5AAMC

Structure of a redesigned cross-reactive antibody to dengue virus with increased in vivo potency
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
95
structure length
95
Chain Sequence
b'TMCSGKFSIDKEMAETQHGTTVVKVKYEGAGAPCKVPIEIRDVNKEKVVGRIISSTPLAENTNSVTNIELEPPFGDSYIVIGVGNSALTLHWFRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SCFV513
publication title Structure-Guided Design of an Anti-Dengue Antibody Directed to a Non-Immunodominant Epitope.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 10
structure length 95
sequence length 95
chains with identical sequence J
ec nomenclature
pdb deposition date 2015-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5aamC00
5AAMC 4ALAC 3J27A 1S6NA 1RERA 5LCVA 4UTCA 4UTBA 3N40F 4FG0A 3G7TA 2GG1A 1ZTXE 4UTAA 3UZVA 5GZOA 1OK8A 2I69A 3UAJA 5AAWC 1OANA 2HG0A 2JSFA 4L5FE 3MUUA 5H37A 5KVGE 4FFYA 3P54A 5KVDE 2V33A 2R29A 1UZGA 2H0PA 3UZQB 4BZ1A 3IRCA 3WE1A 3UYPB 2R69A 4GT0A 5LBSA 1Z66A 3C5XA 4FFZA 4GSXA 5IREA 3N44F 2ALAA 5LBVA 4BZ2A 1OKEA 5KVEE 5GZNA 3N42F 5KVFE 3N43F 5JHLA 3C6EA 3UZEC 4AM0Q 1SVBA 3VTTA 3N41F 5B1CA 4UT6A 3J2PA 2JV6A 2JQMA 4UT9A 1TG8A 1URZA 4X42A 4AL8C 2P5PA 5JHMA 1PJWA 5IZ7A 1Z3RA
chains in the Genus database with same CATH superfamily
5CJQH 3TBWA 2TRYA 2WBXA 3UACA 1A8ZA 5EZIH 1NC4A 5C07D 4M93B 1X4YA 1A1NB 3O4LA 1TTAA 4ZFGL 4Z23A 2AS5M 3U46A 3QO1B 1YHPA 4I0PC 5LBGA 3QB7C 3GIZL 4R97B 3CH8A 2GT9B 3Q2LA 3P2TA 4E9YA 1WTGT 5IY5B 4O2FB 3CMOH 1AKJD 3MNVB 2WTPA 2PXYB 4ES8A 4O02H 5IGXH 4YC2C 32C2B 3WIAA 2O93L 1RMFL 3J07A 3QUZC 3FB8B 2Y22A 4HPOH 4MXVF 7PAZA 1JFQL 1FZJA 2Y9RT 4GMTL 4KMTL 5T3ZD 3F04A 3D12B 5BRQA 3LQZA 4WCYL 2GSIB 1H3VA 3D33A 3T77B 3P9LB 2NZIA 3P69A 5AOIA 2L7JA 3F58L 4DZ8A 5EH1A 2ICWA 4Y1AD 4IK7A 1PZDA 1MCFA 3WLWD 4UUJA 1H3PH 5I16A 3SCMD 1LP9A 1ZPUA 2J2ZB 4KTGA 3EG9B 4MJIE 1I4FB 4OD1H 2K1MA 5GJTH 2YUXA 3S36L 4LLVB 3DOSA 4G8IA 4BFKA 1JP5A 3ZE2F 4BA8A 1P4UA 1ZLSH 4MHHG 1SJHA 4OU3A 3DVIA 4Z95H 3BLBA 3UTZB 3O6LL 4HOWA 4S0TD 3O45B 4UV4H 1RZJC 1CXIA 3I02A 4V1DD 4L4VA 3FO9A 3UGUA 4R9HA 5C7XL 1FVDB 2F8OA 1FGNH 1WAAF 3WFCL 4NPYB 4Z7VF 3QDMA 3ME0B 5DRNB 5H35B 3GGWB 5BV7H 3MLTA 3VFUB 1SDDA 2XXFA 3VD7A 4WLCA 4HIHA 5DJCB 3S88L 3W38A 2HLAB 2FGWH 4JM2B 1A0QL 2MNWA 3DNKA 4F9PC 1WGVA 3IJ8A 1C08B 4N0FB 4A7SA 4GIOA 1KXVC 5DUMH 5EZLB 5EO1A 3ULVF 2BSSB 2I25N 4GW5B 1ZS2A 2WYIA 3BZEA 3G6JB 4Y1TA 1JNNL 1XCTA 2WUCH 3ZJAA 1QFOA 3S8FB 4RA0C 5BXFB 1TO5A 2ZOKB 4YFEA 1DLHA 2FX8L 1DQQA 3QG6A 3E2HC 3FUIA 1XCQB 4PRDA 1KLUA 1YQVL 5K9KA 1EO5A 1D2PA 2J20A 4TRPL 1A2YA 4DH2A 1CS6A 2BHFA 3KPSA 4H1LG 4Y19B 2JQZA 2CHZA 3BFWA 4JCLA 3JTSB 3V4UH 1A7NL 3C5SA 5IK3A 1GA2A 5ISZB 2AQRA 3SE8L 5L6YL 2A73B 1EMTL 2COQA 4FXKB 4Q7DA 1T04A 4U1LB 5JW3L 1AGEA 3X14B 1FVCB 1ZV5A 2YJQA 3IMVA 4X5RA 1JHTA 1T4KA 2EYTB 1RUKH 1Q9OB 2N59A 1QVOA 3FRUB 4JFQB 4PUBL 1SVCP 4MQTB 4U6YB 3Q8EA 3MV7D 4NQSB 4FXTA 5CLZA 4I8DA 2BNRD 1TEYA 3T4YB 1SLVA 1F18A 2OJZH 5AZEH 4K5MA 1OP5K 3HZYB 3U4BH 5LXVA 4B41A 3IKKA 1VFAB 3MXWL 4WHTA 3SPVB 4HOZA 4UT7H 3BE1L 1UWYA 2X4QB 4GRWH 4HC1A 3ASWA 5HDBE 4YMPA 1GGUA 5IBLC 3TZVC 5EC1A 4DO5A 2DQJL 1QSEE 2WTRA 4G5ZH 2BFGA 4ZD3H 1XF4B 4PLOB 4YSTA 2ICEC 3ZKXB 2J44A 1ITBB 4WW2F 2ZKHH 4ZYKB 4I3GA 2R2CA 4YVNA 5JQ6L 1VRSA 1ND0A 4BGLA 4X5WA 3FUEA 2KZWA 4K7PH 5AYUL 3SOTA 1NGYB 3BSGA 1HN1A 4ZQKB 2VMDA 4GNKB 1DBKH 2NPLX 4Q0XH 1GGIL 3H3PL 4P5KA 2JCWA 5EBWA 3KGTA 3OXSA 2EYRA 2YPLA 4N6RB 4PB0L 2H6UA 4GS7B 5IHZB 3QJOA 2BIIA 1V3JA 2BY2A 4GQQA 4KZDL 1OKEA 4PRIB 3DX7B 1SEBA 3J7HA 3LIUA 4HDIA 3JUZA 3UG3A 4K9JA 4Z76B 1X5YA 3RILA 3LRKA 1WA1X 2M26A 5SWZA 3MZTA 3O0RL 3O2WH 4MNQB 2K70A 4FYQA 3RVUC 3SGDI 4K94H 2XZAH 1KGIA 2X0WA 4YHZH 3ROLA 3WGUB 4HXAH 3SPCA 3O9WA 1H15B 3S2CA 2Y7OA 3KYMB 4QXGH 3ARBD 3SGEI 2MMXA 4MCZA 4MA8H 4YK4C 1Z2KA 1QI3A 5E8OA 5FO2A 1TSHA 2AJYH 3VNYA 4NC1E 4ZK8A 3D2UD 1XXDC 4N8UA 5MI0C 3B9KA 4XC3H 1I7RA 4Y16B 1F56A 1RY7B 4DGVL 3T2OA 1XZ0A 2WXPA 3C60D 4NQVB 3NT0A 3M17A 2IAMA 2NNAB 2OL3L 1XF2A 2JKWA 2WC7A 3H7BA 1FL5A 1HH9B 1CU4L 2PABA 3GSQB 3THML 5FK9B 1J5OL 2MPVA 2O61B 3QUMA 1XHHA 1D5MA 2F7IA 1FO0L 3KBEA 4S11A 1OAXH 2H8PA 3QAZB 5ABZA 1WLHA 2PETA 3FPYA 4BRJA 3LRGA 5AYTA 4H25B 5IWLA 3AAZA 3QDGB 1FL6A 1QWUA 2VC2H 4Z78A 5JDSB 3L3HB 1ZLUK 2DZEA 3PHOA 4WNSA 1NJ9A 3E9TA 4Q52A 2YGOA 4UOQA 3WFBL 2BM3A 4K8RH 3FTWA 3VI3E 3UJJH 4IYKA 4WK0B 1I9IL 3WD5H 1DSYA 4N20A 4BSVA 3QYNA 1T0MA 4OLZL 5FUCE 3MUUA 3PUCA 2HT2C 3RFZB 1OQXA 1S9VA 3EUUA 4IBUA 4Q9QH 3IDNB 3ZE1B 4IRJC 5AB2A 1N8OE 3ESOA 4HJIA 3AXHA 5DT1L 4IOIB 1ZPLA 1OO2A 4ODVL 3CZJA 2W59A 4HC1L 2EIBA 3PP4H 1ZE3H 2CIIA 4YSEA 4P9HH 5D96B 4DUXA 2Y07H 3HZ3A 2AKRA 1QLFB 4DERA 2DIBA 2WY3B 3MUJA 1CFNA 1SPDA 4RGNE 2QVFB 3PV6B 1PLGH 2CRMA 4NCC1 4KDVA 5JPMB 3PGFH 4DAGH 1NSNL 4OZ4B 1E8WA 1SXCA 1ACYH 3DIFB 3SDAB 3BQUC 4I3SH 3RBSA 3LRSB 3POHA 5C0IB 4PJFE 3TCXA 4X6DF 5KYYB 4TLSA 4IU2A 2X9XA 3GTNA 4CMHB 4ZT1A 5KVEE 1P5VA 4P59H 1FRGL 2VDOH 3BJ91 3MODL 3W2DL 4UQ2A 3HC0B 2WXQA 3ZDYE 1I53A 4NX0A 5AQ0A 5FWQA 3CVDA 3D18B 2QDWA 1P4IL 2GUYA 1T66D 3IWVA 4FQXA 1R5WB 4E36A 4MA3A 3UBXA 1N5YH 1FIGH 3O6FB 1T1WA 2WQRA 5D1ZI 1KJMA 1MFEH 5DLMH 3S37H 5B3NA 2NX5A 3QAQA 2XVGA 4PG9B 5CCHE 3VM5A 2HSIA 2ZJSH 3RVVD 2ESVA 1HU8A 4WI4A 5I9QC 4KNUA 1A6PA 4WO4B 2WIIB 4R0LB 1GW6A 3O3DB 5ACMA 3SYOA 2AZUA 2XTJE 4JMNA 2G60H 2OSWA 2E59A 5IF0B 5E8PB 8FABB 3W39B 3FU7B 3VWJB 4LDEB 4PJAF 4X98A 2WSPA 2WXFA 5I8OL 2F53E 4N85A 2XNAB 3QARA 1YYMH 2WWKO 4KKLD 2AK1H 4D0BB 2DQEH 1XGZA 3V4PA 4BYHA 4AQ1B 3NACL 1XGPA 1P7BA 1FSKB 5E9DD 1R3KA 3QUML 3SDCD 1M71A 3U2JA 1LO4L 1NBZA 4JFXB 3DGGA 3KYOB 4U6VH 2WLIA 3FCTB 3CFQA 1RUML 4M7JL 5GPRA 1INDL 1RH8A 2YRLA 3E3QE 4FLHA 1S7VA 2EIMB 3ZKMC 4ZUWB 2GC7C 5GZOC 1ZEAL 3WAKA 1UH2A 4K23L 4MDIA 2OYKA 4KQ0A 2BRRH 1IJNA 1MZYA 5M7QA 2P5ED 1OGSA 3ZYOA 3RNQB 4BWTA 2GK2A 3OKOA 4IOFD 4MASA 3X1BA 3OBAA 5DJZB 1X7TA 1MJJA 2IADB 1VERA 4KY2A 3TNMA 4JFDE 1I7ZB 4R8WL 1WUNT 1NFAA 1XGYH 1K8DB 2P26A 1QSZA 4K5LA 2X9ZA 3KM2A 4HKBB 4AYBA 5IVOA 5F1NB 5FM5O 3T65A 3CSYB 3UJTL 4ZUUA 4YS4A 3NZUA 1JN6A 4PYHA 3NN8A 2AEQL 1SHSA 1QD0A 2JK5B 1XIWD 1G7IB 5FLUA 4IIZA 1WVZA 4NKOA 1A1MA 1L0QA 5K69A 1CF8L 3EYVA 1UA6H 5LJYH 3F84A 4IGBB 1P5UC 5K5YA 5EF2A 4UDUA 2J8UE 1GY1A 4HUUB 3K6OA 3PWJA 3FTYA 1WICA 4B0MB 2DI7A 5ICYB 1BX2A 3AZUA 5IQLA 3H85A 3HBGA 4TQEL 4L4TD 5E1AA 2UY7B 3QUYD 4K8RD 1SN0A 3BAYA 4MA7L 4JM2F 3MUY1 4NCDA 2NY1B 3PG2A 2IG2H 1QFUH 4Y7MA 4DO4A 3GTTA 3FJTA 1YNTF 3NJHA 4JHZA 4LVEA 1U8IB 5E9AA 3VI3A 4J1UB 2P80A 3OPUA 3QZWA 4M1CC 4U2ZA 1A1OA 3D85D 1KGYE 1MW3A 4DKEL 3VWKC 2QTEA 5KYWB 4B0MM 4N4YB 3QXWA 2P49B 2FBJH 3VSTA 1JIBA 3RI5F 1JPSH 1E65A 2B08A 1DBBL 4ZUTA 5HTSA 4C56D 4F15C 3N1MC 5TE7L 3FUFA 2RQ8A 3JWNH 4PMEA 3K5SA 3RKDC 4C47A 4G5AA 5EU3B 5EOQL 1R47A 2X9WA 4M48H 2A6JB 1TDQA 5A2CA 3CCHA 4JPIA 1U8HA 4TQ8A 4AM0A 2E7LA 3MRMB 1N5AB 1TMQA 2MTPA 4OAWA 5A2BA 1BFSA 1G4RA 1ETB1 1TCRA 1ZT7A 3WBDA 4JFPA 1UTDA 1Q0XL 4JZNB 4PH8A 5AAWA 5ABDE 2VWEC 3FQ2A 2VQ1A 3H42H 5KBPA 3C8KB 2F08A 3DVGA 4L0ZA 4XZUA 3UBHA 4EN3C 1HHHA 1Q1JH 3V4PL 5I8CB 2N4IA 1AC6A 3D52A 3ET9F 4ELKA 4L2LA 3MRDB 3V4VL 1QRND 1G87A 5INDB 4L8CA 4U1HB 5ENWA 2DJ4A 4QRPB 4EI5D 5IV2A 1BF5A 1DUYB 1KTDB 1OD7A 1YEGH 4W9CC 4U3HA 5CJ8A 3QQ4A 3QCTL 3M07A 4CMMA 3ZO9A 4OTXL 2OXHA 1DFBL 4LVHC 2UY6A 4U6XB 2VDNH 3UTTA 2ENSA 2ZICA 3GJFA 5DI8B 1AO7E 2VM4A 3ARFC 4FJ6A 2C9AA 3F5WA 2D03H 4ZXBC 1IAIM 2KT6A 1L5GB 1OAZL 5C3LD 4XPAL 2MIZA 4ADJA 3REWA 2I5YL 2KERA 1WIPA 5HY9A 1X6NA 4BZ2A 1LO0H 4QHMB 2R51A 1ZVSA 1GIGH 3AM8C 2AV1A 2GITA 3E8UL 4XVSL 4LLUA 2AJUH 2MRYA 3KDMB 3PDDA 4HLJA 4JKNA 3O3EA 4BRVA 3HAEG 3UMNA 4W68A 5CBAB 2F53A 4TULH 5HHQB 4KHXL 4PTUA 1KXQE 1U8QA 2OMUA 2XWBA 2WN3A 2OLDA 5KBKA 5JHLA 3AT9A 2XN1A 4NRYB 5T5NF 4WFGD 5DD1L 3NFNA 1HYSC 3CE1A 4H20L 4ZO6A 1AIFA 4NC2B 1A6AA 1MW2A 1P4BH 4JZOB 5J6GA 1Q9KB 1U8CB 1F90L 3OXRA 3ZRSA 3PQYB 1OAKH 4ANXA 3D4ZA 5BS0B 1EUTA 3DHPA 1WSST 4HIIA 4N25A 4LVOB 5EDXA 3TVMC 2VLJE 1RK0B 3D0VA 1XGUA 3T5WA 2ODIA 1NCBH 1OSZA 3FU3A 2Z8VC 3LXCA 2HKHH 1UURA 2YMOA 3LV3A 5C0NC 5FEBA 4GO8A 1RJCA 1PSKL 4AQZA 5L2KE 2CG9X 4RGMB 3NAAL 1NOAA 1UM6L 1CLOL 4FQIH 3RURA 4L5FH 1NCJA 1P2CA 4CVZB 1FCCA 1HSBA 3CQQA 4ZX3A 4NM8H 3CZFA 5TF1H 4JFDA 2OW6A 1A7QL 4JEGB 4NC0B 1PNDA 3CV5A 3FW6A 4J5VA 4GSDH 1G7LA 4IU3A 3E6HA 1EQWA 3D8MA 3AMLA 4BE5A 4G82A 2ADYA 1CGSH 3EYFA 4JN1L 4K9EC 4JRYD 4HFUH 3E1ZA 1YN6A 5EMYA 3ULUF 5DD0L 3K2KA 4RGOH 2VZ1A 3HC4L 3S36X 3X12B 3M46A 2HVJA 2W9EL 3U30C 2HFGH 2YQ3A 1XWVA 5I17B 4DPCX 4S1DD 2XPGB 4BH7A 3RIFK 4MQXC 5HYSB 2LU5A 4F9PA 1I7UB 5FLVA 4LLMA 4GJTB 2KH2B 3ABLB 4NXKA 1E2VA 5JZ7D 3AS0A 4MGXA 3BUYA 4NO2A 4JFFE 2GSGA 4ALAH 2WPGA 1O6TA 4HS3A 4PJCB 3ZE1F 3GZOA 4R7NB 1BVKA 5T33L 5E6IA 2ZKWA 2Q1EA 3US1A 2WLLA 2HYMA 4TUOB 3TM6A 1S5IL 3CHSA 4KROC 3WCYA 3K74B 3T1WA 1U8LB 4R5VA 3JV6A 5LN8A 5DMJB 4MXQD 5BRZB 2YAQA 3LQAC 3FRPA 2C3VB 2QT6A 1MRDL 5I1JL 2E9BA 4NZFA 2X2JA 3DUHA 3PL6B 4IQHA 4WWPA 2X4TA 1LWRA 3SOBL 4BINA 2AV7B 1QR1B 4FJYA 3FB6B 4WFFD 1CI5A 3MA9L 2J55A 2QKIC 3PNWA 4XNBA 5C6WH 3N2JA 4OZFH 2JELL 4XMLH 3CN3A 4NRZA 3QQ3B 4HD5A 3S3SA 4UNVA 1KCBA 3QEGH 1WZ1H 5HYIA 1FDLL 3ECBB 3LN5A 2AABH 2E5EA 4KUCD 3WJJA 4BJLA 3NIDB 4FZEH 5DSCB 5J8OA 3U9WA 1MCBA 3BPLB 3B2PA 4OF6A 1DQKA 1Q90A 4G9FE 3RZCC 1D9KC 4TSAL 3QI9C 4K5NA 3ULAB 2R0ZL 1B4JL 5HVFB 4OZGE 1DVXA 4N0UB 2G0KA 5JHLL 1HXMA 3TO4D 3ZDWA 4OCWL 1J5CA 1BQSA 4ANUA 5D2LE 2PO6C 5IMMA 3L17A 2ZKXA 4PJEE 4ZBJA 3R7QA 4QHPA 5IQ7H 4EIGB 4AEEA 1HIML 2IGTA 2ICEA 3GHEH 3D34A 3LS5H 1MFUA 1TYJA 1Y6NR 1YJDL 2OZ4A 4QEGA 4V2BA 2ZUYA 2BSED 4PS3A 4GIPD 3OB0K 4E42B 1FN4B 3S4SB 2CD0A 3VG9C 2CA3A 4P2RB 5D7SH 2FEEI 4AUYA 1TVHB 3DK2A 3IFNH 4B9CA 4AZUA 1BW8A 2C7UB 3ARGB 5IHZA 3V6BR 1HSAB 1AR1B 2O30A 3I50L 5GRZA 4I5BB 1NOLA 4MD5B 4NAMA 2B4CC 3BKJL 3BH8B 2FLBT 1THCA 3EJUA 1XBDA 3KLLA 4HJSA 4OIIL 5F97E 4KJWC 3PUUA 1QATA 2KBGA 5GGQL 3KWTA 1DQML 4PRPE 3K6NA 3S35L 3FT1A 4PJBA 3L3OA 3HZMB 4E41E 1SUJA 3R06B 5GIRA 4JFEE 3FB7B 1SMDA 2BDNH 4O58H 2ID5A 4OUOA 1JNLL 3OJVC 3NRPA 4LO9A 4P57A 2O5ZL 3ZL2A 3AU1B 1BWMA 2K4WA 2CK2A 2WANA 4I18C 2NYKA 2EXYD 2JJVA 4EUPB 1H3WM 5EIIA 2NR6D 4FMVA 3ESMA 5I6XC 3E0GA 3OG4B 4TL4A 5LAPA 2FX9L 1BJ1H 4FTVB 4I3RL 3BIAX 3LH2L 1G0DA 4G8GE 2IFGA 4TSCL 4AWJC 4R7DA 3MGOB 3ZK0A 1T83A 4MVBD 5E51A 1JZ6A 2C4FT 1ZLWH 1WS7A 3ATDA 3VH8A 1N6QH 4ELMA 1J8SA 1YYLL 1MXGA 1TPXC 3FO2A 4L8DA 5I0WA 2OYMA 4S0HA 2X3CA 3N42B 1UJTA 1B0WA 1E6JH 2MQ0A 1S8DB 3N1PC 1KBGH 1W0WA 3CHPA 4YWGH 5BCAA 5EN3A 1R1CA 4ODWA 2AK4E 4ZAKD 3CZNA 3CHQA 4S2SA 1KB9K 5FR3A 4W4OA 3QJUB 4X4YB 1CD1B 4YDNA 2EJ1A 1MH5A 1XTMA 2C1OA 2DIJA 5EB9A 1HTYA 3DIDA 5D6DA 2CKNA 3LRLA 3OPZH 3KWWA 3Q5TA 4YHPA 5GGUB 2LV4A 3LKOA 5DRZB 3VXSE 3K2MC 1VCAA 3JYBA 4YSDA 1VKXA 3GUTA 1BBJA 3NZHH 1RQ5A 4XBGA 4IKLA 1ZT1A 4UM9D 3S48A 1YUKB 2ZWYA 4Y4KB 4DP5X 3VMNA 3FQXA 2Q10A 4HUVA 5K39B 5I28A 2ZSWB 3MBEC 1AHWA 2PR4H 3HN8A 3NZ8A 3IYLW 5DEJA 1GTFA 1UZ8B 3H9HB 4ZMVA 1I8IA 4WY7L 4Y2DB 4BQ9A 4XOCA 1DUZB 3W9DB 1T1YA 5KANI 4TV3A 4N8VG 3VFTB 1KDIA 2X6CA 1N2RB 3TNNB 5C0BD 2EABA 1J1PL 2AANA 3FU0A 1BXXA 5KBMA 1JHLH 1E7UA 4X6FA 1IGIH 5LBSH 1WCQA 4PVMA 5LXGL 2EVIA 5HI5C 2AMGA 3CSGA 2R56L 1R3HB 3VACA 4NJAL 3GSWB 1M1XA 1ITCA 3AWGA 5BO1L 4LU5H 3TBSB 1OE1A 4M5ZH 3U7WL 3UTQB 2FRGP 4OJFH 4PLJD 4KKBD 2BP8B 3SJVD 4N2FA 3KPQB 1OARL 1TZHB 2VWEE 3BQUA 3VRLE 4Z3TA 4HJGA 4MNHA 4XNYL 4U1IB 4ZTPL 4KY1H 1UEYA 4TUJA 4DTGH 5AKTA 1LVEA 5BZXA 2VRKA 3W0WA 4UOJA 4YH6A 4DOHB 2E4TA 2CK0H 3WXVL 4R2GD 1ZHNB 4YLQT 4NWUL 4YQXL 5KVGL 2HH0L 4PP2A 5KTEL 5DRWB 4RWYL 5EV7A 3TEXA 1RPKA 5ECGA 1ECZA 2IJ0C 2EO1A 4J6RH 3CH1B 2GY5A 2LFGA 3QXVA 4G9FA 1JK8A 1A4BA 4OZGA 3RWHB 5F3BB 3NJMA 3WEXA 4QNPE 4LSTH 2VXTH 4RVBA 2W8CA 3A24A 3DJ9A 5D2LA 4PJEA 3DX2A 4XH2A 3VB9A 3U7YL 2UYLB 4PJ8C 5I1EH 1KZYA 4G70B 4BZYA 2H2SC 1GGCH 2BZ7A 2JIXA 4JFZH 1FAKT 1G1CA 4TLUA 1BOYA 1CDCA 4F7CA 1HHJA 3TA3D 4Y5VB 3U36A 1XQ4A 1IAII 5ILTH 4RISL 4PGDB 2J88L 3OX8B 3BPOB 4NI6A 2XQYA 3JV4A 3VXME 4WAFA 2UXTA 5JDJA 2J73A 4HWBL 4HX1B 3NUKA 2JCCE 4HJUA 1OCOB 3GIZH 5IM7A 4U7SA 1JZ7A 5CZXC 1MJUL 5HGHA 1FYTE 3TLRA 3FT3A 4WIQA 5I15L 3VI4E 2DQFA 4Z7WB 2B9BA 2XWTA 1X5XA 1U6AH 4D9QD 3PJSB 4E41A 2WMPA 3N55A 1TU2A 1RMFH 1Q1PA 2R1YB 4J3VA 1RIVL 4GMTH 5DO2D 5FM8A 4B6ZA 5J6HB 3IMWA 5LDSA 2AF2A 4M6OH 1GC1L 3AUVA 3NSJA 5LN4A 3F58H 1H5BB 5DC2A 3MCKA 1JUFB 3KPRA 3NEOA 1I1AD 1T5WA 4E5XG 4OI8A 1F6FB 1U3YA 4N5EC 2XXMB 3BUIA 3VXRD 3DV6B 3FONB 2MHAB 5JIPA 4XWOD 4G8GA 5CIPB 2XV2A 5DRXA 1KJ3H 3A4DA 3R8QA 3D2TA 5HHNA 1MJ7H 3CIQA 3QWOA 2Y25A 5CEYA 1KJ2L 3JWOL 1BA9A 1F6AA 3WNKA 5GGSA 2J7LA 1FNGA 5AL8A 3PLYA 4AYSA 4BZ1H 4WHYH 2FHCA 1GJIA 5B22A 4A2LA 2QQKL 5LGYA 2VXSL 2PCPA 3FQRB 5KSAA 3SDYH 3GRBA 1G7JA 3T0VA 3GXIA 4KQ3H 3AT8A 4DO6A 4X9FA 1DYZA 1ASQA 4A7GF 3S34H 2JMRA 1KG0B 1RIUL 3BO8A 4K3DL 3VXUB 4N26A 1KNOA 1QFWH 4JG1L 3EOYG 2HFEB 5TFSH 5BZZA 4DKFL 2TSAA 5JR1L 4FMKA 4OV5A 2OJEB 3IRZA 4NZ8A 3WIIL 2ADJA 2OK0L 3MUHL 2VR4A 3N9GH 1I3GH 2QADC 4NB7A 3AY2A 4P2OD 5DHVH 3DIVA 2XQBL 3K2UH 5K59E 1F13A 4OGAC 3WENA 3WHE0 4BFGA 2EXWD 2HTKD 2F7OA 3LDBB 3L4ZA 4FS0A 4P49A 3K71A 2VJ0A 4XMUA 1F4YL 1I1YB 1V55B 2CDFB 3EAKA 1VACB 3LPGA 1MI5D 2XI9A 3UO1L 5JHDD 4JRWA 4CKVX 1K85A 1AJ7H 4BSWA 5B8CC 4TNWK 1X5MA 2J1WA 3LVEA 3SE8H 5L6YH 3MN8A 4MD4A 2DBLL 3P4MA 2YC1A 3VFPA 3OSKA 5ACZA 3WS6C 3T4AB 4LGPB 5C08A 3SDXE 3T6ZA 3A6CH 3QPQC 3ML9A 2FK9A 4RBPH 4TKWA 4YHNB 3WTSA 3Q13A 1T7XA 5JQHC 3LXBA 1AD9A 3QJSB 1AXTL 2BSTB 2NXZC 2E8YA 3MV9D 2HWZH 3E6FB 2I7OA 2J8HA 1LO2H 2PTUA 2R9HD 2ZWZA 5EHFA 1IE5A 5F89A 2Z7UA 1MFBH 4WJ5B 1P7HL 1YEFL 2WB1A 2V7HA 3JTTA 4PLNC 1XR9B 1MVFA 5JUEL 1KIQB 1EFXA 4BFIA 3BP4B 2XWRA 2SODB 4AIZA 4Q97A 2FJGB 3CZLA 4LKCB 3U0TB 5JQ6H 1AQDA 5BOJA 1RZ7H 3QT2A 1S7TB 2YD8A 4KRPD 1IM3B 1G7MB 1A3ZA 4LMQI 1WEJL 4Z1PA 4HHAB 3VGEA 2VDLL 1X5KA 3MAWA 3D4CA 4R5XA 2ALWA 4IS6B 2IANE 1GGIH 2HG5A 4ICWA 1YDPB 4YXKL 4YHOL 3PGDB 2GK0B 4OD3L 4PB0H 4WWKB 3I3BA 1EPFA 2PR9A 3APDA 1HI6A 3GHBH 5AW8B 2X1QA 2BOLA 3CDZB 4JPSA 4QOKA 4DFHA 3P3RA 3HE7C 4FQLL 3DXAB 3OR7B 3VXMA 3IDUA 2E7DA 4OGQC 3UAEA 1X4XA 4I77L 5D4HA 2EEDA 3RJDA 4B9KC 3WUWG 4GUQA 1DL7L 1SMAA 1VCBC 3HW7A 3QXUA 1M9WA 4Z3GA 4PY8I 3AITA 3OKNA 3P9MB 4L3FA 1IFHL 5ITBL 1L0XA 3J8F7 1J9TA 4JQXC 2HUHA 2JE8A 4Y0GA 4LHUB 3L5XH 1DVZA 3CVCA 3M1BA 4L37A 1Q9LB 3FS9A 4L3ED 3WNPA 3I9PA 5DD3H 1L6ZA 1JDDA 2QLYA 2EDEA 3BZDA 4LPTA 5J4MA 4PWFA 5CKGA 1UYWH 5E4AA 4LAQL 4QRUA 3CXDL 1J5HA 3VYNA 3JWDH 1BXVA 1IGTB 3HPLA 5EUOB 3KYAA 1JGUH 1CU4H 3FULA 3G04A 3RIAF 3C2SA 4JQVA 5CCKH 4LNRB 1YC8A 5F7NC 3N42F 5KVFE 1FLRH 1NC4B 3O4LB 4I4WA 3QNYA 3RDTC 3RLSA 4DKTA 1T5XB 1PLAA 4DPAX 2VDPL 3JSSA 5TH2A 5HHMB 1I8MB 2DYPB 5L4JA 2PYEB 5TE6L 2P24A 4YZWA 4U1MB 4YSUA 3FTVA 5GGRA 2CLVA 4GINA 5HVWA 5EU4B 2EDXA 1GSMA 3NH7L 4WV1C 3WFBH 1A47A 2V9RA 4P5TA 1XAKA 1OALA 1B4TA 4F7MB 1UT9A 3N6YA 2GJ6E 3NGBB 1KTKE 2WZ0A 4F5CE 4F8QA 4YHLL 3F7PC 3U6XA 2ED8A 5DT1H 3ZDZB 3ZRFC 2VSMB 4ODVH 3KW7A 3WO4B 1E3FA 2Z31D 3QIUC 4HC1H 4JUTA 4UUJB 1CDIA 5B21A 3WFHA 1R17A 2GI7A 4M8UA 1LP9B 5CSZA 5F2FA 5MP6H 4L48A 4HEPG 4JUSA 2VITA 1V7ML 4RDQF 4HIEA 3EDJA 4PGEB 1OTSC 2IGFL 3K7UA 2XBDA 3VB8A 4PJDF 1E6OH 4IMKC 5IUCA 2V2WA 1NSNH 2CXGA 4HXBH 4QTIH 4WUUD 4Z8FL 1T2JA 4BSJA 1EVUA 2ZT9C 2VLLB 4MFHA 3CBRA 4EI0A 2QELA 5B38G 5D71L 1UEMA 3QDMB 3V95A 1T1ZB 1GZHC 1JI2A 4A67A 2IEPA 5A16A 3IK2A 4JGJA 1N6UA 4NDMA 4HIHB 3W2DH 2RB8A 2FL5A 3IGUA 2BVPB 4XCCH 5TGBA 3SDXA 3HZKA 1SJMA 3UAJC 2W0LA 4YLCA 1W0VA 3T2NH 2AQ2A 2ZXEB 5D1QE 1WAPA 1CLYL 3GB7B 3QG7H 3RAJH 3HLKA 4U7MA 3KYKL 2E86A 1D9KA 4QRAA 2BFVH 3ECUA 2OL3B 1SOQA 3OLIA 4K3JH 4BD4A 2R69A 3SO5A 1KPUA 1TQUA 1MCNA 1KCKA 2ZP8A 2VLKA 5K9KB 1BAWA 1IKFL 2WCPA 4EKXA 2H9GA 2PO6A 1MCWM 3B3IB 1FO0B 4JLRB 4PRNA 4UM8A 3BLPX 3FHQA 3IB4A 5DK0A 1ZHBB 3TN0B 5BQ7B 3BSZA 5I24A 3QIBC 1NPUA 5JIKA 5J9PB 5D93C 4EOWL 3AG4B 5EU6D 5JLZB 4JVWA 5FYKE 2GBVA 1Z9PA 4Y4FB 2D7OA 2HRHA 2HX8A 2VSKB 4XWGL 5C0DB 2M8XA 1S7QB 1Z3GL 1S78D 4FFVD 1JE6A 3UAAA 3WS3B 4O9HH 4Q14A 1OGPA 1A6TB 1LYQA 2GI0A 4L3CB 4V11A 3ARDA 4NZUH 4NXSA 3KR3L 4TOYH 5G55A 3AS3A 3EFOA 3GXUB 1LEIB 3HS0C 4JE4B 1YPZE 1G7QA 2XLLA 4L4VD 2QPSA 1AGBB 1CZ8L 5T1MA 1ZA3B 4QDGA 2W5PA 2JKIS 2CMRL 3FUHA 3IWUA 1INDH 1F00I 1MLBA 1F3DH 1ZJBA 5EFIB 4N8PA 4K9EL 4Z7WF 4JRLA 2ZXBA 3PIQA 3QS3A 3ZKND 4PVNA 3DX6A 4NNXA 3S5LA 1L6XA 1OF0A 4WDIB 3MV7B 5I2IA 1NAMA 5JPNC 3S35X 2JKXA 3IBEA 3VRJB 1KCWA 1I9RH 3D3VB 4ODTL 3DO4A 2HX9A 3EJZD 4GSQA 2EC8A 4LSQL 4XRCA 4NN7B 2FQDA 5LCVA 1NBYA 2NY4D 3BH9A 5DA0B 5EZOL 4KJYB 5CD3A 4R96A 3H2QA 4M7ZC 4WI6A 3QJFA 4H0GA 4UDTA 5LAXA 2HVKA 1FYHB 6PAZA 4L29B 3VJ6A 3KPSD 2AEQH 3POCA 1QBML 3MUGB 4PB9L 3L7FA 2R0WL 4P5RA 2HN7A 3EO1A 2RACA 3WTUA 3ATFA 2C9PA 4U3SB 3QPXL 4TVPL 2G9HA 2PKDA 3RIFF 5HJ3B 3FTUA 3GRWA 3MJ8A 3GBNH 4I88A 1XB3A 1QBBA 1NMCB 3SY0B 4JY4B 2R0LL 5IG7A 2NUTB 2G3ZA 4OQTA 4P4KA 4RFOH 1PCXA 4G8FB 2YWYA 1GS6X 3ROLB 5IQ9A 4PJIE 1TTGA 1UB5B 2CLZA 3N0AA 1LL1A 3O9WB 4NNYB 4L8SB 1ADQA 5DGQA 3U2SA 3C6LC 3GMNA 2WBWB 2FQEA 1ROWA 1WFJA 3HBPA 3NCJL 3MBEA 1O9ZA 2ZOOA 2WQXA 1NCGA 4RCAA 4Y9GA 2JJWA 2VCOA 3MFFA 2GJ6A 4DKEH 1QEXA 3ES6A 3UZVA 1G1YA 4F5CA 2OA9A 1ULVA 4B50A 2WWMD 1IEHA 1WT5C 1VHPA 2IAMB 3OAZK 5B1JA 3HR6A 3KYNA 4LIQL 1FI8C 2EEXA 5TE7H 1J48A 2AEWA 2R69L 5L88L 3FZUC 4P2QE 3KJ6H 3ETBF 1C5BL 3L7EA 2DJSA 2FD6L 4DSYA 2W07A 3FQ1A 3FH8A 1VGEL 1C16A 2GQHA 4JGMA 4OFYA 4YGVB 5JHBA 2QL1A 4PJ5E 4HYTB 5D2NA 2ZOLA 3BSZL 2QEJA 5KAQG 2GHZA 1Q0XH 1MZZA 4GFXA 2N0MA 4LF3B 1JMZA 4YBHA 2LU7A 2R4SL 5K9JH 2R8SL 4LLYA 1FPTL 2BCKA 3DO7A 5JORB 4UILL 1ONQA 3V4PH 1QQDA 4HJJH 1U58B 3MOQA 4BQ6A 4YDVB 4YDKL 3OKEA 1FHNA 3QEHB 3NJIA 3X2QB 1T3FA 1T0MB 4KDTC 5D1QA 3ZN6A 3U4AA 3PREA 5I66A 2Z0BA 2H2PC 3II1A 1CICA 3O3AA 3TXAA 5IVXE 4U3XA 1BIIA 1XH3A 3QPKA 2DAVA 3QQNA 4ODXA 3B3BA 5CJXC 4OTXH 3RBGA 1DFBH 3QZOA 5GRVL 1L9MA 2CIIB 2DQHL 3X3GH 3O2VL 2A6KA 2J5LB 1FFPB 2Z0UA 3CFCL 1CFNB 12E8H 1EA9C 3IVKA 1TVBA 1NAML 2A99A 4Z3EA 3JZYA 3QDJA 4JAMB 3B9KD 2VUYA 2EDHA 5FUZL 4D0CB 1E9PA 2VZOA 4ELDA 1NDMA 4PR5A 3WLWC 5CLXA 1SFHA 1T7YA 5EOTA 5LCVL 3LKSA 5CP7A 1CWVA 3DRQA 2AJ3B 3MRGA 3HCVB 4JHWH 4MJID 1SLWA 4P46D 2XTSA 3OLEA 2UZXA 2DIAA 4DP7X 3V79C 5I1CH 3BP7A 5DD1H 2A5UA 4CSTA 3WTYA 4LVNB 3HE6C 2OR7A 1T89A 4B96A 9CGTA 1F90H 1FQ9C 5AW2B 3LX9A 1N4XH 1D5BA 4A68A 3QORA 5F88A 3WIFB 3GRWL 3OKDA 1CVSC 4BXSV 2F2HA 1AXSB 3BQVA 2KC0A 1X5LA 2Y1YA 3DETC 2GAZA 3O8XA 2NTFA 1Y07A 4DW2L 5HHVH 2NX5B 4H44C 1ZIAA 5CXPA 4HG4K 1A6WL 6CGTA 4HGWA 4TF4A 3BEVA 5F6IB 3EFFB 2OR9L 3GSXB 4OQTL 3PY9A 4OLEA 3N40P 4IRZH 3GMMB 4HCIA 3ILQD 5CBEB 5I71B 4OLUL 1N7MH 5CEZL 1BZ8A 1IU1A 1RZGB 1ADQL 2KL6A 2W65A 2WLKA 3B9DA 5IHWA 4XXDA 4OT1H 2PP8A 4GRLC 3BVNB 4R97C 4GRWB 4X4ME 3RPIA 3G5VB 1MREH 3NCFB 4WI0A 2WTOA 4WJKB 5CS7A 1BVNT 3RTQA 5FO9B 4NQEE 2F7PA 5F9AC 3QQDA 3TT1L 1CDUA 2OTWA 5EUOF 3HG2A 4PLKD 1DBAL 4U6TA 3U7AA 1UD6A 1XGPB 3LY6A 3DVNA 1PD6A 1CDJA 4TVSa 3MRRA 3V4VB 5F7WC 5B1KA 1MCQA 1YEJH 1R3KB 2Y5EA 4HSAC 1LE5B 4XI5D 3HHMA 5A6IA 2FIKB 1TJXA 5FGCE 3KPOB 1ZHLB 4JFVA 4RAHA 3LNIA 3L08A 3ILDA 2NXYB 3EADA 4G3YL 2R4RH 1E8ZA 2A3TA 4ZFOB 2X38A 4XTRD 2G3XA 5I1LB 2WQUA 3ZHDA 4LBAA 1ZY9A 4KO7A 2A9AA 1QG3A 4LCUA 3HC2A 1WD9A 3G6DL 4QXUH 2DI9A 1WAAE 2YEVB 5KVEH 2AAVA 3MRHA 2QZQA 2WKOA 3MCLH 4KHTL 3NSYA 4HF5H 5DD6B 2VN4A 3CFBA 2Z35A 5A6MA 1BJ8A 3C87A 3IF1B 1CQKA 3TNMB 2PPAA 2Z64C 3FFCB 3PYCA 1GRWA 3ZDZF 1S3KH 2Y1ZA 2XU9A 2LAAA 5CUSH 1DBML 5I0XA 3FUNA 4BQCA 2YD7A 1A9BA 3FQWA 1S5IH 4QT5A 4N8CH 3IU4L 1VADA 1DQTA 5DQJB 3JV0A 2BHZA 4OCMC 1QSED 3NN8B 4K3EL 5FM4A 4ORZC 4KX8A 1MRDH 1VFBA 5I1JH 2ATKB 3FSOA 3RGVD 4P2QA 2P5EB 3QRFM 2BNQA 1A1MB 1IGCL 5GGVY 3MRFA 4KAQL 3HAEH 3O2DH 4GW1B 5KZCB 3NDYE 1I75A 3D25B 4AQ8C 4YGAB 2JELH 3JZ7A 3Q1SH 1HDMA 3MHZA 4PWJA 4D0DA 3DBSA 4NO5A 3L3IA 2H1LM 1CPUA 1OY3B 5ETUA 4BZ2H 1SF5A 6TAAA 2YEQA 5ICXA 1QR4A 1JVKA 3BGMA 2ZYIA 3ATAA 2H45A 1MIEH 3U0PB 2ZUQB 1I1FA 1VZHA 3K46A 4A6YH 5BUGA 5B7MA 1TO4A 3FHEA 1IAKB 4XVJL 1PZ2A 1XIWB 1E4HA 1JGLH 5JHLH 4OCWH 1D5RA 3ZZLA 1AY1L 1HS6A 1OTTD 3QZWB 1IBYA 5DEFA 2IBBA 3G5XA 1BLNB 1DQDH 4LXFA 1IAMA 4Z7NE 3OL2A 5DQ9A 5IVXA 3BAKA 3RWEA 1KPVB 3A4FA 4GAYB 3IGAB 4J3OF 4G6FB 4L4TB 2ZCKL 3QUYB 4X6EB 1J88A 4M6NL 3K72B 5IB1A 3TPUA 3F83A 4TN9A 2A9ML 2X4PB 1K4DB 2Z93B 4QD2E 4M3HA 2IAAC 3MLUH 4POZC 1BEYL 2QV4A 4JPIB 3L8QA 2OMBA 1OAYH 3CHRA 5IEHA 1CDYA 4R83A 2A9NH 4N9OB 3C60C 3I50H 3VXPB 2BZCA 2XN9E 2XIBA 3SGJC 2X1PA 3B56A 3O41A 4KXBA 5DMKA 1G9NL 1BSIA 1ACXA 2X44D 3EW3B 3VNZA 2X5PA 5CEXA 3F65A 1HHHB 4LL9A 2F74B 4XAWL 1MEXH 3O3BA 1X6LA 3A6BL 2BIMA 2EYSA 3FOLB 4HD9A 3MLRH 5E5RB 1RLBA 3WIHH 3R1GH 3KGUA 3NIGE 1RZJH 1LWHA 2R15A 3GS7A 1Q94B 2VABB 4PRHB 3TA4D 4RIRA 4AVKA 4G8EB 4ZQTA 2BK8A 2FX9H 4KFZC 1K6QL 4MJHA 4J3BA 4NKMA 5E6RB 3TTYA 1JG9A 3GJFB 2BERA 3QHZL 5E1HB 1JPFA 1JZ3A 4TSCH 2A4CA 4X80L 4FYSA 5J13C 1P9MC 3V6FA 1FFNA 1ZA6A 5HGBA 3GS4A 2VXQH 4KWUA 3FQYA 1F5WA 1EEZB 3ZR5A 3HS9A 1WWBX 4MAYD 4DKDC 4PY7A 2F54E 5F9JA 5CM1A 4X4MA 4GBXA 1E4XH 2CJTA 1B2YA 1KJVA 4EI5B 4XPGL 4DPRA 2E7BA 3CFEB 4OCYH 1AFVH 3HMXH 4U1KB 4QY8B 2A6IB 5DC0A 3G5WA 5JQIB 1TUPA 1F3JB 3MMEB 1WWAX 2ED9A 2O6PA 4UNUA 1NMBL 1MHHB 4U0QB 2CPCA 3G08B 4Y5YB 4Y9FA 4PV8A 2KPNA 4RGND 1RIHH 4QR7A 4FNPA 4OZIB 4LKXB 1CFTB 1S3RA 3ASNB 4G1EA 4HV8B 4U1JA 5DFAA 1A3LL 1AIFB 5C1MB 3OXRB 1TNNA 2I7SA 2ZSVA 3CXHJ 1BVOA 4LZKA 4FQQB 1FNEA 4MDJB 1TQBB 2DLFH 5C6TL 1N19A 3F62A 3CK0L 4FQJL 4QRRA 4XN7A 5FCUL 5HYJA 4H8UA 1RZIB 1HE7A 4GW4A 1IL1A 1DDHA 3K6DA 2XFGB 5DQDL 3WO3B 4P4RA 4MQSB 1JWSA 5I1IL 2NY0C 5ESQB 4J4PC 3QW9A 4HCFA 1NCCL 4DQOL 4HHWA 5KJ4A 4GI6A 2EVHA 4TNWF 1NBVL 1XMWA 4WY7H 3DPBA 4CA4A 1NL0L 5FOBA 1WAAA 4Z7VA 1HSBB 1QWNA 5GZNA 4NQDE 3T2PA 1M2VB 1ED3B 2A4EA 2DQGH 4NQCA 2GBUA 4LQFL 5HYQA 3DC0A 4ZPVB 2FO8A 3MNWB 5SWSE 4TNGA 5LXGH 4FI6A 1MRFL 3DJTA 4NIYE 3VUAA 4JCWA 1NBCA 3ATEA 4NJAH 3UTTD 1IGYA 4HWUA 5BO1H 2WBJA 3T3MB 1PQZA 3VFMB 2OZ4H 1J9RA 4YNYB 5KSUA 2DOCA 1L7IL 1IT9L 4UQAA 4WEUD 2VR5A 1P4LA 1LO5A 3MRKB 4LDOB 3DRTA 4JJ5B 2XTJD 2EC9T 3DVFA 4KKPA 2HVJB 2JKLA 2C9UA 4HH9A 4DGIL 2F8IA 4XNYH 1YZZA 4X8CA 5HXMA 3AREC 1B4LA 1U3HB 3AGVA 2F53D 1YEDB 4D9LL 2BXZA 2JF1A 4KKLC 4BH7B 2ITDA 1MUJB 3WXVH 2XG4A 4NWUH 1KT2A 2AZAA 4RWYH 1UOKA 1S9YB 5JPMC 4PWGA 3TBVA 4PJ7E 4MB5A 3V0VA 4AEHL 4CRPA 4PS8A 1T80A 2NSXA 3LSOB 3U4EA 4C8XA 4DP0X 4E9XA 3EH4B 3QIWC 1DANU 1UD2A 4FEMA 4I0PD 1N70A 1PPIA 3V0FA 1ZLWK 2NNFA 3U9PL 2EDQA 2Z7ZA 1PLBA 5IIEA 4O4YL 3BGFB 4K94C 1JPST 1E0OB 3ZTDC 2DTML 5AVYB 4CMHC 1ORQB 4EIZC 2FATL 3N1QC 3UIYA 1KYUA 4P2AA 3QUZD 5C9KA 5T3ZE 4AEIL 4X5LA 2L8AA 1Z5HA 3RVTC 4AKOA 1E8XA 2YBGA 3EOBB 2E7CA 3FTGB 3H56A 1MVYA 4N2GA 4OH2A 1ZWIA 4AZ8B 4HJEA 3TBCA 2XVBA 3S96B 2HT3D 2H0FA 3CZKA 1QLRA 4JFDD 5HVGB 3HEIB 2MOVA 2HUEA 5ID0B 2OV0A 3ALXA 4JHAL 4P23A 2Z1KA 4WW2A 2OX5B 5E94A 4AENA 3S0PA 3CPLA 5E8EB 3ROOA 1FLTX 4M02A 2J8OA 3CC1A 3VA2C 4Z7AA 4OLVL 1F4XL 3KM1A 3OKKA 4ZFZB 2NY2B 2G2NA 4YR6B 4EZJA 1AQHA 2V2XB 2PYFB 1KLGA 2D3LA 3MNDA 1YEEL 1RIVH 2OYLA 3CSFA 2OBGA 3WY4A 5AB0A 4DVRL 4CNIB 2MJWA 3WN5A 2NW3A 2JKNA 4HLZH 5E6ZA 3FU6A 4M4RA 1TTFA 1FG2A 3TC9A 3I75B 1FSKC 4FKKA 5I6PA 1UC6A 2YD6A 4O2EB 2Q7NA 3EYUL 4OIFA 5CFAA 4JO4L 1VEOA 1HJBC 2BJML 4ZDHA 4CC4A 3QRGL 4GRWF 1KPRB 3TO4B 4JPQA 3WDJA 3RNKA 1R24B 4P9HC 4M7LH 2F54A 2FUQA 5IHUL 2XHNA 1INEL 4PYGA 2QQKH 3UTSE 2VXSH 5D70H 3ZY7A 1CG9A 3B6SA 3ZQWA 3LKPA 4LSUH 1MAMH 1DVFA 5TJWK 3ULVL 2Z34A 1FL3B 2OR8A 3S3PA 4NQXA 1KCUL 2ZAGA 5CN3A 5JXAL 3OHXA 3KS0H 4GAFB 1X5FA 3DYMA 1OM3L 1ZLVH 1B2WH 4C4BA 1NGPH 3TIDA 4RZCA 2DMHA 2Q0ZX 3F3HA 5F8QC 1RFDL 4JG1H 3D0AA 4DKFH 5IMLB 1PNCA 2WP3T 4TUKL 1E50A 5JR1H 3A67H 1R5VB 1HL8A 5D1XA 1CLZH 3RP1A 4W9IC 4JCMA 2YGQA 4R7DB 4XO3A 2KI6A 3AROA 4AVIA 3PP3H 3Q9PA 1DCEA 1ZS8A 3VH8B 5IBLD 3TZVD 4N0YH 3HG4A 3FO2B 1JK9A 3QUHA 2D2CC 2UWEB 2YD1A 4NAJA 4TNEA 5FDYA 4H0LC 4XBPB 4ZW7A 3KWUA 2VTFA 4XN8A 4NQDA 3D1MC 5HHOB 3CJJA 3G6JE 4JPVL 1PL3A 3X13A 1HHKA 2NY1C 2YMXH 4X4KA 4ODWB 3Q7JA 5BZWB 1PTZA 2DBLH 1ETJA 3BVUA 4S2SB 5GS1C 4ZZKA 1AO7D 3DMMA 1R19A 3QZMA 2IQ9L 4APQC 2JLPA 3QO0B 2A38A 1KY7A 4YHPB 4ZFFA 1AZBA 1JS4A 2XIIA 4JM4L 3WMQA 2JB6A 3GLEA 4Y7OC 5D7LE 1VKXB 3WLBA 1BBJB 2BSCA 2X4UB 4Y19E 4XBGB 1I8AA 3ISRA 1U36A 1AXTH 4S0SD 4GUOA 2X7LB 3DUUB 5D1ZA 3HZVB 4LBEB 2YAPA 2X4SA 1EEQA 1AHWB 4RFEA 4UQEA 1CR9L 4F8LA 3CFJB 1G6RA 2AXGB 2H3XC 2DV6A 5I0VA 1X9LA 4KDTA 5KW9L 4PJ7A 5FKPA 1KJ2B 4GO6B 1KXTA 1IQDB 4X6DA 4X6CB 1EGJA 5AZ2H 3TJEH 3RVUD 2Y69B 5K9OB 1PKQB 1S5HA 3DGDA 1E9QA 3QNXA 2DWDA 5DR5L 2MPAL 2VLJD 4UTAH 1GSKA 4UM9B 1UWFA 1EJOL 1CFVH 3BDYL 4YDIL 4WNQA 4JDVA 2YRZA 3P2DA 4QHKI 3IU3A 5KUMA 4NKDA 3VFWB 3RVXC 3UBGA 5L2KD 2QSVA 3TO2B 2WQ8A 1MQKL 4BDVA 1I8LC 1KYOK 1H19A 4I1RA 4E9RA 5DK3A 4UT9A 3AXLB 4H8HA 4AUUA 2NUPA 3P4OA 3QJVB 4MB3A 3FTXA 4LCCA 1FV1A 4OLYL 3T0EB 1L0YA 2P5PA 3RZWA 3LNDA 1O0VA 4JJHA 1S2EA 1WIUA 2DICA 1F4WH 2MEJB 3H1ZA 3VTAA 3W0WB 1W0YT 3QFJA 2P3YA 5DU7A 4G42B 4F9LA 5IJKA 1BVLA 4QAMB 3ERXA 3FBKA 1DL7H 4XVTL 5A40E 1MCIA 2QR0B 4PJAA 3MYZA 1R9FA 2RTTA 4FOMA 5CU5A 2J4WH 2XG5B 2XJLA 3PWLB 4LSRL 4LRNL 4Z7UB 4PJXB 2VDRB 4OZFB 5IOPB 2NQDA 1ETZB 3B2UC 5DZ9A 3MACL 3PWPB 4PRIE 3RX7A 3GK8L 4MSWA 5GRJL 1G7HB 1SLXA 4B27A 3OAUL 1LMKA 1A1NA 1ZTXE 5IHBA 4RX4D 2HXAA 4R2GB 1SRDA 2HT2D 3QO1A 4MNQE 2JIXB 1KCSL 1S7UB 4IRJD 4JY5L 4ILDA 4LCVA 4X2UA 4JFFD 4Q74A 4NZTL 3EJQA 2Y4SA 4RBPK 4F7CB 1UJ3B 4PD4K 3T0BA 3MNVA 1NICA 2PXYA 3P73A 4PJHE 5C7ZA 4XMTA 2X6AA 2XICA 32C2A 4FFYA 4AOFA 3FB8A 2GJJA 3CU7A 2V4LA 5E2VL 1DQVA 2AERT 4RGMC 3SODB 2GSIA 2NY3D 3T77A 3P9LA 1OB1B 3N85H 4MS6A 5AFAA 1DJZA 4N2NA 4OZIF 4P0DA 1TLKA 2DQFB 5KBLA 2XWTB 3BQUD 1MFAL 1GPOL 3QK0A 1OGTA 1JSYA 2J2ZA 4W81A 1BQRA 2HFFB 3DBXB 3EG9A 1I4FA 4FQPA 3G5YB 2BCMA 3TA3B 4LLVA 1WHOA 4GT7A 4KK5C 1NCAH 1NFDB 2AQQA 2VDLB 2YUVA 1TVDA 1RCYA 2VH5L 3UTZA 1GCFA 4TVUA 3OC8A 3JYCA 3O45A 4ZODA 3DX4A 4G9FD 5C0GB 1FVDA 5AW5B 1G6RL 5H4YA 4NPYA 3HVDA 3QJXA 3K80A 5DUPL 1OHZA 3ME0A 5DRNA 3GGWA 1MCCA 3IMTA 1LLAA 1AANA 2VW6A 1EGJL 4J23A 5DJCA 1I9JL 1UGNA 2HLAA 4JM2A 4MRCA 1SQMA 2EIKB 2K6YA 4Z8FH 1AI1L 1C08A 1EUUA 5LQBH 1TSRA 2BSSA 4GW5A 4XMZA 2X53A 3G6JA 4WO0A 4FNUA 3ZR6A 3D5OF 2K6ZA 5BXFA 3VXRB 1JGDB 2VDKL 3UJIL 5EEUA 3MJ9A 2J6EA 2ZOKA 1J1XH 1NAKL 1JNJA 3IETB 4AQ8A 2UVEA 1XD0A 2CRZA 4JBSA 5HGAA 1XCQA 3H0TB 2X70B 4PCYA 4ZNEE 1AE6H 1SQ2N 4UT9L 4QHLB 1CLYH 4Y19A 3CDGB 4MCYB 4AGQA 4OZHE 3ZLQC 1GMEA 4FYTA 3PL6C 3JTSA 5ECJE 2E47A 3ETSA 5ISZA 4PRPD 2A73A 1J8RA 4FXKA 4U1LA 2PWFA 5C0RL 3C9NB 4E41D 3X14A 1FVCA 2MWCA 1TTUA 3FFOA 2EYTA 1Q9OA 1CGXA 4JFQA 1EXUB 1IC0A 3FRUA 3DUSB 4LT7A 4MX7B 4MMYB 1IBDA 4N2HA 4U6YA 4NQSA 3SDDB 3CFUA 5AVZB 2VDPB 3R8BB 1I85A 1ZV9A 3BPLC 3BIBX 3KPRD 3QCVL 3DSNB 5E99L 3T4YA 4HIXL 4CSZA 3BISA 4JPKH 5JNYB 3HZYA 3GMOB 1O7DC 1VFAA 2WZPA 4JG5A 3SPVA 5CR1A 4QO1A 2YC1B 4UNIA 4XP6H 1XTLA 2QPEB 3ECWA 4G8GD 4A2EA 4MJ5B 1MW0A 4MVBC 1F58L 4JFYB 2X4QA 4XWGH 4PV9B 1JYNA 4WU7B 3Q3GB 1DEEB 4LP4A 5CZVH 4QUOA 4C57C 4E5XA 3R18A 2YKLH 1DVUA 3W5NA 4EXPX 4AV0A 2GJRA 1XF4A 1W9XA 3MLYH 5GS0C 1TYRA 3ZVVA 1MHPL 5LNGA 3WE1A 4EE2A 4OQ1A 2AJVL 3LN4B 5CN2A 4ZYKA 5JW4R 3MRJB 4XPFL 3WN6A 2X28A 4ZAKC 1PIGA 3PNRB 1SHWA 1BGXL 2CMRH 4WTQA 2AFNA 2D8KA 5KSAD 3IJYA 3VGHA 4GFTB 3UFIA 3QEQB 4BFEA 5IROA 4YXLH 1F8TL 4ADIA 4K9EH 4JJOA 2V7HB 1NGYA 3BFQG 4ZQKA 3ARGC 1WA0X 3FB5B 2P5WE 4FLSA 2Y0SA 3VXSD 4F24A 3C5ZA 1RXLA 5I18H 4B7IA 2VDMB 1N0XL 3VFNA 3WJLC 4N6RA 1AQDB 2WZ6A 4JDEA 3ARRA 1REIA 3JVGC 2AJZB 2WLJA 4F8OA 1JV2B 3ENEA 4OD2B 2FX7L 4LSQH 1ZDSA 5BUPA 3WY1A 1D2OA 3UZEC 3VYOA 1OGAE 4KUCF 4BCXA 4G6JH 5TTRA 4Z76A 4YX2L 2UZYB 3EJYC 4M1CD 4D8PB 4K2UL 2DH3A 3O6ML 4MNQA 3VWKD 1XBRA 4KBPA 4PB9H 3EH2A 2RCSL 1U4EA 2R0WH 1H6EA 4NQTA 4Z5RB 3V0HA 2E7HA 1P84K 3UC0L 4ZO8A 3EIFA 1H15A 3KYMA 2MQCA 2XA3A 2G3MA 2UZIH 3VSUA 5H8DA 3I84A 3RKDD 4KRPB 4QI3A 3FU9A 3VXQB 1KEGH 4KKBC 3L5IA 1D6VH 1PBYA 1NKGA 5GSVB 2DDQH 1CTNA 4FZ8H 1O75A 4Y16A 4PSRA 4A37A 3KLSA 1FCGA 4NQVA 2NNAA 1UKSA 4JDTL 3MJ9L 5C86A 2J6EL 4D9RE 3M1BB 5G5DB 5DJYB 3GSQA 5CILH 5FK9A 4X7SL 1A25A 5KJRL 3NCJH 2A6DB 2ZXGA 3L1OH 1RLWA 4UQ9A 3ZZSA 5C92A 3OMNB 3Q9QA 3GMPB 1HE8A 3HPLB 3UMTA 2R69H 3VGGA 1RUAH 3G04B 4H25A 3WKNA 7FABL 3CTTA 3PXHA 2UWEF 3QDGA 2MCMA 2ORBH 1IM9D 2NNXA 3L3HA 1S7RA 5JDSA 3K6IA 4L3EB 2R29A 3OMIB 2QFPA 3BFOA 5I1GH 3GO1L 2ADFL 2WLHA 5F72S 2OTUB 4XN9A 1CFSB 3Q43A 4QCIB 2P24B 4Y2DC 5T1LB 5IT2L 3RFZA 1NUDA 2EDKA 3IDNA 5BW7C 4IOIA 4PPTA 4Z6AT 1DN2A 4ADGA 3I9GH 4IIQB 4PP1C 4YXHL 1KFAH 2PW2A 4AI7A 1UADC 3GYRA 1U93B 2B5IB 4YHMH 2K9UA 1H6FA 1QLFA 4QOKD 1E2ZA 3BGAA 4ZX4A 2B4CH 3HIZA 2PWEA 4ZNEA 4M56A 3PV6A 1P69B 2OS7A 3VXMD 4KKRA 4UMSA 4POYA 5JPMA 4Z0XB 2ROXA 1A6VL 4IMLA 1F97A 4IRSC 3DIFA 3SDAA 3GBLA 1FYTD 2O5YH 5F9OL 1TYEB 2F5BH 3LRSA 3P4NB 5EC2B 5C0IA 1BPVA 1PZ5B 4L1DA 5KYYA 4KVCL 4X6CF 3TVMD 2QMKA 3NA4A 4K71C 2FAUA 5B1CA 4YZFF 2BLFA 4MCNA 1M42A 2CGYA 3HC0A 5C0ND 3OZ9L 3ABZA 1J8HB 2AVFA 3ARUA 3DV4B 4H5SA 2LABA 2DH2A 5FUZH 3D18A 5DWUL 3KXFB 1UCBL 4XPHL 4KO6A 1YG9A 2FIRT 1JV5B 1R5WA 3FN9A 3L2NA 3LEVH 4QRPE 2EUZA 5LCVH 3O6FA 4N2OA 1P7QB 3HKZA 3UCRA 3US0A 2Z31B 2FR4A 3IEAA 2O4EA 4OFIA 1JWUB 1K4CA 4PG9A 5DMIH 1RVFH 1AGCB 2GW5A 3HOGA 3UDWA 3BN3B 1X5GA 3B9AA 4ZUVB 2YRBA 3CZEA 4ZJ9A 4PJGB 4WO4A 2WIIA 4G9DB 4R0LA 4XBEH 3RWIB 5KVFH 4K3HA 2EDWA 1MFCH 3EH1A 1TZIB 3O3DA 4P5SA 4ZOEA 1S9KC 3B43A 4NKQB 2PPCA 5IF0A 5E8PA 4MNGB 3W39A 4KH9A 3VWJA 8FABA 2VXVL 3E1F1 5AG9A 4Z7UF 1TTBA 4RMUA 5D7IB 2BVEA 4PJXF 4P5TD 4Y5VC 3W3BA 4WI5A 4Z3JA 3WE6B 2XNAA 2B15A 3BPOC 4D0BA 2YR3A 4LNVA 2Z92B 4KVNH 3K4ZA 4MQXD 2SEBB 4AQ1A 2ZX5A 4F33B 2VB5A 2CJUH 2RA1A 3HNSL 3HI6L 4GG6E 3PQYE 4JFTA 5BS0E 2L7QA 3QRBA 2O5XL 3OQRA 4FA8A 3EYSL 4JFXA 3X3FL 1KCVH 3N1GC 3KYOA 3ZDXB 3GSNA 3ULUL 1BD2E 4XPBL 3FCTA 3KJ4C 1DBAH 4KPHL 2E4FA 5I76B 1M4KA 4ZUWA 2H6OA 1UZ6E 3ARDB 1EFQA 1TZAA 1H5BC 5AVXB 1FP5A 1UD5A 5HHXL 3RNQA 4CC0A 2WVTA 1C5CH 1MCPL 2FYYB 5DJZA 2R29L 5D5MB 3NA9L 2XY1A 3HUJB 1UM4H 1NDGB 4AVJA 4B9GA 2IADA 4G3YH 1A14H 3VQLA 1MCKA 3GMLA 2DKSA 5EU6B 3SCMC 1I7ZA 4UIKL 1T0OA 5F0PB 3TFKD 3W82A 4HKBA 5JTWA 5E5LA 1QYGL 5F1NA 5AOZA 3CSYA 3MLVH 5FDWB 1NAMB 3EBAA 1FJ1B 3NTCL 1R6VA 3GI8L 1NEPA 1J05B 2NY5C 2NY7L 4WI2A 4MMXB 4Y4HB 1EHLH 2JK5A 1HOCB 3MV8B 1G7IA 4JRFA 1HILA 1NFDF 5IJKC 1V7NL 3AS2A 3RZCD 1D9KD 3QI9D 5CZRA 4IGBA 4NEHB 4BK5C 1DBMH 4R96B 1FORH 4HUUA 3M8OH 2XQ0A 3CZGA 3IU4H 3PF2A 4GAAA 4DZBA 4XNMA 1MCJA 3WV0A 4OCXL 5LGKA 2EIZA 2PO6D 4K3EH 2RFXB 3AU0A 2UY7A 3MV01 2HN7B 4QGYA 1RUPL 2D9QB 1IGCH 1DSFL 3PFQA 2FEEL 2JJTA 5D8JL 3VGBA 4WTZA 5L4FA 3P2BA 3GBML 4AT6B 4H1LB 2JJSC 4PJCE 1U8IA 1NGZB 3D30A 3QHTC 2EEAA 4J1UA 4U0RB 4X9BA 4RAUB 3QXTA 1RAMA 2ZWNA 1S7WA 2IAND 2A74C 2WXOA 5KYWA 5E6SB 2IFFL 1NCNA 2YS4A 3EZ8A 5LB1A 5FYKH 5BRZE 4RRPG 1QNIA 1YECH 4XVJH 4M5YL 15C8L 1IIIA 1PS3A 2CKBH 5IB2B 1U3NA 1QI4A 5EU3A 3GTVA 5TQ0L 4K73A 4PJ9B 2A6JA 1Q9WB 3HRZB 2YSTA 4Q6KA 1BZEA 3T4AC 3CVHB 1N5AA 3MRMA 3HG5A 3KNBB 5F7FA 4GQRA 4JZNA 4JO2L 4L1TA 1N10A 4NP4H 2ZCKH 3NIDE 4M6NH 1OLLA 3GMQB 1Z5YD 3C8KA 4R7XA 3L7EB 1O5PA 3KL5A 2YEZA 4L5FE 2OMWA 2W07B 1J0HA 1O7DE 2B1AL 4ES9A 1IQWL 3GUFA 4OB5H 4N0UE 3I9AA 5I8CA 5D2NB 3UH8A 5D7JB 3I2CL 4HUXB 5F7DB 3S3CB 4J3WA 4M61A 3MRDA 4KO5A 3KPTA 1GZPB 1ORSB 5DD5L 1G9NH 4NJ9L 4QRPA 1DUYA 1KTDA 1WITA 4JR9H 4LLYB 5D7EA 2Z4TA 3GSNL 4O5LH 1IC7H 4P9ML 4C59B 3GZKA 1E67A 1QQDB 5CGMA 1J8KA 4HPYH 4S1SL 2DMCA 4FNRA 2EO9A 1VIWA 1BMWA 5EEVA 3IFLL 4QXWA 4XP4H 3Q44A 1EO7A 5HYFA 1NUFA 1A22B 2ERJB 3ELAT 5JIQA 1BIIB 3H4HA 5DJ0B 4WWKC 3QUXC 1L7TL 4M8VA 5I19H 4QHMA 3CLEH 2ADGA 4GMSH 5C09B 5E2TH 3MQIA 4GO9A 3KDMA 4UINL 4XOEA 4YSQA 1JHKH 2WGXA 1E42A 5E4EC 4M1DL 2YQGA 5HHQA 3MBED 4EDWL 1PAMA 5BMFL 2DL9A 2LTQC 4H8VA 3K0WA 2GJ6D 3QDJB 4ZZFA 4NRYA 4QRSB 3MI6A 3CFDB 4Y5XC 5AAPA 4JZOA 1Q9KA 1U8CA 4XPGH 1GGYA 3PQYA 4G6MH 5FC9A 3SKJL 1Z9MA 3AXIA 1BF2A 1ZIBA 1MXDA 3ARSA 5BS0A 5JO5A 2GPZA 3TT3L 2DD8H 2GUOB 3LKSB 3QISA 4X7EC 4OLWL 4FTVE 5HI5D 3KH4A 3SYAA 3TIEB 3P3TA 2YOCA 4OFYD 1QOKA 1CCZA 4KI5C 1A3RL 4NI3A 4ZW3A 3T0WA 2OXGB 4CVZA 3H2PA 1CVRA 3PWUB 3CK0H 2ZCLL 1IAOB 4NPKA 3FDWA 4WGKA 1E2WA 2QSTA 4OM0L 5EORH 4S10A 3U4KA 4B5EA 2WJ5A 4LARH 1NCCH 4FFTA 1MCSA 4Z7OF 1AHKA 2B1HL 2BP0A 4I9XA 4MJIB 1NBVH 4P46B 3NCYS 3A3YB 3Q8CA 4F8NA 2XVLA 4XXDB 5ABAA 3LJ3A 5D1QD 5GSRB 4LDLB 3FF7A 2O26U 2VZ3A 1X9UA 4LQFH 2UXVA 2VR8A 3LVTA 1WA2X 4O51B 5CJOL 2C9RA 2VMEA 4A7GA 3RTLA 4FC3E 1NGXB 2P48B 2Y2WA 3KCWA 5E70A 3X12A 4EF3A 3DWTA 5KVDE 1TXKA 2DM7A 2OMYA 3IDMB 4N22A 5I17A 2MCPH 3WSQH 1CYXA 1YYCA 1L7IH 5HJDA 3OMZA 3HI5L 5HYSA 3ILPB 1I7UA 4FCAA 4ODBD 1YMMB 4IBTA 5BUAA 1EZLA 2O6FA 4WI3A 3GIVB 3AMKA 3T6QC 4GPVA 1IAIL 4DGIH 1DLFL 2JVUA 3IDIB 3KEDA 1KV3A 3IMUA 5FYKD 1Q0YL 3DTXB 5HHPA 3T1FB 4TUOA 3WEBA 2JH2A 3PHQB 3ZUNC 4AEHH 2EH7H 4QJ3B 2AVGA 3BDXA 3LIZH 5BRZA 2CM6A 3KPPB 4Z0BL 1QA9B 2C3VA 5IJCC 3ZQXA 5CZXD 2C8NA 4O4YH 4AK2A 2AV7A 1F0LA 1QR1A 4PMFA 3INUL 3FB6A 3U83A 4CSPA 2IQAB 4DP1X 1URIA 4X7CC 1CT8A 1TENA 2ZG2A 3QZLA 3QQ3A 4DOHE 4U49A 3IJHB 3ECBA 3TWCL 5DSCA 2OZNA 5GHWL 4YOKA 5B1BB 3RE0A 3EJZC 5GRUH 3RGBA 1QSFB 3UEZA 5I75C 3HG1B 4EO5A 2VQ4A 4YDLB 1NUGA 4N0UA 2H3KA 2EACA 2WNGA 1HDMB 4NO5B 1Z3RA 4JHAH 3AG2B 5ADPH 1NIEA 2ZYHA 2BSRB 4YHYB 5ICXB 1U8MB 1BM7A 5EOCH 1MPAL 5DS8A 1BDYA 4GP5B 5G4MA 1QSEB 5LVEA 2X10A 1NM4A 4YSAA 2QSCL 4Z7QB 1JGVL 3RGVB 4AKQA 3DSFH 1G43A 4PJGF 4FHKA 4Q9CA 4E42A 4HOXA 1FN4A 3OR6B 3S4SA 2XWDA 3HC3H 4P2RA 2IH3A 4XZ4A 1QFWI 4DVRH 1TVHA 1E5YA 1LK2B 3H8NA 3LTVA 4GKZB 2C7UA 2V8LA 2VGLM 3ARGA 4U1NB 2C4FU 2EDMA 2X89D 3RY5A 3K5RA 1HSAA 5IFAL 1MSPA 1HXKA 4I5BA 1AP2B 3KD4A 4MD5A 4CAGA 4GAGH 5D7IF 4UT6H 4TPRH 2EILB 3GSUB 3BH8A 3WJLA 3WFZA 2F58L 4MS8C 2JI1A 4XC1L 1WH0A 3EYUH 3JVGA 2AJXH 1UENA 2QADD 4JO4H 1NCDH 3UZEA 2BJMH 1HNFA 1NEZG 3HZMA 5IEHB 3OHMB 1BYNA 1U30A 3MYJB 3R06A 4FNLH 4X8JB 3TYFA 4L05A 4JREC 3GFUA 2Q5BA 4PBDA 2OJ1A 3FN3A 3GMRB 3IJSA 4FN0A 1RP9A 2MCAA 4FGMA 3ZDXF 5L8LB 1G9ML 1AD0A 3CDYA 3AU1A 1INEH 2P7TB 5JHDE 4RNRB 2CQVA 5DMKB 3BUDA 1GY2A 1Y0LB 1P6AB 4EUPA 5AB1A 2LVCA 2RBLA 4P2QD 1M53A 1LE9B 3E7JA 4FXGA 4G1MA 4MAUH 2D4FA 3C2AL 4FTVA 1KCUH 4KTDH 3N04A 4YUEL 2EYSB 4GEIA 3U0WL 4AMWA 1X5HA 4PJ5D 3MGOA 2A7BA 5D5MF 3RX5A 1K5NB 3HUJF 1F41A 1BZDA 4YE4H 2PCFB 3QPQD 2B59B 4TUKH 4RIRB 2CO1A 1CK0L 1AIZA 4CVXB 3EBGA 4F1SA 2ZOWA 3C6SA 2DQCL 2BIOA 1RHFA 2NXZD 3EOTL 4TTDC 3L3GA 3X1NA 5CLWA 1CUOA 3T8XB 4PS4L 2NTSP 4P3DB 3T9WA 4X4YA 1CD1A 4FHJA 5D4QA 4MWFB 3D39E 4OCRL 2DL2A 5GGUA 3VXUE 5F9JB 4G71B 5MENA 4LESA 5DRZA 1KJVB 3O9WC 3TH3T 4YE0A 4Y4KA 2V0AA 1SM3H 3EO9L 5CN1A 5K39A 4XP5L 4MHHI 1NLBL 3MTXA 3Q1EA 4XHJD 3V0WH 2IQ9H 4KJPD 1OSEA 3NEXA 2CNYA 4QRQB 2CNZA 4G1EB 1UZ8A 3ABMB 1ZJAA 3GQFA 2HMIC 1OVZA 1TJHL 1DUZA 2IAMC 3W9DA 2WIMA 5BW7A 4MAYB 3VFTA 5HPMB 3TNNA 1W72H 1GKOA 3MVSA 2IBZY 4JFHE 2YHGA 3EF4A 5L4IA 3ZE2B 1FWXA 2B2XL 4M5TA 3UG5A 4KX7A 2OQJB 4H0HB 3VSQA 2BOCB 4WI9A 1R3HA 2V5RA 3D6GA 1GYUA 3GSWA 2H4EA 5IW3A 4AMXA 5E2WH 3TBSA 3HE7D 3UTQA 5KW9H 3EXLA 2BMKB 3SE3C 2GVYA 4YFDB 2D7TH 4J28A 4NM4L 2HTLC 5F1KC 3UPRB 2BP8A 2VKWA 4P07A 2GJZB 3DO3A 3KPQA 4NQCB 1UWEL 3ULSB 5HYQB 5IWLC 1TZHA 1FFQA 5F7EL 2MPAH 4OVVA 1A7RL 3OF6A 5ANMA 4JGUA 4AIOA 4PV1C 4PJFB 1EJOH 3MC0A 5JMRA 1LEGB 2V3DA 4U1IA 4UB0L 4XNDA 1G84A 1TJIH 1KOAA 3CFMA 4F7PB 3FN0H 5C0CA 3PJNA 1QZ1A 2YGNA 4YO0B 3S6CA 3ZDYB 5DRWA 1N0LA 4F58H 1ZLVK 1VF5C 2OP4L 3TF7C 3CH1A 1YNLH 4HFWB 5DJ2B 5DUBB 1NCWH 4UQCA 3ZZQA 3MR9B 3L95B 3AWFA 1NMAH 3EKCA 3FQNB 3HNVH 4HH9B 3RWHA 4B9JA 5F3BA 1DDTA 5JIIA 2LQRA 1MAKA 2VMCA 4NQED 2XX0A 3APNA 3F2LA 4LQ1A 2XG4B 1QASA 3V10A 3DO7B 3KG5A 4I7ZC 2X1XR 4NHCL 2EVGA 2UYLA 1NLDL 3HAEB 4ZMQA 4MXWH 2YXMA 4UQBA 1UUNA 1GTNA 3HNTH 3MACH 3GPEA 2WXRA 2XTJB 4LEXH 25C8H 4ZS7L 3GK8H 2C26A 4XTRC 5GRJH 1MCDA 1QUNB 3W11C 3OAUH 4N1EA 4OF3A 5JW5B 4Y5VA 3IM1A 3M86A 2QGDA 2DEXX 1X7QB 4GKNB 4PGDA 3OX8A 3V7AG 1KGCE 4LVNC 3BVVA 3TYGH 5I1DB 2WNWA 4HX1A 4FQXC 1KCSH 2OMVB 2F5AH 4N2AA 4JY5H 5JXEA 3PPSA 2D3JA 3SO3C 3CVIL 3H9SA 3HS8A 1EZVY 3CC5B 3O11B 4JMXA 5L9DH 2XWJB 4Z7WA 1ZHKB 4GP4B 3SQBB 1JZIA 3L4XA 3TFBA 3A23A 4KUZH 2R1YA 5F6IC 2CUHA 4WW2B 4ZOBA 5E94B 1J9SA 3NEEA 5E2VH 5J6HA 2WBJD 4YC2B 2WO4A 5E00B 4AXWB 4HKJB 1ML0A 3QUZB 1OTSD 4KI5E 4F7KA 4AUJA 1O9VA 2RALA 2XQYK 3J27A 4IEFB 3RA7H 2APBA 1P53A 1H5BA 5IBUG 1JUFA 3UP1A 3IGFA 4BWWA 1S6NA 3CUPB 4OV6F 5IVZB 5KVDL 1RULH 3ZSSA 4RSVA 3IPEA 3FONA 2W9DH 2MHAA 2B7DT 5CIPA 3NJVA 3TS8A 1EO8H 2VDQH 5F71A 1ZLEA 4XGZB 1JERA 3BC9A 3O4LE 2FJHB 3ZT7A 2NW3B 3VSVA 3UAJD 5DFTA 5SWQB 2P28B 5GISH 1K2DA 4NUGH 4CN6A 4V2CB 2XA8H 4XN4A 1G6RH 4S1RH 3FQRA 5DUPH 1P7KB 7TAAA 4BK8A 5B39G 3R4RA 2FEJA 1LEKB 1XGQB 1I7TB 1JZHA 3F6JA 1KG0A 1AI1H 1RUQL 3MCG1 3I6SA 1IC4L 2HFEA 2IGLA 4ODHL 1T03L 5IHHA 2OJEA 1GJWA 2YFNA 4KK8D 5T1KD 4FFZA 4GSXA 2VDKH 3B9VA 5I1HH 5DVMA 1LP9E 3KPLB 4NC1C 3B7UX 4LL1A 2FECI 3DOIA 2CO3A 3P02A 4P23D 1ZLDA 2N0KA 1I1YA 2CDFA 3UL4A 1VACA 1NPJA 3WY3A 5D1XB 4PW9A 5FA3B 1HZHL 2WAQA 5MEPB 3QDME 1U8JB 2XZCL 3QYCA 3V9FA 4Q2ZB 3D08A 1JPEA 1R3LB 4BE6A 4XPTL 4WGWB 3T4AA 1JK9B 1PY4A 5DGRA 2JKTM 4R26H 3TEUA 3RJOA 1RZPA 2VLRB 1CBVH 2YN3A 2I9LA 3L3JB 1I3UA 3WMSA 1WJ3A 3DJZA 1HKLL 4YHNA 4JNXA 2AJSL 2ZUQC 1IARB 5TE4L 3U2IA 4BHUA 5BVPH 3ZHNA 4E2OA 2BSTA 4KI1A 3E6FA 2F7RA 3PJLA 1EZSA 3K8KA 1GGBL 4N6QA 1ZGLB 1IC5H 2LAGB 5IQOA 1XR9A 1KIQA 3TZVB 2F54D 4PG2A 3LS4L 3BP4A 4A7QA 3MU3A 2M83A 5HDBF 4FFYH 2FJGA 4OGZA 5ALBL 2X4SB 4KNSA 1LTXA 4GAJL 2CHWA 3U0TA 1H0DB 1S7TA 1HHGB 5DZPA 4HP5A 5E08L 1XXFC 1IM3A 1ZT4B 4FMFA 4RGNC 1F8TH 1G7MA 1KY6A 3OAWA 4HHAA 3SYCA 4IS6A 2AXFB 4X6DB 4JPWH 5AAWC 4EEEA 1ZGLM 5FGRA 4N2KA 1YDPA 1N0XH 4WHYG 3PGDA 2H26B 2GK0A 3H6JA 3FU5A 4KKQA 5I74C 4WWKA 1SBSH 3QBTB 4AH2B 5H37A 2XWCA 4FLOA 4OJYA 4TSBH 4XMWA 3C6LD 1UACL 1ZK9A 5FF6B 4EBQL 5CINL 2CIKB 1OPGH 1U3ZA 4AVHA 4CDHA 3CDZA 3VG0H 3PFUA 1USZA 1ILSA 4ZG1A 3DXAA 3VMPA 3KLHC 3OR7A 4Y9EA 4XMPH 3BIKB 3FCUB 3IGLA 3CZUB 1BQHG 5LGHL 2A9DA 3VD0A 3PAUA 3P9MA 4NQDD 1TJMA 2R2EB 3FNKA 5M95B 2J25A 1KN4L 3UC0H 4D7PA 3FZUD 1N68A 5SWSD 1RU9L 3EYQC 1A7PL 1KCRL 3D3VE 1Q9LA 2Z7YA 1TETH 2LLLA 2VLJB 1GZQB 4HKXB 3IE9A 3QFJB 4S1QL 5LHDA 2D2OA 2KPWA 1S7SA 1UOWA 5DZOA 3ZGHA 4FLRA 3EJJX 4Y2OB 3QQ9D 4M03A 5A7BA 5TK2A 3HB3B 2AGJL 5L2KB 5CHNB 4JHVA 2YPLE 4YHKL 4P2CG 5L7XL 3FUMA 3MJ9H 3INOA 1IGTA 3IAQA 5EUOA 3KMDA 5KJRH 4XBMA 5D1ZD 4MSWB 2VIRA 4KU1A 1NC2D 2B3RA 4LNRA 4AIXA 4MTMA 4B5ZA 3S3JA 4XCEB 2A1WH 1HZKA 2NCMA 3DX9B 5SWZE 3GSOB 1T5XA 1BAFH 4XCYB 1IB5A 2B0SH 1I8MA 2DYPA 2C3GA 5E8NA 4ISVB 2PYEA 1AOHA 1RJLB 3TP4A 2H2PD 4M7LT 4LOEA 2Z4QA 2EINB 2HLEB 4U1MA 1OWWA 4DGUA 1YJDC 2Z1PA 3P73B 2CLRB 1BM3H 4R4FH 5EU4A 3E3QC 1XGTA 4N8VB 2DLIA 1HCZA 2ZG3A 2WXKA 3GO1H 2ADFH 1JZJA 4F7MA 1IGFL 1M3JA 5C07A 3AB0C 4DCQB 1DQIA 5TQ2L 4Q6YA 3MLPA 1KELH 1AACA 4NLHA 1ODAA 2R39A 4WF7A 2HT3C 4AV5A 3VI3F 4IRJB 4YXHH 4XODA 2OI9C 1OGTB 3PABA 3TH4T 2COVD 4JFFB 1CGUA 2K9FB 1MHEB 5C0JB 4W9HC 2WQVA 4ZUSB 1C1EL 3BWUF 1AKJA 2Z3FA 4JVUA 2VL4A 1NH6A 5FHAL 4PGEA 2A83B 1L9QA 1E43A 2WQAA 3D07A 3VXOB 5IB5B 2GKIA 2L04A 3HE6D 1AYOA 2X2UA 3QXAB 4XNZB 3LHPL 4LCYA 2VLLA 5HPOA 4OVUA 3TF4A 2IH9A 1T1ZA 3O4OC 6FABH 4M3JA 1BFVH 3DETD 4HS6B 3H9ZA 3V9EA 4WI7A 1U3HC 1FAIH 1GHFH 1N59B 3CQPA 2BVPA 2FSEB 5AZUA 3OZ9H 4JL2A 1OLZA 1SY6A 3BUPA 4PJFF 2ED7A 1N64H 1TZGH 2B14A 3ECQA 4RDBA 4WFHE 3GDBA 4EPSA 1UCBH 2UV3A 1UKTA 3GB7A 1YNTB 2K4AA 1UWGL 2ZXAA 2D0GA 2K3HA 4GRLD 3WJMB 4X0NA 4WEBL 1QHQA 2D31B 4NYLB 4ZRGA 4KKCC 1ZTXH 3V2AR 3QS2A 3BGFC 5SX4I 2OL3A 3ZDYF 3MLXL 2BC4B 5E6IC 4F91B 1C12A 2PXYD 2GYSA 3FT0A 3TBTB 4F7EB 4FQ2H 4DP6X 3X1GA 1CLVA 3C09C 2XYCA 3B3IA 1FO0A 4JLRA 1P6WA 3QNZB 3KZ8A 4ZNCD 4AMKL 1ZHBA 3TN0A 5BQ7A 3P0GB 3ZMNA 1PZCA 2QQNL 3UTSD 5BJTB 2DEYX 2CM5A 3WKMH 5J9PA 3VTTA 2NQ3A 1BXUA 4PAZA 2WD0A 3IJEB 5JLZA 4MLIA 2X4RB 3CFNA 4UQIM 3BW9B 1J87A 4Y4FA 4ZTOH 1EZUA 1F1AA 3GEFA 3UZVB 3NJLA 5C0DA 5I5RA 1S7QA 3WS3A 1IV8A 5FOJA 3WJJC 1A6TA 4L3CA 4OFDA 2CHDA 3ZTJH 1RZKL 3MRQB 4UBDC 1X9QA 3HNSH 2CJSA 3HI6H 2CDEA 4F57H 2C9SA 1LEIA 4QO1B 1AGBA 2AXWA 2X4OB 1ZA3A 5EEWA 3FCSB 4ONGL 4GUPB 4PRPB 2NYYC 2XX1A 3SE9H 2NX5E 4DK5A 3D69B 1B90A 4KPHH 2IBZX 5DXWA 3GI9L 4E5XB 5EFIA 2BSBA 1MJ8L 1XD1A 2ESVE 4JFEB 1F42A 4JM2D 5KBDA 2IV9A 4C4KT 5HYEA 1K3IA 3EGDB 3I6KB 4WDIA 3MV7A 4F2MB 4HA1A 3MNMA 4UTBA 4EMZA 3VRJA 3ZHLA 4ABWA 3D3VA 4G7YL 1CD9B 3IJYB 3VAEA 4P2YA 2JQAA 5KSBB 1UUSA 3D06A 4H8QA 4KJYA 1QYGH 3HR5B 5GRVK 2EH8L 2XV3A 1PG7L 3CDCA 4LEOB 3IS0X 1GAFL 4M9OA 3C5ZB 3C8HA 5D7LD 5J1TC 3VFNB 4L29A 4Y19D 3HHSB 1G94A 3MUGA 3Q01A 4JDEB 3RY6A 1XGRB 4BFBD 3AWEA 1SXBA 2IPUK 2PWGA 3V5HB 5ISZD 4U3SA 3L3OC 2Y1VA 3Q6GL 5HJ3A 1RD6A 3IDXH 1B3IA 2AK4B 5J3HC 1P5UB 5J1SC 2BIQA 3MCYA 2X09A 3QDHA 3SY0A 4JY4A 1CXEA 5SV3A 2NUTA 1UQSB 4ONFH 5CO1A 2OCFD 2QHRL 1DQJB 5GGTH 3CIAA 4G8FA 4WUKH 2J8UF 4AC4A 3VXSB 1WBXB 3AGWA 1UB5A 4JB9L 3TWYA 4NNYA 2ATPB 4L8SA 4FNTA 2XACC 3GBMH 3V8OA 4Z77B 3ARXA 1EHAA 3I9IA 2WZPD 1SY6L 1LILA 3FFCE 5CWSB 3SB3A 2Y1AA 4POZD 1T83C 5CD5C 4MZRA 2G0LA 4HS8L 1UT2A 4WK4B 1R3IH 1PZ3A 3NP3A 4PRAB 1UXLA 3NK3A 1IVTA 3FK3A 2DQ6A 3KGRA 4LSPL 3VWKB 2V7NB 2WXNA 3NYKA 4M5YH 15C8H 2W95A 3MFGB 5ELIA 4FYRA 2YPKB 4L23A 1MFVA 4L18A 2QGCA 4AQOA 4AW7A 5TQ0H 4F15B 2E27H 2WVVB 4A2HA 4W4OC 4YGVA 1EZVX 3B5TA 5EU7C 2V3EA 4HQQH 4FABH 5D6DC 2ZCZA 4UU9B 2A77L 4AQAB 4OBRA 3SE3A 3STZA 1GC1C 3VGFA 4LF3A 4QYAA 3IDGB 3SQRA<