5AAMC

Structure of a redesigned cross-reactive antibody to dengue virus with increased in vivo potency
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
95
structure length
95
Chain Sequence
TMCSGKFSIDKEMAETQHGTTVVKVKYEGAGAPCKVPIEIRDVNKEKVVGRIISSTPLAENTNSVTNIELEPPFGDSYIVIGVGNSALTLHWFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SCFV513
publication title Structure-Guided Design of an Anti-Dengue Antibody Directed to a Non-Immunodominant Epitope.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 10
structure length 95
sequence length 95
chains with identical sequence J
ec nomenclature
pdb deposition date 2015-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5aamC00
4FFYA 4GT0A 2R69A 4UTCA 3UYPB 3IRCA 5KVDE 2GG1A 5IREA 5KVGE 3N40F 5GZNA 2HG0A 4GSXA 5LCVA 3WE1A 1Z3RA 1SVBA 5AAMC 3N44F 4BZ2A 5LBSA 3MUUA 1URZA 2H0PA 5KVEE 4X42A 2ALAA 5JHLA 4ALAC 4BZ1A 4UT6A 2JSFA 3VTTA 5H37A 5KVFE 2P5PA 2JV6A 3N41F 5LBVA 1PJWA 5AAWC 4UTBA 4UTAA 3UZEC 4UT9A 1Z66A 3N42F 5GZOA 4L5FE 1TG8A 2V33A 3J2PA 1RERA 1ZTXE 3UZQB 3G7TA 3UAJA 4FFZA 5IZ7A 4FG0A 5JHMA 1OANA 4AL8C 2JQMA 2R29A 1UZGA 1OK8A 2I69A 3N43F 3UZVA 4AM0Q 3J27A 1S6NA 1OKEA 5B1CA 3C5XA 3C6EA 3P54A
chains in the Genus database with same CATH superfamily
4GBXD 1XGTB 2K6YA 2CNZA 1RKRA 1YHPA 4DGVH 1WJ3A 2K3TA 4OH2A 1U8OA 1C7SA 1TTFA 1LQSR 3EYQC 3BZEB 1CYGA 3Q9PA 3QIWA 3VFMA 2WN3A 4ZSOE 4LSRH 4I0PA 1JK8B 4YHIA 4AMKH 2BY0A 4MAYA 2NLJA 3K6FA 3ZPDA 2WSDA 2DTSA 1V55B 5ACZA 3KPMB 2ZP8A 1ZPUA 3V5DB 4P4RB 5D9SA 5MEOB 4H8WC 4AJWA 5EF3A 2H6OA 4R7DB 2AQ1A 1ICTA 1KEML 1PAMA 4MBRA 4TTGA 1M3JA 4PJIB 1YEFL 3LKOA 3ROOB 5HPOA 5JO5A 4YDZA 4OW6A 3H2WA 5TE6L 3H9YA 5D7JB 1RZJC 1F4XL 4L8CA 2G2PA 3V4VA 1JZDC 4FTVB 4YSPA 1JTTA 2HP4A 2XN1A 4C54A 4NT6B 3DMMD 3AS0A 4N90E 4A2HA 1VLXA 1ZGLP 3T6ZA 3TX4A 3UTTA 4U3SA 2FX7L 1KEMH 1G9HA 4J3OF 1YEFH 1NFIB 2JIXA 3GSQA 3TC9A 4DWHA 5AENA 2EKSA 4OD2B 5I15L 5TE6H 1XF2A 1F4XH 4N9GA 1M42A 3QG6B 1ILUA 4YWGL 1QQDA 4FLHA 4XVSL 2K8QA 4Y4FD 1GOHA 4DTGL 4L29B 1HFUA 3DSNB 2PP7A 3LPWA 1CF8L 1BZ8A 1YQ2A 3KLSA 4GIPD 2EE2A 1D5IL 4GSRA 3NIFE 1ODAA 3QAZB 3KHQA 5GGQL 4PJXB 4HOZA 1S9VA 2FX7H 3FAXA 3QO1B 4NZUL 4QT5A 5I15H 4GRLA 3HN8A 4GP5B 4Z77B 3GLDA 2RMNA 3KPOB 3KL0A 4YWGH 4XVSH 3NABL 1FL6B 1S9YB 2KZKA 4DTGH 3KCWA 5DJ2B 2I9TB 2OSLB 3M17B 5A2AA 1PEWA 4E9SA 1OM3L 1CF8H 3PAZA 2UZYB 2J56A 5K9KB 2NW2B 3IFLL 4LLUA 1D5IH 2CJUL 3CSYA 3HZMA 3IB4A 2Z4QB 1PZSA 1SN0A 1IFHL 5GGQH 4NN7C 1JGVL 3P4MA 1KIUB 2A6DA 3VD7A 4FTDA 4ZUVA 2WN2A 2EYTA 4NZUH 5LKNA 5DU7A 4I88A 4C57C 1SHWA 1A7BA 2X7LA 2JKLA 3T3PB 1HI6B 3EJUA 2DI7A 3NABH 4QR7A 5JW3L 3ZN6A 3H0TB 1PMYA 4JDTL 3NESA 1OM3H 4JHAL 3VFOB 1FNFA 1IKFL 3IFLH 2CJUH 2CH8A 3FUKA 4O51A 1IFHH 3KGUA 3QH3A 1JGVH 1F1GA 2QZ5A 5FYKU 2BP0A 3CFDB 1TPXB 3E6HB 4CW1B 1PF3A 2LFGA 2WLIA 3QEHB 4R4BB 3H3BC 5HD8C 3TBTA 1ORSA 3FUIA 4RIRB 4ZOEA 3T0EE 4X50A 4G5ZL 2F5BL 2EUZA 4GW1A 4KJPC 1DYZA 4NAQA 4NWUL 4CJ1A 4XAWL 5B1KA 2X38A 3O4LA 5JW3H 3CXHK 4JDTH 4JHAH 4X5XA 1IKFH 2DLGA 3ZQXA 4X6CB 3DO7B 3CDCA 1P4UA 3P1VA 4FQQA 4WI0A 4D9QE 2BIQA 3A4AA 5BW7A 2MH4A 1YMMA 3FTUA 4GXFA 3ZE0F 2NNAB 3IMVA 4PJ5E 2NRDA 4G5ZH 4PIBA 2F5BH 1FZJB 1HQ4B 4K07A 3ES6A 3QDMA 3BUPA 1O7VA 2BK8A 1TCMA 2YPLB 2IADB 3AVEA 3MYJB 1FL3B 1WAAF 4XAWH 1MCRA 3QIBD 1G1CA 3MLYL 1KENL 2BNQE 2WTOA 2ZKYA 1I8UA 3LXCA 4MNHA 2EIZA 4W9EC 2GTQA 3SJVD 1WBXB 1Z7JA 4KX8A 3VI3F 5BV7B 1PLBA 3VH8B 3UZEC 1KPRA 3T2OA 5KBPA 4BM7A 1NUFA 2D8KA 2V3FA 4MMYB 4X4KA 4WIQA 1JJUA 2AQ3A 2GSIA 3ARPA 3TEWA 5LNEA 2PN5A 5HVGB 2BSEA 3POHA 5FB8B 4ZMPA 3MA7A 1JF1A 5F89A 1KCBA 5IIEB 1I7ZB 3UTSD 4U3XA 1UB6A 2Y3AA 1DHKA 3B2DC 2QQLL 5SWZD 3K2IA 2G3MA 4I5BB 5LAXA 1YEWA 5GGTA 1RK0B 4ES8A 3MLYH 1KENH 2ITEA 3GC3A 1ITCA 1MFBL 3PP4L 1G9NC 2YO3A 4JG9A 4G8EB 3II1A 4XBGB 4IEFA 2UWEE 4KJYB 5T1JA 1NDTA 3BESR 2W0LA 3KLHD 1X5ZA 3LKSB 1G6VK 3ULUD 1H6UA 1IGJA 1S78C 4XXCA 1EHXA 1MFMA 3P3UA 5J6HB 4YNYB 2QVFB 4AIOA 2QQLH 3EXLA 4HHWA 1C5CL 2Z31A 2B7DT 3B5TA 3VXQB 3WNNA 3SE3C 1CBJA 1MFBH 3PP4H 4K71B 5CD5C 1BBDL 1S7SB 4PI2A 3F7QA 4E36A 4PBDA 1CUOA 1WCQA 3ULVF 3NCYP 4Z18A 4N0UE 3D51A 2B08A 5M7QA 3EF4A 4LFHD 3GSUB 4NKOB 3DHPA 3MGAA 1C5CH 2ADIA 2GTWA 4K9EC 4A55A 1GYCA 3QULA 3EH3B 2HT2D 3EH2A 1IX2A 1BBDH 1YVLA 1I8MA 4PGZA 1GC1L 2DIAA 3HAEA 4KVNL 1CGXA 3KPLA 4CMMB 3AABA 4HV8A 1X4YA 3CU7A 3T4AC 1U8IA 1BAWA 3PIQA 4LMQE 4KBPA 1QLRB 4UV7L 1X5IA 3KPRB 4WNQA 1Z5HA 3NPSC 1J8HE 4K0OA 3NSDA 2YFOA 1DBBL 4ES9A 4JY4B 4G8GE 4R7VA 5EBLA 4AQ8A 4JKMA 4FA6A 1GC1H 2VLKB 3FTZA 5GIRB 3RY4A 2UXFA 1CLZL 3MRHB 5KSUB 4KVNH 2Z7ZA 2CRIA 2IANA 4B97A 2K70A 4L3CA 2UYLA 4CSTA 3WELA 1E4HA 4UV7H 2V17L 3RPIA 4AK2A 2PTTA 3PHQA 1NKOA 2WMPB 3MNWA 4NNXB 3SZ6A 1PDKA 1G43A 1DBBH 5DUPL 4OZHB 4UT9A 4XMTA 1U2CA 4AW7A 1WBYB 5HYSB 5L7XL 1OL0A 3VXNB 1CLZH 3FSZA 1BOGA 2QLYA 3P3SA 4LLYA 3HFFA 3T3ME 4CVXB 3SDXB 4HC1L 3GJFH 4GG6B 4DGUA 5FECA 1QUNB 1G4MA 4NQSA 3MRPA 2V17H 3OQRA 1EH9A 3BN3B 2NY6C 3RUGE 3VTMA 4XNXL 1BHGA 4IGBC 2CR6A 1A7RL 1QZ1A 4ZPTA 5DUPH 3BP6A 5EPMB 4JFSA 2KDYA 5BRZA 2ZWSA 3QUXA 4U6TA 5GGUB 4NRYA 3MFFA 1BREA 5L7XH 1XD1A 1D7FA 2GITB 2PXYD 3BEWA 4NIYE 1D7BA 1RQ5A 1NCJA 3FB7B 4HC1H 3HUJB 4XR8C 5EU5B 5I1AA 3II3A 1A14L 2LQRA 3CN4A 5CWSA 1LMIA 4EI6B 4OGXL 1T20B 3BVDB 4WK2B 2APTA 3WJLC 1KCKA 1B0WA 3WL9B 4XNXH 3NPSB 2R9HC 3D87B 1MW1A 2VM3A 4KI5C 1A7RH 2AJYL 2C3HA 4HAGA 4JG5A 4LEXL 2WLYA 4DZ8A 1I3GL 2HT3C 1N8ZB 1QFWI 1BQRA 1YO4A 5DZPA 4ZTEA 3RGVA 3V4PL 3LV3A 3ZQWA 1WHOA 1FVCB 3KPSD 4PPTA 5E9AA 3L5JA 1A14H 5M94B 2CR0A 2NTFA 3HVNA 2EEAA 4OGXH 4NQXA 3IDNB 3OJ2C 2WNXA 4PW3A 1Z0NA 4X6BA 5JORB 4QRQA 1S7UA 4WEMB 4ZT1A 3ZW3A 4QRPD 5DF0A 1ONQB 4BK8A 1EBAA 2BZDA 4IOFC 4ELMA 1LEIB 1AZRA 2AJYH 4LEXH 5DRWA 3RTQC 5B8CC 4Y5VB 1I3GH 4WWOA 3FQTA 3EBGA 2DQDL 2FIKA 4OZ4B 1IU1A 3CC1A 3V4PH 3FCSB 3RFRA 3WS6A 4L37B 3KXFA 5J1TC 1U8JA 2GJ6D 4HT1L 3DYMA 4GMSL 5A3ID 2CDFA 3MCG1 2G2NA 4HD9A 1RIVL 3SE9L 2DKUA 3VXUB 5L9DH 3GEFA 4H5SA 4MCZB 3VTTA 2B8OT 1NAML 3Q48A 2WANA 3HRZA 2KKQA 5DHVH 2FTAA 2DQDH 3SPVB 1HYSC 1UXSA 4X0NA 4AE0A 4N2MA 3EGXB 1HHKA 4PHXA 2OR9L 5F7DB 1UD8A 4C47A 4DP7X 2Q9OA 2OTUA 4HT1H 2LAAA 3FRPA 2OXHB 4GMSH 5IM7A 2ZSWA 3U2JA 4YDJB 2XWDA 1RIVH 2XNAA 5K9JL 4G9FE 3SE9H 1NCIA 5EF1A 3L1EA 3FUFA 4M7LT 5JMOC 1NAMH 2V3DA 5FYJE 3C8KB 5I18L 1SFDA 3LKRB 4HU2A 4TLTA 3O8XB 4JEGB 4P2RD 1KSRA 2VZ1A 2OFQA 3MRIB 4LF3B 4YSRA 5I0YA 2OR9H 3ZU8A 1PY0A 1OK0A 3VFVA 1XEUA 4OGAD 4YLCA 3DX8A 2V2XB 2XUWA 1QACA 3QUHA 4X7FC 2YRPA 3RNQB 2PWFA 2MFNA 2WUBL 3I75A 4POZD 4LLQB 5K9JH 4KPHH 2AMGA 3IFOB 4PR5B 3UMNA 5I18H 3RTQB 1WIUA 5D6DC 4I2XB 1OP4A 1FHNA 4LDLB 5DGQA 2WJ5A 1MCLA 3FB5B 4LEEA 2Z3FA 5H2BB 3SYCA 2DL9A 1XBDA 3F7VA 1RY7B 1R46A 3UJJL 4QJ4B 2H45A 4V2CB 4GUPA 4PEEA 4KKRA 1QTSA 4X8JA 2VLRE 4LEOB 2WUBH 2JQAA 3DV6B 4UAOC 5JQ6L 5MEPA 1VPOL 2EYRA 3DX6A 2A5UA 3CK0L 2OCFD 5JHDB 4LEBA 4Y9BA 3PNWA 1EWHA 4YO0B 4A7UA 32C2A 5IV2A 1OTTC 4U31A 3UJJH 3KYOB 4HKJB 3TV3L 3PL6C 2VRQA 3OM3B 2O6DA 1IGFL 1YSOA 5E6RB 5BCAA 3FDWA 4NNYB 1OM9A 5JQ6H 5L8JB 1PQZB 1VPOH 4DKDC 1ZV9A 1XH2A 3OR7A 4ZS7L 2V7HB 3CK0H 4PRHB 5HSFA 4Q8BA 4JM2C 2VR6A 3WGUB 5IK3B 4J4PC 4P5KB 3SQOL 5T8IA 2PABA 3D8MA 3FF7A 5DURD 3GQFA 4N5ED 1JXKA 4W9FC 3TV3H 1OSZB 3N85L 3PCYA 3VG0L 3V7AE 4TNVK 1A3ZA 2IPTL 1IGFH 4UDUB 3GDCA 4KI5E 4D0DA 3LJ3A 4QD2E 3TF4A 2D73A 3WTXA 1E28A 1WFTA 1MAML 4IRSC 1S7QA 3AXLB 3MNVA 2A6IA 1NGXA 4ZS7H 2YIHA 3AWFA 1CICC 1ND0B 3AT0A 3AREC 4WO0A 4YGVA 5DQ9B 4JHVA 3V7AG 3ZE0E 4BYHA 5KEZA 3SQOH 2BNUA 3WUZA 4W9KC 3MV7A 2OL3L 2FZ3B 1DCLA 3QFJD 3UGUA 3TNMA 3GO1L 3IDUA 3N85H 2WIIB 3VG0H 1WAAE 5E8NB 4AGOA 5CBEB 2IPTH 4FYQA 4AT6B 1UZ8B 3VJ6B 5J56B 3BIKB 4KX9A 3VI3E 5EOCJ 3DX7B 5TE4L 1S7WA 1MAMH 4M3KB 5I82A 3WY4A 4IBVA 3BZ4B 3MJGX 2X4TB 1DBML 4OY9A 4JJHA 1BXVA 1FO0B 3SPHA 1B0GB 5EBMB 3FT2A 3GIVA 5JOFB 1BLNB 2OL3H 3GO1H 5IMLA 1VZGA 1IL1B 3SGJA 4ZMZA 4WI9A 2GJRA 4B9PA 4DEPC 1HXYA 1XB3A 5TE4H 4I89A 1NC4A 2JLPA 1VEMA 4PRPE 3WE6A 3V5HA 1DBMH 1KBBA 3PWVB 4ZOCA 1AQKL 4YSCA 1WT5A 5FFLA 1UH3A 2J6EL 2VR9A 3EOYG 1FCCA 4J3OD 2PO6D 4JFEE 2OMZA 4CSPA 4APQD 1H3UA 3LN4A 3WTUA 3JWNH 2P47B 1HOCA 5I1LA 4XPAL 2I25N 4XXDA 3AS1A 5HGHA 1IVLA 4IRSB 2CJ3A 1ETB1 5GGRY 4PJ9D 5IWLA 5E1QA 4F8OA 1Q9WB 4KWUA 3ULVE 4DUVA 2FWUA 4GKNA 3OHXA 1OLLA 3K74B 1WFUA 1CICB 1AQKH 1PKQA 2LVCA 4ZXBA 1C7TA 4UDTA 4A04A 4HP5A 1WTGT 2J6EH 2K3HA 4JJOA 4P57A 4EBQL 4QOKA 3SE4A 4U1MA 3RDTD 2XKSA 4DN3L 1KWGA 1QRND 2HWZL 5C6TL 5CP7A 1MSPA 3FJTA 4XPAH 4PGDB 1K3IA 1YY8A 1OT2A 1GGBL 2EP6A 2GT9A 3SO3B 4WU5A 8PAZA 2Q76B 4ELDA 2NNRA 2VC2L 4AITA 1AGEA 2O61B 2A4CA 5D1QA 5B39G 4Z7VF 3ZO9A 4N8VA 1YNKL 3K72A 3HG3A 4EBQH 3BI9X 3LRSA 2QSTA 3QJTB 2GCYB 3ZE1B 4PP1C 1DEEA 2AXHA 3NA4A 4DN3H 1WA0X 4XVTL 1A4BA 2HWZH 5C6TH 3TLRA 4ANVA 1LK3L 5ICZA 3GMOA 5KUKA 4QRTA 4XBEL 1M1XA 4E9VA 1GGBH 1JHTB 2HFFB 4JRWA 2VR7A 2ZG2A 3L7EA 3MYZA 1VSCA 2CM6A 4L3FA 5E4IA 3FHAA 3BN9D 5LWYL 2VC2H 4BFRA 2ZUQB 5C2BL 4KGJA 2DQFA 2DY2A 1GSMA 1YNKH 4WWKA 4D8OA 4FXGB 2VQ1A 3KL3A 4JS7A 5EIIA 1NINA 4D0BB 4XVTH 4LCCB 3VWKB 1JZIA 4L0ZA 1LK3H 1IFRA 2OMVA 4XBEH 2FSEB 1OGPA 1B4RA 2EDXA 3A4FA 2AQ2A 2YUXA 5EU6D 4ODWA 2J20A 2KH2B 4OR1A 4GKZB 1I3UA 5LWYH 2HMID 4XN4A 5CJXC 1XF5B 1F00I 3FCTA 5C2BH 5FGSA 1ET8A 3GJFA 4HZLB 3ZBMA 4GFTB 4G6FD 3N1FC 5KYUB 1T2XA 1E4KC 3IN0A 5KVDL 1E90A 3MV8A 4GI6A 4P23A 1D5BA 1S7RA 3QS3A 4AM0Q 1C5BL 5T1LD 1RJZB 4ZI8A 5E1HB 2CRZA 4GSQA 5ELIA 3D4YA 4LQ1A 4Y16A 3ASOB 1XF4A 2WIMA 1B4JL 5D7KD 3WEOA 3FQNA 1M6OB 5CZRA 4N1EA 2BC4B 1U6AL 4X8XA 2VUOA 2GKIA 3E38A 1SEBB 1KJVA 3TYFB 5KVDH 3WFDL 4Y19E 2YAEA 1TQVA 2HVKA 3P77A 1I8LA 1C5BH 4JQXA 3SCMA 1U8MA 3UTPD 2VR8A 3DTUB 3VMOA 2P8PB 3OAZK 3W1ZA 1BQSA 1YYML 3MO1A 1G5AA 1U4FA 3WE1A 3TEXA 1WEJL 4EN3D 3KJ6L 2O6CA 2XG4A 4Y88A 5JIIA 1B4JH 3VE0A 4QRAA 4FE9A 4PJHB 1GGCL 1U6AH 3BWZA 3EOBA 3FQXB 3H9SA 1QATA 4WFED 3C60D 2BSRA 4PTUA 2QKIC 5A1AA 4XNQA 4GRWH 4OZGA 4MTMA 3WFDH 1N10A 4M7ZC 1PCSA 3L9RA 1VKXB 3VCLA 5AYQA 1A1NB 5I16B 2YXVA 1DSFL 3R8QA 5JYLA 2DICA 1YYMH 3MCLL 1WEJH 2Y36L 4YHPB 5KYXB 3I6SA 3KJ6H 4K8RL 1W72L 4WHYG 3LS5L 3V4PA 1KLUA 4PJAE 1RHHB 2BWQA 2XN9D 1Q4NX 4P3DA 1GGCH 1J0KA 1AD0A 1PNDA 3VXME 5D7IB 2GAZB 1PD1A 1XT5A 4L1SA 3I6KA 1KPVA 2Y7NA 4ZAKC 2ZUVA 1OOAA 4NSKB 4EDXB 3RHWF 1DSFH 3U9WA 5GS1A 5IQ9B 4TQIA 2X41A 3GS0A 2JI2A 3FHEA 1JD9A 3IDJB 1AIFA 2Z65C 4R0LC 3V5KA 4HCRL 4QTHB 4B9CA 4DP9X 3MCLH 1KXHA 1EEYA 2Y36H 5EFIA 2VDNL 4IHOB 4UQBA 4H4NA 1W72H 4K8RH 3LS5H 1GZQB 2ZUUA 1FLRL 3P4OB 5JTWA 3BO8A 1Z5LB 3WNOA 5SWSB 5E1IA 4GKSA 4XVUC 1HZLA 4RGOL 1G7IA 1N0XL 4NYLB 2NR6C 5GS3A 5KSAA 1HDMA 1NAMA 1O9WA 1TQTA 1UGNA 4I18C 4UWQB 2CK0L 3UPRB 4XH2B 1YDPA 2P42B 1MY5A 2E4FA 2FGZA 3QIWD 4HCRH 5D2NB 4I0PD 2VDNH 2X42A 2E7CA 2YQ2A 1OE1A 2EXYC 4MAYD 2XWJB 5CJOL 1FLRH 3B56A 2OMYA 1FN4A 2Q10A 4PRAA 1MCQA 4GAGL 2BOBA 2Q3AA 2QKIB 4EQ2A 3L4XA 4QHUA 2VJ0A 3UP1A 5EZJA 1P7HL 1S7TA 2X0WA 3HNTL 4OFQA 1FZMB 1N0XH 4RGOH 2YKKA 4TULL 2ARWA 1FV1B 4IKJA 3BGMB 2CK0H 2X40A 3MUJA 4AKOA 3KHOA 3MJ9L 3GMPA 1KGXA 4HDIA 2CKBL 2B2XL 3A24A 4NUJA 1UATA 3HJEA 3PHSA 5CJOH 1WICA 4XN1A 4BFOA 3GTNA 1CQYA 4GAGH 2RALA 5FYKD 3UTTD 2J8UA 2LU7A 4ZAKB 5A2BA 5LXVA 2JIXD 1WV7T 3JV4A 4MCYB 1IBHA 5PCYA 3HNTH 1U8KB 1K2DA 2UUDK 2CE6A 4TULH 1PYWA 1GR7A 2BXZA 3QIUB 4KOCA 3ZT7A 2CBQA 4JL1A 4MNGB 3VD5A 3MJ9H 4AQEA 1DBKL 2CKBH 2B2XH 4H1LG 4MVBC 2CUHA 2VZVA 3JXAA 2W95A 3T8XB 2Z8RA 3EYFA 1K5NA 2P24B 5HVWA 5CCHE 3RZCC 4ENEC 3PV6A 2BCKA 2R56L 4UU9A 4ACTA 5DLML 1I7RA 1BGXL 1O75A 3U0TB 4XAKD 1QW9A 4IBSA 3U6XS 3TA3A 4GRLD 3L5IA 4ZRGA 1H3TA 4WRLA 1V05A 5EZLA 1FFOA 4TUOB 5E03A 3D39A 3RIKA 3DX9A 3TH4T 1DBKH 2I60L 3VFTB 1AGCA 2A0LC 4OV5A 1FYHB 3F12B 3QEQB 1XGRB 4P46C 2R56H 5LBSL 5DLMH 1BGXH 1SDDB 3ABMB 4HLZG 5HHXL 1IIIA 4H13C 3MN8A 3ZTJG 1UQSB 4RGMB 2NQ3A 3FSAA 4X7DC 1Q72L 2A9BA 2AQRA 3O6FA 5HI3D 5C86A 4XCNA 5BPPA 2ICWA 1FIEA 4P2OC 4QRSB 1J9SA 2XQYA 4KKLD 4WTXA 4FZ8L 2I60H 3NCMA 4GBXC 4JFTA 2V8MA 3UZQB 3ARFC 3HB3C 4K3HA 2QADD 4WVRA 5LBSH 1EA9C 4HXBL 1B2YA 1V7NL 5HHXH 1AKJA 3FRUB 5I6MA 1BDYA 1J8SA 1RUQL 3WO3B 2ZXAA 1HN1A 1NGZA 1KG0A 1Q72H 1AY1L 4J3TA 4NQCB 1Z3GL 1U9KA 1LQBC 1RZ7L 3HKZA 3O4LD 1RPQA 4F7MB 4NO2B 4FZ8H 4X7SL 3VFUB 3PXJA 5JA9A 2OL3A 3HZVB 1F90L 1YYCA 1CYXA 1RJLA 1W0WB 4QF1B 2PPFA 4GAYB 2AK1L 3MJ8A 4OD1L 3QXUA 1UWYA 4HXBH 5ANMB 2C3GA 3FN0L 1V7NH 4Y4KD 4UOQA 4Z78B 1RUQH 4Q9QL 1YMMD 4GAAA 4JGJA 2NY3D 2Q1EA 4JE4B 1AY1H 1TZIB 3EHBD 1Z3GH 1G7JA 3DMMC 5CGYC 3VA2C 1JWUA 3QDMD 4Z1PA 1W6LA 1RZ7H 4LCUB 4QJ5B 4X7SH 1UWEL 1S9XA 1P2CB 1U3HB 3MNMA 1F90H 2N1TE 3QRGL 1LK2A 4XMWA 4MB3A 1DVZA 5DSCA 1UD3A 4QI3A 4X9IA 4CGTA 2AK1H 1MUJB 1OGTB 3L48A 4OD1H 1UUSA 4P46B 4M9OA 4P2CG 5E1AA 2DQIL 3FN0H 2ESVE 4UM8A 2DM7A 3IJEB 4OLUL 4Y4FC 2R59A 4YFDB 4Q9QH 1CZ8L 2VDLL 1UENA 1MI5A 2A74C 3QDJE 3TVMA 3KYNA 1I7TB 3GSXA 3PE9A 3AU1B 4M56A 1R5IA 1JGUL 2EVFA 1T0OA 2ZONA 4K3GA 1RURL 3IMRA 2OMTB 2LTQB 5KYYA 1OGSA 2AZUA 2OM5A 4YIQB 2DWDA 4P2OB 2DMCA 3AT8A 3FO2A 1UWEH 5AYTA 1ECYA 3F5WA 4K55A 4GBXB 4K3EL 3BH8A 3BJ91 1MJJB 2D2OA 2Z34A 3Q6GL 3QRGH 4OTXL 4EVNA 3FTVA 2I24N 3UG3A 4ILDA 5FS5A 4MNQA 4DSYA 4JFQA 1KJ3L 2YMTA 3UH8A 2ZAIA 3U2SB 1QR1B 4LVEA 2DQIH 1J7VR 3W5NA 4OLUH 4PWHA 1CZ8H 2VDLH 5KS9F 1HHJB 1L7TL 2H47C 5DHDA 4BHUA 1JGUH 3B37A 4P3WA 4Z7VE 1RURH 1TYRA 1X5XA 4JPSA 4WGKA 3MRGA 5IKCB 5GS0L 1TEYA 2ZZUT 4MMZA 3KBEA 2Z31D 4GNKB 4K3EH 3G5YB 4GT7A 3CHOA 3Q6GH 4OTXH 3FBKA 2EXSA 4YJZL 1KJ3H 5CHNA 1X7QB 4WDIB 4DIXA 1EX0A 1ZLUH 4J3XA 5E8EB 4LOUC 1VFOA 3LZOA 4LLWA 5I6PA 2CCLA 1L7TH 2QSVA 3B9EA 4JFVA 3DBXB 2XWEA 3BAXA 2OMWB 1UT1A 1ZTXE 1QW8A 2BSDA 3DMMB 1OAUL 3MRRA 1UGKA 5SX4H 5GS0H 3D0AA 1ECZA 3CFUA 4HIPA 2E27L 5IF0B 4P9HL 1GGIL 5EC1A 5IBUB 1HH6B 1O0VA 3BLPX 5DZOA 2VISB 4H8VA 3GFUA 2PMZA 3FQWB 1CQKA 1UCBL 3MAWA 3P2BA 5C09B 4IKNA 2BVOB 3WDJA 4IMLB 4YSOA 1NZRA 3ZRSA 1NGQL 1P0SE 1MFUA 4Y4FB 2A74B 4QY8A 1R4XA 5E7FA 4Q56A 2H2PC 1VAHA 4OUUB 4L4TE 3NIDB 1OAUH 1W6WA 2ERJB 1RZPA 3EDDA 2E27H 3TBSA 4LCWE 3FN3A 1GGIH 3MRJB 4LRIA 1WWAX 4P9HH 3V9FA 4WI3A 2AVFA 2EIMB 5CAYB 1LNUB 4ETQA 4F33B 1IV8A 4E9QA 1X44A 4TNEA 1K4CB 1UCBH 2H5UA 4UOW1 3EDEA 2CK2A 4OFIA 5T3ZE 2FBJL 5E2VL 3VW3L 4LK4A 2IAND 1NGQH 1C8PA 4Y1AA 4XOBA 3L4CA 3VXSA 3MR9B 1SQ2N 2OJZL 5J6GA 3R19A 3A6OA 3NH7L 3QIBC 4NRXB 3T08A 2VSCA 2AXWA 4JZOA 4U2YA 5BUAA 2ZKWA 1JYNA 1ZVSA 2R0LL 3OKNA 3FUEA 2XRAL 3ARYA 3PP3K 3GHPA 3RPKA 2MNJB 3TBYB 1WQVT 4AQOA 4ODSL 3VGBA 5I1JL 2FBJH 5E2VH 3UBXB 2K6WA 3VW3H 5FAAA 1MFVA 1RMFL 4NHUA 2XV3A 1LEKA 5M95B 2J8UF 2OJZH 3G5XB 1E9PB 4JQIL 3NH7H 2MMXA 2XY1A 3QORC 1ZDSA 3GF8A 3SKUD 1GS8A 2E6JA 4NQEE 1JZ3A 2IBZY 2JK5A 4JDZA 1GOFA 1RCYA 5BQ7A 4Z3TA 2DQ6A 1OZUA 2R0LH 5BRZD 5IVXB 4G1MA 4ZD3L 2XRAH 3QUXD 1WC7B 5IB1A 3PWPA 3ULUC 3ZTCC 4ODSH 5I1JH 1OAJA 1HSBA 5L2JB 1JDDA 1A6TB 1RMFH 3CZEA 5DJYA 4JZJB 4HUWA 4XWOC 5BS0E 2C4XA 2QJDA 4JQIH 5ETUA 2IG2L 3PREA 4WI6A 5C92A 5F1OB 3AZUA 4GI8A 1N2RB 5D1ZA 5F70A 4MD0B 4PGBA 5FA3B 1W9XA 4I1NB 4JCMA 3SHSA 5IB2B 4ZD3H 2NDFA 4MLSA 1U58A 2EDQA 5CZXD 1I1YB 2F61A 4OLXL 3BXNA 5DHYA 5FV2A 4RMBA 1MCFA 4JHBA 3RGVD 1NJ9B 1SVZA 3DUUA 1N8OE 2K4AA 5BV7L 4XP1L 1Y7VA 2WAQA 3NJMA 4KKQA 4FQLL 2IG2H 4JUSA 5HYJA 4FG0A 5E9NA 1IJNA 3JUYA 5INDB 1PIFA 1W72A 2LT9A 2PYFA 4RGND 3SDCC 3MNZB 4EIUA 5DK2B 3D12B 4QHMA 1JNLL 3MRBA 5TQ0L 3L3HA 1EMTL 1HCFX 2X0UA 5C0FB 4OLXH 2NCMA 3ZKMC 1EFQA 1IQDB 4Z3JA 4CVZB 2VDOB 3KLAB 2CPUA 2BSSA 3CFNA 5AVWB 5BV7H 5CEYA 3UTSB 4XP1H 1AFVL 3VFWA 3OKKB 2X2UA 5SWZB 4FQLH 1JN6A 3KGTA 1DJWA 4M03A 1SRDA 4HCRA 4J3UA 1R3HB 5LQBL 1CDHA 3FQ2A 4ORGB 3K6DA 2D03L 2SEBB 4M4RB 1FG2B 4HKBA 1SLVA 1JNLH 1G1OA 5TQ0H 1EMTH 1FFPA 3IEAA 4LHUG 3WKPA 3R4DA 1CXLA 1HL4A 4YBLC 2FJSA 1CFVL 1DVFA 3HNSL 3DGGB 3U9PL 1A6WL 1AFVH 3MFGB 3HC0A 3VU1A 2R29L 4M5SA 4HW6A 1PL3A 2GC7C 4Q6YA 3BQVA 43CAA 5HDBE 1WP6A 5DLLA 2NCEA 5CD3B 4HIIB 5TE7L 1VF5C 2F19L 4YH6A 2JELL 1URZA 3T2QA 5LQBH 4PWIA 1IJ9A 2D03H 2Y5TB 1MJ8L 3R0NA 1TNNA 5KVEL 2YBRB 4PY7B 1EEZB 4QNPE 1YPZA 1CFVH 1IAKA 3HNSH 5AB2A 3IYLW 5KSVB 3FTXA 4U1JA 3U9PH 1A6WH 5AUMB 3RVUC 3O3DB 3Q1EA 3W39A 2R29H 2X70B 2FEEI 2ZWYA 1FWXA 4LAJH 3ZYOA 1D6EB 2HJKA 2R0WL 4J6IA 1UWXK 5CF3A 1F4YL 2OTWA 3ENEA 2F19H 5TE7H 2JELH 2CKBA 4CADA 2QGCA 5JW4M 2JB6B 1MJ8H 5KVEH 2BZCA 2N7BA 2PR4L 1NCGA 1AC6A 2HJFB 5EOTB 4AKQA 5HY9B 1IBBA 2A73A 2Z91A 3NRFA 3RWJB 1T2QL 1P69B 3DSFL 3MLXL 2EDNA 1UKTA 5J5EA 2X2HA 5IJKA 4QPEA 1Z9NA 4YDKL 2R0WH 3NSFA 1H3PL 3UROR 3O4OC 1F4YH 5DYFA 4DUWA 1HHGB 3SKOB 4FXKC 3WKYA 2VDPB 3EO1A 4BJLA 2ZT9C 2MCMA 4R7NA 5I8EA 2PR4H 4FG4A 1FZOB 9PCYA 1JDAA 5B38B 2AK4A 3IFPA 4YBLB 1BZOA 1T2QH 3DSFH 3QNYB 3MLXH 4X8GA 2FLRT 4GLRI 4Y9EA 1DLHA 5IQMA 1JIBA 2W81C 3APCA 1G94A 3NEOA 1A6ZB 4YDKH 2GSMB 3LQMA 1G7MB 1H3PH 4JFYB 2ETWA 2LVEA 4OVUA 2JFCA 3BYYA 5H35A 4DERA 3L1GA 1XGQA 1QO3A 1N6QL 2VM9A 5IEHB 1HE8A 3DROB 3EIFA 4PBWD 5C3LD 1GOGA 3MV9A 5A3IC 3CH1B 3PWLB 5EU7E 4GT0A 3S48A 2J43A 3AGVA 5FIEA 5I6KA 4I1PA 1BQHA 2GTZB 3FT4A 4PJ5B 1MF2L 5ICXA 3STZA 3RAJL 2IV9A 4H20L 3HS0A 1BCIA 5TGBB 4KUCF 1RPUA 2MRYA 3EOAA 3ETTA 2PXYB 4EF3A 5MERB 1N6QH 2XWRA 1MDAA 4O5LL 2YWZA 2YAFA 3L3OA 5IW6B 4IRJA 3T1FB 3FF8A 3MV7D 4HKXB 1LO4L 2V6HA 5FHBL 1L0YA 2RB8A 2G5UA 5LVEA 2FE0A 3GXFA 1ET7A 1FA4A 4YSAA 2XFGB 4LLVA 2BX5A 2LGNA 2X3BA 5GGRA 1II4E 2WOYA 4QRUA 4JANB 1MF2H 1BVKB 3RAJH 2F54B 1MCWW 4H20H 4PTTA 5T5NG 2HFEB 3DHJA 1VGKA 4YHLL 1AQ8A 2HJLA 2VLJA 1W0YT 4OGAC 4O5LH 3LEXB 2VLMD 3U9UB 4DP6X 3M07A 2E9GA 2X09A 2NPLX 1LO4H 5FHBH 4POZC 3VI4A 5CO1A 4C55A 1E8XA 4Y9CA 2I9LB 3K6OA 2Y7LA 4OLVL 1KTDB 2QL1A 1CD1B 2J8OA 3VRLE 1RK1A 1NC4D 4YSTA 3BZ5A 3MMEA 4NRZA 5FR3A 4YHLH 4JFFE 3K4ZA 2A7BA 4JPIA 3QA3A 4XN5A 1C9SA 2ZX9A 3L5HA 1JUFA 1I1FA 3US0A 5KS9E 4HG4J 2IXQB 2A6KA 4TMPA 1DUYB 1HCZA 4HIEA 2VLLA 3WLBB 1PAZA 5HI5D 1MHCA 2MTPA 1X3DA 3RY6C 3BPLC 1DE4A 2LHAA 5INCB 1I53A 3U82B 4OLVH 3G5VB 3CBKB 2YEZA 3U46B 3EYSL 1NBVL 2YWYA 2WXKA 1MLBB 2YC1A 3GSWA 3JVFC 1U92B 4WTZA 4PJBF 2X1XR 1KIQB 3UAEA 4U0QB 5DC0A 1TQBB 4ZXBD 5DK0B 1QD0A 1XGPA 1LVEA 5F3FA 1OALA 3A3YB 4ICWA 4R7DA 2EIKB 1NFDB 3GI8L 4QOKD 5DD0L 3L3KA 1HX0A 3K1DA 4PJIA 3WUWA 4U1HA 4I0CC 3EYSH 2X4RA 1NBVH 1JS4A 3D06A 4R2GD 2LV4A 1X4XA 1DQQA 4FTVA 2CALA 3WJMA 3MU3A 1J8HB 2VAAB 3WIFB 2GBVA 2BY3A 3GTTA 2WLZA 1I85C 4B7LA 4G8GB 2NZ1A 5I0XA 2GVYA 4B0MM 3DVGB 1KY7A 5D1QD 4PB9L 5D8JL 3K8LA 4FXLA 3QZNA 4Y5YC 5E0FA 4L2LA 1A9VA 5DD0H 3GI8H 3LN5A 3F6IA 3D85A 5EIVA 4LIQL 5I74C 5AALA 1VFAB 3KPSE 3OLGA 1N12A 2OMXB 1IUZA 2IC2A 3D48R 4L29A 4CL7A 3BWUF 5FK9A 1MCPL 3QQDA 5H8DA 2XG5A 1JMXA 1CMOA 3C8HA 3QUYC 3S36L 4F8QA 4HHGA 4JFDE 3CFKB 1JF6A 4PB9H 5G2NA 1COBA 1TZAA 4WWKD 5D8JH 2GBTA 3RX8A 1TQCB 2AV7B 4PJXA 5I19L 3CLWA 5A43C 2BSCA 2ZUWA 3QJZA 4LIQH 1WHPA 3L5XL 5DVPA 1P4BL 4ETYA 2GHZA 3CPLA 3KPOA 3P73B 4LBAA 3X11A 4EIBA 3RIFF 1FL6A 1MXDA 1J9TA 1S9YA 2J6WA 4D7BA 3B2UD 2H6PA 2CDEB 4X4MA 3RVXC 1MCPH 3C8DA 3LPPA 4HUNB 3S36H 1TJGL 2D9CA 3QUGA 3CXDL 1YPZF 4Z0XA 5I19H 2ICEB 4KQ3L 4ZX6A 4U1IB 1EJ6A 4YQXL 1KFGA 2QTVA 3L3DB 4N2DA 3WIHL 5IQOA 2X4OA 3Q2CA 4BKSC 5KYWA 3L5XH 3MV8D 4P23D 1P4BH 1HI6A 1R33A 1D7CA 1SDAB 2AZAA 3B6SB 4PJ7E 5DURB 5AVYB 5EN2B 4GXUM 4UILL 3ZIMA 3RVVD 1P1ZA 1B9KA 4U1GC 1TJGH 4Y16D 4KXZH 3CXDH 2GB2A 2MCG1 3CHRA 2WCGA 2YJQA 4KQ3H 4Y5YB 1KXVA 5DR5L 3QEHA 4YQXH 2M8XA 3WIHH 4PJ9C 4UTBL 3R1GL 4EUPG 2DPKA 1N59A 1UASA 4MS6A 4RIRA 4CN6A 1RVFL 3FQ4A 2GK0B 2NXZC 4FFTA 3SCMD 3VSVA 3BAIA 2ZX8A 3QFJB 5GXBB 2AKRB 3PGCB 4UILH 2WZ5A 3OHMB 1NIEA 1OSPL 3RDTC 1FO0L 3DO7A 4CVUA 5I6NA 3D0LB 1ORQA 4BD4A 3LSOA 2XBZA 4BXVA 3H9SD 5DR5H 5FO9A 5F9JB 4UTBH 3K91A 3R1GH 1FRGL 3MREA 3C5JB 1Z9SA 1J05A 1RVFH 4BFJA 4C83A 5I66B 3MRMA 4N2BA 5IROA 3ZZ1A 4HPYL 5PAZA 3L1FA 3M8OL 2R27A 3T0VA 3LXAA 1SXNA 5DO2D 3ULAB 1K4DB 2ZKHH 2W65A 4N20A 2WNWA 4NP9A 1OSPH 5D5MF 4OFKA 1FO0H 2NUPB 3JSSA 1WBXA 2E6PA 2VRAA 3F8UB 4KH2A 1KV7A 4F15C 1GMIA 1UM4L 1FRGH 1MPAL 5HGGS 4CN4A 3FUMA 5DD6A 1HJBC 3BN9C 1IM9A 3BH9B 3ZHKA 1OQOA 1HEZB 3PFUA 3HN5A 2XWCA 3OGCB 2EE6A 1I7ZA 3MODL 4JFHE 5C3TA 4HPYH 4MJ6A 3M8OH 2LU5A 2E7HA 2WAHA 4F2ME 4WNSA 2OQJA 5C0CA 4I5BA 1RJYB 4PJEF 2VR3A 2XVLA 3EYVB 1RK0A 2KERA 2PO6B 2N56A 4HBQA 4MA3B 2PYEA 4Z9KB 4OCSL 4APQB 4E9TA 3BUBA 4RFEA 4U1GB 3QJOA 2GFBA 2P26A 1XD0A 1SOSA 2JV6A 4XBGA 1UJ3A 4KJYA 5DJ8B 1UM4H 4B6ZA 4K5PA 1MPAH 4RFNC 4L23A 3GSRB 3E6FA 2AXFA 4NO5A 3LKSA 3TH2T 1INEL 3RWGB 3MODH 3F01A 5J6HA 2D0GA 2FAUA 5KSAD 5HJ3B 4OCWL 3QC6X 3VXQA 4L0YA 2DBJA 4KK9D 4ZO7A 2VR5A 4OCSH 1S7SA 5ID1B 4J3VA 5F6IC 1QRNB 2FYYB 4OF5A 3LRKA 3I85A 5B7FA 5D4IA 3L95A 4JY6B 2YXWA 2DL2A 2WBJA 4BBWA 3RNKA 1ZEAL 1NQBA 5L9DL 1INEH 4XXWC 1OTSD 2G75B 3RYMA 1F02I 1WGVA 2RBLA 3H54A 4OCWH 3ASWA 1JWMA 2B9BA 1XFPA 1JPGA 3TZVB 3TS8A 5EZOL 1PX4A 3GMLA 3GPSA 3GS4A 1JRHI 2JJSA 4PRDA 3QFGA 1CGSL 4AL8C 3PGDB 5LDSA 2VZ3A 2BCMA 4XNZC 1ZEAH 1ZXKA 3F04A 4QHKJ 3KJ4C 3BISA 1UWFA 2V9QA 5JDSB 4ICXA 3TJHD 1ETJA 2Y72A 3HG1E 1QSFA 2XWTA 1PD0A 1F2XK 3C60C 1AO7E 1YEDB 2YKLL 2R1WA 3L45A 4L1DA 3SKNA 4HXAL 5EZOH 3QUZA 2VABB 3M86A 3D52A 1CGSH 1ZTMA 5KW9L 3S8FB 3ZKND 4RFNB 1MVYA 5EU6B 4PV1C 5DQJB 1I75A 3TA3D 1TF4A 1WSST 3IU4L 3X1NA 5T3XL 4TNWK 4OZHA 2A9DA 1YLBB 5EEYA 2YKLH 4G6FB 2J1WA 4HXAH 3ZE0B 1GJIA 5HYSA 1XDTT 5F6IB 4LLMB 2X6AA 5LB1A 2K7QA 5AW9B 1V10A 3SDXA 5KW9H 1GJWA 1T7VA 1QUNA 2BRRL 3LOWA 4JDEB 3OXSB 1QWHA 4U3HA 4AKPA 3EJPA 3O6FD 4KNUA 3VI3B 2F53A 2X4UB 1XR9B 4NO3B 1TJMA 3IU4H 1EAJA 5T3XH 1E7UA 2E7DA 1N9PA 2NX5E 3F7YB 3SPIA 4FYSA 4JAMA 3CFJB 2Y69B 2Q7YB 4FD0A 1HQRB 2EXWC 4ZPVB 1B90A 3FB7A 1TYEB 5EU5A 3CDYA 1AKJD 3G6JF 3LVTA 3BHBB 3QIWC 2BRRH 2CHWA 4XNZB 5C1MB 1CT8B 4JVWA 3KJ4B 3VWJA 1NH6A 1SM3L 2XX0A 4EN3B 4HF5L 4BGLA 2VIRA 3G5ZB 1NLBL 1NLDL 1H6TA 4KRPB 2PCPA 1D5ZB 2WQRA 4PRPB 5F7BA 3QHFL 1DN0B 2Z7YA 1TOXA 2IDSA 4KROC 4BWTA 6PCYA 3X13A 2JCWA 4Y7MA 4TVPD 2K9UA 1V3LA 1RFDL 1BXXA 1FVCA 3EG9A 3QNZB 4JFEB 2CM5A 1FNHA 2Q7NA 2WWKT 1SM3H 4RA0C 4G1EA 4HF5H 3C5SB 1NLBH 1NLDH 1P6WA 1RJCA 2FO4B 3QHFH 1KXTB 1WWCA 3RKPA 1U0QA 5HHMD 5KANG 4Y5VA 2DLEA 4KFZC 5AVUB 3IGFA 4OZ4A 4X7TB 1A4KB 4AGQA 1RFDH 4UT6L 2AEPL 2Z0UA 3CC5A 5A6MA 2EE3A 1MI5D 3TVMD 4HWZB 1HXMA 3FU6A 5J06A 3HG4A 1E9OA 2XZAL 4LVHC 2D7NA 3Q5OA 5E8DL 3TM6A 4CU7A 3QT2A 1IEBA 3ARVA 2A83B 1U8NB 2GYSA 3MACL 1MCOL 4GXVL 1J0IA 1IKNA 3RJQB 1DFXA 2FIRT 4UOW0 4NC2B 1NCDL 5DYOB 4MNQD 5JA8B 4UT6H 2JJTA 2AEPH 2BWDA 1U8OB 2X12A 3ZYIA 2JKWA 3QIWB 4DO4A 2R2CA 4YDJA 3AXIA 4I0PB 3TXAA 5LHDA 4YHIB 2XZAH 4MAYB 2NLJB 3WS3B 4C4KT 5E8DH 1JZGA 4PJCF 1KLGA 2YSTA 3EJSA 3GRGA 3GRWL 1CL7L 5ACZB 3C8KA 4LVNC 4PWJA 3MACH 3HE6C 3MBEA 1MCOH 4GXVH 2H3NB 2PR9A 1G9EA 3DJTA 3O8XA 3LKOB 3WY1A 1NCDH 3GNML 3NAAL 5JO5B 3ARDD 4EKXA 4URTB 3LTVA 5LDUA 5DJCA 4L8CB 4LCYA 1W91A 4N2FA 2V2XA 4P5SA 4MZ2A 5B21A 1NIDA 3V4VB 4PLJD 1M3IA 5A7EA 4KKLC 5C0DB 3V6OC 4LLQA 2JCCF 3MZTA 5DMGD 4JRXA 1B9ZA 4XWGL 2GABA 3GRWH 1CL7H 2A3TA 3LX9A 4PR5A 5CR8A 4MAUL 2CMRL 4I2XA 2WYHA 5AW2B 3BC9A 1UH4A 5F1IA 3GNMH 3NAAH 3KWWA 1FFNA 1IBYA 1ZLDA 1QA9A 1Y1DA 1GAFL 3B2PA 1LJMA 3QZWG 1TZOA 4R3SA 1QQDB 2ZOTA 3BPNC 1E8WA 1OGAB 1DLFL 1PY4A 5CEXA 4LVHB 4KUCD 4XWGH 4YS4A 4YUEL 3TL5A 4MAUH 2CMRH 3S97C 5JHDA 1S9VB 3Q6FB 1TDQA 5BW7C 5G5DB 1NGPL 4OZFG 4XBMA 2B1AL 1XTMA 4QT5B 4KO5A 2NY3C 2VQ4A 4FNQA 1QI4A 3B1TA 4GRLB 3S5LG 4AYID 1GAFH 4HKJA 4X4YB 4X6EA 3X17A 4NKDA 3FQ1A 4Y1AD 2B20A 1DLFH 2XPZA 1BW8A 5J0BA 1P4LA 1NCCL 4ZNEA 4RLDA 5C0AE 5E95B 1GZHA 4LLUB 3CSYB 4YUEH 2FDBP 3S3BB 3ARUA 3BX7C 3DETD 4UMSA 3U4AA 5KJ7E 2YOCA 2W9EL 4PLOB 2IH8A 5C08A 1NGPH 4ZUVB 2CG9X 2EYTB 2B1AH 3TBWB 1J1XL 2C26A 2CO3A 2EE9A 2X7LB 3WIHA 3IMTA 4FFWD 3UYPA 4ZUUA 5D2LA 2EKJA 4UDUA 3ECVA 5IHZB 2APVA 2QVMA 4HIHA 4PH8A 1NCCH 2VW7A 2VZOA 4UTCA 1MXGA 3B3BA 4WEEA 3RILA 4LLAA 3AU0A 3AXLA 3CDGB 2W91A 3FUHA 2NZIA 2G3NA 2QADB 1PZ5B 2W9EH 3BVUA 3GTVA 2J5WA 3MCYA 5KZCD 4ODUB 4B3EA 3WAJA 1ORSB 1J1XH 3WXVL 2FZ3A 4XXCC 2K45A 4MYWB 1H15A 3N06B 4GW1B 4NUGL 3VXMB 5F21B 5AW7B 4AT6A 4WWID 2QR0B 2ZWNA 2L7EA 3BIKA 2Z31C 3F6LA 2P8MA 2XY2A 4YDIL 2ADYA 4X5XB 3DX7A 1RZQA 2HKAA 2E0PA 2ALAA 2JF1A 1X5LA 3BZ4A 2WB1A 4NB7A 5D1ZD 5FLVA 4WI0B 2D4FA 1JNHB 4N2LA 4EMZA 1B0GA 1ZD6A 2B1HL 2NY0D 2ZUSA 3BKCL 4JKKA 4PRIE 4Y4KB 3FCGA 5EBMA 5KSBA 4Q9CA 1YMMB 5JOFA 4NDMB 3WXVH 1A3LL 3BRGC 2NY3B 3UIZA 3BRDA 1IAIL 3VVVA 2VUYA 3EHBB 1ASPA 4NUGH 4PJEE 4HS8L 2XLLA 3QDMB 5DGRA 4YDIH 1BJMA 2QKSA 2P48B 5HYJD 4HETA 1PBYA 3KGRA 1SOKA 1G7LA 2EIZB 4J39A 3D05A 2OS7A 3QDGE 5JW4Q 4K8RD 1X5FA 3C6LC 1KPRB 3BKCH 2B1HH 4QHKI 2ATPA 3PS6A 2VZSA 4BQ9A 3SGKA 5C0GB 4E42B 1A3LH 3AS2A 4BGDA 1IAIH 5D7EA 2FBRA 4BZ1L 3VACA 1G9MC 4HS8H 4JB9L 5LAXB 4OAWA 2AEIT 4DETA 4AQ8C 4V33A 1O6VA 1A3QA 1OTUD 3ATAA 1B4TA 5E70A 5LCVL 2IGTA 1OO2A 2UZIL 4LOVA 4M48L 1Q9WA 5FM5O 1L6ZA 1ZLVH 1L9PA 4DGYL 1M9WA 4IEFB 3VYNA 3S37L 5IR1A 2B4CL 3V6OE 3D18A 1DVFD 4RRPM 1IGJB 5CGTA 4BZ1H 1T66C 1GA2A 1ET5A 2W94A 2DM2A 1ZV2A 3QYCA 3Q43A 3LQAL 1XIWB 4JB9H 4OIAA 5E08L 5I6OA 4YBQC 2Z31B 2A9AA 3OLIA 5DVKA 4WO4B 3GWJA 4H25B 5JOEA 5LCVH 4WKZB 2NOYA 2UZIH 4M48H 1A3RL 1IC7L 1CDIA 4Z95L 5LG6A 4DGYH 2Q76A 1AZVA 4NX0A 5DMKA 3S37H 4HCFA 2O61A 2B4CH 1M6UA 3QEUB 4F91B 4P5MB 5BOJA 4N2IA 4EI0A 3HLAB 1HXKA 4IK6A 4AVKA 3LQAH 5DEGA 5E08H 1F13A 3QHZL 2ADIB 2GTWB 3T6QC 3QUXC 5DWPA 2HG0A 4GSXA 2HFFA 3GBDA 5EULV 3QZBA 1A3RH 2Z92B 5K9OA 2CRMA 1IC7H 2L7UA 3CHQA 1DQIA 4Z95H 5EEZA 1SVBA 2FNBA 4YR6A 1A1MA 2YGNA 3KPLB 4GQ9L 1NPJA 1U8IB 2JJUA 3FFCE 3PIQB 4FXGA 1HHIA 2AGJL 3EF7A 4WNQB 1QP1A 3DUHA 3QHZH 4LCCA 2IO5A 5HVFB 4S2SA 1FFTB 5D7LB 4V2BA 3JZYA 5LN8A 2FSEA 5CZXC 1E6JL 4F9LA 4FJYA 2V5MA 1O9VA 1CG9B 4L3EA 5FO8B 4TSAL 4OI7A 4GKZA 1TSRA 2IANB 4GQ9H 5DD1L 2J25A 2UYLB 2MPAL 4ZQKA 2X9YA 2AK4D 3OXRA 4AW4A 1SMOA 4HZLA 3RPIB 2AGJH 2PTTB 3L4UA 3PHQB 3A47A 4YHZL 3MNWB 4D9RE 1PDKB 2YD9A 4RGNC 4C58B 5CMAB 4P3CL 4S0HA 3KW7A 1E6JH 3PGFL 2ZSVB 2ZWZA 4TSAH 3WS6C 3LD8B 1BOGB 3G6JE 4LLYB 4X6DF 1DJGA 3GBML 4HK3J 2AITA 5DD1H 2FECL 3GT6A 4LE8A 2MPAH 5FECB 3FS9A 3MRPB 3MV9D 3CIAA 2G0KA 4NIKB 2BC4A 5IOKA 3NJGA 4YHML 2X6UA 1NAKL 5EBWA 1BA9A 4UYQA 4ZMLA 3F84A 4YHZH 1IVTA 4BCZA 1EXUA 3I50L 1XBRA 3NQIA 3HRZC 5BRZB 4P3CH 4ZPTB 3BP6B 3PGFH 1JG9A 4M7JL 1AQMA 3KVPA 4FYTA 4NRYB 3MFFB 5CLZA 4AGLA 3VXRE 4ZOBA 5JZ7D 5C0BE 3BEWB 2D7TL 3GBMH 3DOIA 3K3QA 4QTFA 5AL8A 1JE6A 4IBQA 2ZD0A 5I26A 3DTDA 3WIAA 4IJTA 4IRJD 1CDYA 5CWSB 2M1KA 1J11A 3JV6A 3KPPA 4YHMH 5EWIL 1NAKH 4NJAL 3REVA 1MFAL 2EE0A 1IKOP 2ESVB 3I50H 1S4IA 1NSNL 4ZUWB 4C4BA 3BP4A 2IWEA 4YDLC 4M7JH 3ZOAA 5I1DA 1IMHC 4RISL 2F8OA 4A37A 1YA5A 1TLKA 4R90L 3RGVB 3ECQA 3L17A 2VLJD 3IRCA 4AJYV 2D7TH 5KYXA 3ZYZA 1GIGL 5CJBA 1CTMA 3MGTA 3RG1C 1RHHA 3HAEG 2XVGA 5MP6L 4AYFA 1ZIBA 4RCAA 2GG1A 5EWIH 4NJAH 2EUXA 3TIDA 5IHWA 2GAZA 5HGAB 3NCWA 1MFAH 2VDOL 2YPKA 4Y7OC 5BZWA 1YN6B 1S7UB 4ELMB 1NSNH 3AQDA 5D2LF 1KJMA 4EDXA 5DRWB 3BPOC 4ZX5A 1XSJA 5FW8A 1KACB 4GSDL 1IZKA 1ZS8B 5IT2L 4Z7VB 3FQTB 5HP5A 2FIKB 4RISH 1P7BA 3OB8A 4R90H 3RX5A 1HCVA 2W07B 4QTHA 4NZDA 5AL0A 4U6VL 2CAKA 1GIGH 2YGOA 2CBMA 1GZQA 4UT6A 5MP6H 1ROWA 5TPWL 1PU0A 3MRFA 2KDGA 4CC4A 2VDOH 5GS2H 5HXMA 3U0PA 4OI8A 1SYSA 1Y6KR 4H5SB 1T7ZA 1EJOL 2X6MA 2XPYA 3HRZB 1ID5I 4JFOB 4X6FB 5DZAA 4GSDH 5F7AA 5IT2H 3UPRA 4K9JA 1UXSB 5D2NA 2VNCA 1UZ6F 2JNZA 4L1TA 1HHKB 2WCSA 4U6VH 3A0OA 1RUML 3NN8A 2XWJA 1L6PA 1TFHA 2OTUB 4R97B 4Z3EA 5DUML 2N01B 2GIXA 2ZCHL 3FRPB 5TPWH 3ZDXF 3EJRA 2I07A 5E7BA 5HYEA 2XNAB 2A99A 1ETZA 3DECA 3MOQA 4WCYL 3WNIA 3DO3A 1L5GB 1U30A 2ISDA 1EJOH 1FZMA 4NC1E 3MBWB 2V33A 1FV1A 3S4SB 1RSYA 3BGMA 3FZUD 4LB8A 4Z7NF 4FTVD 5DVLA 3Q05A 3ZL4L 3VAEA 4AQAA 1BG9A 4TYUA 1RERA 3VFVB 4QXGL 1RUMH 4M6ML 3SDAC 4QRRA 3DX8B 3LMJL 4NQTA 5DUMH 1KT2A 2ZCHH 5F7EL 4BQCA 4FKHA 4WCYH 3NT0A 4Q9BA 4PFEA 1UKQA 4FFVD 3V0AC 4AJ0A 1B0IA 3D85D 1CC3A 3C12A 2FECI 3O45B 1JYVA 2G3XA 3BPOB 2Z35A 4JDVB 3X1EA 3QIUA 3VYPA 3ZL4H 1NC2A 3F7VB 2CHZA 2C9QA 1HKFA 4BFGA 4QXGH 3PDGA 4M6MH 4GUPB 3LMJH 2X2IA 3V79C 2P24A 1TKWA 5F7EH 3P9MB 3D7PA 4X8JB 1M7IB 4WI2A 4HSQA 3IJHA 3NGBC 1QMUA 3CH8A 3MBXL 5T1DL 1L9OA 2QDVA 3K7UA 4BA0A 3DX6B 3KXFE 3DDFA 3LNFA 2E9BA 2IH1A 2ADJA 4NQEB 1UOKA 2ZYSA 32C2B 4KV5E 2ZAHA 5GZNA 4AUUA 5CS7A 3F58L 5F7YC 3VFTA 1PEZA 3F00A 2FJGA 1MCBA 3P9LA 1FNEB 3GEWB 4JPVL 1R47A 3MBXH 5T1DH 1JVOA 1KYOK 2NNFA 3CX5J 1ZVYA 3OR7B 2VMJA 3ZL1A 3SPCA 2K1MA 5I1CL 2VW6A 3P3RA 1SDYA 1PG7W 4HK0A 1WT5C 4QRSA 3F58H 4AM0B 5FWRA 2NT0A 5DFTA 2J1YA 5EEUA 4NS0A 4E41E 2PKDA 2FSDA 1PJWA 1UC6A 1WD9A 3CCHB 1JAEA 4D0DB 1D7DA 4PYGA 2IFFL 2EH8L 4JPVH 4O02B 1E28B 5ID0A 3COOA 5DC2A 1S7QB 3IJSA 3IS0X 3JYBA 3MNVB 2A6IB 3QJRB 4FJZA 5IWLC 1KTBA 2WKOF 4F5CE 3B8SA 1KCWA 4BRVA 3OHXC 5AFAA 4PJDA 2BIPA 4YGVB 3S3CB 2CUMA 1EFXB 1SOQA 5GRZA 5I1CH 5E2TL 2BNUB 4ZXBC 4XB7A 3DIDA 2HT4D 3CFIC 3TNMB 4NO2A 4YHYB 2OKMA 1CFQA 4TPRL 2ZX6A 3SE4C 2DF3A 4WK4B 2ITFA 4OFDA 3BKML 1W0VA 1Z6JT 1W0WA 4ZX4A 4IOSA 2IFFH 2EH8H 4R2GC 3NGBB 3JTSA 2LLNA 1C08B 1S7WB 3KYMA 4Z78A 5I0WA 4PU2A 3VGGA 3ASNB 3J2PA 1TZIA 1I9EA 4U1NA 5E2TH 5IROD 3GIVB 2E3VA 5D1QC 3ZE2E 1QFUL 2V5TA 1R34A 4G42A 1KB5B 1L9RA 4LCUA 25C8L 3TH3T 5IMLB 3DRQB 1P2CA 4TPRH 4KKZA 5JNYA 1U3HA 1T3FA 1J0JA 3BKMH 4U1LB 2X44D 1VDGA 4F1SA 1MUJA 1HXYB 3U30B 2IFGA 5DS2A 2YRBA 2VDQB 2AERT 1NC4B 5GRVL 2YFNA 1OAXL 1OKEA 4DPRA 1IM9D 1YEGL 5CN1A 1GC1C 4U6HA 1VIWA 1X9QA 3MGOB 2C3WA 4M61B 2B14A 1QFUH 2XOTA 4HJGA 3I9IA 5C0CD 25C8H 3CSPA 3IKCA 3SGEH 3EGSA 1A7PL 4G5AA 2PYED 2XETA 4GPVA 5LBGA 3U2SA 5EZIL 1QR1A 4XXDB 3BCDA 3TJPA 5HGHB 3GINA 2QEJA 3B2UC 3X3GL 1OAXH 1HHJA 1I7UA 4GKNB 5FUCE 3OHXB 2AQQA 1YEGH 4LSPL 4QLRA 5LCVA 2WQ8A 1PKQB 3H9HB 3KS0H 4P9ML 5C0EB 2HFTA 1J9CT 3RX7A 1CIUA 3LPOA 4P57B 4Y0GA 5AG8A 4QOKB 4S11A 1A7PH 4XB3A 3PDOA 2CBPA 4F7PB 1BZ9B 2ZOOA 5EZIH 1X7QA 3OF6A 5CP7B 1EEUA 3KGSA 2F8XC 4R2GB 1AGBB 1YY8B 3K0WA 5E8EA 3QPQD 4UMGA 4KZ0A 2GT9B 2WBJD 3X3GH 1Q0XL 3T8VA 1ZT4A 2D4DA 4LSPH 3IGAB 2OMWA 4Y4HA 4Y16C 1AGEB 4P9MH 4BKLB 3HPJA 5D1QB 1KBPA 4N8VB 3K72B 2HLEB 5B7MA 1UUNA 2VDRB 3LRSB 2CWRA 2VISA 4IW4C 5C09A 2BVOA 4OT1L 2RD0A 2F7IA 3GMOB 4IMLA 3SCMC 4IRZL 4ZG1A 1M1XB 1CXKA 4KHTL 3MXWL 3ZJAA 1Q0XH 3V0DA 2DWEA 3L7EB 3OWEA 4MCNA 3WSQL 4OJCA 3F7KA 3X1FA 5C07E 2G9HB 2DQFB 4IKKA 5DDHA 5IESL 2YEVB 3RWEA 4WWKB 3FOMA 2HG5A 2VQ1B 3ABKB 1QSFD 3QK0A 5HVHC 4F33A 1AG6A 4Z0BL 2KPNA 5EIIB 2W0PA 1PTZA 1R24A 1K4CA 3QUZD 3UX9B 5ISZA 4MB5A 4PVMA 5E9DE 5I6LA 1N64L 2OMVB 4OT1H 4IRZH 4Z7QE 3LHAA 4KHTH 3MXWH 4X6DE 3NVQA 2P3YA 5CN3A 3ZZQA 4IM8A 2WWOA 3L13A 4IIZA 3NJJA 5CINL 3WSQH 4YC2B 3FCTB 3NCJL 2VQUA 5IESH 2GI0A 2PP9A 2ZNWA 3GJFB 1F0LA 4ONGL 2DM4A 4Z0BH 3B2XA 1ZY9A 2YARA 3DGCR 2YN5A 3MV8B 4P23B 1D5BB 3HA0A 4NQDA 1N64H 1S7RB 4GO8A 5E6IA 3IDYB 3QZPA 3UBXA 4AYGA 1FE8L 5GS1C 4OZIA 1XF3B 3UL4A 3ZDZF 4CKQA 2Z7WA 3BGFB 2O4EA 4XVJL 1VB9A 5CINH 3BWAB 4N3UA 4A68A 4UOZA 5EF0A 3OMZA 1NOAA 3NCJH 4Y16B 4YSDA 5AKTA 1GH7A 2F53D 1ZLUK 3FQNB 1JZ4A 4XNMA 2IBZX 3CLEL 2J1XA 4FYRA 3IJ8A 4ONGH 4PWKA 3BRFA 1KJVB 4LASL 4JQVA 4YPGB 5HI4D 4FL4B 5IQNA 5L2JA 3P77B 2C1OA 2M83A 1FE8H 4JZJA 1H3GA 2WY3B 3S36X 4XVJH 1NM4A 4GAJL 3CHSA 3EFFB 3HRPA 3VWJD 3IDIB 4MJIA 4AV5A 2XG4B 4NN6B 3KAAA 1IQWL 4Y1SA 3PHAA 4MD0A 3VE0B 1JWSA 2E75C 3VGAC 4RRPA 3H9SB 3DWTA 2XTJD 3VB9A 5HVHB 2WO2B 5I1GL 2PCFB 4LASH 2BSRB 2KS0A 4PTUB 2WGNB 3ARTA 4XNQB 3JV0A 4OKVA 3OLDA 1S5HA 3L9RB 5CKGA 1KCUL 2G5BB 2IOMA 3HG0A 2IVFC 5HJDA 2HPTA 3VCLB 4ADIA 4GY4A 4W9DC 4ANXA 4M93B 3O9WB 4XX5A 4GAJH 3MNDA 3CZNA 1W2KT 4OJFL 5CJ8A 4U7SA 3G04A 1KXQE 1ZOXA 1UEYA 3QUKB 1IQWH 3IJYA 5J57B 4M5YL 5KYNA 1OOWA 3QNXA 5E0QA 1OHQA 4HPHA 4N3TA 2F9BT 1AD0B 3MNZA 4GP8B 2DEYX 5I1GH 4ZSOA 1DSYA 3HPLB 5C0FA 1IM3A 5D6CB 1IQDA 4CVZA 2X9WA 1KCUH 4AEHL 4LZKA 3TJHC 4HQQL 3E7JA 4L5FE 1NEPA 3OV6A 1AIFB 2OYPA 4B95C 3V5KB 4OJFH 3P02A 4XTRC 1EEYB 5EFIB 4JVPA 4PJDF 1KCSL 3ZDXE 3IVKB 1FYTE 1R3HA 4M5YH 4WI7A 3L7FA 3BO8B 1FG2A 2XXMB 3AFLA 3PAVA 1L3NA 4NM8L 4Q7DA 3ZKNC 2DLFL 4GKSB 4J3OH 4K7PY 3AACA 4BZ2L 4AEHH 1S9KC 4EI5A 4PG2A 1CTNA 1EZVY 1A9BB 3N2JA 2JTDA 4KVPA 4HQQH 1QRKA 5KSAB 1HDMB 3G5WA 3KPQA 1MIML 5E23A 1YDPB 3BUYB 4PG9A 4KGLA 5GSRA 3UBFA 1MJUL 3NA9L 5CD3A 1KCSH 4HIIA 2ZKMX 3QB7C 3UADA 1DVTA 3OTTA 4PRAB 3VGAB 2YBRA 3MBED 2BOBB 4NM8H 5JPMC 4AWJC 2DLFH 4TLSA 1EEZA 5BZXA 4G83A 3O8XD 4JE0A 4BZ2H 4QHUB 5IMOA 4J8RA 5EZJB 5C0JA 1S7TB 4W70A 4POUB 2NXYD 3O6FC 4JFZL 1WUZA 4XNAA 4ZX3A 1MIMH 2X70A 4WHDA 3NSCA 3NIGF 4HDIB 5IJBC 3MTRA 4NUJB 5FA4A 3NA9H 4E9XA 1L0QA 3UO8B 3VB8A 5EUOF 4JRXD 4OZGE 4A7QA 3FU0A 2JB6A 4XMZA 4BE6A 4PLNC 4ZFZA 4FS0A 2VSKB 4BSJA 2J8UB 4IDJL 3VQ1C 5EOTA 2UV3A 5HY9A 2IBGA 5ALBL 1UA6L 4PCTA 3JV4B 2Q8AL 1U8QB 4YZFF 4JFZH 2NY1C 3WENA 3LXBA 1PYWB 4YX2L 3ETBJ 4KI1A 4XOAA 3X1GA 5T1MA 5E4AA 2BNRE 1OCZB 3OKYA 3ZDYF 4AQEB 1UM6L 1AD9A 1IC0A 1BVLB 1HHGA 2CO4A 2W38A 4IHBA 1K5NB 5HHPB 3SKOA 3WEBA 3GXPA 3ZKXC 5FDWA 1MW3A 4LKXA 2QPSA 4NFDA 6FABL 3PV6B 2BCKB 4UU9B 4X7EC 3ZTDC 1I7RB 4IDJH 3BP5B 3CSTA 5F1SA 5ICYB 5ALBH 1OAZH 1UA6H 3TOPA 2KHAA 1JK9A 4HIQA 4RMSA 5H4YA 2Q8AH 3TA3B 4EO5A 5JHAA 4YX2H 5EZLB 1FFOB 1UD4A 3NJFA 1A6ZA 2WUCL 5F1NB 1F3RB 3BGAA 1LL1A 1UM6H 1G7MA 3K2UL 4WW1A 5AOIA 3T0EA 3QPKA 4JFYA 4A6YB 1AGCB 4OV5B 4PJ8D 1Z66A 4E0RB 5A2CA 1FUNA 1BG1A 1X6LA 3V9EA 3KMDA 6FABH 2ZF8A 4HGWB 1V3MA 3BH4A 5ABZA 5GZOA 1LGVA 2HVJA 1NBCA 1LXMA 1JYWA 5C08D 5AQ0A 1HHHB 1A1OA 2E46A 5DRNA 3TVMC 5EF2A 1F18A 1ZHBB 4M3HA 1LP9E 4YHKL 5KAQG 3MJWA 2IALB 3O6FB 2OYKA 3CSGA 4XCNB 5J9PA 3GJEB 2FGWL 2WUCH 4L9LA 4LBEB 3O2WL 4Y89A 2GTZA 3SOTA 4AL8L 3K2UH 1JMZA 1S8DB 4JG0L 4PJ5A 4Z7WF 3JYCA 4UTAL 2MOQA 5TGBA 3C87A 2AJSL 1I1AC 4EE2A 4EEEA 2K8MA 3ISYA 5EO1A 4K3JL 2BHFA 2JQMA 3L3JA 2BNQA 4OQTL 4HWNA 4HKXA 1NGZB 4YHKH 2XZZA 3CN3A 1AANA 1CDCA 3W37A 2WWKO 4J23A 1QLEL 2FGWH 3AY4A 4MMZC 3O2WH 4AL8H 1IBFA 1KYUA 4JG0H 2B3IA 3DXAE 3HTLX 3ZVVA 2F54A 2OL3B 4UTAH 2HFEA 3FN9A 4P2AA 1X5JA 2AJSH 1RJLB 3ABZA 5FDYA 5CZVL 3T1WA 3ZKXB 2AQPA 2X4PB 4H0GA 5DMJB 3DX4A 3TO4A 4K3JH 3TCLA 4PLJC 3S3DB 3P3YA 3ULVL 4OQTH 2ENSA 3WG7B 3ELQA 3CZUB 5DMGC 4FQ2L 4PSRA 2R2EB 1SLXA 1G7JB 2O1AA 2UWEA 4YFEA 1TNMA 1QLEH 1JWUB 4OZIF 1CD1A 5HHMB 1S9XB 1CXHA 2FT8A 2VOTA 1LDSA 1Q8MA 4KTDL 1LK2B 5DSCB 5CZVH 2GIYA 4RAVA 4WJKB 4L8SB 3DLQR 1KFAL 4HS3A 1KIRB 4UM8B 2IXQA 3D39E 3F7RA 2YAMA 3MV11 5AAPA 3WJJA 3ULVH 4KZEL 1KIPA 3TVMB 3KYNB 3GSXB 4U3CA 4N5UA 4ZFOB 4FQ2H 5I5RA 1BD2E 3QBTB 1ZDQA 4NN5B 3SYOA 4LOEA 4NQQA 4PSPA 5INCA 1E5ZA 3G5VA 3QQ4A 4Q4EA 4MFHA 3KYAA 4LRIC 3BW9A 4KJWD 2EINB 3UCRA 3BH8B 4N0UA 4EVNB 3Q8BA 4KTDH 1MLBA 5L4MA 3M46A 4JFQB 1KFAH 1U92A 4ONHB 3T0WA 3Q13A 4HIJA 3PQYE 3GHBL 3B2MA 3DIVA 4KZEH 3T09A 3MX0A 3ISWA 1IILE 3OR6B 1J0HA 4DP0X 1RZKL 4X98A 5AZEL 3I2CL 1Y1UA 3MRGB 1BFTA 3DETC 4L8BB 5JW5B 1DTUA 3V4VL 3GMNA 5C7XL 3FU8A 2FL5A 2E9JA 3HBPA 2BP8A 4JJ5A 4NXSA 3ARDB 1J8HA 1ZT1B 2EIDA 2VAAA 3N6YA 2YRZA 4OQ1A 4FFWC 5CHNB 3WTSA 3GSVA 3HG1B 3GHBH 4G8GA 3VMNA 1ZVHA 1TVHB 1JPTL 1RZKH 1JHLL 5AZEH 3I2CH 3FTSA 4B96A 2YOAA 1I8KA 4IIQA 4R4FL 3ZTEA 2KUTA 4RMWA 2VC2B 3V4VH 3IS1X 5EC1B 5C7XH 1YJDL 1J5DA 3X3FL 4MB4A 3VDCA 1G6RB 3CZSA 3ABLB 3F05A 5JHLL 1OAQL 5MEQB 4BFBD 5FM4A 5GHWL 4FQHA 4K5LA 4JLRA 2X3AA 1JPTH 4ZZFA 2YD0A 2P1YA 1JHLH 4QY8B 5DA0B 5DD5L 4HCGA 1O7DC 5DRZB 1L9SA 5C0IA 4R4FH 5D1ZC 3VFNA 3IWUA 3TBSB 3IPEA 1BF8A 1YJDH 2NY0C 3JWNE 3X3FH 2JJVA 1B6UA 3P73A 4ETQB 4IOIB 1H5BC 2E56A 1OAQH 3NJLA 4L3ED 4YL9A 3RUGA 5JHLH 2CDEA 4UZSA 3ZDZE 1ZE3H 5GHWH 2EDOA 2YUVA 2VN4A 5JOPD 4N86A 5J6GB 1JP5A 1BQKA 1Z3RA 5DD5H 2W88A 1EHKB 2VN5A 3JWNG 1LDPL 2ICEA 4CC0A 1H6EA 1OV8A 1GS7A 1SZNA 3BUQA 3SGDI 3NIFF 3TBVA 3L3DA 1F86A 4JZOB 1X7SA 3CG8A 4NBYB 2IGFL 2PPDA 4K8RC 4WV1B 1ZVSB 3OKNB 3HKFA 5E4EC 3CXHJ 1LEGA 1EXHA 1DANT 4X99B 3VFGL 3VYOA 2JSFA 4E9RA 1TLMA 2Q7AA 3QS2A 1LEKB 1U42A 3AUVA 3CPUA 3K6IA 1FG9C 2BVQB 3RIAF 1PY9A 4F1ZA 1D5MB 2ZTBA 4ESKA 1LDPH 1OTUC 3P0GB 1RHFA 3WN6A 4K5MA 2HYMA 3B5GA 2JK5B 5KBLA 2MIZA 4J12A 4JDZB 3QEGL 1VHPA 2IGFH 2R2HA 3O2VL 4PJGF 2GK0A 1FQ9C 2IOOA 2IWGA 4F80A 3GBNL 5IB1B 2P5EE 1ODUA 2CO6A 4OU3A 2AKRA 3VFGH 4K7PL 1KGCE 4Z3FA 4WENB 3GMRA 5F2FA 1RLBA 4HUWB 1GSKA 1XL6A 2B3RA 2VWEE 1T0MB 4PRBB 4MRCA 5ETUB 4W6YB 1IFGA 3LVEA 1TG8A 4Y2LA 1RD6A 2KBGA 5MENE 3QEGH 3C5JA 3UJTL 4KFMA 4PJBB 2DYPA 4PGBB 3ARGA 2DM3A 4AJVA 3WYRA 3O2VH 4OFVA 4FMFA 4C4UA 4GUOA 4I0KA 2NY0B 3A23A 1UCTA 4EPSA 1U58B 3GBNH 1OP9A 3MRNB 4MJ2A 5DHYB 4JHUA 1T1YB 4M6AA 4K7PH 2NSXA 4H0HB 3DUUB 5BVPL 2NUPA 4G8IA 4HEME 4A2LA 3AAZA 5C0ND 2Q2EB 2ENJA 1VFMA 2OYMA 4NEHB 2AW2A 5HYJB 3HS9A 2YAQA 4O2CA 3S34L 1A66A 3UJTH 3UZVA 3VD0A 5ILTL 3BH9A 1JI2A 2PYFB 1HEZA 1T2JA 3JT2A 4QHMB 4Y1AE 3MRBB 3VXSE 3L3HB 4G9FA 1A4AA 2H3KA 4MZIA 2VB5A 1RJYA 5A2LH 2BSSB 4ZYKB 5E6ZA 2PO6A 5CEYB 5BVPH 2Y2TA 4APQA 5IJKC 1EGJL 2F5AL 1JN6B 2AJZA 2MWCA 2Y1YA 5DJ8A 2XIIA 5I17B 4GRMA 1L9NA 1Y18A 2GJJA 2ITCB 4HZAA 1CJYA 3S34H 2P43B 5BZZA 1RZGA 2NQCA 1A8JH 5ILTH 5KVDE 4HKBB 3RWGA 3ZX1A 1ZGLM 2LW3A 3MLWL 1FFPB 1P5VB 3HJ0A 2A4ZA 4HOWA 1DVFB 1PS3A 5AYUL 4E9YA 4BZ2A 1BAGA 1T7WA 3HC0B 5ID1A 1EGJH 1WFNA 2F5AH 2ILLA 4U49A 5BVJB 3S96B 1GHFL 4JY6A 2K4WA 5DJXB 3PWPE 3ZMNA 1AXSA 5IOPA 1E42A 4WI4A 5DFVC 1OF2B 1HH9B 4F2FA 1Y07A 3SKJL 4GRWE 2VLRA 3MLWH 4MMXA 4YZFE 1YPZB 4Y1TA 3LKQA 1O7DE 5AYUH 4U1JB 4KC3B 3W39B 3TZVA 4QRRD 4G71B 1T7YA 4ZW6A 3L1OL 2HJKB 1GHFH 2J12B 4V1DB 3PGDA 2XPGA 3FTYA 3HS0C 1D5XA 2CKBB 4ANUA 4CADB 5JZ7C 3BE1L 3SKJH 4IGBA 3ILQD 5FUZL 3ZUNC 1TVBA 4FFYL 1LWHA 4LT7A 4IRJC 4UANA 2R8SL 2QMKA 4AUJA 1BEYL 1NC2D 4X6CF 3DK2A 1AHWB 5FYJU 2FHFA 4HLZH 5A16A 3BCFA 4OSUL 2WO4A 3VX0A 2MJWA 2YJLA 4X5WA 3L1OH 4JMXA 3CZLA 3S37X 1HJCA 3M1CA 1ZA3A 1U8LA 2QV4A 1IO4C 1QKZL 1K3ZA 4ZW3A 4C56D 3BE1H 3EO9L 5FUZH 3UAJA 1BF5A 4FFYH 2V4LA 4R7NB 4DP8X 1MELA 2NY4D 3MI6A 2C9AA 4UT9L 3FOLA 2R8SH 2AK4B 3IFPB 1BEYH 2QPUA 1YEJL 4TLKA 1CO1A 4K94L 5GZND 3BSHA 2CLZA 4OSUH 2WGXA 2NSQA 4Z7WE 4TXVB 3M7FB 5KBDA 1ACCA 3DURB 2XV2A 2N1KA 1SPDA 1A7OL 3U1PA 1FPTL 5I8CA 2ZNXA 5ITFA 3JBG7 5IY5B 1QKZH 1WAAA 3TO2A 5H35B 4HD5A 3EO9H 3FTGA 1E3FA 2WZAA 1XGQB 1QO3B 3W5MA 5D5MB 4CMHB 2WLJA 1AIZA 5HDWA 3VI3A 4UT9H 3GSOB 3SBRA 3MV9B 2MPVA 4K4KA 1YEJH 2VAJA 4K94H 4MDJB 2HLAA 3B7YA 4LESA 5CEZD 2W5PA 4PRIB 1BQHB 2Q7YA 3FT4B 2V5YA 1A7OH 3NDYE 1A02N 1FPTH 3DX1A 3N40F 5KVGE 2AJUL 1TTCA 5ICXB 3V8OA 3I3BA 3H3PL 5BXFB 4GINA 3HS0B 1GKOA 3T3MF 3EOAB 4QHPA 3MTXA 2DEXX 1Q0YL 4EN3A 4PQXA 1N5AB 3L3OB 4IRJB 4D0CA 2I85A 4P2QE 4PRPA 1DN0A 2JTYA 3QDGB 2WXPA 4OQTA 2AEWA 2BW4A 1P4IL 4AEFA 2P46B 1HSAA 4IOSD 5D7JC 5GS0C 2AJUH 4MD4B 1J9QA 3H3PH 3QNZA 4PTTB 1NUDA 1VGKB 3ET9F 4JFEA 2AVGA 2VLJB 3NJXA 1Q0YH 2DMKA 1ZA6B 4W6XB 3C5SA 3SYPA 4RBPH 2FO4A 2VERA 3UYRL 2FJHB 4H0LC 2J5LB 3Q7JA 4YSSA 4OKDA 2Q86A 1P4IH 1U3HD 4M1CD 4N25A 2DWXA 1HL8A 3T0AA 2A9ML 2J88L 3IDMA 5D55A 1RK1B 4BKTC 4P9HC 5IHHA 4NRZB 2XFXA 4JPIB 3QA3B 1DQVA 1OB1B 1I1FB 3AW5A 3DJZA 4LSRL 4M43L 1DVSA 2DQMA 5FKAA 3W0WB 5B39A 2A6KB 2WXLA 1MNNA 3FPXA 5EB9A 1CXFA 3UYRH 1IZJA 1TEGA 4HIEB 2VLLB 4LP4A 2O6EA 3UC0L 1ZTXL 1MHCB 3G7TA 4FEMA 4MXQD 3RWIA 1U93A 2QHRL 1DE4B 1EQWA 2W80C 1F3DJ 3BMVA 5SX5H 5DYOA 4ZFQA 2A9MH 2BVTA 2FRGP 2YEZB 2J88H 5I5JA 4QIRA 1XCQA 1U2HA 1IGTA 4OGZA 2DRUA 4KTYA 1MOEA 1CCZA 3UGXA 4XI5D 2YC1B 3GSWB 2C9VA 4WFHD 4BA8A 4M43H 4I9WE 4DK3A 1U36A 5L88L 1BLIA 3WS3A 4WUUE 2X9XA 3MRDB 3UTQA 4AQZA 2EADA 1XGPB 2YGPA 3UC0H 1ZTXH 1J1PL 5BQDA 4ERSL 2H3NA 2QHRH 3KWUA 3L3KB 3CN1A 5DHMC 2MQ3A 3CWGA 4U1HB 3WUWB 5IJVB 4GG6F 3OF6D 2X4RB 1ZXQA 3AROA 4NZ8A 1NMBL 5DC4B 3VX1A 1DQQB 1UD6A 3HHMA 1Z9PA 4J1UA 3UBHA 3WJMB 4PJFE 5C0DA 3H7BB 2PUQT 2NNCA 3R7RA 5L88H 2VW4A 4Y4HD 4NUPA 4JM2A 2F68X 1R5VA 3HVDA 3C6SB 4UQ2B 4G8FA 3EJTA 2JKIS 4WFFE 3ZRFC 2O72A 4UQCA 1J1PH 1TPXC 2JKSA 1KXVC 4ERSH 1N6VA 5F0LB 1GYAA 3VMPA 3GDBA 3LN5B 1SOXA 4R7XA 3D85B 3FO9A 2DIJA 5C09D 2W1NA 1A47A 3LAFA 1OY3B 1QBLL 1NMBH 4GMTL 1OWWA 5DEJA 4M00A 3VI4E 1OGAA 4L9DA 1LD9A 5FK9B 1WE5A 4HLEA 3QQDB 1EZSA 2XG5B 2YQGA 2VKWA 5JHLA 3L4YA 1DUZA 4FADA 3TNNA 3Q6FA 5G5DA 3ZSTA 4S1DD 4PS3A 1QPXA 3BAEL 4X4YA 3G9AB 5ISZD 1QFWM 1QBLH 5IROC 4GMTH 3CPLB 4MJ4A 3X11B 3AY2A 2H6PB 1U3NA 4NI6A 4TRPL 15C8L 1LWJA 2E9WA 5DEFA 2GW5A 3VD3A 4PI0A 3T5WA 5GRYA 2VXQA 3A67L 5BV7C 2MNWA 4Z0XB 3TBBA 2DKSA 2AQNA 3CAFA 3WTTA 3QI9B 1BWMA 1MAJA 1SLUA 5FGRA 1RZFL 4PJGE 2WQUA 4EKJA 3TBWA 2X4OB 1S9WA 2X6BA 3BAEH 5KYWB 2RR3A 3AUWB 3IPFA 4L1HA 1WFJA 4NQDD 3WDIA 5E6ID 1E65A 1OP5H 1HESA 5DZ9A 4O02L 5IHZA 5A2KH 4TRPH 15C8H 1DQML 2DH2A 2W8CA 4AXWA 2P44B 1P1ZB 3CDGA 3A67H 1EAOA 1F4WL 4N2HA 5L2KB 3ILPB 3NSYA 3QO0B 3MRQA 2P8LB 1QBML 4LU5L 5I6XB 1UG9A 1PZ5A 1UJ3C 2AXGB 4DQAA 4W93A 4OUOA 3QQXA 4KK6D 1RZFH 4ODUA 5J11B 1N59B 3M1BA 4PJAA 5AVZB 3RBGA 2PW2A 3K80A 1JXGA 4K7FA 3VXMA 5JIDA 1IGML 4O02H 2QR0A 4W9LC 1DQMH 3ORJA 1XB8A 1ERNA 4KI5F 4MJID 4K71C 3O81A 2ZCZA 4DFIA 3TFKD 1K5WA 1F4WH 2BJML 4JM4L 4LU5H 1QBMH 2HA1A 1ORQB 3LSOB 4N8PA 1JNHA 3MKKA 3QPQC 1GXEA 4Y4KA 1KB5L 4FCAA 2WBJC 5FO9B 2WSPA 3MREB 4NDMA 1Z9SB 1J05B 2GJZA 3BT2L 3U6XA 4C83B 3T2PA 2AAAA 3MRMB 4PJCB 2H32B 5TK4A 1IGMH 7CGTA 2VDQL 5LJYH 3VQLA 1AH1A 4PJXE 3H55A 4ZMQA 3MJ7A 2W65B 2BHUA 4UYPA 2BJMH 4JM4H 3V6ZA 2P4AB 2HPOA 4XMVA 2JJSC 4RFOL 1UOLA 2ARJQ 1KB5H 3GHEL 5AOMA 2P5WE 5T1KA 5C0GA 1XV8A 4E42A 5DD6B 1IM3D 2IDFA 2JCCB 1IM9B 3BT2H 3HZ3A 5GS2D 2WPGA 5JMRA 5FKPA 1IAMA 1P7KA 4MJ6B 1QFHA 4LSSL 2VDQH 5C0CB 2OQJB 3PXLA 2VZTA 4GIOA 3CE1A 3TJEL 1AQDA 2PYEB 2ZOLA 4RFEB 3QUZC 1ZSDA 2GFBB 4RFOH 4QUOA 1UJ3B 3GHEH 1EGJA 5DT1L 1GGYA 1QASA 4G70B 1C1EL