5AB9A

Structure of the p53 cancer mutant y220c with bound small molecule 7- ethyl-3-(piperidin-4-yl)-1h-indole
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
195
structure length
195
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploiting Transient Protein States for the Design of Small-Molecule Stabilizers of Mutant P53.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords CELLULAR TUMOR ANTIGEN P53
total genus 50
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5ab9A00
3D07A 4QO1B 2YBGA 1EAQA 5AOJA 1YCSA 4L18A 2H1LM 4AGMA 4G82A 2BIMA 4AGOA 4IBZA 1IO4C 2X0UA 5BUAA 2X0WA 5AOLA 2BIPA 4XR8C 2ADYA 3WTXA 3WTSA 5A7BA 3D0AA 3TS8A 4KVPA 2VUKA 2RMNA 3QYNA 4G83A 1EANA 5ABAA 2WGXA 3QYMA 1TSRA 4MZIA 1HJBC 2J1WA 5G4NA 3WTUA 4IBUA 5LAPA 2IOOA 2GEQA 3D09A 2XWRA 1LJMA 4L0ZA 3WTYA 5AOMA 4AGNA 1EAOA 3WU1A 3KZ8A 2OCJA 5AB9A 1CO1A 2J6WA 2J20A 3D05A 1CMOA 1UOLA 5G4OA 1E50A 1GZHC 3KMDA 2BIOA 1HJCA 2P52A 2J1ZA 4HJEA 2IOMA 3ZMEA 1KZYA 2J21A 2IOIA 2MEJB 4MZRA 4GUQA 4IBVA 4LOEA 2ATAA 5AOIA 5LGYA 3Q05A 4LOFA 1T4WA 4IBWA 4IBTA 3D06A 3EXJA 4IBYA 3D08A 3Q06A 5KBDA 4A63A 3US1A 2J1XA 2FEJA 2AHIA 4AGPA 3VD1A 3IGKA 3US0A 4AGQA 4L0YA 2J1YA 3VD0A 2BINA 4IBSA 4IBQA 5G4MA 4GUOA 3EXLA 3Q01A 1GZHA 3WTWA 1H9DA 3WTVA 1HU8A 1TUPA 2XWCA 2AC0A 2BIQA 2X0VA 3WTTA 3IGLA 4LO9A 4IJTA 2PCXA 3VD2A 5AOKA 4AGLA 5ECGA
chains in the Genus database with same CATH superfamily
3D07A 3VWJD 5ITFA 3VFWB 3NZ8A 3X1BA 2BMKB 4ERSH 4QCIB 4WI8A 5H8DA 4CL7A 3DYOA 4NQSB 4AV5A 4C8XA 1A9BB 3CFDA 5D7LD 3BHBA 3GD1C 4JY4A 4NB7A 4PJIF 1MAMH 3AFLA 5DK2B 3WFEL 5SWZA 1R3LB 1O6SB 4XP9L 3MUHL 3S88L 1XF1A 1P84J 1QQDA 4TNEA 4JDVA 4X0KA 4XP5H 3WTXA 4PJ8D 4MZ3A 2AI0L 3MJ9H 4LSSL 5ESVA 3NGBB 4HUXA 5IVXE 3WENA 2BSDA 1TZ8A 1N8ZA 5HYQA 3WELA 4ZUSB 2ITEA 4HK0B 2WM0A 5GQBA 3DNKA 4PRAB 2FH6A 4F20A 3RFRA 4ZZKA 3U6XA 4L4TB 2V5YA 4KKLD 1E0OB 1BJ1J 3CK0L 1ZVYA 1AZZC 3GMNA 4YBQD 1U4EA 4YPJA 2OAAA 1G6RL 2WTRA 1DSYA 5C0JB 4S0SD 3PY9A 4FNSA 2VLRB 4LNRB 4U7MA 3MLVL 3UIYA 4ZG1A 5E8PB 5BS0E 1ASPA 1ZLDA 3I74A 4HALA 3FUIA 2IWGA 3MOAH 4S10A 3WFCH 4YDNA 3VWKD 4CSSA 4HULB 1INQA 2OL3A 3BW9B 4EUPB 1UJ3A 4AUYA 1M7UA 2A1WH 3VI4F 4ZUVA 1M71B 1N12A 2NX5E 4JFXA 4MAUL 1HOCB 5C0AB 4HKJA 4JPVL 3PP4L 5D93B 2EE6A 4GQRA 3BAEH 2DMGA 1T2QH 2CR6A 5H4ZA 2WWKO 4F1ZA 2C7UA 2OL3L 2J7LA 4PAZA 4TUOA 1MIMH 5AW2B 1XH2A 4XNBA 2BVTA 1A0QL 3OM3B 5DYOA 3OV6A 4YR6B 3LJ3A 4AEHL 1YJDL 3MRNB 1Z1WA 1TTGA 3LH2H 4JKMA 4ZO9A 1N19A 5DD5L 4BWWA 5EOQH 1RZFL 4I3SL 4AGQA 4LKCA 2UX6A 3KDPB 1R34A 4BFFA 2FB4L 2NLJB 4KQ4L 1TVHA 3CUPB 4AEEA 1JYXA 1LM8V 1U92B 2QADD 3L3HA 1MEXL 2XC8A 4WFGE 4Y16B 3V5HA 4J3WA 4Y9BA 2G2NA 3IDIA 3Q2LA 4GINA 3KGRA 1DQDH 3GBEA 4EZKA 3EH4B 3C60C 4AQEB 3SE3A 2ZUQB 3Q6FB 4CILA 3ULUH 4JDVB 4A2GA 3T1WA 3MV9E 2HT2C 2ZKXA 1MRFH 3T0BA 4PB0L 1U8MA 3ISRA 2LAAA 2Z31C 2QEJA 2WUBL 5I26A 1EEZB 3R8BB 1IKFH 2WXLA 4JFOA 5C2UB 35C8L 2CKNA 5E24E 3G5XB 4F7PB 3IAGC 2YRLA 4L4VA 3SDCB 1YY8B 2K45A 3CTTA 4XC1L 5F1IA 2AQSA 4HT1H 5IJVA 3NMEA 3QJXA 2D9QB 3KGSA 1ACYH 1CUOA 4Y19D 4UTBA 4JAMA 4NP4L 3NIGB 2ITCB 4WI0B 2NY0C 2VDLH 4PGBA 3SO3C 1U58B 1UWEL 3EJTA 1JWSB 2WP3T 4LSVL 4J2XA 1CR9L 1PPIA 1CU4L 2EINB 2WXJA 2CHNA 1DBKH 1GMIA 3D09A 3P3UA 1JHLH 5KJRL 3AC0A 3O3AA 5JIDA 1G0DA 2AJVL 3MA9H 2YMXH 4B50A 1G5AA 1GR7A 3CQFA 4U6HA 5C0EA 1NDMA 4YNYB 4WEBH 1XIWA 4OZHA 2Y5TA 4BFEA 4ZI8A 3FHAA 1EQWA 4J1UA 4PV8B 3P0VH 4HP5A 4PV1C 4Z0XA 4BFKA 1DBMH 1YYML 1MCNA 4JFDB 4JG0L 3QIWB 4DIXA 2IH1A 2UYLB 4X7TA 4YSTA 3STBA 2YN5A 2Z7UA 2JJTC 3T8XB 5I75B 4Z7UF 5HHNA 4XBEL 2DY2A 1WEJH 2Z92B 3NIDB 4IRSA 2IQ9H 3KJ6L 5DFVD 3WJMB 4F24A 5AZUA 4LOFA 3N2JA 5I6KA 1KG0A 3EGXB 4NKMA 3MNZB 4ZAKD 1JE6A 5LXVA 3B9VA 1NM9A 1UUNA 2LTQC 2C1OA 3H3KA 2LAGB 1Z2KA 2BVPB 3K2IA 1B4LA 1D6VL 4P9HC 2QDVA 4HKJB 2A9CA 4UV4H 5D7SL 1A4CA 4MWFB 3SYCA 3RWCA 5F88A 4H25B 5IIEB 5GGUB 4UTAL 2ZKMX 2NUTB 1U58A 1MCBA 3LIZA 5IQ9B 3AG4B 4PJ8B 1WHPA 1CT8B 1MJUH 2FT8A 3QZWG 4IHBA 1RUAL 4Y2DC 1SYSA 1LO4H 2Z31D 4DK5A 1JCKA 1AZVA 1I9RL 4ONHB 3ZTNH 2D03L 5C3IA 2ZX5A 3G3LA 3TBTA 5HHQA 5CJXC 1MCRA 4JANB 2VLJE 5DC4B 1G5GA 5T1KB 4YDIH 4R7LA 1F2XK 2ICWB 4XN2A 4YDIL 4L4VD 4X98A 1OAKH 5J3HD 4ZNEE 2QQLH 5JOFB 2WMPA 1MDAA 1H6EA 2FGWH 5F1KC 5B39B 4PJBE 1XZ0A 1T21B 3ILPB 1YY9C 4PQXA 4N2KA 1DCEA 1BZ9A 2AV1B 3NA9L 1W9XA 5HHXL 1S3KL 2MNWA 1KN2L 4G6JH 3VNZA 3BE1L 3IJEA 4FXKC 4Z8FH 4HS8L 2X4SB 4FG4A 4MJJA 1E40A 4K7PY 2Y9RT 3ECQA 1XH3A 1SDDB 3AGVA 5A3ID 3X11A 4ZRGA 4OV6F 3DSFH 5F9WB 3T6XA 2XG5A 1AQ8A 3VXPA 2ZCHH 1OM3L 1CICD 2B1HH 3ARUA 4MDJA 3SODB 3ZTCC 3DX0A 3SDXE 1JNJA 4KMLB 1OE3A 1PGRB 3C6SA 2DQHL 1Q1JL 2ZE0A 4WO0A 4X5WB 5DQDH 1UD6A 3FTZA 3QNXB 4N6RA 1HDMB 4NQDA 1W0WB 4NENA 4MCZA 3K2UH 1WRFA 1OAZL 3L1OH 1R75A 1NEUA 4GO8A 3ARSA 3C8KB 2NY1C 3GKWH 4F7TA 5C6WH 4X50A 2YR3A 2LVEA 5KSUB 3BGFB 5DLML 1N3NA 3UJTH 4APQB 3QDMA 4RVBA 5JQIB 1A3LL 1PL3A 4Y0GA 3X14B 3MRCB 2H3KA 4HS6B 2J4WH 2OTUB 3ERXA 2YMXL 5IR1A 3HCVA 2O1AA 2VSDA 3LRLA 3LY6A 3GINA 2IAMC 3R0MA 3DIVA 1QWUA 1A4JA 2ORBL 4HPHA 5DJCB 1D9KC 4RETB 3A6BH 4GMTH 4LPYA 1IV8A 1JNHA 3KH3A 2P8PA 4LOEA 1L0PA 3H8NA 3TONA 2Q3AA 3L4XA 4MVBC 2FR4B 4R2GB 1FZKA 3TA3D 2X40A 4IDJH 2CLVB 1TVBA 1CL7L 4XPBL 5EC2B 2X4TB 5TE4L 1NJ9A 4R26H 3BXNB 2VQUA 1P4IH 1X5MA 2FSEA 4XMPL 3V5DA 2LFEA 3UBFA 4AG4L 3V2AR 1F6AB 5HHMB 3GSNB 4K9EC 1VACA 4Y7MA 2DEYX 4YLCA 2Q5BA 3ML9A 4Q9QL 3BZDA 3WNIA 3DUUB 3QDME 2Y7NA 1AI1L 2AVFA 1HXMA 3MRMB 4NM4H 4IBSA 5AVXB 2DWSA 4PWEA 2P46B 5DS1A 1ZT7B 3QUZB 4OLYH 5D7JA 3SBQA 4E41D 1HL8A 3RHWK 4NNYB 1Z9SB 2DKMA 1GZQA 2RACA 5IOKA 2CLRA 1WZ1H 1OF2A 3OAYK 3H54A 1R5IA 1V7NH 3OAZH 5LHDA 3F84A 3M8OL 3DUSB 4APXB 3WE6B 2VDRH 4EOWL 3JVFC 3GUTA 4TULH 5L2JB 1WFNA 2CIIA 3EZJB 1PJ9A 4N8CH 2W0LA 1VSCA 4LFHG 2WNXA 5DD1L 2XPGB 4MB4A 5HGDB 5BUGA 5HBBA 3AREC 3VI3B 5DF0A 3TV8A 1BYPA 2FEDD 2JFCA 2P48B 1KBGL 1YC8A 2G0KA 4APXA 3MLYL 5MI0C 1EO5A 4XVJH 5T1DL 3VXMA 4YBLC 3ULUL 4ALAC 5A7BA 2B1AL 3LN4B 1CGTA 2OCFD 2FQDA 4XVOA 2NYKA 4V1DA 3BH8B 3FDWA 2QMJA 2C9AA 3NCJL 4N0RA 1YEIL 2G0LA 3CH1B 5IBUG 4N1CA 1KV3A 3SKMA 3FULA 1A8JH 3C5ZD 4NLAA 1U91A 1EJ6A 4RAVB 3SQOL 1LWJA 1ES0B 2AABH 3PV6A 1HI6A 2LE9A 4F80A 1AKJD 1CICA 3CSBA 1MIEL 4J4PA 1H0DA 1HIMH 2O5YL 4NCC2 2Q8AH 4GAFB 2W60B 4LSUH 1JF6A 3V95A 5C0BE 3HE6B 2CBOA 5JW3H 4C4BA 1MDTA 3T2OA 2GKIA 3KPSD 1BIIB 4R5VA 3EOYG 1V05A 3VWJA 4OY9A 2V9TA 1BXUA 2JLPA 4PWHA 3W82A 3FUFA 4GPVA 4H8WH 2E46A 1FFNA 4ZMTA 4XI5C 5CP3H 1G7PA 2DYRB 4DKEH 3GNMH 1GYUA 3GRBA 2J57A 3MMEB 4O2EA 4FFYH 5DLLA 4LEXH 3ZUNC 3MXVL 3RRQA 1NBZB 1TKWB 3RWFB 2R56H 1GC1H 3BH4A 1MFUA 4BKLA 1LO0H 3TNNA 5C0IA 4OCRL 4GAYB 1I7ZA 1L9QA 3FQTA 3C2AL 5E8EB 4QRQA 5JZ7C 1TSHA 1A4AA 4OGAC 2BWIA 2VZSA 4UM8B 1T6WA 5KJ4A 1YN7B 3CPUA 4RMVA 2XN2A 1MVUA 3K8MA 1Q94B 2Q7NA 4IKLA 2JCCF 4W93A 3K80A 3SE8L 1BVKB 1OK0A 3UCRA 1N64L 2KQMA 3MLTB 2DWTA 4N2CA 2X4NB 3TT3L 3U4KA 1NCBH 2BC4B 4BH7B 4HH9A 5A16A 5MP6L 4J3TA 4YC2C 5BXFB 1RQ5A 3MJWA 4HIEB 1WUZA 2AXHA 5C09A 1FNAA 3EG9B 5E2UL 3V9CA 1HHIA 2X9XA 1COBA 1IFHH 3IDUA 2AJZA 4HJ0C 3EJRA 4LHUD 3ZUCA 4WF7A 5GGTH 2F74B 1W80A 4PRDA 1WZMA 4JY5L 4P2AA 2BX5A 1TTFA 1HEJC 4S1QH 4KQ3L 3WSQL 2X28A 1VF5C 1PDKA 3FFOA 3ZN6A 3GSOB 4OZFB 3CPLA 2O5YH 4K2UH 1XT5A 4CVZA 2AJ3B 3U7YH 2DMHA 4XVTL 1SXNA 4OI9A 3KYMB 1FVCA 2H32A 1X9RA 2VXSL 5BCAA 4GRWB 2R0WL 4KVPA 1FN4B 3QZNA 3O2WL 1U41A 3SDDC 1GGTA 1OM9A 1ZLVH 2PTVA 1F90H 4XVUC 4UDTA 3PP3H 4UANA 3QQ9C 5DFAA 3S8WA 1RVFH 5F6IC 5LAPA 2PTTA 1KJ3L 2F58L 2H45A 3OVUB 3K72B 4LRIC 5TJWK 4JFQA 3SO5A 1LE9A 1KN4H 1HIML 3FSVA 1E65A 3U82B 3QZLA 2UWEA 2G30A 1FYTE 1JWUB 4JFUA 4R0LC 5EF3A 4NQCD 4BZ2H 4XCYB 1A1MA 4TULL 2I85A 2VN4A 4Q8BA 3QJTB 2GSMB 4UV4L 3K5RA 3PAVA 5DSCA 2KL6A 3RWHB 3ULAB 4YGAB 1P7QD 3LD8B 5AKVA 3ZSTA 1QSFB 4G71B 5FO7B 1YEGL 4PJXB 1TETH 2WSDA 2BSTA 1MW3A 1KPVA 2IBZY 4LKXA 3D85D 3LQAC 1IGYA 3L3DA 5CKAA 4KJPD 1RZ7H 5FEBA 3NJGA 2AEPL 4Z7WB 4QOKB 4ZOEA 3D06A 4R97C 2MQCA 5C0BD 5E4OA 3HC2A 3FKUS 2F19H 4TVPE 4YEFA 5ERWA 2ZZUT 4J3OH 1B3JA 1MCDA 1SUHA 1ZHBA 5CJOH 1Q8MA 1Q9KA 3MBED 2YAOA 4K94L 4MMZB 4NNPH 4RQQB 1P4IL 5HGGS 2AAVA 1VFBA 3CSFA 5FF6A 5LAXB 4JKPL 3KYAA 4JB9H 2VL4A 5CLZA 3IDGA 4Z7UE 1BOYA 1OE1A 2HAZA 3CHPA 3R8QA 1F56A 2BINA 4JZOA 4WK2B 3DX8A 1QUNB 4DN3L 3VFSA 4ZTEA 3Q01A 4P57A 3F83A 5DMIL 3C5ZB 4JHBA 2QPEB 3VXOB 4OIBA 2IPUG 5HJDA 3QH3B 3GUFA 3LVEA 3MNDA 1NCCL 1RUQL 1A14H 3ZKQD 1GYCA 2IV9A 1QASA 1PKQE 3CFUA 2EDFA 5EEYA 2ROYA 1NTDA 5F7UA 2YRPA 1BQLL 3HLKA 3LXUX 3R19A 4ODWA 4AKPA 4HH8A 1RUKH 2DI9A 3D2UA 4PJ9B 3VFOA 5CD3A 2X1QA 2Q7YB 4X5XA 2W0FA 3US9A 3Q13A 1KLFB 2IVFC 5GHWH 4C4KO 5I17A 4K0OA 2PPFA 2X0WA 3VXNA 3IU4H 4W9GC 3UTTE 3P40A 3QE5A 3E7JA 3RWEA 3PWPA 2VXQH 1O7VA 4OZ4B 3TFKD 2NY5H 1A9VA 1R47A 2LGNA 1C7TA 3MR9B 2YUXA 4N8VB 4R84A 1J5CA 1SLVA 1R3HB 3TIDA 5J6GB 4MJIB 5IG7B 4JHAL 1OGAD 1IRAY 2ALAA 3DOIA 4ANUA 5L4FA 5ID1B 2YARA 1ORQB 3BT2H 1X4ZA 1YC7A 4FX5A 4XMLL 3PQYD 4X6BB 5F3HA 4OD3L 3RGVB 1SEQH 1WCBA 3ZE0F 4RBPH 1CLOH 2PTUA 5AEAA 4B60A 3KAAA 4GQQA 1I4FB 5JHBA 3PWUB 1PNCA 3PGDA 4Z23A 1Q9OB 2EVHA 4EUPG 1KULA 1LWRA 4CKQA 4ZSOB 3OZKA 1UM4L 2WVVB 1HS6A 3QUZC 4QXGL 4PSPA 3SY0B 3OKMA 1EZVX 1T7ZA 2R2HA 2JI2A 1ACXA 2NY7L 3C6EA 3KBHE 1T66D 4H4NA 3CSYA 2WTOA 4OT1H 2XA3A 1B6UA 4X83A 3ZQ9A 4AL8H 5HVFB 4PVBA 4JGUA 1KB5L 1F1AA 5E9DA 5K9KB 5LAXA 5FF6B 4W9DC 2J8HA 4X7DC 3VW3L 2CO6A 1I1AD 2H2PD 3U2JA 5IJVB 3WMPA 3EJZC 1XF2A 2JE8A 2IAMA 3HN5A 1TJXA 4KMQA 3RLSA 2E7HA 5B3NA 1BF5A 1WK0A 2PABA 2N56A 2O6DA 1L5GA 4DWHA 1F4XH 1PY9A 4WY7H 5BVJA 5J7CC 3P30H 3WKPA 5A2CA 3IDMA 3QO0B 4OD2B 5F0JB 4DP7X 3O41B 3IS1X 5IB3A 3E80A 3UYPB 3QHFH 2E0PA 4RCAA 4P4KA 5EN2A 1QSEE 3TT1L 2EADA 1BFVH 2OR9L 3I50H 4WW1B 1ZA3B 3CGTA 1PX8A 2X2YA 4BK5A 1S78D 1M4KA 3E8VA 4XN4A 3ROOA 3K6SB 2B2XL 2AP2A 5ABZA 2ALWA 2XWBB 5FM5O 2GY5A 2NNAA 3SE4C 2APVA 4AQZA 2FNWA 4HJUA 3AS3A 4EI0A 1FAKT 2GTZA 5E2TH 2YPLD 2WQSA 3V0IA 3EJUA 3ZQXA 4ZS7L 2O61A 3UADA 1FL5A 1QFUH 2IBZX 5I73C 4APQC 4NIYE 1O7SA 2WLIA 2XQYG 3KXFB 4J4PC 5B8CC 4L18A 4JN1H 4QRTB 3CD4A 4A68A 2ZP8A 4G1MA 4QTIH 3F01A 3DJSA 3QDJA 1JHKH 4Q6IC 4E0RA 5I6PA 1AO7B 1PD1A 2CO3A 2DWEB 3QPXL 3U6XS 2Y23A 1LP9A 4TOYH 3QFJD 4JPIB 2GBVA 4CSZA 5IIEA 1UASA 1FE8L 5JOPE 4H0HB 3DK0A 3HHSA 4HWZA 1XBDA 1GW6A 4OSUL 1UWXK 5E03A 4DGIH 3N6YA 3WLBB 2C9UA 4XCEB 3X1GA 1B4RA 5DQJA 3FO0L 4LLDB 1XGPB 2ZCLH 2BWQA 4NN7B 4NRYA 3ABMB 3U4AA 3KG5A 4EVNA 3PL6B 1TNNA 1JV5A 1MHEB 4LB8A 2D0FA 5I16B 5JW4R 1MFCL 5HJGA 4FNLL 2ZWNA 3BWAB 3CX5K 1YPZA 1R3JB 3UG3A 1KLUA 3ZQWA 1UCTA 3QI9D 3PWLA 4XO3A 1FO0H 3FYEB 3RYMA 1AZCA 4F7KA 2H6UA 3GSXA 3MBEB 4I8DA 4X9BA 5K5YA 3O9WA 1ZLSL 1WS7A 2PCPB 3IVKA 3S6CA 1PVHA 4BXSV 1QP1A 3FHQA 3W1ZA 2VWEE 4KKBC 2WQ8A 3PL6A 3QUXC 1RERA 1S7RA 2R1YB 1YNLH 4TVPD 3TVMD 4D9QE 4FI8A 5I1CH 2VXTH 1K8IB 3VFGH 5BVJB 2WBXA 1JVLA 5CGYD 3F12B 2F18A 1QFWM 2VR8A 2X10A 3DECA 1CLZH 1SZNA 4LLYA 4XNUL 5CWSA 4JG9A 4P5MB 2D7NA 1HESA 4IBWA 1NINA 5EA0L 3MV8E 2RTTA 4G6JL 3R1GH 1BAGA 1EHNA 2VUOA 4JY4B 3VWJC 5A2LH 3MO1B 1NCDH 3TEZA 3K46A 3ZE1E 4Q9RL 2H26B 3WEXB 3KJ4B 4WTXA 3HUJF 5AW1B 2AHIA 3WXVL 1FL5B 2R9HC 3FOLB 4HIIB 3RAJH 2DLGA 3I6LD 3H3BC 5HYEA 4OFYA 3W11C 3ESMA 4IM8A 2OR9H 1A47A 4PJAE 4X99A 3TT1H 1A7RH 2NW2B 2P5WB 5EBMA 1IE5A 3SDAB 2ZOWA 3ESOA 2AEQH 3EXLA 5BZWB 4QOKE 5LGJA 1QAWA 1MHHA 5JPMB 2BIQA 4W4OA 3D2UD 2JQMA 2WYHA 1G7IA 4AC2A 1OSPL 1ZY9A 3UEQA 3FRUB 5DUPH 3VD2A 4TF4A 1BAFH 5SWSA 8FABB 1DQJB 1PZCA 3GS7A 1ZHNB 4P3DB 1AXSA 5DUBA 3WIFB 5ADPL 4JFVA 3BUTA 3V52L 1LP9F 1SXBA 4TS6A 4FL4B 1MCHA 2DBJA 3ALPA 5K9JL 4LKCB 3UMTA 4LCVA 4H8HA 5FDWA 1HEHC 4HBCL 3RVWD 1DVQA 3BWUF 4A2FA 2HRPH 1RAMA 4B7IA 4TLSA 4KU1A 4KC3B 4AMWA 5KS9E 4JK0D 3H2PA 2MCMA 3ZKNC 5L4MA 1RHHB 2HG5B 4BSWA 1G1OA 1DJWA 1KGWA 3QORA 2KC0A 5HPMB 2N59A 3DXAB 5IB3B 2FD6L 2I25N 1KYOK 4UILL 5J4MA 5AVYB 3L7FA 5KYYB 2JJUA 5E08H 3EYOA 5F1NB 4QXWA 1AHKA 2BWDA 1MW0A 5AW9B 3QIUB 4GKOA 4GRWE 3LZNA 1CGUA 1KJ2B 2HJKB 5FW8A 2G9HA 4R7NA 3HMXA 1KYUA 3KYOA 5HVGB 1G84A 5J6HA 3F6IA 3GK8H 1IIIA 3UPAA 4FLOA 2WAHA 3C5JB 2NY4B 1TTCA 2XWZA 1XFPA 2H2SC 4PRPD 3FBQA 4PJFE 3C6LD 1H3XA 5BQ7A 5J5EA 5C0FA 5SWQB 1IKOP 4Y19E 1XMWA 5SX4H 4EE2A 1OW0A 3O4LB 4EDXB 2K6WA 5I18L 2MEJB 4GUQA 1YUHA 5DYFA 1S7SB 3BX7C 3PQYE 4UOQA 3HJEA 3KYNA 4M6NH 3GO1H 2HJFA 4KO5A 3QEQE 4EVNB 2E9IA 2VLJB 2E27L 4GXVL 4OF0A 4KV5F 5C07D 2Y22A 4ISVB 1QPKA 3R06B 3OL2A 2KH2B 4NQED 2C8NA 4H40A 3VD1A 2IC2A 5AVRB 3MROB 1QVOB 3AAZB 2DOCA 3HZYA 3AM8A 4HX1B 3MKGA 4QLRA 3TCTA 2Q76B 3CC5B 4PVMA 3WUZA 3U0WL 3ZKMD 1NCOA 2HT2D 4OI8A 4E9SA 1OCZB 3JV0A 4V1DB 1Z6JT 4ZUTB 2ICEB 1PJWA 4OKVB 3WNKA 2EIEA 3BKYH 4AXWB 1IM3A 1AOHA 1SMAA 2DEWX 2R51A 3ZXAC 1N4XH 1HL4A 3Q1SH 3RWGA 2ADFH 1J1PL 1DR9A 5DK3A 3JT2A 4IYKA 3BEVB 2BZDA 1P1ZB 1HQRA 2W94A 4Q6IA 1XGYL 2ZNWA 1ZANH 5IHWA 3GSRB 4WJ5B 4PJ5E 3GIVB 1UATA 4P2YA 1NCGA 1HYSD 2IPKB 4F7MB 2IPTH 2C3HA 1EFQA 3BP4B 4MNGB 1E5CA 2QR0A 2OMTB 5CEZH 2CKBH 4GXUM 3QAQA 5J9PA 3UTTD 1CXKA 1MCPL 4R8WH 1SLUA 4W4NA 3VA2C 2CUHA 5D2LB 1UH4A 4W6YB 1CIDA 4WSKA 2OX5B 1A5FH 2XRAL 3KCWA 2ZXEB 1VCBC 3LKSA 4POUB 1NGYA 2PMZA 3FU9A 2XTJC 3DO7A 3T3PF 3IKCA 4X80H 3F04A 5B8CB 3FFDB 1SVZA 4IBUA 1C9SA 2AEQL 5KN5B 3B3BA 4DUWA 2FATH 4N5ED 1LK3H 1E27B 2OJZL 4Y1AE 4X6CA 1U8CB 2C26A 4WFGD 5DUBB 1KELH 5E6SB 4WJKB 4I77H 4PLJD 5HHVH 4P4KC 2X2UA 3QXDA 2Y3AA 2E47A 4FLSA 3P9MA 1NAMB 4LAJH 1OT2A 4BK5C 1I7UB 3RZCB 4E41A 4ZYKA 5KTEH 5L6YL 5DJ6A 1Z3GH 3QZWB 5D55A 3PDOB 5E6IB 5LGJB 4NQEA 1BJ1H 4B97A 4MNHA 4AT6A 1LD9B 2Y1ZA 1JS4A 2YLKA 4XP9H 5GS1B 3FT2B 1SOKA 4QNPF 2YAMA 4CW1A 3GMOB 1RUPL 5CLXA 5IHZA 4G59C 1WWCA 4MTMA 1BM7A 4EIUA 3ULVD 3QRGL 2E9WA 4AUJA 2ZQKA 1YNLL 3CCHB 1A1NB 2OYLA 2OMNA 4AXWA 1E90A 1U3NA 3F7LA 1RZKH 2NYYC 4Y2OB 4CUCA 1AD0B 2VIRB 1EZUA 4BFOA 1R1CA 3NDZE 3L5WA 2YBRB 5C92A 2W65B 3QW9A 4MMYB 4MRCA 3H7BB 4O00A 4PJHE 5GRWA 4A37A 4MXVF 4O9HL 4JUSA 2YD7A 4KJPC 5CD3B 4JL2A 2YD0A 3SEPA 4G8EA 2LR4A 5JYLA 2GYSA 4NI6A 1NZRA 1UWXH 3P3SA 4ODWB 4MJIE 1OP9A 4MJ5B 2MJWA 1E28B 3C5JA 5AW7B 1ZTXH 5AAPA 3QJFB 4QRUA 5J9PB 4GBXB 3LQMA 3C2AH 2EH8H 3FO9A 3QO0A 5CSZB 4JRXB 1MVYA 4M8RA 2VO8A 2X4SA 1U91B 1BXVA 3DX3A 2VJXA 1AR1D 1IBFA 4R5XA 2CD0A 3N5AA 2PW2B 1KJ2H 4NJ9H 2F1AA 3WJLA 3WS3A 3ETBF 4RGNE 1ZXQA 3V4UL 4TNVF 2NY4D 3HAEG 1I7RA 1JRHL 3WV0A 1MNUL 3O9WD 2D9CA 3ZE2F 3NP3A 5F7LB 2QHRL 4YK4B 4TL5A 2O6CA 4UB0L 2VLKD 1I7TA 2UZYB 1ZHBB 1B0GA 1R46A 3LEVL 3EJJX 4I0PD 4ZMQA 4NM8L 1R4XA 5HYIA 1NCAH 4O51B 4K3EL 3UL4A 4FXKA 3IFPB 3ZVVA 4LESA 3RY6A 5EN3A 1I9JL 3RFZA 1SLXA 4HUKB 4IMKA 2DDQH 5C0AE 2VLJD 2F53A 4NFCA 3U4BL 5AVTB 2FX8L 5AW3B 4JFWA 2H8PA 2OMWA 3IM1A 4KNTA 4DUXA 1UB6A 1REIA 2YWZA 1OP5K 3JWOC 5C0IB 4UT6H 3SD5A 1ZGLM 3HC0B 5HYJA 2ROXA 4FKHA 2QHRH 3IMSA 5AB9A 1JK9A 2C4XA 1UZGA 2DEXX 4PS7A 1DVFB 4G43A 4N0CD 1G7HA 4B0MB 3TOPA 3V0JA 5E9NA 1DHKA 3HZKA 4PTTB 1TZGL 1ETB1 3JV4B 4KBPA 3FRPB 4U3SA 4PHZA 3FCTB 4ZDHB 3CFIC 3NUKA 3Q44A 3DROA 1A6AA 2BSRB 2VM9A 3E6FA 2MMXA 5E99H 3UIZA 3MZTA 4XNZC 2PR4H 4H44C 4ODHL 3C5XA 4PJCA 1NL0L 4E42A 2YLHA 5HYFA 5E00B 3H0TA 4ANWA 1RVFL 1QSEA 2B5IC 4NN6C 2H0FA 4I48A 4AE1A 1B0IA 4YSEA 3RJOA 4IBYA 1H3UA 4I18C 1N6UA 1Z9NA 3ZU8A 2YD5A 3ASOB 4OGQC 5C0CE 1BDYA 1CXIA 5KVFL 4JPWL 4QXGH 5C09E 1TQCB 4BH8B 3PRZA 5B3JF 4KAQH 2EE2A 3PHAA 3L1FA 3TJEH 3CPLB 3IJ9A 4OJFL 1E9OA 1N64H 3FB6A 3BW9A 4Z7WE 3CLWA 4EUPA 1IM9B 1CLVA 3ELAT 1N67A 4QRTA 2GJRA 2H3NA 1U9KA 3PIQB 1UM6H 4XMLH 1FNSH 5D2NE 3EOBA 3GLZA 3I9AA 3KXFA 1F1GA 4KMTH 3CZLA 3JWDC 1YNKH 4HPOH 4QD2E 1PKOA 3HUJE 1K8DB 2XSKA 4XTRD 3VSVA 4LO9A 3V7AG 1F3JB 3BIKB 1SHMA 3AACA 4AYDC 5C0DB 2FL5B 3RU8H 3SBPA 1MH5B 3HJ0A 4XO8A 1A6VL 2A7BA 4BE5A 4LLYB 3IU4L 3QCUL 4FFWD 5MI0B 1XGPA 3MLZL 2Z34A 1EMTH 4K55A 5BV7B 2Z1PA 2XX0A 4KNSA 3DGGB 1G7IB 2MKLC 4G6FB 3MNMA 4OLUL 3HPLA 4YO0A 4EDWH 4U6YA 1TENA 4J3OD 5LN8A 4ZO6A 1XB8A 5SX4I 4QHMA 4KKLC 5DSCB 1OAXH 4OF8A 1INEH 4KVCL 1UD5A 4LE8A 5J06A 3EYUL 3NFSL 3OKOA 2EDDA 3ESUF 3F5WA 1KB5A 2XNAB 4H13C 5CAYB 2F68X 3H4HA 1JCVA 3C8DA 4YHZH 3LHPH 5ICYB 1BZ7B 2XQYA 3QARA 4Y19A 3MV7E 1MCPH 1FFNB 1ZAGA 4JO3L 4LEOB 2HSIA 3QJHA 5ETUA 4RSYA 4MA7L 4PIRF 3OX8A 5E94A 2Z91B 5IVZA 5T3XH 2A2QT 3SYPA 4DGYL 3B2PA 1T1ZB 1JZIA 4M6AA 3MXWH 5FM8A 5I9QB 4GSRA 3CFQA 2VWEC 1CG9A 1Z0MA 2YPKA 3IDYC 1A7OH 2DQTH 2XYBA 4UOW0 5MEPB 3LN5A 3ZDZF 1YN6B 4JRFA 3H3PL 1ZA6B 2P1YA 4X80L 2XZQL 4LVHC 3PV7A 2NTSP 4Z0BL 1S3KH 3X11B 2P80D 2CALA 5JORA 3DBXB 3N0AA 3NFNB 1JZ7A 4KI1A 1IKNA 3MRBB 4DFIA 2CE6A 3FUMA 2IF7A 3G6AA 3OAZK 4M3KB 5DEFA 1A7PL 2CDGA 5DJAB 1TQBC 3HBQA 4WCYH 4KDTC 2G9KA 1FO0B 3WJMA 4QAMB 2KLTA 1T1XB 2PKDA 2XN9B 3JWNG 3V5KA 1NGWA 2J44A 1KGIA 4M6OH 3SJVE 5CM1A 1RK0A 3MBEA 2WMPB 3LVTA 4TV3A 4IRZA 1FORL 2YD9A 1EGJL 2A6JA 3APMA 2ED9A 4X42A 5E2VL 4ZFGH 4UUJA 5I6NA 2ZXWB 3G6AB 2P28B 3UO1L 3GSNH 3SDDA 2WVVA 3EZ8A 3KYOB 15C8L 1N8ZB 4HU8A 4Y4KA 4P3CH 5JPMC 1SFHA 1MHPL 4XHJC 4O58L 1QRKA 5AL0A 2XTJB 4LLUA 4Z3FA 5FYKL 1KJVA 5I24A 4NQDE 3WJLC 2PP7A 3PWVB 4XPAH 4YJZL 1R3LA 1Z9SA 3O0LA 1DVYA 1LK2A 1G7JA 4XCYA 4XB3A 2EEDA 2MQGA 5HPMA 4NQSA 2BVPA 4UAHA 2WY3B 2WXQA 1BJ8A 4XWGH 3OPZL 1ZPLA 2WLIB 2NY3C 4D0BA 3DGDA 5A2JH 5JHMA 4LVOC 4OGAD 3GSNA 1BREA 2CBPA 2ZJSH 3X3GL 1H6UA 4BD4A 3RZCC 3DROB 4AG4H 2CDFA 4P59H 5BRZE 1KCUH 3VI3F 4JQIL 4NFDA 4WO4B 5JMRA 1BPVA 3S3BB 4UU9A 4OZGA 2W81C 1S2EA 4L1SA 2OK0H 4D7PA 3BPOC 3C8HA 2P8PB 1RIHL 2R0KH 3LTVA 1MFAL 1DEDA 3WNPA 2FRGP 3IB4A 2P7TB 2Q9OA 1BAWA 3FCBA 4MQ7B 5FYKU 4NOBA 4I0KA 4JQIA 4GG6F 4PWGA 5IF0B 3QIBB 5KZCD 2HRPL 3F6JA 3HHMA 2F5BL 4WHDA 1MH5A 5D96B 4M6OL 4XX1E 3SZ6A 4JFZL 4MKTA 4QJ5B 2VGLM 3DRTA 1K6QH 2F7OA 5IVZB 1JPGB 1NMBL 1X7QB 2I24N 3QNZB 3OJMB 3DVNB 1NCJA 3MV01 3CFBA 4X7SH 4MSWB 4ZPTA 5CGYC 4AYMC 1J5HA 5C09D 2VRQA 2DBLL 3J07A 4Y2NA 1ZHLB 3NA9H 5F7YC 2MOGA 1NFDF 3G5YB 7FABL 4IMLB 3QUXD 1O7DE 3V4VH 4EXKA 5C0NC 1ED3B 1U0QA 3FK3A 3AY2A 4PJBA 2NNFA 4CN6A 3KGTA 4I77L 1RULH 4S1RL 3NCWA 4TLKA 1RSFA 1DJYA 2NZIA 1MW2A 1Z7JA 2DLTA 3L9RB 4H8WL 3CFCH 4WUKH 4NSKB 5LDSA 3MRRB 4FQ2H 2EQDA 3VGDA 2YPVA 1H3WM 3WXWL 1UM5H 1THAA 3DUSA 1AZNA 4P57B 1MI5D 3JTTB 3WL9A 1BBJB 1W0YT 2Y69B 2NYZA 3QHFL 4MQXD 3GZQA 5F7NC 3NZHL 2KMWA 2YKLH 4F15C 5JLZA 1LO4L 2A1WL 4YVNA 3VXME 3KWTA 3MN8A 3NN8A 1EDHA 2QQQA 5CCKH 2GI7A 4D9LH 3MGOB 3P11H 4AJYV 7CGTA 3VMOA 4I13B 3HFML 4NQVB 3MRMA 5BW7A 3G9VA 2EYSA 5HDQL 4MNQB 4JBSA 1S7XA 3W9DB 1OAYH 2DV6A 2LABA 3BN9C 4G8IA 4UQEA 3V6BR 5D7LE 4JDEB 4UQ9A 3OBAA 3IMVA 1SJHB 4ODVH 3QBTB 3V4LA 3LDBB 2BC4A 2X4TA 4QKXB 3RAJL 1TYEB 1OT1A 1Z5LA 3L8QA 1I9RH 2ZYHA 1AP2A 4XH2A 1NAKL 1FJ1B 2D3VA 2GQHA 4K5NA 1E67A 3Q43A 1H0DB 1BM3H 2KQNA 4XC3L 1SPDA 5CIPH 1LP9B 2BIPA 3L3HB 4FTVE 5E6IA 2LV4A 2VAAB 3AUVA 3N1QC 4HU2A 1N4XL 3OTTA 2OR8A 4U3XA 3DVGB 4YHLH 3KM1A 2DTML 2WQUA 3MCKB 4XCFH 3HC3H 1E5ZA 2WN2A 2ZUTA 5AZ2H 1G9NL 3NSFA 2IALA 4OZFG 3GDCA 3TBCA 3L13A 4ZMOA 1KBPA 1QNZL 2GBAA 5GRYA 3VFPA 1HCFX 4HV8A 4ZMAT 1RZGB 5IHHA 2XKNA 1KYAA 1ETZB 3G04B 3FTWA 5ICXB 3UMNA 4QY8B 1IJ9A 4OBRA 5K1JA 2Y7MA 1LD9A 1CYGA 4MNHB 1B0WA 1HHIB 4YSPA 4AT6B 3FCUB 5FGBA 3KPTA 4EZLA 4G7VL 2GG1A 2VAJA 3GMQA 1O5DT 3U7AA 1MXGA 1G94A 4XAKD 2PW1B 3B5GA 5BRZB 3IMWA 4YFLI 4I3GA 4MD4A 4HC1H 5DURB 3HE6A 3RL1A 3Q2VA 4AENB 4KZEH 2OKMA 1RUKL 4N90E 5J1SC 4P06A 4KZEL 1BQ5A 1GZPA 1ZK9A 4A6YH 2UY7A 4M6ML 4POYA 1QTYT 2EDLA 1DBKL 2JVUA 3C60B 4G7YH 4YMPA 5F6HJ 5IBLC 5KVMC 4FLHA 3TEWA 4LLMB 1R5VA 4X4XA 5H4YA 3QUYA 4LRIA 3ZO0A 4ZXBD 2AV1A 1I7ZB 5LCVL 1OQXA 2Z4QB 3L95A 1FH2A 2WXNA 2HFGH 1HNGA 5FXCH 5CSGA 2JXMA 1SJVA 1U8JA 3BKML 5EPMA 2HVBA 3WJJA 3WY3A 5CLYA 5JHDD 3AREB 1I9EA 5ADPH 4OM1L 4ENED 4FZ8H 3IMBA 1IGJB 3AXLA 1F42A 3EO1B 4JEGB 5LCVA 3K6IA 1C5CH 2W88A 4X4MA 3WS3B 3TBTB 3L7EB 1PD0A 2QKIC 3SSGA 3WO3B 1KN4L 4P2QB 1AIFA 3QZPA 4Z3GA 2AKRB 3BVNB 4HGWB 2AJXL 2V7HB 5JNYA 4K73A 2YXWA 2YEZB 2NUTA 3FQTB 3BMWA 2ETWA 1AQDB 4YHNA 4B9KC 4MJ5A 4JFEE 4LVOB 1FFOA 5HGHA 4I1NB 1XXFC 3Q8FA 3L3OA 3NGBC 2HG0A 2XZAL 3GWJA 5JHAA 3FTXA 3V52H 4KO9A 3H6JA 4DAGL 2VLJA 1E27A 2OZ4H 2J8OA 2PPEA 3MV7A 4HS8H 5ACZA 1KG0B 3E6FB 4NX0A 3RKPA 1S5IL 5DZJA 3IU3A 4UQBA 3AG1B 3N44F 5ESQA 3HA0A 1R5WA 3LEXB 2CO2A 1JTPA 2AQTA 3TJHD 4D7BA 3ULVH 3CCHA 1IGCH 2E86A 3UG4A 1WAPA 2VUKA 2TRHA 3QNXA 4N6RB 4HEPG 1U36A 4NZDA 3QUXB 4JY5H 4WDIB 4LAQH 2EDOA 3OC5A 4A39A 4YE4L 3ATBA 2VLME 2CGZA 2JWYA 2DQFA 2BNQB 2JSFA 3M1OA 5FCSH 2Z8RA 5ENWA 1ILSA 3WD5H 2AGJL 4POZC 4G80B 1QZ1A 5F1SA 1CC3A 2G9HB 4OIAA 4NKDB 1RKRA 3U36B 3QIUA 3H2WA 3VXSE 4FG2A 5FX3A 3HVDA 2JB6A 4Q6IB 1U8KA 1QA9B 4PGEA 3K0YA 5B39A 1E4KC 1QBLH 4KVCH 2HJLA 5I5JA 5D1ZB 1CYWA 5TQ2H 4Y9CA 3RX7A 4WFED 3QORB 3GLDA 3QUHA 3T65A 1MFVA 3B56A 3H85A 1N3NB 1J7VR 3VG0H 1MCOL 1VA9A 5EBLB 4HKZA 1QI5A 1WFMA 4Y2LA 3Q05A 1YRKA 1EFXA 1OF0A 1DBAL 2QSTA 2VDNH 3MLZH 3U48A 4Z7WA 4OSUH 2Z8VC 3NJNA 1SN0A 5K9OB 2DI7A 3WE6A 5IK3B 1R5VB 4X4XB 4ZX4A 1T03L 1I3VA 4MXQD 2XG4B 1KELL 1GCFA 3T2NL 5TK4A 1SFDA 4PYHA 4GKZB 1QQDB 5GJTH 4K94C 2BY2A 1PLGH 1ZT7A 3ASNB 3QUZA 2B16A 1ESOA 4DH2A 4RMBA 1F11B 4JR9L 1FZJA 4NOFA 1KTKE 1M6OA 3MRKA 1MAML 2ZD0A 3T5WA 7PAZA 2ZF8A 2N4IA 1OTSD 3TO2A 3LSOB 1GJIA 4OI7A 2R4SH 1C1EL 3GLAA 3QAZC 2QZQA 1AD0A 5GISL 2VO5A 1A64A 1LO0L 4MCYA 4OH2A 4KROC 3TNMA 1A5FL 1YMMB 4PLKC 3ULUD 3UOAB 4XNMA 1GGCL 3KPRE 1DANU 3S8GB 3KPOB 1QFPA 2ICEA 4AVJA 3LRSA 3KYKH 1OXYA 4YHNB 3UAFA 2BXZA 4DKTA 1A2YB 3BKJH 4XPHH 2FE0A 3RVUC 3PGCB 1CF8L 1PKQB 1QVOA 4PS4H 3KWWB 3T3MB 4BRVA 5T33L 5BO0D 2QGDA 4K5OA 4CVZB 2ZSVB 3ECUA 1W8NA 3QXDB 1JGVL 2I7OA 3GZPA 3MGTB 1INQB 4Y5VB 2VLKA 4B95C 3KL0A 4NDMB 4X8XA 4Y4FB 5I75C 1T04A 4P2CG 1BG1A 2PWDA 3U0PA 2P4AB 5LXGL 5ALCL 3VFRB 3CDZB 3HAEB 2YA1A 4JFPB 5B8CA 5D6DA 2DD8L 1MEXH 3CDCA 2ATPA 3ZLQC 3QUYB 1E4WL 3U2SA 1KB9J 3BH9A 2G60H 2IAAC 2VDQH 5D7IA 5E5MA 2HPOA 5MEOB 1K72A 3LIUA 3MLRL 1IC1A 4FTVD 4YHPB 4P2OA 4M61A 2EC9T 4JFOB 4QDGA 2ZG3A 1JV5B 2VC2B 4M5ZL 1EHLL 4UDUB 2ZSWB 3MFFA 1INEL 1BVKA 5MEND 1EWHA 3HNSL 4MMZC 4NJAH 5HYQB 5AAMC 4K3EH 1IC4L 1E9PA 3VGBA 4LP8A 3KPNA 3LH8A 2C3VB 5E9AA 4KJYB 4GO6B 2F0CA 3LMJL 4YHKL 3PPSA 1ZHKA 4GG6A 2E9JA 4NPYB 5KSBE 4KQ0A 4R97B 3UH8A 2ZUSA 2GSIB 1OGPA 2OSLB 3JWOH 4PJ9C 1AO7A 2WW8A 4LHJB 4NHCH 1DL7H 1N0LB 5L9DH 1FNEB 2QQNL 3VGAB 3T04D 2F7RA 1EPFA 5FV1L 3QUYC 4YBLB 1GGCH 1D5IL 4BSVA 4OGXH 3EYVB 1V10A 1HOEA 4NKMB 4HJJH 1P84K 5I1DA 5E51A 3FONA 4PLKD 3RWDA 4AYFB 3PL6C 4XNZB 1DVZA 4L4VB 1BVLA 4G1EB 4LARH 3NK3A 5K93A 4U1MA 1HHKA 3RVTC 3C5ZC 3W81A 4YL9A 4BYHA 3A4AA 3NIDE 1ZVHA 1ACZA 5DJYA 3TBWB 4Z7IA 5IWLA 4NYLA 2O72A 2FJGB 1HZKA 4C54A 1P7QB 2DWEA 4WW1A 3VD7A 2WTPA 4L37B 2X0VA 3WKMH 3O3BA 2OMZB 5PAZA 3C87A 1V3MA 3BO8A 3JV6B 1HZHH 4JO2H 5IFAH 1TTRA 2K4AA 3RDJA 2PCXA 2I7SA 4JPWH 5D5MA 4U05A 1OPOA 5BZWA 3RNKA 2YBGA 3MNZA 4F57L 4JHZA 3BWZA 2MCPH 4X9IA 5FECB 1D2PA 1RHFA 4H88H 4UCFA 3ESPA 2G3XA 4IRJA 4GOSA 5HJBA 2K7PA 4DEUA 5IHBA 4GKNB 1HXKA 1KUMA 2ZCKL 3QORD 1FNSL 1WC7A 2FCBA 2RFXB 4P4RB 3ARQA 3CN4A 1CTNA 4M5ZH 4WI0A 4JFHE 5ECJE 3TO4D 3HBZA 4CNIB 4LVNC 5KSAA 3HVNA 3WCYA 2G75A 5JUEL 1K4CB 2R1XA 4IU2B 4AZ8B 3D9AL 4PJEE 4B9CA 3NQKA 4ONHA 8CGTA 3B8SA 4Y16D 4OCYL 2L7QA 4WFFE 2XWTB 5DI8A 2Y2TA 4KK5C 3O3AB 4DAGH 5DGQA 5HJ3B 2APWA 4HIQA 3EFDL 4NPJA 4EN3A 1R24B 3ZDYB 1CFMA 3F2LA 3GS4A 1SQ2N 1WITA 1WF5A 4Z76B 1UEYA 3R7QA 4AEIL 3ARPA 2XPZA 4YWGH 2O26U 4YSSA 1UGNA 4MLSA 2RAMA 5DK2A 1P6AB 1RZJL 2IBBA 5IFJA 3KZ8A 1TYRA 5DUMH 2YEQA 1G7MB 3DARA 5LNEA 2XQ0A 4PRHE 2JJWA 3NJMA 4P8QA 3NIGF 3G5VA 2AXFA 1XQ4A 2PCPA 3IVKB 4JQVC 4IRSB 3MUGA 2GEEA 2PWGA 1E9QA 3L17A 4RAUB 4FTVA 1OCWH 1B0RB 3ETTA 5I1KL 3RB7A 1CZ8H 4NO5B 5BV7C 3BZ4B 2CBQA 2CKBL 2PUQT 1BMZA 3O0RL 1FCCA 5IW1B 4JFFE 3V0DA 5I1AB 2XA8L 2Z6FA 1TEYA 1J8SA 2CHXA 4HCRH 4Y1AD 4HWEL 3D08A 3EDFA 5FV2A 3IRZA 4K71C 2J8UF 4N0UA 1BZDA 3MUUA 4PBWD 2GVYA 2ZXDA 4BCXA 2A99A 2A9NH 1X3DA 4FQXD 3TH4T 4XOEA 1YMME 4X0KB 4N5UA 4QYAA 2Y25A 3RPBA 4A2LA 3T4AB 4YC2B 2MQ3A 4FOMA 5FOBB 4E2OA 3C12A 2ZKWA 2E7LA 2ARJQ 4Q0XL 3HRZA 1A6ZB 2DICA 3U6RB 4QPEA 3RNQB 3FF7A 4WRLA 2NX5B 3CZUB 5HI4D 4P46A 3C6LA 1GZHA 4JY6A 3TF4A 5E9DD 3T0EB 4HJ1A 4KDWA 2Q6WB 4PRBB 1T03H 4PCYA 2VLRA 4RGOL 4ACTA 5BZXA 4FG6D 4NI3A 3B37A 3QDGA 1GCYA 4TUOB 4NP9A 2EIJB 2RCSL 3H55A 1D7DA 3TIEA 4NAMA 3QI9A 3LRHA 5L2JA 1NBVH 4JG0H 3CFEB 3SHSA 3P02A 1S7VB 3UJJH 4Y88A 1MWAA 1M71A 2NW3B 3VXPB 5HI5C 1N0LA 3KL3A 4Y5VC 1IBZA 3N06B 1KIQA 3O4LE 2IMNA 2WQRA 1N9PA 2X70A 3N1GC 4IOIA 3H1ZA 5FYKD 1QX1A 1RPQA 1T0OA 1QFUL 1DVFC 2J8UB 1NBYA 3OXRB 4GRLA 3L3OC 4ZS7H 5J13B 2X3AA 1K4DA 1DCLA 2EO1A 3GHBL 2HX8A 5ABAA 3ZKMC 3VXRE 1NIFA 2CKBB 2WWMC 2EH7H 1XF2B 3CHOA 1V8HA 5KSAB 2WXHA 5E4AA 2DLFH 5GRUL 1JF5A 3WTUA 4N1HB 2CO4A 1HH6A 3SQBA 1PEZA 3N1MC 3BH9B 1BFVL 1EFXD 2KZWA 4RMRA 3UTZB 3S36L 4S2SB 4WWPA 4NP4H 1Y18B 1XL6A 3SGJA 1ACYL 1D2OA 2EUZA 1E30A 2WZ6A 4UZUA 3P77A 5FO2A 3OXRA 3VM5A 3U79A 1UOLA 4OZGE 1MW1A 2AJSH 1BD2E 2ZCZA 3J27A 2OMBA 3VCLA 3KR3H 2EE0A 5EU6A 3C08H 3KS0J 4YPGB 5EU4B 4XNYH 4NCC1 5AAMA 4XP4H 2BHYA 3ZR5A 5FUZH 1BVOA 1S7WB 4HIXL 2JKNA 4L9LA 4Y4KD 2XXMB 1N59A 2VDOB 1EHXA 4XXWC 3SDDD 1WAAF 3EH2A 2ZWYA 3QRLA 3DX8B 2AXGB 5C6PB 2B1AH 2DYPA 3VFVA 1KBBA 4XPFH 5ICYA 4B9FA 1U21A 2H6PB 1OCOB 2G75B 2QGEA 3L3GB 2YMOA 3L16A 3CXHJ 1IX2A 1WG3A 3HNSH 2Q6WA 2BP3A 1UKQA 3B8YA 3PJLA 4I3SH 3UAJC 2CUIA 3TVMC 1NGZB 3WUWG 4JPKL 3O4OC 4HAGA 1OTSC 4C4UA 4Y5XA 1QR1B 1S7UA 2VXQA 1WBXB 1UWGH 3INUL 4G6ML 5DD0L 2Q2EB 2Q7YA 5INCB 4ALAH 5HDOA 4ZMZA 5C8JA 5IV2A 1NEZB 1HILA 2NY6C 2Z7YA 4HCIA 4ZUWB 2AXFB 3O2DL 5TH2B 3O6KH 3T4AA 4OU3A 2JKRM 3IRCA 4JFEA 1L6ZA 4N8PA 4WI5A 4WQOA 2EKJA 2FX7L 3JV6A 3VQMA 4S1RH 3WTTA 1T5XB 2BHFA 3EGSB 3EYFA 3JXAA 2CHWA 2UV3A 3QWRA 4GEIA 1JNLH 4R2GC 4O02A 1ID5I 2WVTA 1YYMH 4PGBB 2NXYD 4E9RA 3KLHC 3D0VB 4R9HA 2GK2A 4NO5A 4GAYA 4KO6A 5DFWH 1IBGH 5I2IB 4KUCD 2WO3B 5GRZA 5F96H 5L8KB 4HJTA 4FXGB 1OB1A 4H1LB 1KXHA 4RX4D 3H9HA 3K71B 4IOFD 2ZYRA 4OFYD 3EDKA 2H4EA 4XPBH 4TQ8A 4A04A 5HI3C 5AD0A 4HPYH 3VXTB 1GS6X 4LCWA 4Z95H 3PGDB 2GI0A 1SNRA 2WK2A 3RX8A 3QUZD 4F15B 5EIIG 3IDYB 2COVD 4HHAA 2B59A 1YEKH 1FZMA 4WHYH 4ZO8A 1I7RB 1YEKL 1TJHL 2XETA 5DMKB 4L1HA 1AI1H 1Q9LA 2CCLA 5C0RH 5ACMA 3CN3A 1FSKC 2XJKA 1W15A 2Y06H 1NWPA 1PIFA 3CV5A 5LGKA 3WTYA 3BSHA 3FO9B 3KLDA 5DO8A 3QXTA 43C9B 2BNQA 4XNAA 4PY7B 1P5UC 3MYJA 1WYJA 4WK4B 5FR3A 3X3GH 1OANA 3QC5X 2VJ8A 1NMAH 3B2UC 3LPFA 1P7KA 2ZCLL 5IQNA 3FO0H 3KPLB 4JQVA 2Q86B 4BZ1H 4QI3A 5C97A 5I15L 3H7BA 1KWGA 5E2VH 3ASWA 3HTLX 4AC4A 1N5YH 1G7HB 4GIAA 4HIEA 5LN4A 1UXWB 4JG1H 1YEGH 3D69B 1MJ8L 1MLBA 3ES6A 3FCSB 5CMAA 5C08B 3BLPX 3UERA 2FO4B 1QTSA 4NQTA 2G2PA 1IGML 1TG8A 1U93B 2G3NA 3D4GA 1XZWA 3MRLA 3UDWA 3RJDA 1S9KC 3IN0A 3RX5A 4YDJA 5AKSA 5TPWL 3V9EA 5IMLB 4JPSA 1PIGA 4AIZB 4RISH 4N2LA 3W0WA 4MNQE 3FB7B 3S48A 3ZR6A 2P24B 2ISDA 3UZQA 3O3DA 1R3KA 2AK4E 4WO4C 3RX9A 4XP6L 1I1AA 1JG9A 5KSBF 3KPMA 5JO5A 5I1EL 4Y2DB 1OAZH 3RZCA 1BD2B 5K33A 32C2A 1F4YL 3S37X 2DF3A 3FH7A 1UKTA 5KOVC 2HN7A 2OTWA 3WHE1 3AWEA 4YQXH 5CF3A 1J9TA 2NDGA 1D6EA 4XBPB 4Y5YC 4QHKI 3BD4A 4M61B 4PJ8C 5EMYA 1SXAA 2AJZB 4ZK8A 2HVKB 4FG6C 2NY7H 1VLXA 4UIMB 3HE7C 1HHJA 1KCWA 1GOFA 5LKNA 4QYOB 2CSPA 3QXWA 3DOSB 1QO3A 4HA1A 4P2RB 3V5DB 2TRYA 3MACH 2BERA 1HN1A 4G70B 3S96A 1YCSA 3PQYA 5ANMA 3DTUB 1AS7A 1HCZA 2WQAA 4LKXB 5C07B 1FH5L 1Z66A 4CC1A 1QNIA 1T04B 4NPYA 4C55A 2AQ2A 2J6EH 4P04A 5GGSB 1W0VB 2V2XB 3JTSA 4HUWA 1USZA 4U1SB 4AK2A 4GKZA 1JZEA 2V17L 1JD9A 1DVXA 4NNXA 1OAKL 4KKAC 5CJQH 1NSNL 3ENEA 4P2OB 3D52A 2XTSA 1ZS8A 5BV7H 5E5MB 2Z7WA 4RX4A 4GKLA 5FUZL 5I1IH 3CDGB 4Y5XC 2FSEB 4K4KA 4F37F 1P2CB 3VGFA 3DVIA 2I5YL 2JIXB 3D18A 1M1SA 5EU5B 3GEFA 1ZRUA 3QDHA 3T4AC 4FQHB 1J5OL 2HN7B 4I87A 4M1DL 4HKBA 5FO9A 1HKLH 2LVCA 4JLRB 3TEXA 1UZ8A 3H9SB 4ZPVB 2J1ZA 4PV9A 1B4JH 1RMFH 3A4EA 3HRZC 2GB2A 3QHTC 4D9RE 5EWIL 4L9LB 3UTTB 1R0AL 2XI9A 3CBJB 1LO2H 1JUFB 3CZNA 1A6VH 5CBAB 1T0NA 4NKIH 4YLQT 4G7YL 1ES0A 2V5SA 3G6JA 4K3HA 5I30H 5IR1B 2EDQA 3AB0B 5CEZD 5HY9B 1ZSDA 1L0XA 4FZEH 4LSSH 1IAIL 4X9HA 6CGTA 4JJOA 3F85A 4JJHA 4ZMXA 4O58H 3RGHA 2PYFA 2VMJA 5F6IB 3IFNL 1OPGH 4NBZB 2YO3A 4DEPC 3T08A 2JXMB 4HHWA 4NENB 1DP0A 4UIMA 5FW7A 4S1DC 2VE6B 4AYGA 3US0A 3DX2A 1LQSR 2PR4L 3BGMA 1T0PB 1N5AB 5SWQA 5C0FB 1H15B 4NUJA 3H53A 1DBJH 4TL4A 5I66B 3GXUB 4GKSB 4AM0Q 2WHVA 3MTRA 1F8TL 4XWGL 2VW4A 5KBLA 4OAWB 4PG2C 4HWEH 1J12A 1X9QA 4FFVD 3UBXG 1E4WH 4RGMB 4FQ1H 3IT8D 1W0VA 3JTSB 3KPMB 2AC0A 3LZPA 1P5UA 1WZKA 4U1IB 1G7MA 1VFUA 1ZJAA 4R7DA 3HC3L 4JFYB 2NY3D 2WLYA 5DMKA 1PY4A 2AKRA 3H9SA 4FYQA 2BMKA 1GZQB 1A3QA 1EVTC 1K3ZA 1ZSHA 4A2EA 4D3CL 1F13A 4GKSA 35C8H 1KBGH 3EHBD 4Z0BH 4JFED 4ODHH 2XWTA 5DI8B 4IBZA 4QT5B 4C4KT 5CEXA 4GG8B 1NAKH 2I9LA 2AEPH 4OKVA 1YQVL 4NKOA 2F15A 3F65A 4EBQH 5LLIC 4R90L 1NPUA 2PO6A 4RA3A 5IEHB 3CU7A 3GMLA 3MRIA 5GSRB 1QA9A 3AXHA 2D7OA 3S35H 4QHUA 5JO5B 1MJ7L 2WAQA 4GIOA 2CH8A 3Q8BA 5C0GB 1G87A 4PJAF 3N43B 4B5ZA 3T0XA 1M3IA 4X6CE 1CFQA 5K9QG 2NSMA 4DZ8B 3IK2A 4QTFA 3G7TA 2GFBA 3UYRH 1HQ4A 4K2UL 3N91A 4U3HA 3LQAH 1LJMA 5ISZD 4WV1B 2FVNA 4HSQA 2FQFA 3CSTA 3HNVH 4FI7A 4EI5B 3S36X 1CMOA 1XEDA 2APFA 5ANMB 1MIML 3IFNH 3K6FA 5FK9B 5I8EA 5C3TA 4HBQA 4Z77B 2X9WA 4R96B 2ZKHL 3CLEL 3GQFA 5GRUH 4F2ME 2CHZA 2ITCA 4PV8A 3FQUB 1FP5A 4W9FC 4XXDA 1JXGA 1GGUA 2IANA 1LO2L 1WIUA 5HHQB 4RDBA 3HE6C 2VDNL 4YVUA 1ZS8B 2FSDA 2W5PA 43CAB 1S9VA 4P5SA 2XV0A 2VLMD 4OZGF 4XCNB 1AZBA 3NFPB 3CX5J 3AUWB 2C9PA 1U8QA 5IB4A 4NC0B 3L08A 2BJMH 3RWCB 3HC4L 1ZVSA 1FL6B 3IRPX 1YEDA 1BQKA 2Z35A 1QBLL 1TOXA 5DMGD 1X5XA 3QFDA 4I2XA 4PGJA 5LBSL 1JZHA 2DLFL 1R33A 5KTEL 3GMRA 7PCYA 1U8OB 2ESVD 3C9NA 4H20H 1HZLA 3N42B 1OTUC 1VGEH 4PCSA 4Y4HB 2VE6A 5GJSL 4ZNCD 5IBLD 3WKML 1G7LB 4MAYD 1DL7L 2VR7A 4J3VA 2GTWB 5GGSY 4BXVA 5L9DL 1KTLB 4OCSH 2AI0H 2DQHH 3MJ9L 3CFBB 1NANI 4F7PA 2ENYA 4AWJC 2JIXD 5EZJA 1W2KT 3DRTB 4HK3J 5FUCE 1RH8A 2VDPL 3WLWC 4JN2A 5KUMA 5HYJD 2BP8A 2GIYA 3QWRD 8FABA 4LT7A 2FHFA 3CDZA 1XIWB 1K4DB 4OZHB 4AEFA 1K5WA 4FMFA 1XB3A 1EDQA 3DX9B 1KNOA 3T2LA 5HHXH 3RKDC 1AYOA 3FCGA 1QRNE 2X0UA 4X6DE 5BUAA 3FT3A 5ALBH 2NY2D 2P7TA 3QJOA 3QORC 4LEXL 2BS71 2GFBB 2X88A 3NACH 4QRAA 3TH3T 1TJGL 3K91A 3CLFL 5C2BH 1EERB 3T2QA 3WTSA 1T22B 1AVAA 1BV8A 1SN2A 1GS8A 3APCA 3MV8D 4PSRA 4RGOH 4F2MA 3DO3A 5DK0B 1BEXA 3DV4B 1Q0YH 2IAMD 2EDEA 4HIIA 5GRVK 4M7KH 4RGND 3MCG1 4JKWA 5ID0B 5IQOA 3DX9A 5HDBF 4PW9A 1NFDB 5BVPH 3VO0A 1MI5E 3KPQB 2E7CA 3C8KA 3IDXL 1F45A 1KLGB 2CR3A 2VW7A 3FH8A 5D1XD 4JY6B 2CU9A 3FT1A 4O4YH 4LRNH 3VM7A 2IALB 4UWQB 5FDYA 3RTLA 2Z64C 3GFUA 3MCKA 3MLRH 4J1UB 5TQ0H 5H37A 3LEVH 3FUNA 5D7SH 3PWPE 3F12A 1OLLA 2XG5B 1I3GH 5D7JC 2XZAH 1D9KB 1IQWH 3MJ7A 3FOMA 1QUPA 3BN9D 5TF1H 2CR0A 1MWAL 2L3BA 2IPTL 2IANE 4N0YH 1Z5LB 4N2BA 2PPDA 1KNOB 2FX9H 2Z35B 3P73A 4YIQB 2WYIA 2D2OA 5AVQB 3ILPA 3EBHA 4LSPH 2HFTA 2Y4SA 3QS2A 3B1UA 3BVVA 3O2VH 4E9TA 2E27H 1JVOA 1B0RA 3DI3B 4JNXA 1DFBH 3VXTA 3QI9B 1C8PA 1PLBA 5M94B 1DJHA 3H9SE 2GTWA 1P4LB 2FEJA 4L29B 2H1XA 4PJ7F 1S9WB 2AK4D 1NGPL 3H9ZA 1JAEA 5D7IF 1FGVL 4GRLD 5EIQA 2EVIA 2J1YA 4AJ0A 2HT3C 5CHNB 3DVNA 3OQ3B 3QR1A 4OLXH 5MP6H 4A2MA 2SEBA 1P69B 3NACL 3NSDA 4PJAA 5LO7A 4AM0A 3DJTA 3VRLE 1J9CT 4OF3A 2ENPA 4FHBD 3FFCB 4ICXA 5C6TH 2ZWZA 3I6KB 3V0VA 3PWJA 1WHOA 4PI2A 1WCBB 1FSKB 4JFSA 5FS5A 2ILLA 1KB9K 1RIVH 3N44B 4F9PA 5I8KH 4PS3A 1CDIA 1ED3A 1MPAH 3T2PA 2UXTA 2XY1A 5CUSL 2L7JA 5F96L 2G5BB 5FGCE 1J11A 3TIDB 4YHOL 5JW4N 5J6GA 4QNPE 3JYCA 3QCTL 4U6TA 1JSYA 2HT4D 2ICEC 2X2HA 1JNNH 1OL0A 4PM1A 3HE7A 3ZIMA 5CLWA 3K6SA 2X44D 4QKTA 3U1SL 1G9EA 4N0CC 3HFFA 4PY7A 1E3FA 4DPRA 4AQ8A 2ORBH 1KY7A 3KVDD 4MJ6B 2IV8A 3NFNA 5MENE 4UT9A 4MMXA 3DPBA 1UD8A 3KWUA 2YN3A 3LXBA 2DM3A 3CVHH 4YDZA 3CAFA 2ZPKL 2DJ4A 4PJGE 2HPTA 1BMWA 1IAMA 3OB0H 3RTQC 1YA5A 5MEPA 2J6WA 2V7HA 3ZDXF 5JNYB 2X38A 1CK0H 1NMCB 3WFHA 2JB5L 5DMYA 5E8PA 3SPCA 3LNFA 5I6MA 4XMXA 1L7IL 5AUMA 3TZVB 2BS8A 3WGVB 3HMWH 2P52A 1GHFH 2CGRH 3ZO9A 5IWLC 3GEWB 3PE9A 4W9EC 3OHXB 1NWOA 3BRFA 2AERT 2ZKHH 1GSMA 3AXLB 2OP4H 3EO1A 1YVLA 1P4LA 4L29A 1IE4A 2B4CL 3N42F 2JKTM 3UTPE 1EBPA 4MXWL 4CNIA 2CIKA 3Q9PA 4V11A 1QTPA 1M1XA 5FA4B 4L8SB 4P46B 4XVJL 5DD6B 5T1DH 1MCEA 3V0GA 1VEMA 5IP4A 3GGWB 4EKXA 1NGWB 4PRAA 1DQMH 5JQ6H 4JPQA 1O6VA 3D4YA 3EYFB 3VSTA 4ICWA 2RA1A 5J56B 5ID1A 3QIUC 1U42A 3K1DA 1J10A 1G7QB 4BFIA 5I73B 4F7CB 1AC0A 2Z0UA 3AU0A 2VLLB 1T83C 1D3CA 4ZAKA 1CLZL 2AF2A 3II1A 2DQFB 4CVXA 3BMVA 5DRWB 4UI2A 2NW3A 2R4RH 1DO5A 1TQWA 3R18A 3L45A 1XF3B 3ARFD 1MJ8H 4XB7A 4JG1L 4E9VA 1WGVA 3GXFA 4HZAA 3HB3C 1DQLL 2XIDA 1YQVH 4IJ3C 4WKZB 2NNCA 2YAPA 2PYFB 5KYWA 4PB9L 3SJVD 5ISZE 1FPTL 3MREB 4JG5A 2EDKA 4GS7C 2YKKA 1ADQH 5EUKB 4RISL 4K3JH 5IMKA 1WT5A 4FZ8L 2WQWA 5TFSL 1GAFL 4ODSH 5I18H 3V0VB 4JFTA 2OFQA 5C0CD 4DETA 3PUCA 4WJG3 3SKNA 1GW0A 1MFDH 2LU3A 4XOCA 4B0MM 4OB5L 1SY6L 1QOKA 4NZJA 3VG9B 3NCBB 2VKWA 4P23B 3EUUA 5DVKA 3QZWA 4LP4A 3KYMA 5D1ZI 3BRGC 2VAAA 1UTDA 1I7UA 2A83A 5B3JE 3I3BA 4HUWB 4U1SA 5FO9B 2DQMA 4MJHA 4K7PX 5JHLA 4Q9QH 3V4VB 4XPAL 4F7EA 2P5EA 2DZEA 5IB1A 3RHWF 5J1AB 2A6KB 2W1NA 1B0GB 1ZLWH 3MV7D 4N2GA 3TURA 4NZ8A 2DQUL 2YD4A 1Q1PA 2E7BA 4PJDB 4F93B 2HLFC 2F74A 2N0MA 4NQCE 4PRPA 3OKLA 1NLDL 4J3BA 4M48L 3DIFA 4B3EA 3OLEA 4DP9X 5KVEL 4FQJL 5ITBH 3HG1A 4IEFB 4CA4A 4YSOA 5FGCB 1JN6B 3TGXA 4IOIB 2IH3A 3CIAA 2ZOUA 4GW5B 3FYIB 2X89A 2JTYA 3FOMB 4OLVL 2OX5A 1H8OA 1OARH 4FFZH 3ALWA 4X6CF 1QNZH 1D5XB 3BPOB 3MU3A 2NDFA 1I9IH 1Y7VA 2DQ6A 4L1BA 3VJ6B 4FERA 3ZTDC 4M4RB 1A1OB 3ARTA 5T5NG 4YHPA 3V6FB 3CHXA 1YN7A 4NSKA 2EXYD 4N0FB 1KOAA 1LEGA 4YS4A 3K72A 2E59A 4QYOA 4I18A 2PCFA 1NIEA 5D1QE 3MJGX 3N04A 4CN1A 1SLWA 1YNTF 3JZ7A 4NZTL 5C7XH 4U1LA 5FYLD 4FXGC 4HFUL 4ZFFB 4Z7OB 3HE7D 4R5TA 5CGMA 2B77A 1A7OL 2DQTL 1FORH 3UTSB 2O6EA 5CGTA 3POHA 3HS0B 3VI4E 1ONQB 12E8L 1WV7T 1KC5H 1CXEA 3MCYA 4UQ3A 2M2DA 2A38A 2QHLA 5L2KD 1HC1A 1DYZA 3M1CA 1G9HA 3SO3B 1DVFA 3V4VL 5L8JB 4ABWA 4ONOA 1S7WA 3VAEA 2GSGA 4DKAA 3S8FB 4GBXA 5A43C 3VXRB 3ULVF 5LUMA 2W8CA 5DQ9A 1U8NB 2HVJB 2VJ0A 4JS7A 5A6IA 1KENL 2X42A 3MACL 1QEWA 4QRRE 4XH2B 4I48B 2OMWB 4KKZA 4BQ9A 3D48R 4JE0A 3SDCC 4XO9A 3CVHB 5JIIA 5IK3A 4HOWA 2CXGA 3DX6A 5D72H 5BOZG 3NZUA 4JM0A 3MNWB 4KRNA 4GT0A 1S7SA 2ATPB 2IQ9L 3KJ6H 3PABB 3UTOA 4AZUA 3OGOE 3QJSB 5E8OB 3UG5A 4HXAL 4PEEA 3LSOA 2FWSA 4PTTA 3BFOA 5F0MB 3NABH 2JB5H 1XCTA 4XZUA 3IMRA 1J1PH 2NR6C 4PRNA 1DLFL 5T3ZH 4KX7A 4ECNA 4Y5VA 2NTFA 5BS0B 2VXUH 3RILA 1BD2A 2WGXA 4DESA 4XCCL 4Z7OF 3F62A 2EYRA 4HD9A 1Q0EA 3D33A 3T0EE 2UWEE 2DLEA 3O3UN 3IDJB 2PW2A 4QXTA 5I1JL 3DJRA 3FU6A 4O02B 1LEKA 2EC9U 2YQGA 1V3KA 3WBDA 3O4OB 2WKGA 2Y06L 3WFEH 3ZJAA 1L0YA 4L1DA 3ZZSA 1IQDB 1H5BB 1F4WL 5E5LA 1CQKA 1UB5B 5SWZD 1QI4A 1VGKB 3LAFA 1N6QL 1ZDSA 4U7KA 5LQBL 4UT7L 3WDHA 3S5LB 1E42A 1MCLA 4R3SB 2IGFL 3OHXC 4Q14A 3VSUA 5EV7A 4AQAB 2JI1A 2R0LH 2WWKT 4A6YL 5IQLA 2XPYA 2QDWA 4WEMB 4J23A 1TF4A 2JKIS 2XFGB 3ZMNA 4YHYC 4KJWD 5FC9A 2ATAA 5H35A 5I71B 3ATFA 4OM0H 2AQRA 1YNTB 2YRBA 1JZ6A 5HHOE 4Y4FA 1MLCB 1TXKA 2XTJE 3HZYB 2BOCB 1KIUB 3CZFB 4ZBJA 5FYLL 1RUQH 2BP0B 4H0GA 1JUFA 4PB9H 4Z1PA 2R0ZL 2Y36H 1FZKB 1KACB 1QRNB 2VERA 4X6DB 4F7CA 4PLNC 4LL4A 4XMZA 2XG4A 4UQ2B 3BJ91 4OZHE 4S11A 4XHJD 4N0YL 3SCMC 1NFKA 4NUQA 4O2CB 3IE9A 3FTUA 2GABA 3ZKXB 2ZG2A 2APBA 2YPKB 2VR3A 5D1ZD 4NO0B 4AL8C 4UT6L 3FQ2A 4GRWH 4BZ2L 1HU8A 5LGHH 4KKAD 3GBDA 3I75A 15C8H 1DFBL 5ESAA 5F0PB 2QTVA 2HWZL 2GW5A 2VXVL 1JZDC 3F7YA 3RJQB 4L0PB 5A40E 5B3SB 1FFOB 1WP6A 5HGHB 5JMOC 2CIIB 5E99L 5D7IE 3KPSA 3EYSL 2EXSA 4E5XB 3VW3H 2RB8A 5IKCA 1TVDA 4IIQB 3A6CL 3EJSA 5FYLE 1Y6MR 1H3PL 3WS6C 3BVNA 4BFRA 4H26B 4UMGA 3THMH 3UBXB 3KBPA 3D6GA 4TYUA 1WFTA 3OPUA 2IH3B 1FNGB 2BCKB 3R06A 1BFSA 3QEUA 2YA0A 4ZQKA 3PWPD 5LDUA 4WU7A 4X6CB 3RPIB 1OSPH 5BRZA 2XN1A 2GY7B 3UZEC 3QUKA 4L8CA 2HFEB 5IJCC 3SCMD 4OCLC 4D9QD 2EC8A 2I07A 5TDOA 1W91A 1KXVA 1U3ZA 2IOOA 3BUYB 3QI9C 4X6EB 3VFRA 4HWBA 4JR9H 4TTDD 2HLFD 2YGVA 3WIHH 3JUZA 3CK0H 3QDGB 1N7MH 4UB0H 1T1XA 4HMCA 3VGHA 2HJLB 3KDMA 4WI4A 2HLAA 3N9GL 1RULL 5KSVA 3A6OA 2P8LB 2SODB 3X12B 2VDKB 2X09A 4XMWA 3WJJC 1QHOA 4X7CC 3BESR 3CMOL 3RTQD 3RU8L 3FFCA 2J21A 1J1XL 3MRRA 2B9AA 4NS0A 5ENWB 4B53A 4F7MA 4P48A 5BOPA 2ZUVA 3MAWA 4DP2X 1BW8A 2X4OA 4FAAB 4BWTA 2R7EA 4PJGF 4K5PA 4KRPD 2ZX7A 3HUJB 3TP4A 3ZTJH 5DZOA 4EDWL 5EU5A 3UGEA 4W9JC 1TJIH 5A6MA 3WKYA 3OX8B 5E94B 3F7VB 2NT0A 2V9RA 1C16A 3DMMC 2WLKA 4N2NA 4OLVH 3U1SH 5EOCJ 4DVBB 4TVPH 2J3SA 4X8GA 1JYWA 3EYVA 1F3DJ 5DJ0A 1BIHA 2NCEA 4ZW7A 2DQCH 1PZ3A 1FF5A 1MZYA 1RIHH 2R0KL 4CC0A 1RV6X 2UYLA 2FEDC 4XAKE 2OA9A 1MELA 4PBXA 5MENB 2JF1A 3N40P 5B1BB 4XN5A 5F9DC 2R23B 3LCYA 1NA8A 2XWCA 5ADOL 5JYMA 2ZJSL 5I0YA 2X70B 3MKKA 3O41A 1W6WA 2OMUA 3N41F 1BZ9B 1SJEA 1JOIA 2H9GB 3VD3A 3GZKA 5DVLA 4WEUD 4QEGA 1W8EA 2OCCB 4GRWF 1TETL 3W9DA 2HLEB 4GMSH 1MWAH 4XODA 3WI9A 4G5ZL 3INOA 3O0RH 1E8YA 2VMEA 5T1KA 3RUGE 3LKQB 3LKOA 3TA4D 3ZGIA 5DEGB 1P5VB 1A4BA 1KIRA 4L4TD 3DETC 4WCYL 2PCYA 2RFXA 4P4RA 3P0YL 4Q2ZA 5I2IA 3NJFA 5IESH 5CJOL 3VU1A 3AT9A 4ZX3A 4ZMWA 4IU3B 4WZ9A 2RHEA 4JHVA 5IMOA 1BWMA 1NCWL 2WUCH 3TA3C 2AXJA 2CLZB 2D0HA 2VN6A 4KNQA 4MWFA 3X13B 5AVSB 2FHBA 2VN7A 5IROD 1ZMYA 3A21A 2FJFB 2XWRA 4X2UA 4HIJA 1IFRA 3IJSB 1VESA 4RZCB 1JZGA 1OCRB 4DCQA 4Z78A 3U1QA 4GUCA 1XSKA 4QRRB 5AOZA 1YEEL 4NO2A 2HFFB 1DN0A 4YZWA 3UDWC 3BVUA 2WVUA 4AE0A 3STZA 4NYLB 4PG2A 1CDYA 1F4XL 1E8XA 1NGZA 3DTXB 3H0TB 1FQ9C 1X7QA 9PCYA 2WLMA 3NFSH 3EYUH 1FVEB 1VKXA 5CP7A 4WIQA 4HAFA 2CBTA 3EO0B 3QPKA 1AMXA 4YLBA 3NPSC 2AK1H 2NY1D 4FULA 1X5ZA 4WK0B 3K81A 4NN6B 2LU5A 2B5IB 3P4OB 3TF7C 2IBGA 3BKYL 3RNKB 1XAUA 4BSVB 1DJZA 3B7RL 4NO2B 1DUZA 4DHLA 3CHRA 3ZOAA 5F7FA 3M8OH 5GS3A 4ZFZB 2W0PA 3KCPB 4Z18A 5KW9L 2DKSA 1F3RB 4P5TA 4J3UA 1EAJA 2VXSH 1A25A 1M05A 4HG4J 3AW5A 2AMUA 1FZMB 2IFFH 3A24A 4UT9L 4FQPA 3HR5B 4XN9A 5T1JA 1B6DA 1FJ1A 5TE6H 3O6ML 4KO7A 3RKDD 5K1NA 2EXWC 1RUMH 3RVUD 1YDPB 4BUHA 3ARBB 5HHMD 3RDTB 4GUOA 2ODHA 1B9KA 1JF1A 1OB1B 1KDJA 1USQA 4H1LA 1URLA 3SGEI 2PWHA 4FFTA 5E5UB 2DQIL 1S7XB 3F8UB 1SOQA 1XH0A 2FK9A 3LKQA 3LKOB 3MRQB 2CCVA 3JWDL 3L3IA 4OIIH 1IC7L 4YEEA 3I02A 1S46A 4BBWA 2DIBA 2XN9A 4ETYA 4BZYA 3GRWL 4KAQL 2JCWA 1DJSA 4I9WE 4UT9H 2Z7ZA 3VFNB 2J88L 1IT9H 3WD5L 3QCTH 1XF4B 2IJ0C 4ZUUA 2PXYB 5JW5B 2W91A 5CINL 3TFBA 1TLMA 3EGDA 3EOAA 5C08E 4ELMA 1D5MA 3GI9L 4JO5A 2MH4A 2B15A 2OMTA 3GHPA 3GMMB 3LKRB 4EF3A 5TQ2L 3MR9A 1NKRA 2BM3A 3FTGA 3DYPA 3QWOB 4MZIA 5D2LF 1RK0B 3H56A 3V0HA 3WMQA 3T0ED 3LDBC 1CFBA 3VXSA 4E5XG 4ODVL 1Z5YD 5B1CA 1P1ZA 2PP9A 3QG6A 4BKSC 4Z7QB 1PSKH 5EZPA 4ZOCA 4OVVA 2VW6A 2ARJA 5AVWB 1OGTB 3Q3GA 4XVUD 5FYJH 1C5BL 3QT2A 5J89A 3WU1A 3BZEA 4FQQB 1EUTA 2QVIA 1XXDC 5KOMC 5IW6B 4PJ9A 1T1YB 3VFOB 5D1XE 1LDPL 1HH9B 1JWMB 4DF9A 1E3ZA 3ARDC 4D0DB 1I4FA 2OL3B 3VXUA 1U3HD 2IIJA 2NYYD 4NQQA 2B1OA 1NM4A 4FHKA 4PJHF 1LO3L 1NGXB 2K8QA 3IGUA 3B5HA 1FH5H 1AIFB 3HG1D 4GH7B 1KGXA 4KY1L 4PJEB 2R1WA 3EBIA 3PGFL 3T09A 1R3HA 2R69A 3P4OA 3Q5TA 3RIFK 4PH8A 4QHNB 2WWNA 3L3KB 5D7KE 5IB5B 3QDGE 3FU7A 4LCWD 4V1DE 4N2AA 1HYRC 2GTZB 1EFXB 2GJZB 1U8JB 3ML8A 5EPMB 2XXFA 1OARL 2CNZA 2HKAA 3MV9A 4ONGL 3ULUE 4TQPA 3L5XL 1LE5A 3PPEA 4TNVK 3S34H 1BFOA 1WWBX 2MRYA 5AQ0A 1N5YL 4EEEA 5FFLA 4OCXH 4J8RB 1VPOH 1YMMD 3TASA 1X7TA 4J3OG 3NCCB 3T0DA 1N8OE 3W3BA 4YO0B 2R2HB 2E4TA 3RFZC 4P5KB 2YK1L 4Z78B 3QA3B 1ADWA 3FQ1A 2AV7B 2HRGA 5DHYB 5MEQA 1AXIB 4WEBL 1UB5A 5TPWH 3CFTA 2OJEB 3FU3A 4OKDA 1MVUB 1YN6A 3C60D 5I0WA 3LS4H 2BVUA 1CLYL 4FADA 1AY1H 5JHLL 4BIKA 1GKEA 1SHWA 4JFFA 3GSRA 4LSRL 4WJ5A 1JWUA 3D8MA 3O3EA 3PS6A 4B9IA 2EIBA 4TLTA 2ED8A 1BOGB 5D2NB 2EYRB 2V33A 4LEOA 3IWVA 2M8XA 2G4GA 4AVHA 4OB5H 3T0EA 1YEFL 2WXFA 3IFLL 4ZS6C 1DQTA 3H42L 2NX5A 3WFDL 2ZONA 4HPYL 3AMKA 5ESAB 5ACLA 3FQRB 2ADJA 3TBSB 2CJUH 5KANI 1AD9B 2HTLD 5T5NF 1EX0A 1S3RA 4WTQA 2NXZC 2XZCH 3VRIB 5F89A 5HYSG 2YZ1A 4MS8C 3FN3A 4X5QA 3SBWA 1IAOB 4ESKA 3ZZLA 2BW4A 2QLVB 4KKCC 5DD3H 3ZHKA 3TYGL 3CMOH 3QDAA 5HDWA 1CD0A 3L3OB 2BRRH 3RUGA 3BPNB 5F21B 1U3HA 5GJSH 5JIHA 3BP7A 2AJ3A 4F27A 2ERJB 3TCLB 1ECZA 1G4RA 1U8NA 4OZGB 1NUDA 2ED6A 1FE8H 2B2XH 1WD8A 2FWLB 2H8PB 5IW1A 4Y1SA 5K9QI 1EZSA 3QRGH 2OJZH 1MHHB 4XMVA 5JPMA 1A1MB 4BCZA 3SE6A 5IVNA 1JGUH 1WLHA 3ZZQA 3II2A 5EO9B 3RQ3A 3VE0A 5L2KA 3GXDA 3SDCD 3VFSB 3VGAC 1RURL 3ZMRA 4HKZB 2RQEA 4X8CA 3UACA 2GBUA 5F72S 2IDUA 2WLHA 2PTTB 4KHXL 5EZIH 2FEEI 3F7RA 3RVWC 2I5YH 5GSVA 4JVUA 1LO3H 4PWIA 4FFYL 4W1TA 1U3JA 2P5ED 3VB8A 2R27A 5JXAL 1RD6A 2VZUA 3L9EA 4HXAH 4PJEF 1JGLH 4WWNA 1SDYA 1UT9A 2EILB 3QULA 4QAWA 2VCOA 3UROR 2HKHL 2OR7A 4FFYA 2EVGA 1JHTA 4M1GL 1GHFL 2CGRL 3IFPA 4XO4A 5AW5B 2B3IA 3IDJA 4QXTB 3NSYA 2V3EA 3IETB 3EYOB 1ID2A 3HBPA 2FIKA 1GZPB 4I88A 3UEZA 4MCNA 3ME0A 4GQPH 5MEOA 1X5YA 3NIDF 1CFTB 2C9XA 1D7CA 3SPHA 1G6RA 3I2CH 4R8WL 4RMQA 2JQZA 3KPRD 3QB7C 2VIRA 2VM3A 3NCJH 4QY8A 4AIOA 3BKMH 2KLSA 3WXWH 1WUNT 1MJ7H 4JFHD 3HZKB 2XX1A 2CM5A 4A6YA 2YC1B 4IRJC 5D5MB 1KTCA 5I1CL 5DHDA 3RWJA 2XV2A 3A6CH 4GRLC 1FVDA 3TO4B 4QHNA 3BO8B 3M46A 2D03H 4PJXA 4Q9CA 2OZ4A 4WU5A 1XCXA 3AADB 2PR9A 1T7WA 4GNKB 4BH8A 1U3HB 1DEEB 3DHMA 1QHQA 4GXVH 4MASA 5EO0B 5I5IA 4ETQA 4UNUA 1OSZA 1CDGA 1XGUB 2C9VA 2J12B 2V6HA 3IKKA 3K4ZA 4HFWB 3RA7H 3T77B 4B9GA 2EUVA 4ZTOH 4U1MB 5DJCA 1NMCC 2J5WA 2E7MA 2X1XR 5E8NA 4PGCB 2XQBL 3QEGH 5F7EH 3QAZB 3IXAB 4JRYA 1O7DC 2DRUA 4QF1A 5KVDL 4OUUB 2XKUA 3LZOA