5AAMC

Structure of a redesigned cross-reactive antibody to dengue virus with increased in vivo potency
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
95
structure length
95
Chain Sequence
TMCSGKFSIDKEMAETQHGTTVVKVKYEGAGAPCKVPIEIRDVNKEKVVGRIISSTPLAENTNSVTNIELEPPFGDSYIVIGVGNSALTLHWFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design of an Anti-Dengue Antibody Directed to a Non-Immunodominant Epitope.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords SCFV513
total genus 10
structure length 95
sequence length 95
chains with identical sequence J
ec nomenclature
pdb deposition date 2015-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5aamC00
1S6NA 2H0PA 2JQMA 3C6EA 3N40F 4BZ2A 4FFYA 3UZEC 1OANA 2R69A 2JV6A 5GZOA 4BZ1A 4UTCA 4GSXA 5KVDE 3UYPB 3UAJA 3G7TA 5LCVA 1OK8A 5JHLA 1URZA 5JHMA 3N41F 2R29A 5LBSA 4AM0Q 5AAMC 1RERA 1OKEA 1PJWA 1Z66A 1UZGA 2ALAA 3N43F 4FFZA 4UTAA 4UT6A 5IZ7A 5IREA 2V33A 2P5PA 3VTTA 3J2PA 2I69A 5KVGE 5LBVA 3N42F 1TG8A 5KVFE 4X42A 1SVBA 3UZVA 3N44F 4UT9A 5H37A 5B1CA 5GZNA 5AAWC 4GT0A 3MUUA 1Z3RA 3C5XA 3P54A 3UZQB 4UTBA 2HG0A 4ALAC 4L5FE 2JSFA 4AL8C 5KVEE 3IRCA 3J27A 4FG0A 2GG1A 3WE1A 1ZTXE
chains in the Genus database with same CATH superfamily
3FCSA 4LSDA 3K6DA 5E9DE 3RKDC 1Z6JT 1SOSA 3PPSA 2X12A 1KPVB 5I23A 2VDKB 3MGTA 3QRLA 4XI5C 3WN6A 4MCMA 4BKLA 3TURA 4NP4H 4NUMA 1PS3A 1KGJA 1XIWB 3SCMD 2PYFB 3QQ3B 5ACZB 5C7XL 2PCYA 1LLAA 2FUQA 2Y2TA 3W0WB 1YJDH 2HT3D 4JG1H 5I5JA 5DLMH 4HK0B 5J6SA 5BO0D 5EEZA 2DAVA 2XX0A 4LCYA 1MAMH 2WJ5A 5I1AA 4P2RB 2NNAB 1JV5B 5C0GA 1KPUB 4M1DL 4A67A 1S7RA 1BX2B 1A25A 3DUSA 1R75A 2OXGA 2UZXA 2V5SA 2VDKL 4JM2D 1HHKA 3IJ9A 3H3PL 5D70L 5TE7H 4U33A 2HKHH 3GO1H 1RFDL 5DHEA 1L0PA 3GD1C 2IFGA 4IKLA 4DK3A 2C3HA 3HE7D 2DQHL 3JZ7A 1O7DE 4QHKI 4J8QA 4K5OA 3SQBA 3EGSA 5LN4A 3BP6A 1GC1L 1OB1B 5AW8B 3U30B 1L7TL 3ZDZB 1JGDB 1YRKA 3ABZA 4NC2B 5JO5A 2KQMA 4OT1L 2N4IA 1RK0B 4HPYH 4QJ5B 2ATAA 1XHHA 4F7MA 2F68X 3UBFA 5T3XE 3OKKB 1HILA 4NZUL 4OD2B 3RDJA 5IMOB 4JUSA 1RK1A 5HI4D 3RZWA 1CK0L 4AYGA 4GSXA 3ULSB 1FP5A 3RWJA 2X9ZA 4JY4B 4Z77A 1DJWA 3ATFA 4MB1A 3P9WB 3C09B 5E70A 4HUWB 2XHNA 3GMNB 2BIPA 4FGMA 3I6GA 5E9NA 1NA8A 2FHBA 3VD4A 4YDIH 1J12A 3NJXA 5A3ID 4RIRA 1VADA 4FG6D 4HBCL 4JQVA 5EU7E 3TF4A 3GXTA 1ODAA 4O02H 3VWKD 2XV3A 4TKWA 2J1ZA 2N1TE 5TJWK 1REIA 2FJHB 3VXPA 1Q94B 5EDXA 2IWEA 1KTJA 3NIDE 4XZUB 1UCBL 5EBLA 2DQIL 4UOW1 4XPAL 2NQDA 3HBQA 1AQHA 3P2TA 4NQCE 3M8OH 2VL4A 4IK7A 4KMLB 1I1FB 4TLUA 4WFFD 3WFHA 4P2QD 5GZOA 5HI3C 2CHNA 4IRSB 3QIWA 3LN4A 1OM9A 3ZDYF 4JFSA 4FLHA 1J05B 2Z1PA 1I3VA 1QZ1A 3KLHD 1FNSL 4GKLA 4MKTA 1NGPH 3ZE0E 1A1NB 1VDGA 1KLUB 5BW7A 2AV1B 2P28B 3RX7A 5IUCA 4L05A 2VR4A 2EC8A 3F6JA 4UYPA 1KELL 3MV8B 3N40P 1UQSB 2JKLA 1G9ML 1BMZA 1UXSA 2ZZUT 3GRWL 4L4VE 2ZONA 2B9AA 3FOLB 3APNA 1QLRB 3A4FA 2VXQL 3CLEH 2YBGA 3VH8A 2WZPD 1G7PB 1ZLEA 1IVLA 3PWJA 2CNYA 4WO0A 3IMUA 1OZUA 3GS4A 5HTSA 4B9ZA 5ABAA 4Y8AA 2EH7H 1QKZL 4P5TB 2D7NA 5EU4A 1PZSA 1OARH 4M00A 2ARJB 4KKAC 4NXSA 4QXUL 4RA3A 3SJVE 4A7GA 1AC6A 1ADQL 3H1ZA 1KBBA 1UXWA 4JM2B 1D3CA 2PPAA 4TS6A 2NYYC 4JZJB 2ZXQA 3DBXA 1AMXA 2DYRB 3OZKA 5DWUH 1W8OA 4I3SL 2GJ6D 4KDTA 1KB9K 4P2QA 5DZLA 1YC7A 5E5MA 5AKRA 4GAAA 4ZXBC 1SDAB 4PJHE 2EDKA 4P3DA 3RIFF 3SQBB 4MZRA 4CC0A 5EIIA 2I69A 2J1XA 5JQ6H 4HIEB 5LWYH 4JZNB 1J9CT 3ULSA 4X6CB 4UIMA 2LTQB 1XD1A 3DHUA 1XGTB 4K3DL 4FXGC 1L5GA 1CLCA 1FGVL 1KIUA 1XAKA 3MRLA 4Y4KB 3L9YA 2VDPH 5FK9B 3K81A 1QSEB 1I9EA 4GLRI 4PIBA 5JIDA 5KSBB 2G2NA 3V5KB 5CFAA 1HH9B 1PIFA 4IYKA 1MXDA 2VR6A 1NLDH 3RKPA 3UJIL 1KG0B 1ZHBB 4E9SA 3VQLA 4JAMA 3O3UN 3HAEB 4MCZB 4XOCA 3ROLA 3QUYA 1YPZE 3MREB 1DBMH 2AI0H 4JM2C 5A2LH 4AYID 4OCYH 3T6QC 2BNRB 3D2UD 4RFEB 2B39A 3BWUC 5AL0A 1MJUH 1XIWA 3KJ6H 1A2YB 3L3OA 3K72B 2YA1A 5LQBL 5FYKD 3C6EA 4JAMB 1TEFA 1XSKA 1BVZA 4LSPL 4N68A 1UM4L 4U0QB 5I15H 3UTQA 1Q4NX 3ZU8A 1AG6A 2WAHA 1IB5A 2ZUWA 4HEPG 4F92B 4H8HA 3A6BH 2AV7A 4EBQL 3NSXA 2WXQA 1DANU 1YEWA 3QHZL 1QSED 1OM3L 3TO4D 1YEEL 4JGUA 3DVFA 3ETBF 3R4RA 5E8OB 4GT0A 1TZGL 5KVDE 3MQIA 4GMTL 3QK0A 1L9QA 5AWNH 1XGZA 2XKSA 4M9OA 5JA9A 4QD2E 1WAPA 3HZMA 3SPVB 4NNYA 5SWQB 4PRHA 1YN6A 2VLKD 3RGVD 2CLVB 2BX5A 3OHXB 1HTYA 1AQKH 4IBLT 1T1ZA 2IDUA 2Y3NA 4JRFA 4OF8A 4UQCA 4OZIF 3KPQB 4P2OA 4N2NA 1AGFA 1BQLL 1OVZA 1IKFL 2EYTB 2WW8A 5EEYA 4PVBA 5KBDA 1BZ9B 2J73A 4TPRL 5GGSY 3IDMB 3VFNB 1PZCA 4PJAB 3UTSB 4XXDA 4XNQB 2ZUVA 3SPJA 2RFXA 4Z0BH 3P73A 1OZTG 3SY0B 5T1KA 1NL0H 1NCOA 3ET9F 1X5LA 3V0WH 1LXMA 5E1IA 4MJ2A 5GHWH 3RWHA 1IQDB 1SDDA 5EC2A 4LLMA 4EZLA 1TJGL 1SJMA 3MLYL 1JGUH 5FM5O 4F33A 2VT0A 5D7SH 3O2VL 2WOBA 4UNIA 4YQXH 4LSUL 3ME0A 2RACA 4OUUB 25C8L 5EN2A 1IGIH 4X6EA 1CTMA 1BZEA 4JHAH 1S78D 4DO4A 4GKZB 3P0YH 1MXGA 1G43A 3AROA 3M88A 1INDH 1L9NA 4KUZH 1J05A 4DGVH 4ISVB 2ZXCA 4OVUA 3SKNB 3CC1A 2VLJB 3GSUA 4HBQA 2WYZA 5JOEA 1V27A 4LHUA 5DJXB 5I6NA 5CO1A 3WUWA 5F7HA 4D8PB 1DQKA 4BFIB 1XGPA 4A38A 5J6HB 3EYFA 3NEEA 3ARDC 1ZT7A 2YKLL 3QCVL 1OW0C 2J6EL 4X9IA 1ZA6B 1I31A 4AQEA 4HEPA 4HWEH 3DVNB 1OGAE 3HS0C 4KMTL 2VISA 1CURA 1TLKA 4JPKL 5DJZB 4G43A 4DUXA 3KGSA 1UUNA 1N18A 1YQVH 4LRNH 3VXTB 5BXFB 3LIZH 8CGTA 5EDSA 3ECUA 4MHHI 1K2DB 2BOBA 1Q0YH 4GRWE 3GKWH 1BYPA 2IGFH 2H1PL 3G6JF 4XBPB 3OB0K 3F3HA 3DBSA 5AZEL 5ITFB 4F7MB 4HG4J 4XCNA 1KPRB 1UGKA 5A2IH 4OCWL 4JB9H 1OAQH 5LXGH 4UINH 4GOSA 5K1JA 3UPRA 2BWIA 2G9HA 2GIXA 2X10A 3QXAA 2QLYA 1MF2H 4G83A 4MYWB 3SYAA 3MJ8B 5CEYB 1JZGA 3CFEA 3LB6C 1QKZH 1ZT1A 1IFHL 1N4XL 3QUMA 4P2RD 2IDQA 4FXTA 4YVNA 5HDOA 1PF3A 1XGQB 4FHBD 4ZS7H 1KULA 4RFNB 4Z76A 1JMZA 1R24A 3CAFA 1DQMH 2BVUA 4Y16C 3K5RA 1J0IA 4HJGA 1UZ6F 2W91A 1CGUA 4HT1L 3EGDB 4JKWA 3SD2A 4C59B 1GSKA 1GH7A 4PREB 1T22B 5F97E 5KBMA 3BRDA 3WHXA 4ODSH 4ZD3H 5CMAB 5JR1L 1CU4H 5GIRB 3NIDB 4OCNC 3MLWH 2FZ3A 1F3DJ 5MEPA 4J4PD 5GGRB 3FQ4A 3Q7JA 2IV9A 3FKUS 4B50A 1PEWA 2AXJA 4C55A 1E4WH 3FB6A 4AJVA 1ND0A 1UXMA 1UZ6E 4FQQA 1AOHA 5BRZA 4FC3E 1KDJA 2VO5A 4MNQD 1G6RL 2ZOWA 4N9OB 3UPAA 4WTZG 4LLUB 4D0CA 1EHXA 5EU5A 3DTXB 2A5UA 3GMPA 3FCSB 2CKNA 2EEFA 2RQ8A 2YGQA 1KG0A 2XNAA 3ECBB 5EU6A 4YOKA 4NKMA 3D52A 2ZJSH 1IX2A 3MRHA 2A7BA 1QQDA 5GRWA 1KYOJ 4ALAC 1SHXA 1AZVA 1BEYL 5ADPL 1F90H 2CJ3A 4K7PY 3L3HA 4XCNB 4HGMA 4IRZA 1FZOA 5C07D 2V2XA 4DVRH 4G1MB 4EZKA 2IH3A 3PAYA 4PP1C 2IPTL 5EHFA 4I77L 2XZCH 5IWLA 4JPWH 2OMWA 2IMMA 2GQHA 3KVQA 2FVNA 3SKOA 1YAIA 3MLYH 2P48B 4YSPA 1XGUA 2A83B 1J5OL 3VDCA 5J06A 1PFOA 1PLGH 3C2SA 4BCZA 2JKJA 4NUQA 3QZLA 4DN3L 1MAKA 3AT0A 1AGBA 2EEBA 4J3WA 4LLVA 4M5YL 4NT6A 3DVNA 1UCTA 4UT7L 2OMNA 4L5FE 5IEKB 3D0AA 4MQSB 1U8HA 1UA3A 1A6ZB 1XZ0B 3HFML 3OLDA 2HA1A 1S6NA 3BP5A 4U1NB 4ZBJA 5JXEA 5KAQF 4GRWB 4ZPTB 2NW3B 3WNNA 3CFIC 4MD4A 2I9LA 5LB1A 4AGQA 1RJZB 2XZAH 3UJTH 3S35X 2PR4H 1HAWA 4Y9BA 1JPEA 4KZCA 1AO7D 3CBRA 5SV4A 1OF2B 4X7DC 1WTGT 2ZX6A 4OW6A 2CMRL 2IPTH 3OKOA 2H6PB 4PJIB 5F1NA 3VJ6B 1U8KA 3QSKB 4JKPH 4XO5A 3I6LE 3KL5A 2FLRT 5FKAB 2Z35A 1E67A 4X7SH 5K9QI 4GO6B 4ZW8A 4RAVB 1XGYL 4CGTA 1WK0A 4OJCA 1IAMA 4AEHL 4JM4H 2DQEH 4PJEE 1XR9B 2ZF9A 5CIPB 4JB9L 3B2VL 3DRTA 4RBPH 4AJYV 3BC9A 3VA6A 2FATL 4YHML 4R3SB 4TL4A 5IFJA 2YLKA 3GMLB 4GKSB 1CDUA 3JYCA 1YEFL 3T0EB 3TA3C 2LT9A 1MW3A 2JELH 5HHQA 3BYYA 3LZQA 3Q1SH 1W72B 3QS2A 3HAEG 2WXHA 4H88L 1ETZB 3PWNB 1RIUH 5E08H 4G2AA 25C8H 3S5LA 4KMTH 3PXHA 3L3IA 2B1HL 4HJ1A 5A7BA 2VDLH 2ROXA 4PRBA 1QFWH 2VLKE 5IVXB 2WVTA 1CI5A 4MA7L 1Q0YL 1CTOA 4BXSV 3REVB 2AEQH 2CDGA 4KFMA 4GRLB 1F3JB 2OL3H 4LQFL 5MP6H 2VDPB 2WMPA 4CSSA 1DE4A 4L4VA 4BH7A 2FH8A 3WMQA 2FWOB 2DMGA 3DMMD 1QVOA 4MDJA 4DGWC 3KM2A 5I5RA 5FV1L 4AM0Q 4XO9A 3BGAA 2BC4A 1UD2A 4QRQB 1J1XL 5D1QA 3QI9A 4MJ5B 1A1OA 3IBEA 2EUXA 4MS8D 1P7QB 1HXYA 3MLRH 1KFAL 5FX3A 3ULVH 4Z7UF 1X5GA 4KY1H 2XG4A 3N1PC 3TN0C 3KDMA 2IGFL 2RR3A 2IBZY 4FFWC 5TFSH 2WO4A 3KYOA 1A2YA 1CE1L 1WC7B 4ZTPL 4JFTA 4PJGB 3VWJB 5DRWA 4EE2A 5CCJA 1IGTB 3QUXA 2D4FA 1BFOA 1P69B 3WKYA 4UQ9A 2X0UA 4YPGA 1EJOH 2OXGB 3V9EA 3OPZL 5DJYA 2J8OA 3PJLA 2B1AH 4WJG3 4WW2C 3QQDB 4EUPG 3DJZA 1C1EH 4QRUB 2PTUA 3WHXB 5IFHH 3FRPA 5I24A 1YNTF 1SJVA 2YZ1A 1A6UH 5EEXA 5GZOD 2WNKA 3KPMA 3MV7A 2WO2B 3H9SE 4KKBD 1HVXA 5AW6B 1C7TA 1JXJA 4LEOB 4Z7OF 3FN3A 5EZJB 1E50A 1OALA 2Z7ZA 1H8OA 1T03H 3IMBA 2I85A 3I02A 4A04A 4ZAKA 3LKQB 1FBIL 1EUTA 1ANUA 5GS0L 2FEEI 5EV7A 5EB9A 5CINL 5E9DB 4FAAB 4NQSB 3CFJB 1AOZA 5HHPB 1FVDA 2FR4A 3DX3A 3F7VB 1E4XI 5F9WC 2EZ0C 4NUPA 4NZJA 3VMPA 1BZOA 1QSFE 5F21B 5B7MA 3OPZH 3UAJD 1KEGL 2Q3AA 2DY2A 1NFIB 4WEUD 3U4EB 3I84A 2VDPL 4FFYH 2ERJC 2LAGB 4KRPB 1BXAA 1XMEB 2EXYD 5DR5H 4UI2A 1G9MC 1U2HA 2ZKMX 1YY8B 4N2DA 5DK3A 1YEDB 4V33A 3HJEA 1HFUA 3GINA 1A1MA 2QELA 3CCHA 4JMNA 1IAIM 2AJZB 2VB5A 4XPBL 4AIZA 1DBML 2FH6A 4CMHB 2EDJA 2Z4QA 1JK8B 1UB6A 4I3SH 3V4VB 5HJGA 3SGEI 4F37K 2R27A 4R5TA 1BD2E 2VM9A 3SPGA 2QQQA 3QQXA 4OFIA 1BLNA 1XCQA 3CIQA 1UD6A 2XVLA 3FCBA 4U3SA 5IQ9A 4A6YH 5HHOB 2IMNA 1DQVA 2XKNB 4RNRA 5IHZA 4OV5A 3F12B 5LGKA 5KOVC 4BKTC 2YGVA 3IFNH 4K3DH 4XR8C 5BRQA 3BZ4B 4W68A 3S4SG 3BYTA 1GTFA 4DO5A 2Z8RA 1KC5H 3HG3A 2HSIA 4AIOA 3DJTA 3S96B 2HLFC 4OD3L 1MVFA 1PG7X 3FO0H 2UY7B 4Q89A 3PABA 3NSDA 1U3ZA 3S35H 4Q9CA 3AM8C 1SF3A 4MKMA 4ELMA 1LE9B 4JHWL 3NQIA 4RAUA 1JNNH 4QAWA 1SY6L 1WC7A 1JNJA 4XN2A 3ULVF 5FUOL 3WNJA 1J0JA 2VITA 1ETB1 5FW7A 3BE1H 4KTEL 5HGHB 3GLEA 2KZKA 4I18C 3HB3B 3E1ZA 3ML8A 3CXFA 4Q4EA 1WZLA 3A47A 4LVHB 3VXQB 2PXYC 2EUVA 2R69L 4QCIA 4DEUA 4EXKA 4GAJL 3RWJB 4QF1A 3FT0A 1JG9A 2N1KA 3VWJC 1VFMA 3QUKA 2ORBH 4KX9A 3T4AC 1SBBA 4JM4L 5F9JB 1PAZA 3JTTA 3RWCA 2C9RA 2WQWA 3W9DA 2OI9C 2WXGA 3C2AL 2CDFB 2P8PA 3SE3A 5D8JL 1R3HA 3QWOB 5EIQA 4Z3HA 2BWDA 2R51A 4XPFL 1J0KA 5T3ZE 5B8CC 3WO3B 3VW3L 4MS8C 4CADA 1PZ2A 3REWB 2A9MH 5I8OH 4PU2A 2XWDA 1J86A 2XACC 5HVHC 1EVTC 4C4UA 5B7EA 3L7FB 1FL5A 4Y4KC 3BZDA 3UG4A 5C0ND 4M6NL 2O6CA 1CGSH 3UYPB 3WEMA 5T5FL 1EV2E 3C6LA 2A74A 4QRPD 2B3RA 2UZXB 3IJHA 1AQ8A 5F3BB 2AXWA 3ASNB 1DFXA 4NM4L 4X6CF 3AB0C 3MRDB 4OKVA 2F54B 3DC0A 4DP9X 5BNXD 2A9NH 4R5XA 4N8VG 4HIJA 4EZMA 4L1TA 4O51A 3B43A 3K2IA 3VYNA 5DJYB 2G5BB 4Y19B 2QHLA 5J6GB 4JZJC 5T3XH 3NZ8B 2YN5A 4A66A 3ARDB 3F2LA 2BY2A 1NQBA 3PREA 5D2NC 4L8BA 1AAJA 2VWEC 3TNMB 1MI5E 1I9IH 4WSGA 3FSVA 1JL8A 3OJDB 5F2FA 2EABA 2ZNWA 4J1UA 3M8OL 1A6TA 1AZBA 3CUPB 1AGCB 3HZVB 3QULB 2YOAA 5D70H 3KCPB 1H6EA 2WTRB 5BUAA 2AAVA 2EDNA 1SHWA 4NPKA 2VR7A 4ABUA 4NQVB 5I6OA 1MY5A 2ZYIA 4K9EC 5F6HJ 3P3SA 1QI4A 1NMCC 4Z7WF 1VFUA 2LVCA 1JYNA 1DBJL 3BH8B 4D9QE 1O7VA 2EYRA 2CWRA 2O5NA 1H8SA 2GITA 2W59A 4G42B 4BFEA 4OZGF 1NGWB 5DQDH 4BJLA 4M1GL 1FNEA 4NI3A 4QXWA 5LCVH 4N2AA 1GOFA 3TBSB 3LRKA 2EXWC 4M7LH 1AR1D 2NXYD 1UA7A 1AH1A 3ARGD 4ODXB 4K3HA 4QHUA 5I1JL 1CT8A 3GMRB 3FF8A 1K4DA 4JLRA 3F7LA 4JDEB 2ADJA 5TE7L 4R26H 2CDEA 2PW2A 3J8F7 4MSWA 4NC1C 4U7MA 2ZUSA 4W4NA 4IRSC 4TQIA 5T1LA 3IJ7A 4MNGB 3FN0L 4L8SC 5HHMB 2Z34A 1BQHA 3GSNB 5DR5L 2IANE 5LAPA 3FULA 1MELA 4ONHA 4LRIA 2OBGA 1PPIA 2A9NL 5CEXA 4S1DC 2EYRB 1U91B 4G42A 3P77B 1RJCA 5ALBL 2Z7UA 4MMXC 1JGEB 1IAKA 1DCLA 2JKIS 4FFZA 5IHBA 3VFTB 2WXOA 5C2UB 5J1TC 4GSUA 3P2BA 4KRMB 2J4WH 3HI5H 2F7RA 2P26A 3MRHB 1VCAA 4LCWE 2E6JA 1KCUH 1AZUA 2QSQA 1IM3B 1ZLVK 4J6RH 3NACL 3AG2B 2YAEA 1KZQA 2M2DA 5DJ6A 4JREB 1EIBA 1QR1A 1KXQA 2VJ8A 2GK2A 2VQ1B 3MNWA 3RFRA 2G60L 4M3KB 2EVGA 1GMEA 3FFCA 4PVMA 3IS0X 4LLDB 4TNWF 3H2WA 1WQVT 2XY2A 2HFEA 3IETA 3IPBA 2G5BA 1KENL 2V4LA 4N6QA 3LEVL 4BGDA 1KJ2B 3EGXA 2BPBA 4KUCF 4OF5A 1B6UA 3ZDZF 4HIJB 3GMOB 3BSZA 4JQIA 4NQEE 5EOCH 3ASWA 4AQOA 1YO4A 4YE4H 4YVUA 2GC4C 2JJSA 3SDAC 3K4ZA 3S3CB 1WBZA 1MLBA 4TMPA 4Y4HD 3C6SA 5HGDA 4Z76B 3IFOB 2XI9A 4JS7A 4NM4H 4P2AA 4DKTA 3BVNA 1MRCL 2XWXA 4OLUL 4R83A 1KCKA 2XQBH 4U1LA 3D07A 3UGXA 2IH8A 1TU2A 1AO7E 4L8SA 5HPMA 1R47A 1L0YA 3I6GB 1U8OA 2WLMA 2BW4A 4XPGH 5E95B 4B9IA 4DQAA 1FRGL 4L8CA 3FYIB 4KKCD 2OLDA 2AF2A 1LO5A 4XI5D 5GRUH 4PV8B 2K3TA 1FVCA 4DETA 3DNKA 1L4IA 4LPCA 2V9UA 2DBLL 3A23A 2H8PB 3B9KA 4NS0A 1G4RA 1KBVA 1MFEL 4JDVB 4UNVA 5F3FA 4CC4C 2IADA 1Z2KA 3NMEA 1MI5A 4XOEA 4NUJA 3FC8A 2VLJD 3GZPA 3P0GB 4G8EA 4X6BA 1HX0A 1YMHA 3GJFB 3T65A 5IVZB 4DP6X 3AG3B 1PZ5A 2AABH 1G1CA 1U8JB 2J21A 3QXUA 2Y7QB 4UOJA 4B3VA 4BZ1L 2P8MA 3S8GB 3TTYA 1UH2A 4IBWA 1ZOXA 1LTXA 4I2XA 3Q05A 2IALA 4WW2B 5AG9A 5IHUH 2AXGB 3RPKA 3VFVA 4ZYKB 3T4AB 1SNRA 2BP0A 4OAWA 4X9YA 5D1ZC 4F5CE 5D5ME 2HVJA 3EXJA 1G9NH 1J0YA 4A2MA 2LU3A 4TPRH 5JNYB 2R0KL 3EHBD 5LXVA 5J11B 4ZNCD 4ZAKD 5ESQB 2ZP9A 4GT7A 3GMOA 2CKBA 1T0PB 3NJHA 5IKCA 1KB9J 2EVFA 3NAAH 3HS0B 4LAQL 4RCAA 4APQD 5GGVH 2J25A 4XMPH 2F74A 1N5YL 2M1KA 4MXQD 4N2CA 5KS9E 2QKSA 5CEZH 3TF7C 4AL8H 2J2ZB 4NENB 3IPEA 3VE0A 1EXGA 4K8RH 1OM3H 3WTYA 3IMTA 1Z5HA 4HFUH 1XB8A 5CAYB 5IB1A 1SXAA 1VJSA 4QRSA 4PJBE 1G7MB 5IR1B 1IJ9A 2IPUG 1Q0EA 4GPVA 5DO2C 1ZS8B 1MWAB 2NY1B 4QHPA 3ZDXB 1PY0A 2DM7A 2NW2B 2OJEB 3H4HA 1GGYA 5ITFA 3WJMB 3D87B 1K5WA 2GJPA 4TRPL 3TO4B 4HC1H 4QHNB 3L13A 2F8VA 3BMVA 3U0TB 1LDPL 1EUUA 3FUJA 4DKFH 4GG6F 3MAWA 2H3XC 5I6LA 2M26A 3TIDA 4XOBA 3S36H 1WIOA 4JPSA 5GGTL 1TQCB 5SWSB 3RFZC 3NCXA 5FC9A 3BPLC 2PABA 1QO3B 1QHPA 4YSSA 3U1SH 2NUPB 2R9HD 4ODUA 1CPUA 4MYPA 3CVHB 1S7XB 3FTGB 3SHSA 3QPXL 3V6OC 4P4KA 4TTDC 4W9DC 4MA7H 1QRNA 1RERA 4N6RA 3O2WH 1LEIB 5T3XD 1GS7A 1KBKA 3Q2LA 3BCFA 1BD2A 1J5DA 4HJTA 1JZ2A 5ESVB 3HHMA 4H88H 2GT9B 1DQQB 1U8MA 4HC1L 2V0AA 3RAJL 1UFUA 3CQFA 4KH2A 1IGML 1XB3A 2H26B 4HMDA 2VXVL 2AJYL 1II4E 4UM9A 4OLUH 3H55A 1FA4A 3NIFB 4ZFQA 1QFWM 2D0GA 4HGWB 4K9JA 5FF6A 1PYWB 2R29L 2H2SC 3R06B 4L1HA 2NYYD 1A7BA 1MW1A 3T4AA 4ZYKA 4PD4J 1D9KD 3SCMC 2AC0A 3KDMB 1QRKA 3AQYA 2CK2A 2Q76B 5EO0A 2P44B 4UQDA 2NXZB 4AVIA 2HVKB 4H1LA 1EFXA 4AGNA 1BBDL 1IJNA 1DN0B 3ATDA 5DEGB 5KSUA 3IEAA 3PWVB 5F7BA 3T77A 4PJAA 3CHSA 4MJ5A 3ULUE 3QYMA 4B3EA 4DP4X 4IOFC 1BSIA 1SRDA 4WWKA 5CZVH 3S4SA 4WI3A 1VHPA 5D1ZB 5DMKA 1MHHB 1XL6A 2XSKA 3IAPA 3QRFM 2WTPA 2YRPA 2EH8H 3BI9X 5JOFA 3PF2A 2YD6A 2LVEA 1WAAA 2QPSA 4HUCA 3OAWA 2BP8B 4Z7VA 1QTSA 1G9NC 1KELH 5TDNA 4B96A 1F4YL 1ONQB 5IOKA 1DEDA 1I7UA 2JKSA 5IV2A 1RSFA 3IMVA 5HPMB 5IW1B 3UC0H 1F4XH 3TS8A 1LYQA 1U2CA 1JZJA 5ERWB 3ARSA 3QORC 5BMFL 3C08L 2X6MA 4F2ME 5FB8A 1R19A 1JWSB 4LPWA 3MRQA 1FIGL 1SM3H 3LZFH 1KV3A 4N0UB 1ET8A 3H3KA 5I0VA 2Y23A 4FP8H 5FHAL 4ZMYA 2DI7A 5HD8C 5HDRA 1TDQA 1L6ZA 2CNZA 3Q9QA 4FL4B 4RRPG 1SBSH 1WJ3A 4WO4C 4LCIH 5GRUL 1K4CA 3I6KB 3W39B 4FNPA 4FTDA 2Y7OA 1GW0A 4FQXB 3POHA 5FYLE 4XE5B 4GG8A 4GKOA 4M8VA 4OCSH 5CLZA 3ZDXF 2CO3A 3PWPB 4OUOA 2X4OB 3RTQC 3ZKXC 2HFGH 5D93B 1AKJA 2NX5A 4FTVA 1B9KA 1C16A 5BRZD 3EOTH 4Y4HA 1NCWH 4JKLA 4DUVA 3P11L 1Q9WA 3VQ2C 4PBXA 4CKVX 2G2PA 1E5YA 5IB3B 4YL4A 1CF8L 4ZXBB 6CGTA 3LKOB 4JDZA 1WP6A 2HJLA 4JUTA 4HHAA 3NABH 3WD5L 4NCC2 1OOAA 2L3BA 4XN7A 2BY3A 2X4NA 1U3HC 2H0PA 3QIWB 3SODB 4KXAA 5DI8A 5EO9B 3FRPG 3ZHNA 5KW9L 1W9XA 4UIMB 5IQ9B 4XBGA 5L4IA 1CI3M 3PUUA 4M4RB 1SUJA 4JANB 4E9VA 2IPKB 2FX9H 5LBSA 4HIPA 3IT8D 2IDFA 1JNHB 2IOOA 1R33A 4OJFL 3MFFA 2Q2EB 3CN0A 5AAMA 1FNGA 2RMNA 3KG5A 4PHXA 3HC0B 2YQBA 5AOLA 5E6IA 1INQB 3CZUB 1JK9B 2MNJB 3OB0H 4GXVL 4ZUTB 3FPXA 3MOQA 1ZSDB 2LLGA 2Q8AH 2W5PA 2NR6C 5E9AA 2R2BB 2YPVL 1WWWX 3BFOA 4CRPA 2GW5A 4IKIA 4JPVH 3F7KA 4NN5B 2B7DT 2PF6A 2DB8A 3GMQA 4GW1B 4NO2A 3S5YA 3PV7A 3UXFA 1GC1C 4W9LC 3O9WD 3PHOB 3V6ZB 4WGVB 1E6OL 1DQJA 2NT0A 1JGVL 5EBWB 1RVFH 2MCPH 4UDTB 5I2IB 4IDJH 4I7ZC 1U58B 5IIEB 5KVDL 4JY6B 5D96C 2XXFA 1Z9SB 4LFHG 5DA0B 5AYUH 2YK1L 4NO0A 3SN6N 4Q9QH 3IJEA 1AHWB 1NMAL 2JWYA 2KC0A 4UU9B 3G9AB 4Q58C 3IDUA 1VFBA 2Y22A 3D18B 3GMMA 1C16B 1UJTA 3IAQA 4YPJA 1YVLA 4OFVA 1M71B 5BZWA 5I1JH 4FQHB 4OFDA 3BSHA 4Z7OE 3KVPA 4BUQA 1GKEA 5KYXB 2EE3A 1MNUH 4GAFB 4CVXA 5HYSB 4FQCL 2Y69B 4ZUWB 3L6FB 1E90A 3EDKA 5C86A 3IM1A 5L2KE 1UEMA 3JVGA 1AXIB 1H5BC 4XE0A 1RURH 3ZTDC 1WT5A 1H3TA 3IU4L 3HNTH 3LS5H 4JFZH 4AGOA 1IGFH 3KNBA 3WHE1 4KVCH 4P23C 1A02N 1J9SA 1WHOA 4HHGA 3DX9B 1XCXA 4A7SA 5F6IC 3RUGF 3QEQA 4FABH 2O6EA 4L3ED 3TP4A 3VXRB 2YXFA 4KI5E 2AJXL 1UD5A 4TN9A 4DK5A 4NBYB 4HIIA 3NPSB 1I9RH 4W6WB 1D5IL 1OSEA 4FLOA 3TZVB 2GKIA 2YXWA 4YZWA 4WNSA 2VC2B 4M7KL 4NKDB 3F5WA 1A4JA 3D85A 4FFZL 4MNHA 5ANME 4AGMA 4NO2B 4HUWA 4YBQC 3D0LA 5IMMB 4Z77B 2QADD 4JR9H 1X6NA 1O5PA 5I6PA 4J3OG 2WVUA 2FBOJ 1INDL 2JSFA 2X89D 2YMXH 3N1MC 4Y1TA 3RB5A 4YE0A 3PWPE 2YGPA 3WNOA 1MHHA 3ZQWA 2DQ6A 5KTEL 2ENQA 3KGRA 3BW9B 2PCFB 5TGBA 1BPLB 2JK5A 1KN2H 3VXOB 4GQ9L 2CRMA 4YHPB 2DQDL 1CXEA 5GRVK 1THAA 1G7LA 4KY1L 2NY6C 1KTCA 4Z0XB 2IWFA 4ZDHB 4POZD 2C3VB 4AYSA 1PG7H 1MJ8H 4B7LA 4HMEA 3GT6A 4B53A 2CHXA 3RGVA 1MJJA 1UB5B 2O93L 2R59A 2A74C 3RGVC 4YZFE 4ADGA 5JPNB 5DVNA 3G08A 2WBJB 4IJTA 2R1WA 3NJFA 2E74C 2QSVA 3DUHA 2WXMA 2D73A 1DBKL 1GJUA 2EDBA 3TEXA 1IC1A 3KLLA 2IVFC 3BUTA 3ARED 4Q0XH 4UTBL 4RH4A 4JJ5A 4EBQH 2D7PA 4P23A 1CLYL 1ZDSA 2BVOB 3QS3A 2FBRA 5L8LB 3RGHA 2YZ8A 3S7GA 4AGLA 1THCA 1BXXA 1TVHB 1A47A 1QTPA 2YS4A 5E8PB 3GF8A 4GBXB 1C12B 1E0OB 3CMGA 3ZT6A 3CSYB 3SDCB 1RJLA 3CXDL 2Z7YA 2ENJA 2ZD0A 3VXUB 3WFBL 3HZYB 3PV6B 4ZUVA 5I15L 4KJPD 4KY2A 5C0RL 1UTDA 1AD0B 4FXGB 4E9XA 43CAA 1LO0L 3WLWD 43C9B 4JHAL 3ALPA 4KPHL 3RNQA 2GBUA 5J4MA 5FYLH 3VI4F 3QUZC 5IQOA 4BQ9A 5CN3A 1KEGH 3S2AA 4XXWC 5PAZA 3QHFL 4BBWA 3PNWB 2FSDA 3HC3L 3GDBA 4NRZB 4TVPE 4A2DA 5HHNB 3RWDA 1KCVL 4EZJA 1E7UA 1JZ8A 4P5KB 4X4ME 2VXSH 5IW1A 4GAGH 1U8NB 2CBPA 1YEKL 4MB4A 1YLBB 3FQTB 4HKBA 4KO7A 2NY2B 2JKRM 2K78A 4EQ3A 2FWSA 3HG4A 5EF3A 2DEXX 4JKNA 4E36A 4BQBA 2VR3A 1NWPA 2YIHA 4X8JA 5D7KD 5DRNA 4YXHH 2GTQA 4K07A 3OAUH 4ONFH 3HC0A 3QDJD 2K6YA 3RZCB 5KVDH 2X4UA 1A3ZA 4QOKA 3BKJH 5BVJB 2BSCA 3GSQA 5FPIA 2F7OA 4AEEA 3WIHA 2H32A 2MPAH 3A4DA 1CK0H 1FFPB 4KQ3H 1W2KT 1DVUA 2AJSL 2WPGA 4CUCA 1BQ5A 5T1DL 2OTUB 1ET7A 3CZNA 3HR6A 3WMPA 3INOA 5IEHB 4LF3A 4DZ8B 3V0IA 4E9YA 1JXKA 4PS4L 4X4XA 1AQDA 5CGYD 3LCYA 4F91B 1QQDB 5A16A 3AMLA 2VL5A 1T7ZA 1MHCA 3ZQ9A 4OZHE 2JH2A 5DJ0A 2Y6SD 4JGJA 3FBQA 3NJJA 2DEWX 5FYKH 43C9A 3DXAB 3BXNA 5GRJH 3U48A 1A6TB 4IHBA 3IDYC 1JHKL 3ZLQC 3CLEL 4PY7B 2ZUXA 2WQAA 3OWRA 1E6OH 3Q8FA 2VDKH 2OM5A 4KPHH 4GG8B 3U9PL 2O6FA 3IRPX 4AE1A 4Y16D 3MBEA 4U1GC 4IBTA 4PD4K 4FNLL 3AU0A 1CD8A 3NPZB 5ACLA 1J10A 4KVCL 1GGUA 1IGFL 3NTCL 4QXUH 3H7LA 4B6ZA 5CD5C 2IJ0C 1LEIA 2QKIB 1F86A 4NQDA 3MV7D 5D71L 2GY7B 1FZJB 3CZEA 1KGWA 2HLEB 3HI1B 1MCPL 3QNXB 4R4NC 1RZJC 3FQYA 4C56D 1S7XA 3CZFA 1DJIA 1XCTB 2PR9A 4APXB 3O6MH 4L37A 1RPUA 1IFRA 4F3FB 4HAKA 4JRXE 4ZMTA 1Z32X 4KK9D 4X7SL 5D7JD 1T0MB 3KPTA 3BWAA 3FF7A 3ZYZA 4HUVB 4J7RA 4POZC 4Y2OA 4ZMVA 5E2VH 3SGKA 1HHIB 1R5VB 3QH3A 5AVRB 1NGXA 1FYTE 4EUPA 2VLRB 1JZ7A 3QAZC 5CP7B 3QCTH 4XN5A 4HALA 2PO6C 1KXHA 1K6QH 3QZOA 3W9EB 4PTTB 2P8PB 4IIQB 4JG0H 2B9BA 5IHLB 3RVUC 1IKNC 3V4PL 1BQUA 3EYVB 3TH3T 3ZE1F 3E38A 1IO4C 1UENA 1SGKA 3TASA 1J1OH 1H8LA 4QRSB 4Y4FD 5DUJA 3RG1C 4GRWH 1M7IA 4D94A 2C7UB 2YD1A 2B08A 2F5BH 3OJVC 4S0HA 1EHNA 2Q6WB 4FULA 4R3SA 5F0PB 1WYJA 1X5JA 3HZKB 4JY5H 4IGBA 3I50L 5GGQL 2F5AH 2F7PA 1S4IA 4H5SA 2ZOKB 5IB4A 2H3KA 2Q3XA 3IGKA 2OYKA 1ECZA 1Y0LA 4TLTA 5CHNB 3MA7B 3GM8A 2GC7C 2CO4A 4L4TB 3IDNB 1C8PA 2F54D 3VX0A 2FL5B 1JMXA 4NQDB 2V7HB 5DEZA 5BMFH 1CFQB 4TUUA 1FAIH 2VLMD 2CJUL 5IB2A 1UASA 2AGJH 3FQUB 4MD5A 1NCDH 1Y0LB 1B0RA 2HPTA 1R0AH 5DEFA 4CN4A 2HTLC 1OF2A 4O9HH 5E9DD 5FGSA 3EO9H 2WGXA 5DLLA 3UAJC 1ET5A 1LP9A 2R4SH 3CMOL 3DKHA 3ESVF 1IIIA 1F11A 1FNSH 5E6ID 5H8DA 4BKSC 2OYLA 5IJDC 3BO8A 5FEBA 4JX0A 2WQRA 3FH7A 5DUPH 2ZUQB 1AFVH 1JGLL 4OGYH 5FHBH 4RETB 4ZMPA 3LHAA 4K23L 2NZ9D 4YHIB 2BXYA 1JPTH 2HFTA 4KZ0A 4HWZB 2BP3A 1VEOA 6PAZA 5C0FA 2R0WL 2HTKC 1M7DA 2WXFA 2XXMB 3KL0A 4P49A 4JFDE 3EJUA 2A9ML 1YEDA 4GG6E 3B7RL 1E5CA 1HQ4B 3WE1A 2YJQA 1M53A 3TBSA 3CXHK 2NOYA 2X4RA 1ID2A 1U8OB 1UD3A 3EYQC 1QR4A 4LPVA 4OZIE 3SPCA 5JUEL 3EOTL 1IIKA 3D06A 1AGDB 2H32B 5IVNA 1SM3L 3LZFL 1T0NB 4O2CA 3JQOB 4NCC1 1JDAA 3BKCL 3ESPA 1PQZA 4APXA 1EVUA 2NSQA 12E8H 5ALCL 3X2QB 4LVNC 3J07A 4PRNB 2E6QA 4YDKL 2Z92A 1GTNA 3LXUX 4HUUA 3BGMB 2R15A 2X4TB 3FCTB 3QIBA 2ITEA 4X6FB 1WPCA 1NKOA 4GY4A 4JKKA 4AKPA 1MVUB 2B8OT 5LO7A 4KAQL 1TVHA 3I9IA 5E8PA 5CGMA 3GSWA 3G5ZB 1OP5H 4JE0A 4CJ0A 2X9WA 1R3LA 4RSVA 4BE5A 4Y89A 1P1VA 2VLKB 2VLRE 3CVIH 3HHRB 3RNQB 3AADB 1QI3A 1RZIA 3P9MB 4AYMC 1MFAL 5D1XD 5D7IB 3VFSB 4IBVA 3NJIA 3QJXA 1ASQA 2VC2H 1JWUB 3QJFA 1J5CA 3GHEL 1JGLH 2OL3B 4GB9A 5E00B 4R8WL 4JG1L 5C08B 4J23A 1A3LH 5D7JC 4G9FD 5AZEH 4ODVL 4UDTA 4C4BA 1UM5H 1IZJA 2G4EA 4K8RC 1VEPA 2B0SL 2NY1C 5I0XA 4P9HL 5LGHL 2W94A 2O1AA 1WIUA 2E27L 4MA1C 1OSPL 5KSBA 4Y4KD 4H1LH 3S48A 4E5XG 1E8XA 2KS0A 3DV4A 3RNKB 4AWJC 2B59A 4GP4B 3UTTA 1HH6A 2R2EB 3G6DL 5CUSH 3SPHA 5HYIA 3VI3E 3MLZL 5ERWA 5L2KA 2BNQA 4QCIB 1S9VB 5F7DA 2DIEA 1ZWIA 4MHHG 4Y1AE 4Y19E 2CPUA 3FMGH 3JV5A 2HRGA 5G5DB 3VWKB 5A6MA 3NZSA 4I3RL 4KO5A 3QDGD 4PAZA 3RY6A 1ONQA 3SKMB 2EO7A 3EAKA 4WENB 4PMFA 3B5GA 2XXCB 2LV4A 4JFQA 4PJ7E 4TM9A 3NCYP 5ID1B 2CXGA 3OMNB 2XJLA 3MA9H 4UT9A 1XT5A 2EIJB 1DO5A 3LKOA 4JDZB 3KD4A 3N91A 5GS3A 3M46A 1LEGA 1LWJA 1S8DA 5KG9B 3BH4A 1YMMD 1R17A 4XMLL 5F0JB 4L3EE 1WVZA 2DJUA 2G4GA 3ZDZE 3B2DC 2VLME 1OP9A 2NYZA 4TRPH 2WNWA 3MLVL 1CJYA 3RU8H 1T4WA 4I18B 1NOFA 5ICUA 5GGRY 4IW4C 5I0ZA 2AJVL 1IUZA 2A6DB 4GKNB 4KKQA 4CVUA 2HFEB 2HTLD 1RHHA 3Q6GL 1A6UL 1KN2L 3CZLA 2VDNB 4BSWB 4BXVA 4AMKH 5DD5H 2HRHA 5JPMA 4U3SB 5I66B 5H37A 5B1CA 1SHSA 3ERXA 2AKRB 2J1KA 3BXNB 2Y7NA 3MDJA 3U0WL 2OZNA 3MV8A 1JK8A 1UB6B 3ARGC 3QCVH 3V4VA 1C5CH 5F3BA 3NSCA 4BQ6A 3LNHA 4HG4K 5IJVB 5DHXB 5CBEA 5HHME 2WQVA 2C1OB 2HTKD 1A6VH 1H3GA 3UEQA 4LHUD 1VF5C 2RFXB 1A4AA 3BSZH 3L7FA 4JQIH 4PH8A 4BCXA 3RGVB 4XPTL 2BVYA 1JYVA 3KXFA 3MLVH 4CSTA 1QBLL 1NGXB 3FHEA 1OGTB 3GXIA 5DYOA 3O6LH 1KF9B 2OKMA 2UZIL 3NIDF 4ZO6A 4ZFOA 3L3GA 3HNTL 4JFZL 5CF3A 3UOAB 3QZWG 4W9GC 4M48H 2J8UB 4HKZA 1NCAH 4L3FA 4M02A 2Z0UA 3D3VD 4FKKA 1CGXA 2VLRD 2DWSA 2AEWA 2TSAA 5AOJA 3F7QA 4NQSA 3I85A 4FKEA 1GR7A 3QP3A 4G8FB 5IJBC 1MNUL 4C56A 1IBGL 3MMEB 2YKKA 4XAKE 1UM6L 3AREB 2VDMH 3CD4A 5B22A 5FYLL 1L9MA 3BD5A 2HB0A 3O4LA 1F3RB 1MZYA 3U2JA 4POYA 1V3KA 4JRWA 1TQWA 3B6SB 3MUY1 1MNNA 2XBDA 4UOQA 1M7DB 2ITFA 1CYGA 1JWMB 3MV7B 3R06A 5B3JF 3L7EA 3FU6A 3BGFC 2WIIA 3GSNH 2FEJA 1AJ7L 2AQSA 3WAJA 4M56A 3W82A 1BVKA 1MIMH 1CLYH 3G5VB 4LB8A 4NKOB 3G6JB 4QXGL 2W9DH 4YL9A 5DWUL 4XNYH 5D6CB 4HK3N 2VLKA 2XQYK 4M29A 2WP3O 4G8GD 3CN3A 2ZWKA 4GUCA 1OCWH 4ZMLA 4HD9A 1AIZA 2CD0A 5C8JB 1IC7L 1AO7B 5IESH 3CGTA 1MVUA 3MKKA 3RI5K 5JORB 2HJLB 3B5TA 3LYRA 1MFAH 3SJVB 3SSGA 5ID0B 1TFHA 1VEMA 4HPOL 2E9BA 2Q86B 1FH5H 1NCNA 2HCZX 2IAMA 2ZCLH 2F6AA 1FDLH 3BVTA 2F54A 4P0DA 5D2LA 3TEUA 3TYFA 5CR1A 2FCBA 4Y9GA 3TA4D 4HD5A 5KJRL 3DHPA 3G08B 3L1OL 1UWXK 1Q90A 1Z66A 3DRQB 1N5AB 1BQSA 3TYGL 4PVLA 3DTUB 3UO1H 2BSSB 3EZJB 4LLYB 5C9JA 3BVDB 3TIDB 1U95B 4MA8L 5FWQA 4NBZB 3KMDA 2X4RB 4XZ4A 3KLDA 4D2NA 4NFBA 3DOIA 4M5YH 4O2FA 4OFYD 2CGRH 4GSDH 5K9QG 4MVBC 2AQRA 3AQXA 2BCKA 2FEEL 1TCMA 4WW1A 4AMKL 2W8CA 1QZNA 4PGEA 4I89A 2XFGB 1UWEH 2I9TB 5KN5A 2XWTB 4PJFA 4LNVA 3QUKB 2P46B 4IM8A 1IAIH 1MCOH 5KVMC 4PJ7A 4PJAF 3BAWA 4P06A 7FABH 5AVZB 1EZVX 3EJYD 4ODWA 5HHVL 3QGVA 4U1LB 4BUGA 2P9RA 1I1RA 1NGPL 3WCYA 4OCRL 2YD3A 5JYLA 3CN2A 4HHAB 4JNXA 3LHPL 1I8AA 1KCBA 3HS0A 3VWKC 4P23B 3PWNA 4H7VA 2H0JA 3RRQA 4QXVA 1QAWA 2JI2A 2V7HA 2FWLB 1F4XL 1A4BA 1RZIB 4C58B 3JWNG 1OCRB 4N2BA 4NWTL 2QSTA 3N9GL 4JG9A 5H2BA 2JQAA 4U05A 3ZL1A 1MN4A 5AB9A 4XVSL 3PDDA 2FX7H 5EO1B 1L9OA 4GMSL 4WSJA 1I3GL 3OPUA 3DGGB 4P46C 5T1LD 1JUFB 5IBLC 1JXGA 4QWWD 4WK4B 4AQAB 3CSBA 4F2FA 4PJBA 1RU9L 1T2XA 3QXTA 5K1NA 4TUJB 1KJ2H 5F7MC 5F7WC 1HE8A 4PG2A 2ZSVA 2BFVL 2Y7MA 1D5IH 2QPUA 3PJSB 4U49A 3AT8A 4Z7IA 2A6JB 4I18A 3NBNA 3D39D 4G9FE 4Y2NA 1A6ZA 1XZ0A 2KDYA 2YEVB 1TETH 1IM3A 4AJWA 1YMHB 3T65B 3UO8B 4RDQF 3CQPA 3N43F 1MHCB 5I1EH 2Z9TA 2F5AL 2ZIDA 4DKAA 4MMYA 1M9WA 3COOA 1RUKL 3UZVA 3EFFB 2OSWA 4U6YA 5FM5M 3P9LA 2WBJD 3A67L 4DZ8A 1RURL 4TTDD 4LCUB 5A6IA 3GXMA 2AK1H 1JDDA 1XGUB 3DIFB 3CQQA 3EO1A 4FNLH 2E7LC 4HJJH 4K7FB 3VUAA 2AJUL 4P59L 5EU7C 4J2QA 2E76C 1MAJA 4J3UA 1I7RA 4H0HB 3K74B 4G1MA 4ENED 1TUPA 4N2FA 3WG7B 3DARA 4P4KB 1A9VA 4U3CA 1WUNT 1I1YB 4L3EA 2EDLA 4DP1X 2QT6A 1VFAB 4KROD 1P1ZB 3LIZL 1J9TA 5IR1A 4UB0L 5FS5A 3IRCA 4XVTH 3LKNB 1NMAH 4LLUA 4JPKH 4RAHA 4D0CB 1D7CA 3HAEH 2J88H 4AMXA 4FQJL 1YEIH 5MERA 2IC2A 3NJVA 4F57L 2W07B 4JFDA 3T1FB 1MIML 4GUQA 2CZNA 1O0VA 4M5SA 3RVVD 4XCFH 2DKSA 3DETD 4WKXA 1SYSB 1WD9A 3MLXL 1M2OA 3H6JA 3DX0A 4OT1H 3KCPA 2R2HA 5AOIA 1O6TA 2Q10A 3NVQA 4W9KC 4BD4A 3FQXB 3P2DA 4I87A 2WWNA 3BZ5A 1SYVA 1HT6A 1IAIL 4MLIA 1JZ4A 3UIYA 1X5KA 1MJ7L 3HE7A 4GBXA 5D1ZD 4Z7UE 3MV9A 1E8ZA 3CFBB 1BD2B 4NOFA 2C34A 3EHBC 4AC2A 2ZCLL 1IEAB 5C0AA 4AIEA 5B8CA 1TMCB 1T21A 3GI9H 4L48A 4M8RA 2EC9T 3BEWB 5DJ2B 5T3XL 2DYPB 4JO1H 4S1RH 5JMRA 2MKLC 4UANA 2HPOA 4FOMA 2B4CC 1ESOA 2PW2B 4MSWB 5IW6B 4RFNC 3FQ2A 4R2GC 1U9KA 1VA9A 4JDEA 1CXHA 4TQ8A 5IW3A 4MCYB 3Q5TA 1F18A 3B9DA 3FQRB 3L3GB 5JXAL 1KYFA 3LHPH 2HLAB 4YWGL 2OMWB 4M6NH 1A7RH 1P6AB 3BWAB 1KC5L 1W16A 3QYNA 3MUJA 2WANA 3WJMA 4XPBH 2CU9A 2GIYA 1TIUA 4OLVH 1D7FA 2NW2A 1IBHA 1SJHA 3C5XA 3QRGL 3VXNB 1JF1B 2GCYB 4AQZA 2H6UA 1HHGA 4A6YA 2WOYA 2CUHA 4IU3A 4BFBD 2WXIA 1RZFL 2X40A 3NCEB 4U6VL 3IVKB 2VWEE 4FE9A 5DJXA 4JE4B 2X2JA 2NXZC 3FU0A 3ZX1A 43CAB 3MRIB 1CWVA 4GIAA 5JIPA 2DQUH 3TEWA 4PHZA 1T5WB 4PR5B 4XH2A 2DWDB 1D6VL 3CE1A 3EJZD 2R69H 3DDGA 4Z78A 1E5BA 3QR0A 4HIIB 1ZA6A 2AERT 4JO8A 1FWXA 3NP4A 4PJXA 2WWMD 3QWQB 4FNQA 3MODH 4QRPB 1F1GA 5FR3A 2B77A 3UC2A 2X42A 3BHBB 4KXCA 4ADJA 5I76A 5I73C 2BSRB 3C5JA 2B2XH 4JHWH 4A6YB 1BF2A 3DO7A 3MCLH 2ED8A 4KNSA 4ODVH 1B0GB 3UAJA 3AG4B 4Y1AD 1YEJH 5EA0H 2W07A 3BISA 1YYML 3QWNA 1L3NA 3GIZH 3IE4A 5MEOA 3FS9A 2BNRD 3HN3A 2DWDA 3B2MA 5IP4A 2HJFA 1XGYH 2YAHA 4WU5B 2NNFA 1I75A 1KFGA 4O00A 2C3VA 5C71A 5IMLB 2BOCA 2HLAA 2F08A 1KIQB 3EF4A 1NAMH 3LKPA 2K8QA 5AVYB 3BP5B 4U1NA 3MTRA 1JZEA 3SE4A 2JK5B 2EINB 1BZQK 3X1BA 1F0LA 4KROC 2I9TA 4X4KA 4F20A 3N0PB 3BPNC 4XNUL 4JQVC 4XCYB 1YY8A 4OVVA 3P77A 4XMZA 1Z9OA 1ZE3H 2MCAA 1NIDA 1HHIA 5C0AB 4QHNA 4RMSA 1QFWI 1DBAH 3N44F 3MRBB 3TM6A 2EYSA 1L9PA 2H41A 4XMKH 4BFNA 4PI2A 2IDTA 2F53A 1Q9KA 1HOCA 3DX6B 3TNNB 2W38A 2OA9A 1K5NA 2R0ZL 3IKKA 1K72A 2EO9A 2WB1A 3DX9A 4LQFH 4D8PA 5I8CB 3TWCL 3DTXA 2BNQD 3SDAB 4HIHA 2ETWA 1B4TA 5JQIB 3FQWB 1A3QA 1VSCA 1R3LB 2EJ1A 3QI9D 4DGYL 4KKLD 4AQAA 4LVEA 3AU1B 4LP8A 1OD7A 1TQUA 3JWNH 5E08L 1JTOA 2AVFA 3CH1B 4MCZA 3FU5A 2VQUA 3O0LA 3Q1SL 1HCFX 4JFPA 3RWGA 3ARBB 1ZXQA 2H4EA 3DSNA 3S8FB 1T1XB 3BSZL 4JQIL 2N01B 5J1AA 3P3YA 3UZQA 1UKTA 2RJMA 3KPPA 1OD9A 3KH4A 1DVQA 1HQRA 1RZKH 3NSFA 4FTVD 5IFHL 3V0JA 5DMGC 2X4OA 3HC3H 5CIPH 4NN6B 3VM5A 2XN0A 3Q6FA 4WO4D 4I1PA 5E6RB 1DBJH 2X9YA 3LQZB 3P4MA 4I77H 4R0LA 1DVFA 4X6DA 1U58A 2CCWA 3VGHA 3JYBA 4YXKL 4NZTL 1B6DA 4OLVL 1CFVL 1HC1A 2K9FB 4JFUA 3MJ8A 1CTNA 5CEYA 3SPIA 1I7RB 4L23A 2VERA 1G7HB 1IC4H 4P2QB 2JI1A 4RBPK 3U4EA 3QA3A 3TJPA 4N5UA 2JXMA 4ELMF 1XWVA 3MVSA 3PQYE 4FG6C 3P11H 4NUJB 4YHMH 4Y5XC 4OSUL 2AVGA 4XX5A 3NJNA 1LE5B 2DWYA 4IDJL 3NIGF 4MDRA 1IGCL 4BZ2L 1BVNP 1JNHA 4NNYB 3QJTB 1V7ML 4GRLC 1MDTA 2VSDA 3QBTB 1K2DA 2BOBB 2P5EE 4PJ5E 4QRTA 3VXME 5BOPA 1E4XH 1NUNB 4YDVB 1OQOA 4Z7NB 1OB0A 4G43B 5L0QC 4CBZA 3OGCB 3GXNA 5C9KA 1YEHL 2BSSA 1OAQL 4JZJA 1CDYA 4JHVA 1LQSR 3FOLA 3HCVB 4QHMA 1BIHA 1FFNA 1T5KA 5C3IA 2CK0L 5FUCC 4Z3FA 1MFCL 3DVGB 3TA3B 4UT9H 3E3QC 4KXZI 3QO1A 1P5UC 4BRJA 1WWAX 1BDYA 2WYHA 2PO6B 3PWVA 4EEEA 4JY5L 4MXVE 3RA7L 2ZXGA 1YMMB 2P49B 2L7UA 4PIRF 1A9BB 3JWOL 3VWJA 2VZTA 2V5TA 1LK2A 2CJSA 4MQXC 2WXJA 1KXVA 5J5EA 2G2RA 3MRMA 3SQOH 1KLFA 2NXYB 3AWGA 1AFVL 3LN9A 4JVUA 1NCWL 5EN2B 3KW7A 1YJDL 2WZAA 1BFVH 4XP1H 5EBLB 3D18A 4FF9A 4X99A 3S96A 4Z7UA 5E51A 7CGTA 4LDCA 3TA3A 2FSEB 4IRZH 1E5ZA 1SQ2N 4M8QB 4P57A 2VDLL 4PM1A 4KQ0A 2A4ZA 2PTTB 3CSPA 5KJ4A 1QATA 1T66D 5E2VL 2DW5A 3QIUA 3FSZA 5CLWA 4ZXBD 1DVYA 2GTWB 3T1WA 2V2TA 3BN9C 5AG8A 4OM0L 3S35L 1J9QA 1JVLA 4OGYL 5EOQL 5FHBL 1TVDA 2GY5A 1MWOA 1X5ZA 1YHPA 4OF7A 5F7DB 1QNZH 2OS7A 4YX2L 1FI8C 1E9PA 5C6TH 2FYYA 3JV6B 1BVOA 1NDGA 2DICA 1OAKH 2XZAL 2ED9A 4WU7A 5KVGL 2OMVA 2I7OA 4XMWA 5GSRB 2VZSA 3CMOH 4I9WE 2BMKA 5FA3A 5IF0A 2N56A 4K5NA 3IN0A 4QHUB 3CHOA 4XPHH 4HAFA 1D5RA 3EGSB 5H94B 5DJCB 1NAMB 3BQVA 5H4YA 1CQYA 4Y0GA 1TZOA 5LLIC 1PL3A 5ANMB 1GCYA 2XJKA 4EI0A 3CK0L 5T1MB 2PCPA 2NUTA 2BIOA 1MHEB 3D39E 4HFWB 1PGRB 2VERN 5E00A 5INCA 1R5WA 3QUMH 4G70B 2NY5L 3ZTEA 3VM7A 1H3VA 4P2RA 4LZKA 3EO0B 5KVFE 2J5WA 1Z9LA 4S0TD 1IVTA 4FFYL 2HVBA 4KDTC 1G7QA 2NY2C 4XC3L 4JFOA 2PWEA 1F1DA 2YKLH 1AIFB 4ZX5A 3X11B 4A55A 5DC9B 3B2UD 4M62L 1I1AA 3AU1A 5CJ5A 4KTGA 2J1YA 3QDGE 2E6PA 1MCDA 4Z9KB 2GPZA 4LOFA 3JVFC 4U7SA 4EI5D 1GCFA 4APQA 1UA6H 3TBCA 2NLJB 1S7TB 2VXVH 5D7KE 3CU7A 4TSBL 4P46B 1DBBL 1NWOA 4KUZL 4OGZA 3CVHA 5ESQA 3QJRB 5E2WL 5JR1H 3H9ZA 2ZG2A 3QUGA 4WUUB 4BFGA 5DURB 1ZY9A 5JHBA 3KHOA 3L7EB 1CFVH 2AQ3A 2QR0A 5EUOF 2P5ED 4GAGL 5HVHB 3C2AH 2AXGA 4Q6KA 3MGTB 1OEZW 4KU1A 1A4CA 3ZUNC 4PFEA 4E9TA 1AGDA 5FYKL 3CG8A 3FT1A 3ZYJA 4GSDL 3RL1A 3TPUB 2C9AA 1YN7A 1TLMA 4KMQA 5HI5D 3WFCH 5HHNA 1NIAA 1ORQB 3RWDB 3IDXH 5DUBA 2J1WA 5FM8A 4QHLB 1EHAA 3VD9A 1P6WA 1XV8A 3P4LA 3BN3B 1ZKAA 1P0SE 5SWZA 4OQTA 1CFNB 2HT2D 1SY6H 2X1WL 3VVVA 3ZTNL 3VTAA 2VZVA 5AAPA 4Z7AA 5CKGA 4HEME 4LE8A 2V5RA 3PJSA 4N5ED 4NENA 3GM0A 3U7YL 4QOKD 3B1UA 3QEHA 3G5YB 1EEZB 5K39B 1XDTT 3BP7B 3CLWA 3U9UA 2XKUA 5C08A 1KTLA 4S1QH 5HGDB 5I8OL 5KANI 2AS5M 1U36A 3ZRSA 2YMXL 3AS2A 4HS8L 2IPUK 3UJJL 4XP4H 1G1OA 1ZV2A 1UGNA 1OARL 5H2BB 5IB3A 1UXSB 3GBNL 4MAYD 1WZMA 5DD0L 2X3CA 3ZKQD 1L3WA 3GSOA 2UV3A 3TCLA 3EGXB 1N6UA 2VZUA 3C6LD 1GY2A 1RZ7H 1F3DH 2P80D 3ZQXA 3QEQE 2C3WA 1AJ7H 4AK2A 1HCZA 1PSKH 2YFNA 4UQEA 2P24A 1A5FL 3MNVB 1MDAA 3MUHL 5CGYC 3THML 4PJDF 2Q9OA 3ZJAA 1CYXA 3D9AH 4PJ8D 1SFHA 5GJSL 2CO2A 4PEEA 1QSEE 3MRIA 1TT6A 2DQGL 2WSDA 2Y6SC 2DL9A 3QFJA 3IF1B 2Q0ZX 3HG5A 4PI0A 3PFUA 1JHTB 4CNIB 2UZYA 1NC4A 1ZLWH 1HHHA 2J6EH 2FIKA 2NX5E 1D6VH 4RDQG 4B9GA 3IGLA 3ARFC 3ZE1E 3A6BL 4CL7A 1N6QL 4PGEB 3B2VH 4GRMA 1S3KH 5J89A 5I1HL 2BZDA 2QTVA 4FNSA 5KS9A 1XXFC 3WUWG 2IAND 1Y1UA 4GUPB 2DS4A 4JREC 2Q76A 4OD2A 5EO0B 5IMOA 2MCG1 4X5RA 5IVXA 3Q48A 3DI2B 3DROA 4JKPL 4AJ0A 4NRYB 4Y5VC 3EOBA 1XSJA 3OKDA 2Z7WA 3MRFA 3DO4A 3KWTA 3BUYB 1UA6L 3HI5L 4YHIA 3QUYD 3VFSA 4AT6A 3L5XH 15C8H 3T2NL 3UJIH 2CGYA 3HRZC 4M4RA 5JHLH 2Y5EA 3GJFK 2C7FA 5DEGA 5KSUB 5DD0H 1UACL 3UDWA 1DJHA 2PO6D 2Y5TB 3CN4A 4ZG1A 3RJQB 2R1XA 4F9PA 4OLXH 1VACB 4N25A 2KPNA 3T8XB 1MOEA 3VSTA 2F1BA 4PJFF 5CIPA 3ESUF 3GNML 2ERJB 3FQXA 3KPLA 3T3PE 4ES8A 1ZSHA 3FQ1A 2FHFA 3WFEL 2X28A 5E24E 4MQTB 4M7KH 2WBWB 4ONGH 3EO0A 4ELKA 3VXMB 1FE8H 2C4FU 1AACA 5SX4I 3BLPX 5CKAA 1G4MA 3G5ZA 3RWIB 4NO0B 5KVFL 3R18A 1CFMA 2BP5M 3ULVD 4ZSOA 1CMOA 2VTFA 3FN9A 5B1BB 3NG5A 3KPSE 4PSPA 3INUH 1BGXL 4XTRD 2Y9RT 1H0DB 4UZUA 1MCKA 1NUFA 4P4KC 4BDVB 1MCWW 3O4LB 4F8TA 3LMJL 2I60L 4NZ8A 1CN4A 5DXWA 2GYSA 1MFDH 1TQTA 1N5YH 2LTQC 2H3NB 1AP2A 3BPCA 3DUUB 3IJHB 5IF0B 2YC1B 4NGHL 1T0OA 3SDXF 2CRZA 3ILQD 4JG5A 2VMEA 3EBHA 5CM1A 1A8JH 3CFKB 1ITCA 4R4BB 5I1KH 4OGAD 1NCBH 1X5HA 2OZ4L 1YJDC 2GFBA 1Y1DA 3IDIA 1WITA 5EZIL 3SGEH 3KGTA 1G9NL 2ADIB 2OTWB 1MFMA 3AAZA 3FRUA 3O4OB 2K4AA 5I1DA 3B8YA 1A5FH 4YDIL 4S2SB 1PAMA 1RPKA 2QHRH 4YXLL 4KOCA 1P4IH 5C0FB 1BZ7A 1TXKA 2ESVE 5FYJU 2IH1A 4AQ1A 1R5IA 1N0LA 3V6BR 3US1A 4U4IA 2LABA 3UBXB 4NIKB 1XIWC 3QZBA 4PSRA 1PJWA 4HJJL 2QQKH 1E9QA 2IOIA 4PRDA 4XPAH 1XH3B 4DQOL 3VAEA 4DO6A 3AS1A 4I9XA 1QHOA 2EICA 3OJDA 3F7YB 5DMJB 5FGBA 4ETYA 1ZGLB 3VXUA 1FGVH 1AXSB 3HUJF 2G2RB 1AZNA 3SE6A 4UB0H 2QLVB 4LASH 2XFXB 2MQGA 3VFUB 1DTUA 2DH3A 1UJ3A 4RISL 1RIVL 1TETL 3GIVA 3PQYD 3PCYA 5JHDB 3MBEC 4PJCF 3IMRA 3KWXA 1RUPL 2QZ5A 3HMWL 3WUWB 4FQPA 1DQIA 2QGEA 1GGBH 4FADA 2UVFA 3HE6D 5B1JA 4N1HB 2DL2A 2XUWA 4UQ2A 3SGDI 1OP4A 2GB2A 2VSKB 3HCVA 4QHMB 1JWSA 4O4YL 4YDLC 1QVOB 1E42A 1Z0MA 1IU1A 1DSFL 4RQQB 4KQ4L 2XKNA 4RMVA 4L4VD 4RNRB 5GRZA 5T5FA 5T5NG 2YLHA 1RZJL 2DYSB 3IJSA 4X6DE 1P2CB 1YZZA 4HIXL 5LGJB 2ED6A 3B56A 4DIXA 5HJ3A 2AJYH 2A0LC 5B7FA 5T3ZL 1NICA 2AJ3A 1B4JH 1RCYA 4S1SL 4XNXH 5CZVL 4ETQB 1H15A 1U8PB 4OZHA 3FFDA 5SV3A 2ZXAA 1FV1A 4ATWA 2NY0D 4Y2DA 4KVNH 4JM2A 3ATAA 1UCBH 3JWOH 1KEML 1BBDH 2J7LA 1BEYH 1X7SA 2H32H 3NSYA 5ADPH 4XO8A 4J3BA 4YXKH 4P3CH 3RIFK 4ZI8A 1G6RB 4JY4A 2V7NB 2ZP0T 4G8AC 3PGDA 3DTDA 4XT1C 5AFAA 4BFJA 3QT2A 1T20A 1A6WL 4LVHC 1G6VK 4EI6A 5DUPL 5LDSA 3P02A 4NRZA 3SDYL 1P7HL 3VRIA 3T0AA 4WK0B 1E8YA 1IGJB 1NBYA 4QOKE 1EDQA 4HWBA 2VN6A 5F7EH 2APBA 5DJ8B 3UH8A 5KZCB 4G7SB 3PYCA 4OLZL 4Q6IA 3BP6B 5E7BA 3RUGE 2GIMA 2Y1AA 4UM9B 2X87A 4OZ4B 3DGDA 2WVSA 5GPRA 1ZPUA 5TDOB 1X4YA 5GRYA 1Z5LB 1L7TH 4HS3B 3EJTA 2HN7A 3L6FA 3IBOA 3S0PA 1FF5A 2R69A 1OT1A 3O4LD 4N4YB 2R1XB 1A66A 5F71A 2BJML 4DEPB 2FD6H 4EVNA 4PJIE 3ZIYA 4QYOB 3AB0B 2DJ4A 2LQRA 5K1VA 1UT9A 4BINA 2CIIA 4F33B 3MRDA 3D3VA 5BVJA 2WWKT 2PWGA 4X9FA 4TL5A 4BWUA 1QO3A 1HWHB 4O2CB 3CCHB 3GS7A 1XGQA 9PCYA 1MFBL 3BPOC 2WXRA 3CSFA 5B39G 1D2PA 4KZEL 3B9AA 5AW5B 3WEBA 4QT5B 4QYAA 4Z8FH 5C0DA 4V2CB 1D6EB 1MH5B 4FZEH 2KT6A 3UMTA 1JTPA 4NWUH 1AGFB 4ONGL 4X6BB 1C5CL 2VMDA 1XF3A 2OPCA 2CR6A 2YQ3A 3ETTA 3QXVA 3UG5A 5HYSG 3EFFA 1LO4L 2J57A 3LEXA 1BD2D 1NUGA 2UXTA 5J11C 3O3EB 5IHUL 1CT8B 3GMRA 4JLRB 5D7IF 3VFRB 1A6AA 4N90D 3D69B 4I4WA 2HH0L 2KPWA 5EU6D 2VABA 2K0RA 5A43C 4EIGB 5BJTA 3LKQA 1N8OE 3WFZA 3BIAX 1AD0A 3E8UL 2OMYA 4G5ZH 4HLZH 4POUB 3TWCH 5BRZB 2QR0B 1ES0A 2X0VA 4PJBB 4H8WH 4OCSL 3VGDA 1QBAA 2IGLA 5IM7A 1ZAGA 3TFKD 3D8MA 1BQRA 3RAJH 3KPNA 4D7BA 2UXGA 1HSBB 5BO1L 2HUHA 4YK4B 3IDJB 4HVBA 5GS0H 1EAPA 3CU1A 4OIFA 4DSYA 4JPIA 1LGVA 4QTIH 3V8CA 1CLZL 1RJYA 3RA7H 4EVNB 2KI6A 2Y3AA 4V1DD 1BOGB 1T6BX 3O81A 3QO0A 3WN5B 4Y4HB 3H2PA 2LFGA 2D3JA 2JJVA 1NEUA 3QULA 1LO2L 2RH0A 4YSRA 3SKNA 4X7TB 3V5HB 5ES4B 3PV6A 2SEBB 3QJQB 2R0ZH 5K9OA 1KXTA 2CUMA 2EDQA 2QDVA 4HXAL 3C08H 3FXIC 3TBWA 4DW2L 1QFWL 1DVFC 3HG1E 5LGYA 3OTTA 3O2DA 3MOBH 1P7QA 4YE4L 2C9XA 1ZCRA 3CTTA 4ZDHA 4ENEC 4ZOBA 3QXAB 4OIIL 5EOCL 1MFEH 5IWLC 2WGNB 1F56A 4M48L 3ABGA 1K3IA 1ZIBA 2DQGH 2DZEA 2PETA 3L95A 2WLIB 3GIZL 2VUKA 2WCGA 4MAZA 3IYLW 3QCUH 3MNMA 4N8PA 4Y4KA 3RWCB 1MZZA 1EHLL 1XGTA 1E3XA 2XTJC 5GGVL 5F1IA 2TSBA 3MLTA 3U79A 4OSUH 3MLRL 4AW7A 1DZ0A 1YDPB 3TV8A 3JTSA 5BZXA 4IRSA 1TZHB 1MCLA 4C47A 2B2XL 3VD5A 1I1FA 2D31A 1NMBH 3BGFB 3D85B 3ZW3A 4PW3A 4WEEA 5J3HC 2X2HA 3K6IA 3OVUB 1HXMB 2B3IA 2ZOLB 4Y9EA 3TLRA 3ZZ1A 2ESVA 1CD1A 1YYMH 2EDEA 3CZFB 1RY7B 1FORL 3I2CL 4E9QA 3DV6B 3D2TA 4QXGH 3W2DH 3MCKB 2G60H 1S7TA 3QAQA 2NY4D 1SXBA 1FIEA 3ULUF 4D9QD 5ECJE 1MI5D 1T4KB 1OWWA 5B1AB 1RK1B 1YAZA 3CFBA 3QORD 1YY9C 5C07A 3OG6B 4IU2B 1I53A 4M4PA 2RCSL 4E0RB 4ZODA 4XXWA 4N2KA 4GW4A 1NCGA 5E8NA 1P9MC 2J72A 3HFMH 3HE7C 1O9ZA 3KWWB 4LXFA 5CNHA 4HGWA 12E8L 2UYLA 2AEPH 3AY4C 5E2TH 1U21A 2AQNA 4XVJL 5FV2A 1GOGA 1XEDA 1F8TH 3AY4A 1DR9A 5CJQH 5DHVB 1KYAA 1UM6H 4UTBH 2UWEF 3W0WA 5FDWA 4NJ9L 2E8ZA 2XIIA 5IVXE 4A68A 3MJ7A 2GI7A 1QABA 1A9BA 3VTMA 1DQQA 5BVPH 2JB5L 5IREA 4FFVC 4JRYB 2XZCL 4R4FL 4KNTA 5EOTA 4BKLB 3CDGA 2W81C 5ISZB 3BEVB 4N0RA 3V9CA 4ONOA 1WZ1L 2XG4B 4LCCA 4Q6YA 5IQNA 3S36L 5A7EA 4EJ1C 2X4TA 4RZKA 3D51A 2Z92B 5E2WH 2UUDH 3O8XA 4W81A 5D7LD 4HJSA 4LCYB 4ZTOH 3X13A 1RKRA 2ZJSL 3F7PC 1AC0A 2Y07L 1U8LA 3EW3B 4XNUH 1CFBA 3FUIA 4MNQE 4F2MB 4WWNA 2CDEB 5CP3H 3IJEB 1OPGL 2AMGA 4MBOA 4MX7B 1K4DB 4URKA 3OKYA 3UACA 4WU7B 1M3JA 2AJUH 1X7QB 2EACA 1EGJH 4JFWA 5EZLA 2NY3C 4L4VB 3GSVB 3LKSA 1MW2A 2EEXA 4A7QA 2FDBP 4PJCB 5ENWA 1A6AB 3V4VL 5D2LE 2VC2L 3LV3B 5T3ZD 3T6XA 5LVEA 3TO4A 3GGWA 5EZJA 3BKCH 1MSPA 3TPKA 4NZRL 1CUOA 1XF3B 1KPRA 1EJ8A 4HAGA 2DH2A 1K3ZA 3WDIA 4CN1A 4HX1B 5D1ZA 4DFIA 2YXMA 2AJXH 4AXWB 3UTQB 4U0RC 3GWJA 3DSFL 2QFRA 1ZA3B 5DQ9B 3L2NA 3N1GC 3MKGA 4R7VA 4LSTH 2WKLA 3PWPA 3WSQL 4WI6A 5D93C 1IFGA 2A6IA 1TQBC 3MJ7B 2BNQE 3HG1D 3KLQA 4K5MA 3TBYB 5MEPB 4K94H 1DUYB 1U8IB 4FLQA 4Z7VF 3WMSA 1KB5H 3K71B 5HDBF 5L0QB 1YEIL 5K9JH 3SGKC 1KCWA 2ATKB 3KWWA 4GJTB 3JVGC 3NK3A 3BVWA 3U1QA 1XBRA 2X6BA 3V4LA 3LPFA 5C07B 5EZIH 4MJIE 3BE1L 4KTEH 3IRZA 4PB9L 1Z3RA 2Y2WA 3BUQA 4V1DA 3L3JB 3SE8L 3DVIA 4HW6A 2DLEA 1MUJB 2V8MA 2H9GA 1OAJA 1RMFL 1OSPH 2FJGB 2HJKA 4PJ7F 2NPLX 1SDYA 3PY9A 1F41A 2X1OA 2GJ6A 1PZ5B 2KYIA 2QQLH 4G72B 3RWFB 2ORBL 5C0BD 3CZGA 5FOBA 3DX6A 3TNNA 4FA7B 1PDKA 5ESAA 4YSTA 5EPMB 5CR8A 2PCFA 3C5SB 4LASL 1U8CA 5HY9A 5TGBB 4ANWA 2XG5B 3NACH 2EIZB 4DTGL 2WLNA 2E9IA 2OI9B 3C09C 5DS8B 4TLKA 1BGXH 1WH0A 4HUXA 1HHJB 3BDBA 2J4WL 3C9NA 4JO1L 4FQ2H 1XCWA 2IG2H 3ZKNC 1KWKA 2VR9A 3MGAA 1LP9E 1SOKA 2BNRE 3P40A 2HVKA 4H1LB 5DK0B 2BRRL 4FQLH 4BFFA 1XTMA 1A6PA 3D39A 3ARXA 1YNKL 3MCG1 4QR7A 4L5FH 3VXMD 2Y07H 1QEWB 3E2HB 1EAQA 3AC0A 3NCBB 1Q9OB 1RULH 3WEXB 4WUKL 3A6CL 2ITDA 4U1KA 3C6SB 4NGHH 4J3OD 4WGWB 4UTAA 2HAZA 3ZKSD 4QRRE 3SO3B 4HV8B 3OZLA 2NY6D 4RGNC 5D2LB 3GB7A 2ZXEB 4U6XA 1NCBL 3UAAA 4Z0BL 3IPFA 3D08A 4RVBA 1SOQA 5L88L 2CA4A 2IDSA 1DL7H 3AXIA 5T1DH 1G0DA 5TQ0L 3IETB 3UZEC 4UQBA 5D1QE 2ZUQC 5L7XH 2F74B 1T83C 2J44A 4WF7A 1RIHH 1UXLA 2APVA 4LGSB 5LNDA 1CF1A 3L4UA 4YDZA 3T3MB 4D0DA 2CLZA 1T1YB 5ALBH 3ME0B 2R7EA 3GSNL 2PUQT 1KN4H 1SEBB 1OP5K 5G2NA 3TIEA 1HXKA 5GS0D 5IJKC 3L3KA 1I8IA 3M07A 5DZNA 4H20H 4H0LC 5C0IA 2CUAA 1AE6L 3AUVA 1K5NB 3MV7E 3FN0H 3UO1L 4UTAL 1SHMA 3L3OB 4NT6B 3MOAH 5BRZE 5TPWL 1JV2A 4PJ8A 3E9UA 3IB4A 4TNEA 2JQMA 3FUNA 3WJJA 5SWSA 1TZIA 4PJ5B 4UAOC 2VXSL 4PJXF 1JPGB 1KBGH 3SGDH 1E9QB 3OKLA 2I32A 4PRDB 1JYWA 3VXRD 4Z7NE 3FO0L 4M7LL 2FO4A 1PTZA 2NCEA 4XVOA 5HJBA 3VMNA 1GRWA 4W9HC 3X1GA 2W0FB 1FL3A 1QRNB 4PJDB 3UC0L 4DHLA 4PGBB 3TBVA 4LLQB 3V0WL 1TVBA 4LPTA 3V6FA 5CEZE 2DIBA 2OMZB 3F84A 5GXBB 1JZ5A 4LSRL 4I0PA 2JKXA 2X4UB 4Y2LA 1IEHA 2O30A 1FNLA 3DI3B 5KSVB 4MA3A 4ZTPH 3CFJA 2UX6A 4X6CA 2BS8A 4NQDE 2MCMA 4KQ3L 2WO3B 4JPQA 1DVTA 4HA1A 2A9BA 2PPEA 4HDIA 4PLOB 4YS4A 5CD3B 1TTCA 2O5ZH 3L3DA 5G4NA 3T3PB 4M3JA 2BOCB 5I73B 4EXPX 1JPGA 3L5XL 2F58H 4WU5A 3OB8A 3FB8B 4XBGB 5E5RB 4IIQC 3KXFB 3LY6A 4OZGE 4Y5YC 2ICEB 1N8ZA 1S3KL 2ZYSA 3Q5OA 5AD0A 1A0QL 1Q1JH 2OJEA 2XN9D 2DDQH 1NGYB 5AAWC 3KW8A 2DQFB 5TE6H 3T2PA 2YSSA 3CHQA 4IOSD 1RK7A 1JV5A 1TEGA 2C26A 3N9GH 3TVMD 3VU2A 1UWXH 4N8UA 4DQOH 4HPHA 2P3YA 3L2LA 3CDZA 4QNPF 5TDPB 5DHMC 2VLLB 3ORJA 1CR9H 1FYTA 1GZHA 4PMEA 1CD9B 4X4YB 3D9AL 5BS0E 1EZUA 5JOPD 1T66C 4LEXL 3MRNA 4QRAA 4IEFA 5I1LA 1JD7A 4FYSA 4OCRH 4AX3A 2P5EA 2LLLA 1ZT1B 1RZ7L 3R7QA 1RHHB 4JGNA 2PTVA 2WSPA 3GKWL 3T3PF 3NDYE 1HL8A 2UZIH 1UVQA 2VAAB 4K9EL 1NGYA 3VXUD 1NPNA 1NBYB 3NH7H 5HDQH 1H8NA 3FHQA 4JRYD 5JHDD 3Q3GB 2ICCA 1FN4B 5DQJA 4ZFZB 1R3KA 4IOIA 3KJ4C 1YPZB 4KJQC 5F7KC 1FHGA 1S7QB 4WDIA 1JGEA 3CHXA 2WXPA 3UTSA 2YMTA 3GHBL 4OGXL 2VLRA 4AQ8A 3OMIB 1DLHA 4AT6B 1NTDA 1CBVL 3H54A 4NN7B 4DVBB 1FC2D 3WO4C 5DJZA 3BVXA 4G6KH 3B3BA 1UWGL 3AQZA 1PX8A 1HZKA 2IADB 1CLOH 2WXNA 1V7NH 2ADFL 4P9HH 2Z8WC 1SXZA 4QPEA 5HD8D 1WBZB 1GL4B 4MAUL 4RGND 5KS9B 1PSKL 4HCRH 2FO4B 2DLGA 2YPKB 3GXDA 2D9CA 4J3VA 5IB5B 3ZMNA 4OD3H 3T3MF 3SKUD 5AKTA 4MNHB 5D1QD 5F3HB 5T33H 2E4TA 1NGWA 1ZLVH 3RDTC 4GLRH 2IH3B 1MCRA 3GNMH 4Q14A 3QG6A 2W60A 2R1YA 5I71C 1FFOA 3TL5A 3WEAA 4BH8A 5IESL 4DN3H 1MLBB 4J3TA 4A2EA 1CVRA 2BLFA 8FABA 2EO1A 5GISH 3OAYK 3C5ZD 2EILB 3GIVB 3R0MA 3U9WA 4MD0B 1RP9A 4GEJA 3W11C 2EEDA 2IQ9L 2D7TH 2EUZA 1ORSB 2WCPA 1HL9A 3QEUA 1I9RL 1PG7L 4OZHF 2BFGA 1U8KB 1JS4A 4DVRL 1RIHL 3LVTA 1JI1A 5DK2B 1TPXC 1UKQA 3CFDA 4PP1D 1QW9A 3JV4A 3T0BA 3ARDA 3OQ3B 1UZ8B 5KVEE 4HKXB 4GI6A 5CJ8A 5DFWH 3FT3B 5LG6A 3RPBA 1GGCL 4ANXA 5BZWB 4ONHB 4PV9B 2FO8A 3V5KA 3FDWA 3PXJA 3WXWL 1NCCL 2EDHA 2Y2YA 3RVWC 3GRBA 2ATPA 1HSBA 1KYUA 4KHTH 1E9OB 3OR7A 4KZDH 2HZHA 4AIZB 4WKZA 1JERA 4DJMA 1JYXA 3QHFH 4YDMA 3F04A 2X3BA 3D33A 2AK4A 4MQXD 1Z9SA 4I88A 2QSCL 3WV0A 3GMNA 4ESKA 2CHWA 2VXTL 1B2YA 1KLGA 4P3DB 4FMVA 4HUXB 3EG9B 2CGZA 3QNZB 1N7MH 3FSOA 5CILL 1H6UA 2EE2A 1KJ3L 1MW0A 2J20A 4WQOA 4HOWA 3HPJA 2V17H 2WC7A 3GMQB 3PHQA 4GW1A 2G9HB 4WI0A 4LMQI 1HN1A 5DD1L 3X17A 1MJUL 2YC1A 1TNMA 1OT2A 1UM5L 3ZL2A 4K3EH 2XYCA 2WLLA 2F53E 1A6VL 3EYUH 3W81A 5E4AA 5AZ2L 3HPJB 3FU7B 2DQTH 1KTRL 4GAYA 4NERA 1AZRA 3V2AR 3FAXA 4PJXE 3FSAA 3ZHLA 3CDGB 1UUSA 5DVKA 4X42A 3OJMB 3OAZH 1ND0B 1AS8A 3GXUB 5ISZE 3Q0HA 1LP9B 3Q6FB 3D6GA 2PWDA 3QIBC 4LBEA 1CE1H 1OAKL 1TNNA 2D03L 2R0LH 3H9HB 2DRUA 1GPOL 2FX9L 3SJVD 1MQKH 3ZTCC 2J8UE 4YEFA 5GS2D 2WQSA 1COBA 3ARBA 4XNBA 3T5WA 5LHDA 1XMWA 1F2XK 1W6LA 4JRXA 3QR2A 1BYNA 3DOSB 4WHYG 1KB5L 3O41A 3RVXC 4ZFFB 3ECQA 5IROC 4KHXH 3QUXB 1BREA 2BCMA 2EC9U 3F85A 3LD8B 3ABLB 3TNMA 1OY3B 4LARH 1QUPA 3QFJE 5LKNA 1ORSA 3CXHJ 3MCKA 4MNGE 4Q9BA 1OTTD 4M6OL 4NSKB 4GG6B 4DCQB 3UABA 1LK3H 5C70A 8FABB 1HESA 2HFGL 2Z8VC 5KVGH 5F1OB 4K3GA 3UPRB 5C7XH 5I19H 3VXPB 1JJUA 1QNZL 3N2JA 2Z91B 1JNLH 1F4WH 1JRHH 4N0UA 1T2QL 2NY2D 3FAWA 5TTRA 5DD1H 1GHFL 2AANA 4HKJA 1SQMA 3SY0A 4RWHA 2B1HH 5LNEA 1R0AL 4NZRH 5FKPA 4UQ3A 3EDJA 4PGCA 4LVNB 4Q8BA 1BZ8A 3J27A 4K8RD 3KPSA 4PTUA 5E5UB 5SWZD 4K23H 2DMCA 5DHVH 1AHWC 2K1MA 4PJGE 5C09A 4HUVA 3C8KA 1YNTA 2XZQH 3RP1A 3KWVA 5GS1A 2FJFA 3IFPB 5DQDL 4DOHB 4PWEA 1HZLA 1JZ6A 4YGAB 3KPRE 1LK3L 4P9ML 1XCTA 5E9DA 4K94L 4WWKB 3OBAA 4XOAA 1NCDL 4PJ9B 3GUTA 1JD9A 3ABKB 4LCIL 3BZEB 1KJ3H 3P3RA 4M7ZC 3D50A 1PX4A 4HZAA 4DF9A 1IGCH 2C1OA 5EOCJ 5HGHA 2X09A 4U6HB 2IQ9H 3OXRA 5BQDA 3S97C 4L9LC 5AYUL 1OHZA 2XQ0A 3TOPA 3NFNB 1XXDC 1DQML 3D12B 3RIKA 4P4KD 2H1PH 3LRHA 4W4OC 4N2GA 4XC1H 2ZF8A 4G71B 4PJEF 5ICYB 5D6CA 4LRNL 1ZVYA 1UC6A 4XX1G 2FJHA 1D7BA 1GYCA 1GAFL