PAF A;  2NOO A;  2HQ0 A;  4ZZA A;  4RYA A;  3K1M A;  1SW5 A;  3OEM A;  4ELR A;  3S4U A;  3IOR A;  3SES A;  4OVQ A;  1CE2 A;  1XC1 A;  3ILU B;  4Q30 B;  1O7T A;  3GZG A;  3SEY A;  3MAM A;  3N26 A;  3AXF A;  3H06 B;  3CFX A;  1NV0 A;  4N6P A;  1LB8 A;  3U92 A;  3C4M A;  1TWY A;  1B40 A;  2YJP A;  2QS2 A;  5KZT A;  3DLN A;  3LC8 A;  2Y5L A;  4YMA A;  1IIT A;  1MPC A;  3FJ7 A;  4OYV A;  5DW8 A;  1B7Z A;  3U65 A;  5FHM A;  3VDF A;  1IZ1 A;  2LAO A;  2XXI A;  1FJ9 A;  1D4N A;  1BKA A;  4NED A;  4DIG A;  4FOR A;  1B52 A;  2HAV A;  4EQ9 A;  1FQA A;  2CMO A;  2H4I A;  5H8N A;  3NOH A;  4MCO A;  4RA1 A;  2HXW A;  4N8G A;  5KDT A;  2KLF A;  5AA4 B;  1B9J A;  4H65 A;  4KFQ A;  4OWD A;  2G29 A;  1B05 A;  4P1L A;  4XTC Q;  1J1N A;  1NNK A;  2ZXT A;  2UVG A;  3V83 A;  1FPE A;  2FNC A;  1RYX A;  1MXV A;  3IJO B;  1EYI A;  3BFU A;  4QFL A;  3CHG A;  1PBQ A;  2NWJ A;  1S9T A;  1FCK A;  1FPJ A;  3BBR A;  4I3E A;  4GWS A;  4OFJ A;  2VGQ A;  3USD A;  2OX3 A;  3IFC A;  1FBP A;  1NV3 A;  1OMP A;  2HCA A;  2AYS A;  3EPE A;  2XA5 A;  1PEB A;  4PFT A;  3TMG A;  1R6Z A;  1H43 A;  4N8Y A;  3RPW A;  1URS A;  3KZG A;  3QMF A;  3TTR A;  3EF7 A;  2QS4 A;  1NV2 A;  4IY5 A;  1LST A;  2HAU A;  4PTK A;  2F34 A;  5F24 A;  4FEC A;  4HXV A;  3TCH A;  4GD5 A;  2ONK E;  3S9N C;  1B3L A;  2DQV A;  2FHY A;  4XEQ A;  1WOD A;  2OBG A;  3HFU A;  3Q27 A;  1DCU A;  2Q2C A;  1JVX A;  3RTW B;  2DXR A;  4PFW A;  4R75 A;  3G3G A;  4F19 A;  3K4U A;  4DI3 D;  2V4C A;  5I59 B;  3IB0 A;  4YZZ A;  1VFD A;  1ZKB A;  4IB2 A;  4PQJ A;  3H3G A;  4OQO A;  2XWV A;  2L5V A;  3UIF A;  2ALU A;  4ZZE A;  2THI A;  3CI8 A;  3MUQ A;  5M2V A;  3KG2 A;  3FJG A;  1B32 A;  3IB2 A;  1D9Q A;  4YB7 A;  2RC8 A;  3KJT A;  4LZ5 A;  4F1V A;  2XXH A;  5BWJ A;  2RC7 A;  5I2K B;  1MXU A;  3K6W A;  1LBC A;  1BLF A;  2B3F A;  1MY0 A;  3UOR A;  3MVX A;  4ZEK A;  4YIC A;  2RKM A;  3L6H A;  1LFG A;  4JB7 A;  4XKR A;  1SVX B;  5CMK A;  5EQA A;  4L17 A;  5CBR A;  5JTY A;  5B7D A;  3FD3 A;  3IX1 A;  1FPF A;  3IOT A;  5CM6 A;  1XT8 A;  4ND9 A;  4YKI A;  2OLB A;  2PFZ A;  4PFI A;  4ELQ A;  2NVU B;  4X1B A;  2KR0 A;  4NF8 A;  4Z0I A;  1IQ7 A;  3EN3 A;  2GFE A;  1MRP A;  2A5S A;  3B8B A;  2HHM A;  4IO7 A;  1RYO A;  3QIM A;  3IO4 A;  4OVT A;  5EHS A;  1VR5 A;  2O51 A;  3LV0 A;  1QGX A;  1KA1 A;  1MY2 A;  1POT A;  2F97 A;  2RCA A;  3SKP A;  3M3K A;  2HZL A;  3TTM A;  4GXA A;  5I2N B;  4NF6 B;  3DP4 A;  2B4L A;  2QVR A;  4P3L A;  1QKA A;  5A5X A; 
#chains in the Genus database with same CATH homology
 4POX A;  1UQW A;  1MPB A;  2F35 A;  3H03 A;  1AL3 A;  2QRY A;  3C35 A;  1SW2 A;  3UP9 A;  1B3E A;  5CMM A;  2B3B A;  4H6D A;  1MQJ A;  5FTI A;  2Z22 A;  2XD2 A;  4ESX A;  3H6U A;  1CB6 A;  3TAJ A;  3UK4 A;  4C1T A;  1ZU0 A;  2PYY A;  3PMW A;  1TFD A;  3ZSF A;  2F36 A;  1YAE A;  1S7Y A;  2DE3 A;  1SYI A;  1N76 A;  2DWJ A;  4XKQ A;  4LON B;  1LFH A;  1NH8 A;  5CMB A;  2F6G A;  2REG A;  1R9L A;  1B5J A;  1N7W A;  1POY 1;  4DE8 A;  3QYT A;  4JDF A;  1GTK A;  3B7D A;  5EYF A;  4JWX A;  2I6E A;  2ZYN A;  3IO6 A;  2YLN A;  4QRZ A;  1OQH A;  5DEX A;  3DP6 A;  2VOZ A;  4QSE A;  1TT1 A;  2PMS A;  4ELP A;  4X48 A;  4YU0 A;  5I58 A;  1N84 A;  4LVQ A;  1Y3P A;  2AL5 A;  4OXV A;  3QXM A;  3TCF A;  4AQ4 A;  2AIX A;  4F3S A;  4IO5 A;  5H8N B;  1Y1M A;  1MY1 A;  5KDT B;  3RUM A;  1LFI A;  1DMB A;  3OEL A;  4YB5 A;  1AIV A;  1LB9 A;  4BDM A;  4FAT A;  1MY3 A;  4RNS A;  1SD3 A;  4FAJ A;  5I2K A;  4OEV A;  4DXU A;  1QKB A;  1KWH A;  2FYI A;  2OZZ A;  1IXC A;  1H45 A;  4NF4 A;  4ZED A;  4ESW A;  1B3G A;  1DOT A;  2E0S A;  5H8F A;  3IAZ A;  3KGC A;  3S2V A;  1FTM A;  1D9Y A;  2OJT A;  2XXW A;  1UTH B;  1LCF A;  2R71 A;  1NKX A;  3DEL B;  4F22 A;  3OO8 A;  4BLA A;  5FTH A;  3THI A;  4QF9 A;  2NXO A;  2XXY A;  4UAC A;  3FXR A;  1QUJ A;  3VVF A;  2F8D A;  3N94 A;  5DVF A;  2ABH A;  3K00 A;  1N04 A;  4TLL B;  5FHO A;  3C33 A;  4F3G A;  3KN3 A;  4OET A;  3TPA A;  3V89 B;  1LGB C;  1ANF A;  2O7U A;  1M5E A;  2ZYK A;  4KCC A;  1A8E A;  4NF6 A;  3S9L C;  1MY4 A;  2O84 X;  3TQL A;  2A5T A;  2DP8 A;  2QJE A;  2I0C A;  4EXL A;  3Q28 A;  3RLF E;  2H5Y A;  5F1Q A;  3FUZ A;  1N0T A;  4F39 A;  4ZEI A;  3E4R A;  2Q8J A;  4U21 A;  3FVG A;  3RT6 B;  4G4P A;  4ONY A;  4EF1 A;  2I3W A;  4HW8 A;  3G3K A;  1ZLQ A;  2ZMB A;  1QUK A;  3G3H A;  4R2B A;  1ATG A;  1PBP A;  3MJN A;  3RGY A;  5JTY B;  1A7L A;  4RK9 A;  4HS7 A;  2VD3 A;  4G77 A;  4JSO A;  5L8D A;  1URD A;  3B6Q A;  2ZNU A;  2M8C A;  3QAX A;  1Y1Z A;  4GVO A;  3OMB A;  3PPO A;  2V3Q A;  4UA8 A;  4DXB A;  3OD7 A;  2FA7 A;  3HV1 A;  4U2R A;  3CIJ A;  3FV2 A;  1A40 A;  4NF8 B;  3VVD A;  3IOU A;  5EHM A;  1EU8 A;  3OO6 A;  3VXC A;  1ZIU A;  1Q1K A;  1XS5 A;  2GHA A;  2DE2 A;  1MXX A;  4DCY A;  3B6T A;  1NH7 A;  3CSB A;  3SER A;  3SEV A;  1WDN A;  2XX9 A;  3VLV A;  3L6G A;  4DZ1 A;  5F7V A;  4H67 A;  2V93 A;  1B5I A;  2DOJ A;  3TKD A;  1MXW A;  4R9F A;  1MPD A;  1JEU A;  3PMX A;  1FQB A;  5A5X B;  4IGR A;  3Q29 A;  4FE8 A;  4MLV A;  2GH9 A;  1YTV A;  3OXN A;  1NMU A;  3IR1 A;  5I57 A;  4X9T A;  4TQU Q;  1IIW A;  5DVJ A;  1QJM A;  1T0K A;  3U94 A;  2Y7R A;  2I4C A;  1P1N A;  5I84 A;  4OMB A;  3FZV A;  1Y4T A;  5IKB A;  4MH5 A;  2PVU A;  3RQT A;  1B7U A;  2ZYO A;  4G68 A;  3TOD A;  1Y20 A;  1SW4 A;  2CZL A;  4F1U A;  3F11 A;  1UTH A;  2Q89 A;  2BJJ X;  2Z8E A;  2RIN A;  3PPN A;  4PFY A;  1H44 A;  4EQB A;  3RTF B;  3V5A A;  1MXZ A;  3CG3 A;  1USY E;  3MZB A;  4QFK A;  1LLS A;  2F5X A;  3PPQ A;  1S50 A;  1ZJL A;  3QUF A;  2HFB A;  5DEX B;  4XXU A;  3FJM A;  3TTN A;  1ZTY A;  1B6H A;  4GLI A;  4FJP A;  1M5B A;  2QMW A;  5I58 B;  1QUI A;  4O3B A;  3UN6 A;  5I56 A;  1I6A A;  3VFJ A;  1JQF A;  3R7X A;  1OLC A;  3FAS A;  2F7B A;  3JV9 A;  5CMC A;  5DYH A;  1IXI A;  4R2F A;  4NF5 A;  3SDF A;  4LQ5 A;  3VXB A;  5TP9 A;  4IO4 A;  3S9E A;  4C0R A;  3W9V A;  4KPT A;  5K2X A;  2REJ A;  4BDO A;  3BKI B;  4KI0 E;  1LCT A;  1EZ9 A;  5CC2 A;  1JVY A;  4NF4 B;  3G7W A;  4G8N A;  2UYE A;  5H8F B;  3T9H B;  3FXU A;  1MM6 A;  2Y84 A;  3VLU A;  2Y7I A;  5H8S A;  4ZE9 A;  4HTG A;  4KQP A;  4F29 A;  1OQG A;  2DWH A;  4BDQ A;  2XXR A;  3H6V A;  4IO6 A;  4DXC A;  4TLM B;  4ZS9 A;  2YPN A;  1N3X A;  4IO2 A;  1B2H A;  4QFP A;  5L9O A;  1ELJ A;  3O29 A;  3KEI A;  3DM0 A;  3TCG A;  4YKP A;  3M3L A;  3PPP A;  3LSW A;  3IB1 A;  3MW0 A;  3H6T A;  2I0B A;  4RJZ A;  4M4G A;  4I62 A;  4JWY A;  4R6Y A;  1R9Q A;  2DYX A;  5HBC A;  4RK2 A;  4WKM A;  1DTG A;  2D5W A;  4IGT A;  2A5T B;  4OER A;  2XX7 A;  2P0S A;  1URG A;  3D4G A;  1D3K A;  3LUY A;  3PUZ E;  3PU5 A;  3TUS A;  1P1W A;  5DTB A;  4ISU A;  1JEV A;  4ZEC A;  4BDR A;  1SYH A;  3K01 A;  2WKY A;  3PV0 E;  1VSO A;  4Q0C A;  1I6Q A;  4KYE A;  2DXY A;  2RCB A;  1B58 A;  1OVT A;  2HEU A;  4GIZ A;  3K0V A;  3OO7 A;  2NUV A;  5DVI A;  2PT2 A;  1PB8 A;  4Q5T A;  4H0W A;  1MH3 A;  1WVJ A;  3Q26 A;  2X7P A;  3MC2 A;  4XIG Q;  1MQD A;  3B6W A;  3O97 A;  2ESN A;  2E1S A;  2OCU A;  4KCD A;  2R6G E;  5ELV A;  3TYH A;  3FXQ A;  3PD9 A;  3MBP A;  3KN8 A;  4QFN A;  1TFA A;  5DT6 A;  4HCW A;  1B51 A;  5HM4 B;  3TZA A;  3TQW A;  4KR5 A;  4HCY A;  4H8J A;  1HSL A;  1FQF A;  3EHS A;  2QPQ A;  4LQ2 A;  3IOW A;  1LAX A;  5AE4 A;  3HHF A;  1JW1 A;  1LBB A;  3JYR A;  2OWT A;  1H3D A;  3E13 X;  5H8H B;  2Y7P A;  3OEK A;  2QS3 A;  5H8Q A;  4GF8 A;  5I57 B;  3ECR A;  1XOC A;  2VHA A;  3ZKK A;  5AA3 A;  4KYS A;  4ELO A;  3T66 A;  4RPO A;  2QS1 A;  3MPK A;  3H4Z A;  1FTL A;  1SQY A;  2Z23 A;  3CRB A;  3PMV A;  1GGG A;  1B0H A;  2UVH A;  4X1D A;  3GLB A;  1Z7M E;  4G68 B;  1AMF A;  4YMB A;  1M5D A;  3O6I A;  4OEU A;  3LR1 A;  4OFO A;  2H9B A;  4P0I A;  4ZDM A;  2F7A A;  4F2O A;  1MQI A;  5JK4 A;  1B3H A;  1RKM A;  5ICT A;  3TTL A;  4DCX A;  1MDP 1;  3FVK A;  4OES A;  3I6V A;  4I8C A;  1USY H;  1MH4 A;  1FQD A;  3C34 A;  1FTJ A;  3PGF A;  3ODB A;  5CI5 A;  3IL1 B;  3LSL A;  3CSG A;  1QUL A;  4QFO A;  5I56 B;  5IAI A;  3FVN A;  4G2Z A;  5KCJ A;  3N5L A;  2DWA A;  3O6H A;  1MG1 A;  4NF5 B;  2O7I A;  2Y7W A;  5TP9 B;  3K1N A;  1I6B A;  4QSD A;  3U93 A;  2Z8D A;  4NMY A;  3S9M C;  1XVY A;  2B65 A;  1DSN A;  2XXT A;  4P0G A;  2ZNT A;  3G3I A;  4O3C A;  4RPN A;  3MP6 A;  3CVG A;  1DPP A;  3M3F A;  5ICQ A;  1B46 A;  4PP0 A;  2IEE A;  3RNN A;  1Q35 A;  2P2A A;  3I5O A;  5TPA A;  4U4X A;  4U1O A;  2P1S A;  5ITP A;  1SBP A;  3DP8 A;  4R9G A;  5AA2 A;  3W9W A;  1EZP A;  4KYD A;  3QK6 A;  5L9M A;  3HN0 A;  1P1U A;  2UVJ A;  4ECF A;  2DVZ A;  3ZS6 A;  4H1X A;  3TEL A;  1O64 A;  1B5H A;  4GWO A;  1N7X A;  3R26 A;  4BDL A;  1ZBM A;  2VD2 A;  1JNF A;  3RN8 A;  1NNT A;  4U4S A;  3N6T A;  3MZ9 A;  1QW0 A;  4QSC A;  5LOM A;  5AA2 D;  3FVO A;  3LSX A;  1UTB B;  2HZK A;  3ILT B;  2QL3 A;  2AL4 A;  3TEP A;  2XXQ A;  5H8H A;  3CFZ A;  3K1P A;  1LAH E;  3U72 A;  3K6U A;  3EQ1 A;  1R1N A;  4THI A;  2V84 A;  3UGW A;  2DWI A;  1B3F A;  1D9V A;  1F9B A;  2V25 A;  1LAF E;  1A55 A;  1VE4 A;  1SI0 A;  5FHN A;  1HSJ A;  3HPI A;  2PX1 A;  4G8M A;  2H25 A;  3V8X B;  1M5C A;  2XXU A;  2V3U A;  3CR9 A;  3O2A A;  4FIM A;  4OZ9 A;  4EQ7 A;  3A3C A;  3MVZ A;  1FTO A;  2UVI A;  1NFT A;  2Z8F A;  5J1D A;  3MQ9 A;  1MDQ A;  4YKJ A;  3T93 B;  5B70 A;  4IO3 A;  1P1O A;  2X7Q A;  3MWB A;  1AOV A;  3E3K A;  1FQC A;  3RT8 A;  4RY1 A;  2O68 A;  3OEN A;  2O1L A;  4NWC A;  3H7M A;  4OVJ A;  3C32 A;  1OLA A;  5L9S A;  3WAF A;  4JSD A;  1NNP A;  4YKK A;  2D3I A;  1US5 A;  3QUJ A;  4XKP A;  2X26 A;  4NE4 A;  2W7Y A;  1PB7 A;  1I69 A;  3VE1 B;  4ZE8 A;  5H8Q B;  1Y9U A;  1XHY A;  5CRY A;  4WED A;  4F3P A;  4O3A A;  2PBW A;  4IY6 A;  3Q25 A;  1VFE A;  1B4Z A;  1GR2 A;  1II5 A;  3T9U A;  1MQG A;  4K3F A;  3MVW A;  1MM7 A;  2F7C A;  3KSJ A;  3ONM A;  1ZMG A;  1JW4 A;  2ONS A;  3KJ7 A;  4AB5 A;  4MFI A;  3FIR A;  1DPE A;  2OWS A;  3K6V A;  4G68 C;  3OOA A;  3O66 A;  4EUO A;  3VVE A;  3PUW E;  4E0W A;  3HO7 A;  4JXI A;  1N3W A;  2XX8 A;  1B1H A;  2XD3 A;  2UYF A;  4RXL A;  1YCJ A;  1OVB A;  3U8Q A;  3G3J A;  1SDX A;  1Y4C A;  4OFL A;  4N07 A;  3GBA A;  3IJX B;  3KN7 A;  4R6H A;  4F3B A;  3KOS A;  3D4C A;  1NL5 A;  2PT1 A;  3EHU A;  1LAG E;  2Q88 A;  4F1Y A;  2D21 A;  3PUX E;  5AA1 A;  4GL0 A;  4GFR A;  1L5T A;  4F31 B;  3R6U A;  4F2Q A;  4LA9 A;  1P99 A;  1MQH A;  3MP1 A;  4PFU A;  2DVC A;  4U22 A;  5KCJ B;  3KFM A;  4BDN A;  1UTB A;  4I9D A;  3MVY A;  4R6K A;  5HPQ A;  2XHD A;  1B0L A;  3EHT A;  3WAE A;  4C1U A;  3FAT A;  3JZJ A;  2O69 A;  2I49 A;  1JET A;  1A99 A;  3ZKL A;  4G8H A;  4JWO A;  2UXA A;  5BUU A;  4EF2 A;  3G3F A;  1PB9 A;  5AA4 A;  1H76 A;  3IOV A;  2DSF A;  1P1Q A;  5JEI A;  4FED A;  3KBR A;  4Z7E A;  1B1X A;  4KHZ E;  5TPA B;  3TDJ A;  5CBS A;  1GV8 A;  3H6W A;  2I58 A;  4EDP A;  3GBB A;  5AA2 B;  4PE5 B;  3K2D A;  4NTL A;  3KSX A;  3T9X B;  4NWD A;  1PDA A;  4LAT A;  1Z7N E;  1TXF A;  3KOT A;  2XXP A;  2V3T A;  3T9V A;  3M8U A;  2I4B A;  3W15 C;  2H98 A;  2O6A A;  5ISU A;  2GRV A;  1MXY A;  3K02 A;  3PUV E;  3LSF B;  1FQE A;  1FW0 A;  4LZ8 A;  3C36 A;  1XVX A;  4QHQ A;  4LP2 B;  1IEJ A;  3K6X A;  1IXG A;  4OTE A;  4MBP A;  3HCQ A;  1IXH A;  4JBZ A;  3U1O A;  1FTK A;  4I1D A;  1QVS A;  3T96 B;  2F78 A;  1A8F A;  5ITO A;  5I59 A;  3T22 A;  2H99 A;  4U1Z A;  4H5G A;  1HSE A;  1EZO A;  2GHB A;  3CFL A;  4GQO A;  1Y3N A;  4DLD A;  1B7H A;  3FGS A;  3FV1 A;  3TTK A;  3P7I A;  4F18 A;  4ZEF A;  4GRK A;  3HST A;  4R72 A;  4XKN A;  3A09 A;  3VLW A;  1MS7 A;  2Y7K A;  1DTZ A;  3C31 A;  4FEB A;  1EH3 A;  4GL8 A;  2XXV A;  1A54 A;  4KD5 A;  4PET A;  3QSL A;  3HHG A;  4YB6 A;  4POW A;  3OSR A;  3BFT A;  2I3V A;  1BIY A;  4DDD A;  3RY3 A;  3N6U A;  3MZ1 A;  1NNF A;  3IK6 B;  2I48 A;  1UIV A;  3OO9 A;  4LUB A;  4GOT A;  1UIU A;  1O63 A;  3UA8 A;  4MF3 A;  4MLQ A;  1PC3 A;  3SEU A;  1JW5 A;  1BTJ A;  3SET A;  1B4H A;  3A3U A;  4M1V A;  4OEN A;  2XXX A;  3E9X A;  3MPL A;  1AH5 A;  2QSX A;  1BP5 A;  3I3V A;  3OSQ A;  4R74 A;  2RF1 A;  1Y3Q A;  3O28 A;  3O6G A;  2IA4 A;  1OIB A;  2G93 A;  3TFL A;  2ONR A;  3SEX A;  4P11 A;  1YPN A;  4EXK A;  2ZNS A;  3MP8 A;  2R9J A;  1US4 A;  1GVC A;  3VV5 A;  5I2N A;  4E0X A;  4ZEB A;  2O1M A;  2F6P A;  3C9H A;  4OHN A;  4LZ7 A;  1SW1 A;  5K2Y A;  4Q8R A;  4AB6 A;  2RC9 A;  3SEW A;  2DE4 A;  4YAH X;  4R73 A;  2ZYM A;  4TOZ A;  4WEP A;  2DS9 A;  3GXA A;  3PPR A;  1IUD A;  4U23 A;  4H8I A;  4WXJ A;  4H5F A;  5TU0 A;  2Q9T A;  1SI1 A;  3O9P A;  3CG1 A;  2OK2 A;  3PD8 A;  3PUY E;  2QMX A;  2VP1 A;  4N13 A;  2Q2A A;  3LBS A;  2ANJ A;  4GXS B;  1M5F A;  2NOO A;  2HQ0 A;  4ZZA A;  4RYA A;  3K1M A;  1SW5 A;  3OEM A;  4ELR A;  3S4U A;  3IOR A;  3SES A;  1CE2 A;  1XC1 A;  3ILU B;  4Q30 B;  1O7T A;  3GZG A;  3SEY A;  3MAM A;  3N26 A;  3AXF A;  3H06 B;  3CFX A;  4N6P A;  1LB8 A;  3U92 A;  3C4M A;  1TWY A;  1B40 A;  2YJP A;  2QS2 A;  5KZT A;  3DLN A;  3LC8 A;  4YMA A;  1IIT A;  1MPC A;  3FJ7 A;  4OYV A;  1B7Z A;  5FHM A;  3VDF A;  1IZ1 A;  2LAO A;  2XXI A;  1D4N A;  1BKA A;  4NED A;  4DIG A;  4FOR A;  1B52 A;  2HAV A;  4EQ9 A;  1FQA A;  2CMO A;  2H4I A;  5H8N A;  4RA1 A;  2HXW A;  5KDT A;  2KLF A;  5AA4 B;  1B9J A;  4H65 A;  4KFQ A;  4OWD A;  2G29 A;  1B05 A;  4XTC Q;  1J1N A;  1NNK A;  2ZXT A;  2UVG A;  3V83 A;  2FNC A;  1RYX A;  1MXV A;  3IJO B;  3BFU A;  4QFL A;  2NWJ A;  1PBQ A;  1S9T A;  1FCK A;  3BBR A;  4OFJ A;  2VGQ A;  3USD A;  1OMP A;  2HCA A;  2AYS A;  3EPE A;  1PEB A;  4PFT A;  3TMG A;  1R6Z A;  1H43 A;  3RPW A;  1URS A;  3KZG A;  3TTR A;  3EF7 A;  2QS4 A;  4IY5 A;  1LST A;  2HAU A;  2F34 A;  4FEC A;  3TCH A;  4GD5 A;  2ONK E;  3S9N C;  1B3L A;  2DQV A;  1WOD A;  2OBG A;  3Q27 A;  2Q2C A;  1JVX A;  3RTW B;  2DXR A;  4PFW A;  4R75 A;  3G3G A;  4F19 A;  3K4U A;  5I59 B;  3IB0 A;  4YZZ A;  1VFD A;  1ZKB A;  4IB2 A;  4PQJ A;  3H3G A;  4OQO A;  3UIF A;  2ALU A;  4ZZE A;  2THI A;  3CI8 A;  3MUQ A;  5M2V A;  3KG2 A;  3FJG A;  1B32 A;  3IB2 A;  4YB7 A;  2RC8 A;  3KJT A;  4LZ5 A;  4F1V A;  2XXH A;  5BWJ A;  2RC7 A;  5I2K B;  1MXU A;  3K6W A;  1LBC A;  1BLF A;  2B3F A;  1MY0 A;  3UOR A;  3MVX A;  4ZEK A;  4YIC A;  2RKM A;  3L6H A;  1LFG A;  4JB7 A;  4XKR A;  1SVX B;  5CMK A;  4L17 A;  5CBR A;  5JTY A;  5B7D A;  3FD3 A;  3IX1 A;  3IOT A;  5CM6 A;  1XT8 A;  4ND9 A;  4YKI A;  2OLB A;  4ELQ A;  2NVU B;  4X1B A;  4NF8 A;  4Z0I A;  1IQ7 A;  3EN3 A;  2GFE A;  1MRP A;  2A5S A;  4IO7 A;  1RYO A;  3QIM A;  3IO4 A;  5EHS A;  1VR5 A;  2O51 A;  1MY2 A;  1POT A;  2F97 A;  2RCA A;  3SKP A;  3M3K A;  2HZL A;  3TTM A;  4GXA A;  5I2N B;  4NF6 B;  3DP4 A;  1QKA A;  5A5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...