5AB9A

Structure of the p53 cancer mutant y220c with bound small molecule 7- ethyl-3-(piperidin-4-yl)-1h-indole
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
195
structure length
195
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploiting Transient Protein States for the Design of Small-Molecule Stabilizers of Mutant P53.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords CELLULAR TUMOR ANTIGEN P53
total genus 50
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5ab9A00
5AOIA 3WTUA 2IOMA 1TSRA 4IBTA 3Q05A 5G4MA 2P52A 2ATAA 1T4WA 4MZIA 4LOEA 4L0ZA 5LGYA 2J21A 2BIPA 2BIQA 5AOJA 3EXLA 2J1WA 5KBDA 5BUAA 3KZ8A 2IOIA 2XWCA 3D09A 3VD2A 3TS8A 1HJBC 2J1YA 4IBYA 4HJEA 4L0YA 2WGXA 2BINA 1HJCA 4IBVA 3WU1A 4AGNA 3IGLA 2X0UA 3WTWA 3D07A 4IBWA 4IBSA 1EAQA 2J20A 5AOLA 2FEJA 4LOFA 1IO4C 2H1LM 4KVPA 5ABAA 4IBZA 1GZHA 3QYNA 4G83A 4AGPA 2OCJA 3WTXA 2BIMA 3Q06A 1HU8A 3D05A 4AGQA 3US1A 3US0A 4GUQA 1CMOA 4QO1B 3D0AA 3D06A 4AGOA 3VD1A 1EANA 1YCSA 1EAOA 5AB9A 3ZMEA 5G4OA 3VD0A 4IBUA 1TUPA 5G4NA 2AC0A 4AGLA 1UOLA 1GZHC 2J6WA 3D08A 2MEJB 2BIOA 2J1XA 5A7BA 2AHIA 4IBQA 4GUOA 2YBGA 4AGMA 2GEQA 4LO9A 1H9DA 2VUKA 1CO1A 2X0WA 3WTSA 5AOKA 4G82A 2PCXA 3Q01A 1LJMA 4IJTA 5AOMA 2XWRA 3EXJA 1KZYA 2IOOA 5ECGA 4MZRA 4A63A 3IGKA 3KMDA 2RMNA 3WTYA 3QYMA 2X0VA 2ADYA 4L18A 4XR8C 5LAPA 2J1ZA 3WTTA 3WTVA 1E50A
chains in the Genus database with same CATH superfamily
2OTUA 4XNUH 1QP1A 3FCUB 3U25A 4HCGA 2BM3A 2D3NA 2IBZX 4F33B 1ERNA 1QWUA 3HMXA 3FDWA 1VDGA 4YPGA 3L1EA 3G6DL 4JRLA 3RGVC 2A38A 1LE5A 5GHWH 5CSBA 2HTLD 3RWEB 2OYLA 3TH2T 3L95A 4JFDE 2DS4A 1S7XA 2APTA 4RIRB 3KL3A 5C97A 5JNYA 5K33A 2DH2A 3L4TA 1H3UA 3EH1A 5DFVD 3QRFM 3BD4A 2WYHA 5DD0H 2ZOKB 3T0EA 5GJTL 4YZWA 4ODWA 1P4LA 1WYJA 4AUUA 2C8NA 1UB6A 3A6CH 3FCSB 2J71A 3QDME 4JW3A 1A1OB 4IBWA 1F18A 1U41A 4ZS6D 2Q6WB 2R1XB 5BZWB 1ZVSA 1OWWA 2YAFA 4JFQB 2JKTM 4N86A 4Y2OA 3Q8CA 4WW2A 4PW3A 1JZEA 5IIEA 1ZDQA 4O51A 4PS7A 2XXCB 4FXGC 2GKIA 4GRWF 4Z7NF 4ZUUA 1V10A 1CLOH 2CRZA 1CD9B 1K2DA 4GG8B 2AI0H 4MQXC 5IROA 1BAFH 4JREC 3QAZB 1M1XB 4PRIA 2WPGA 1X7QB 4LHQB 4BKTC 1XZ0B 3C9NA 3KVDD 1AKJD 2MQGA 3N50A 5CLWA 1MG2C 4G9FB 2NW2A 4G3YH 3FSVA 4S1DD 4DGIL 3BP4B 4O2CB 2OXHA 1R17A 4AEHL 3B9AA 1XGYL 1W16A 4W9ZA 5SX5H 4D0DA 3FUDA 4GUOA 4ILDA 3BZ4B 3MLYL 5GGTH 5ISZB 1H6EA 1J1PL 1SJHB 2I24N 5D7IF 3TYFA 2QEJA 2YA1A 4NHUA 4YUEH 5BVPH 4JPKH 1AZZC 1A8ZA 1GGYA 4MCYA 1E9QA 1W0VB 1CK0L 4NKIH 5F6IB 1F2XK 1BECA 3HLKA 4NYLB 4N2IA 5D1ZC 1TJHL 1PZUB 2EDHA 2YQ3A 2NY5H 5CR8A 2YMTA 4POUB 3SKMB 4GUPA 4IEFA 3TGXA 3KYNB 4FNUA 1EDHA 1QFPA 5CJOH 3L1GA 4R8WH 2ICWI 3ZO9A 2AS5M 3CZLA 3O4OB 2W9DL 5C0AE 3T8XB 1KBKA 4OZIE 1EEQA 1OGAE 4UZSA 1OSZA 3H2QA 4BWWA 4KRLB 1GA2A 1JL8A 2CA4A 5EZOH 3EYQC 4HWZB 2E3VA 4EI5D 4KDTA 1KN4L 3H7LA 1JXFA 5BVJA 3K6IA 5JLZB 1ZVYA 2F5AL 3DO3A 1YYML 1MCPH 1D9KD 3R06B 1IGFL 4DPBX 1IEAB 3KZ8A 4ALAL 1MW2A 4DIXA 1SEBB 2ZPKH 1RAMA 3VGAB 3BUYA 4HJJL 1XEUA 3QNZA 5DFWH 1R3IH 1UXWB 2FBJH 5D7IE 3QRLA 4HWEL 3S3JA 1HHJA 3FU7B 5TJWK 4OGAD 4CU6A 3CZEA 4LCYA 4JG9A 5EU3B 5SV3A 3QWOA 3PL6C 4QOKD 1LK2A 1Q9LB 4IOSD 5MEQA 2VSCA 2WIIB 3OLGA 3LKPB 3OLDA 4K71B 4PBXA 2HLFD 5ANMA 4DT2A 1AI1L 5J89A 3QUMA 1WIUA 1WH0A 3V9FA 2CGYA 5ETUA 3VAEA 1J12A 2NYKA 4MASA 1N2RB 4G7QB 1MHHB 3E6FA 2H1PH 4LZKA 4ZPVA 2YPLD 5GQBA 1GCFA 4UMGA 2WXOA 3VWJD 1F8TL 3MV7A 2XV6B 4PJAA 4DKTA 3H53A 2FTAA 4JFWA 1VEPA 3V5KB 4C55A 1X3DA 2A99A 1K6QL 3NFPA 1ACZA 3VMNA 2X12A 3FCSA 1S7VB 4FHKA 3CGTA 4RMRA 3NIDB 1UACL 4U0RC 1MNNA 3SQBB 3WMQA 5F7YC 5DD1H 1HOCA 3VH8A 5E9DE 1YMME 4OSUH 4UAOC 1QQDB 2WXMA 3ESVF 5DMIL 4YX2H 2AGJL 3ARZA 2GK0B 5DLLA 2PR4L 1A6AA 1WFNA 1IEBB 1R5WB 3AXLB 4QGTA 3G04B 4KX7A 3QS3A 3V0DA 1Z3RA 2IFGA 1XIWB 1D7FA 1A6TB 2ZCLH 1UZGA 1A3RL 2BVEA 4WY7L 2Y23A 4PP2A 5IEHA 2NX5B 4GQ9L 4TVPE 1JHKL 3O3AA 1G5GA 1RUQH 4RA3A 3GBLA 5A2JH 2JJWA 3V4VA 5J4MA 1YMHA 3B5TA 3IPEA 1A4JB 2X0WA 4CC1A 4P49A 4N2FA 3ERXA 4RAHA 4ZTPL 1E28B 4OZ4B 4EI5C 4ZI8A 4KI5F 1XMEB 1EEUA 1S9WB 3TJPA 2IH3A 3TNMB 5A2IH 1BF5A 3A4DA 3QXDA 2E4TA 4YZFF 1FUNA 5L4FA 1FIGH 1NLDL 2JQAA 4KTEH 5DHXB 1EA9C 3FT9A 3OGCA 4F8LA 2H0JA 4IW4C 2A5UA 3EO0B 2DICA 1ES0A 3GZOA 2WK2A 1QW9A 5FHBH 4PJXA 2L7EA 3JWNE 5E8DH 3V0VB 2WBJB 3VI4F 1H0DB 3ATFA 4DO4A 1EAPB 4U49A 3IYLW 3OL2A 2O93L 5I24A 1BFSA 4MAUH 3FUKA 3SPJA 1EJ6A 4PTTA 4LDLB 4TLSA 1MIEH 3KYNA 5DJDB 4GS7B 3IPBA 1F2QA 5C6PB 3G6AA 3LQAH 1L3WA 4I1PA 4JHBA 1LO2L 2DV6A 3BLBA 3JWDL 1D5IL 2F0CA 1RP8A 4GIAA 5DQDL 3UYRH 1RSFA 4LCWD 3MRNB 3DYMA 3NPSB 1HAWA 3OKYA 5C0RL 5JXEA 3ARBD 4YHOL 4KH2A 3TIDB 3VRIB 1IILE 4N0UE 7TAAA 3AJ7A 4U7MA 2PWEA 3AU0A 3P0VL 2X3CA 3MPCA 4TSBH 5AZEL 3DX0A 4PEEA 2HJFB 4EF3A 3QHFH 1Q1JL 1BZ8A 3QR0A 2ZYRA 4MNQA 2IBGA 3QZNA 1GMIA 4S1SH 2HP4A 3ZBMA 1KTRL 4OLYH 1F3RB 3W56A 1N3NB 2FB4H 3BRFA 1HIML 3AS2A 2CUMA 4K7FA 2WXFA 1OPGL 2HH0H 1BF8A 1MH5A 4UTAL 4HFWB 5D7IB 1K9TA 3RVTC 4ANWA 2CA3A 3I6LE 3TBTA 2QMJA 1U3NA 2DQFB 2CDEB 5IB5A 2FR4B 1AQKL 2AK4B 3WXWL 1YNLL 4K9EL 5FUZL 4XI5D 1KJ2B 2JKSA 3D9AL 3TZVB 4Z7IA 5HY9A 4NO2A 4NO2B 2YPLA 5FW6A 1MFUA 2DDQL 2D2OA 2WCPA 1SJEB 1NFKA 2KI6A 4YR6B 1V7ML 3VTAA 3CHXA 4E9LA 3DJ9A 1BXVA 4XNMA 5I26A 4K9EC 1GZHC 4TNVF 4AJWA 1NGYB 1GS6X 3IKKA 4MAZA 3DGCR 4IQHA 1MSPA 2R1YA 2C1OA 3LV3B 2R2BB 2VCOA 3HG0A 4FI7A 5IBUG 4Y2DD 1A6ZA 3E3QC 2WINB 1SYVA 1YY8A 5K9OB 4V1DE 5C3LD 4N8VG 1KJ3L 3HNTL 3MOBH 4NXKA 5HDBF 2PPAA 3I9PA 3VGBA 3O6LH 1SLXA 3MROB 1T1YA 1F3DH 2BP3A 2D7PA 2W59A 1F4WH 3ZL4H 2VR7A 4KKCD 4BZ1A 1ETZB 1CC3A 3L7FB 3L7FA 2X2IA 4ZMXA 1WQVT 4MMXA 3UFIA 5C7XL 3DMMC 2ZWKA 4QPEA 3TBYB 2KZ1B 5KSBA 4GBXD 1TZHB 5EWIL 1JZ7A 4WGKA 5E00A 3DURA 3MUHL 1KN2L 1A4KA 5A7EA 1KPRA 4J1UA 4RAUA 3OB8A 2FT8A 3L5JA 3QWNA 4X9GA 2YGQA 3FC8A 3WTUA 3DK2A 3FT1A 4CKQA 5K9JH 2DQ6A 1IJNA 1K4DB 2IV8A 3HVDA 3NSFA 3NZ8A 2E9IA 1I7ZB 4L4TE 5JO5B 3UTSD 4O00A 4JJ5A 5A6LA 3L3OC 4R84A 4JFEB 3BUYB 4NUJA 4KVNL 4ZAKA 1P4BH 3GMRB 5D9SA 3CC5B 4F7PB 2W9LA 3V0VA 1HL8A 1MFBL 1N5AB 3T1FB 3ULUL 3MODH 1CS6A 3NIDF 1U8CB 4F9LA 4BIKA 2BFVL 1UVQB 5E95B 3HN8A 4QMEA 3N5AA 5CUSH 2H47C 2XKNB 4QJ5B 3PGDB 5DMGD 1T1WA 5KVEH 4AQOA 4G70B 3MRGA 2NW3A 3WEXB 1N6QH 2QADB 3T2NL 4WWKC 4XZUA 4MA8L 4YFDB 4X98A 1QBLL 2B59B 4XPAL 3D07A 3VWJB 2E74C 3T1FA 5IBUB 5KSVB 1COBA 3N0AA 1FFPA 1CDYA 5AOLA 2Z91A 1HSBB 1BZEA 2VAAA 5ADPL 2N1TE 3NJVA 5C2BL 2FWUA 5C08D 5LWYL 2V2XB 3ATBA 2AK1H 3X11A 4K3DL 4JFHE 3LNHA 4GW4B 3P2DA 4PJ7B 1A9VA 2HZHA 1P7KA 1PZSA 2DQUH 5CSZB 4EDXB 2Z92B 4I0PA 4JFDB 1DHKA 4PJAE 1PLAA 1OE2A 1SN5A 3F64A 1EHLH 2HPOA 2YRPA 3L95B 4W9IC 4LLDA 1EANA 1EPFA 1EH9A 3B6SA 2YAHA 3GPSA 1A6VH 5EO9A 1MFDH 5F1IB 4DP5X 1JRHL 1JNNL 4HSAC 4OF3A 5EA0H 1J1OL 1UD6A 3BAYA 3UPCA 5B1JA 1LDPL 1E2WA 1T83A 2CAKA 3BXNA 4FFWC 1KXQA 5JPMC 1VKXA 4M43L 4PLNC 4HA1A 2AHIA 1CLYH 3CFNA 2R29A 4BUQA 2PR9A 2Z4QB 3FFDA 4X6DE 1G7LA 3P4MA 4E9RA 4OD1L 5I82A 1U8IA 3QJHA 1RQ5A 4JDZA 1E9PA 1DBBL 2IF7A 1UT9A 2ENQA 5A3IC 1J5IA 4F1ZA 3SGDI 2A74B 1JNHA 4NUJB 2BY1A 3Q8EA 3IKCB 3WIIH 3PWUA 1IB5A 4UMSA 5D96B 3CSYB 5AVSB 2EO9A 1KB5H 3P30L 15C8L 2V3DA 3SSGA 4NCDA 3IFPA 1IBZA 1XGTA 4L18A 1KEMH 2P24B 3K91A 1AXTH 2UWEB 1YQVL 4DP6X 4ANKA 1RPKA 4R26H 3JSSA 2WXHA 4Q9CA 4BZ1L 5HGDB 4L5FE 3WTTA 5K5YA 3M1BA 2NXZB 3MJGX 2AJYH 2I07A 3LZFH 2YOCA 1JZ2A 2DJ4A 3O6FA 4X8GA 1LYQA 1FL5B 5I6MA 2J21A 1IKNC 3BUPA 1AZBA 1F6FB 4GT7A 1NKRA 4G8EA 3IDXH 3Q6FA 4HGWB 1NFDE 4HUXB 4PYGA 4APXB 1HZLA 5DJZB 3MRKA 2JLPA 1CGVA 4IGBC 4MJ4A 4XT1C 3CFKA 5A40E 3OX8B 4UT9L 5I17A 1QFHA 2J8OA 5IJVB 5DJXA 1DVFA 4UQ2A 1I53A 1PJ9A 5AVZB 3BZFB 4XAWL 3ML8A 1EHLL 4L4TA 3OKNA 3W5NA 5ID0B 3DV6B 2HT4D 3PXJA 3IJ9A 2OL3A 3OKOA 3EZ8A 3SE3A 2K6ZA 1JGIA 1KXTA 3Q5YA 2LLLA 1GXEA 1RU9L 1I3UA 2EKSA 2HLAB 4G7YL 2OMWB 3QNFA 4JPIA 4CILA 3HA0A 3M17B 2FIRT 1CYWA 2WW8A 3O6LL 4QCIA 5LBSH 4P3DA 3BP7A 4YHZL 1YEGH 3VM5A 1JZ5A 3QHZL 2A1WH 5I19H 4DGYH 3P73B 4WDIA 3ZDXF 1KJ3H 5FO8A 4IRZL 2VH5L 5CD3B 3A6OA 4RDQG 4ANXA 3LN4A 3W81A 4GSQA 1U0QA 3CZFA 1AR2A 2VDLL 3FH5A 2NY0C 3O6FC 3GRBA 1CU4L 3I85A 4DVRL 2D3JA 1C08A 3X3GH 4LCYB 2EAEA 3H3KA 2NY1D 4N0UB 1UWGL 3RL2B 1WUZA 4DK3A 4KPHH 5C0CB 3LZPA 4NZRL 3K7UA 4XCNB 1ET5A 2ZE0A 1II4E 1Q0YL 4KFZC 3U0PA 4I4WB 1IBYA 1L9QA 3ZDYE 2NZIA 2C9RA 1G9ML 1ZOXA 2WAHA 2IH8A 4PCYA 1AKJA 2BFGA 1MRDH 3ZLQC 1BM3L 3ZKND 2CE6A 4DHLA 1AP2B 5K9JL 4MXVE 1QA9A 2NUPA 2E9GA 5D70L 4XMKL 5I30H 3VXPB 5C07D 4TS6A 1T2XA 1NCWH 2P80A 2G5BB 4F7MA 1T1YB 4WI9A 5B39G 2WC7A 5E9NA 1NM9A 1V7NL 3VA6A 4UZUA 4IHBA 1E90A 2LE9A 3OAYK 1FIEA 1VRSA 4LEEA 5FW7A 3P0VH 5IESL 4PAZA 5FKPB 2QMKA 3NCXA 1D2PA 3HS0A 5DWUL 3M8OL 4XP9L 1LP9A 2FAUA 2Y36H 1U2CA 4UU9A 4KUCD 3QDGD 4OZHE 4YE4L 5F1NA 3CX5J 1E6OL 1HXKA 4FYRA 1PD1A 2GIMA 5CFHA 5LN4A 4H2CA 5KBNC 3OLEA 3EBIA 4MZIA 4WQOA 4XMZA 2ZG3A 3MMEB 5F9WB 1S9VB 4U6XB 4ZOAA 4DGWC 4L3CB 4H8WC 4C58B 2UY6B 3H3PH 3NABH 1XCQA 5TD4A 4D7PA 1XL4A 2CHDA 2V3EA 3IT8D 5KBDA 4I1NB 1I3RA 3ECVA 1AMYA 4BFOA 4URTB 1FYTA 1UM4H 5I8OL 2CJ3A 1KTDB 2XPYA 4WNJA 4L0YA 3B2PA 4TULH 1PF3A 4JGNA 1QSZA 2H8PB 3T4YB 1QSEA 3P9WB 4PH8A 4N0CD 2D31A 4UB0H 4F15C 2PXYC 1NCIA 4H20H 2PYED 4OJEH 3TO2A 4QHKI 4FQIH 4R97C 4X80L 3LIUA 3WUWB 3OMZA 3P2BA 5CWSA 2WNXA 2BERA 2NDGA 4ELMA 4HS6A 3CBJB 1G7JA 3AU1A 35C8H 4YH6A 5JUEL 4JM2D 2AMUA 3BKCH 1OAXH 3TA3B 4AGPA 4IHOB 2B1HH 2W07A 3APNA 2YGNA 4P5TA 1M9WA 4GI6A 3FN9A 1WWCA 5T3XD 4OCLC 2OL3L 3KPTA 3HRZA 1SOSA 4FFVD 4HPOL 5EUKB 5EUKA 4ZNEA 2DYPD 2BSEA 4B9YA 4P9MH 4OZHF 1JHKH 2IH1A 4HCRA 2G30A 5ICXA 1ZLVH 2Q76A 3KS0J 2O72A 5H8DA 1OW0C 3QEQA 4LLDB 1JYNA 1J5HA 5TE4L 2VISB 2Y22A 2PTTA 2YRLA 2XFXB 3SDCA 2FYYB 1E2VA 3VQLA 5JXED 1CGSH 2FX9H 1FNFA 2NZ9C 5JIKA 1EX0A 3GJFB 3TH4T 3B2DC 3JV0A 4KQ4L 5GZNA 1WP6A 4JEGB 3C6LD 4PJEA 5EIIA 2V9UA 1CO1A 3E8VA 3KPNB 3QPXL 4H8PA 4EZLA 5JQ6H 1WBYA 3CN1A 1HDMA 1HDMB 4QXVA 3CFBA 2L3BA 4HUCA 1IC5L 5DGRA 3V4VB 1NC2D 1B0RA 1KTLB 3F2LA 5KBMA 5CCHE 4RRPG 3SOBH 1IL1A 3ULUD 5E8DL 4P5TD 2J12B 1HXMB 4J3SA 3H85A 2VL5A 2ICWJ 2PKDA 3DRQB 4DH2A 3H3PL 1SFDA 3RKDC 1MJ7H 4YDLB 2QFPA 2OW6A 3BYYA 3FHQA 3IFOB 1P7BA 1A7BA 2NY1C 3HI5L 1NUGA 2ED6A 2FJSA 5FOJA 1F42A 1KIQA 3H42L 4PRHB 5AOIA 2XBDA 4HJJH 4KXZI 3S88H 2XTJD 4IKLA 2VLJD 3IGUA 3R4RA 3VMOA 2EDKA 1NGZB 4NCC1 2Y5TA 2V9QA 4MMZB 3SPVB 2O61B 3A3YB 2K3HA 2HRGA 3C2AL 2W07B 5T1KA 3D8MA 5T1KB 1D9KA 4NQSB 4OZFB 1C7SA 2CDGA 4B60A 4L4TB 2IWEA 3QZWB 1MUJB 3BSZA 1NCWL 4LSRH 1JS4A 4RDBA 1T6BX 5AW7B 1DEDA 3PWNA 4BD4A 3FB7A 4QIRA 4C56A 3KGRA 5DMIH 1MQ8A 3ZE2F 3E80A 3PXHA 3KS0H 1OSYA 5DD1L 1WCBB 2VXTL 1U91B 3VFTB 3ATAA 2G2PA 4LU5H 4P2AA 2WUCL 2R59A 1B0GA 1SUJA 2UX6A 1XH3A 3MGAA 1OOWA 4LEOB 5J13B 1WD9A 5ES4B 4NZRH 1TPXB 1OTSC 4IBZA 4WKXA 4XE5B 1KWKA 2KDYA 5INDA 3TFKC 1DBKL 3UJIH 5JMRA 1X9QA 2V0AA 4PGJA 2WJ5A 2GJ6D 4YUEL 5BVPL 3P40A 1DCLA 4UQEA 4LSVL 2NXZD 2A4EA 2VLJA 1S7QA 3S5LB 4X5RA 1JV5B 3QDHA 2QADC 4YNYA 4BM7A 2CO2A 5KSVA 2AMGA 5AB9A 1XGPB 1ZHLA 4TNGA 1AD0B 4XMPH 4AW7A 2APBA 4XMUA 4HUNB 4X4MA 3WL9A 2AK4A 3NJIA 4NHCH 4Q97A 1T1WB 3DECA 5IW1A 3PWPA 4Y19A 5A16B 2VXVH 2OMBA 5I1JH 1BG1A 2VLMD 4FYSA 4OVUA 1F5WA 3DIFA 1QLEB 1BAFL 2MOQA 2EDRA 2AI0L 2LU3A 3AM8C 4QLRA 2A9CA 5AOKA 4ERSL 2C3WA 4XOEA 3WIHH 3FQUA 5E4IA 3O9WD 2VDKH 4G71B 1QFWM 1EJ8A 1YNTF 3VXPA 2TAAA 1NPJA 3VFGL 3DGDA 1T2QH 3NOIA 2V8LA 2DM3A 1CG9B 3S35L 3QDJE 1RPUA 3QZWA 4I89A 3L3JB 1B4TA 3L3JA 2H9GA 2Z31B 1MLBA 3CFCL 1UC6A 2ZP8A 3MUGB 5LQBL 5I15L 1HI6A 1Z0NA 1PIGA 2VMDA 1CK0H 2VLKD 3LPFA 4YSAA 2OSLB 2R9HD 4FQ1L 5IOPB 2NZ1A 2E76C 5GS1A 4UDTA 5D1ZA 1LEIB 3IKCA 3NRFA 4Y4HB 5FO9A 1KTDA 5LGHH 2NNAB 4W9EC 5BO0D 4RZCB 1PKQA 1XAUA 1S7SB 4Q9RH 3P3UA 4WHDA 3UROR 3QQ3B 5IHZB 1NPNA 4MYWB 1DTUA 2EO7A 4FQ2H 1FP5A 1ODAA 3NSXA 5B7MA 1ND0B 3WSQL 4DGIH 2VC2H 3SD2A 4TSCH 3I84A 4UZGA 5HI4D 1RU9H 2CO7A 1ZT7B 5KS9B 1KJMB 2EDQA 3KD4A 1U8CA 4Z76A 1CYXA 1OZTG 4V1DB 2EXYC 4K71C 4BFEA 2A6IA 4ZODA 1BEYL 5I0WA 1DSFL 1D5ZB 1T0MA 3E38A 2OJ1A 3PIQB 4S2SB 5EU7C 4AUJA 1MVFA 3T0AA 5KSAD 4S1RH 1WAEA 5LAXB 4F7EA 1KDJA 1FYTD 5ACZA 1EWHA 2CIIB 5E8NB 3JV4B 2KS0A 1MWAB 1LDPH 3LB6C 1UASA 2OA9A 4QLWA 1P4LB 5BZDB 3BN9C 3PXLA 4Z7QB 4LB8A 4OGQC 5FGCB 4CJ0A 2OMYA 5I17B 1MG3C 3ABMB 4AK2A 1CMOA 1MFAL 4RQQB 5TDOB 4AMKL 1NQBA 4OM1H 2NLJA 3BT2L 2H0EA 3A6CL 3K8LA 3V9CA 5CGYC 4S1QL 4KDTC 4KJPD 2HJFA 4HK0B 3NPSC 1FGVH 3MRCB 4HKZA 3BKMH 4TOYH 3SDXB 1XR9B 3QWRD 3QEGL 3AUWB 3GMMA 5IK3B 4NQVA 4RGND 5MP6L 3CQFA 4G6JH 2X4RB 4PWIA 1INEL 1ZIBA 4H88H 3OG6B 1MDAA 1OLZA 5HHOA 3PGFL 1PQZB 4G9FA 5FB8A 1GRWA 4A6YB 4PJFA 1G43A 1HXYB 1T4KA 2ZKMX 1T4KB 2M8XA 2W0PA 5KYYA 5KYYB 3S8GB 2R2BA 5GRUH 4MJIB 2WBJC 2XQ0A 3FFDB 3O11A 4DUWA 4OI7A 3SDCD 1GIGL 1MQKL 1ZRUA 3NA9L 4FG2A 2JH2A 4HS3B 1KJVA 4KHXH 1MFBH 2DTML 1IL1B 1GW6A 3KMDA 1D5BB 3KVPA 4Y5XC 1HXYA 2RMNA 4J3OF 4M62L 5EEVA 4JO1L 5DMKB 5T8IA 2P4AB 3VXME 5IQ9A 3RL1B 3B2UC 1UM6L 2VZ1A 4X4XB 5BO1H 1YY9C 3GKZA 3ZDZB 3ZE2B 4DAGL 3K0WA 3CV5A 2XICA 3REWB 1TYJA 1KJ2L 2CKBL 4TVSa 1PDKA 3DVNA 1U8KB 2ADFL 4HKJB 2APFA 4NQXB 5KAQF 2WCGA 4X7TA 3VRJB 5BW7A 4YEEA 5SWZE 3MV11 2B0SL 3SN6N 3H6JA 5F88A 1ECYA 2NXYD 2WWKO 3EFFB 1J5OL 1SLVA 4FADA 2D4DA 2R8SL 3C6LB 3PDOB 2AQNA 3T0XA 4HQQH 1WWAX 4XXWA 4B7LA 2AABL 3WAJA 1P9MA 4LP4A 1T1XB 3DSNB 3TIDA 1U8OB 1U92A 4FXKC 4QO1A 2BK8A 4AOFA 2YSSB 1GYCA 3WTWA 1TETH 2A6DA 2DWSA 5DUJA 4NDMA 3AREA 2WTRA 4POZC 3D50A 5FS5A 2HAZA 1BOYA 2ED9A 5E1HB 3RTQA 4R7NB 1CD0A 3GRWA 3G9VA 3ZZLA 1WHOA 3LS4H 1NCDL 5M94B 1OANA 3KJ6L 4F7PA 4P4KA 3OKEB 4KRPC 4XPTH 1RIHL 2DYPB 5JW4M 3C60D 1QUNA 2IDCA 4HC1H 1E3FA 5C7ZA 1XGQA 2X4PB 3RX8A 5MEQB 4F20A 4ODVH 4S1DC 1E4WH 4OQ1A 4TL4A 1DQQB 2P28B 2X9XA 4JNXA 4JAMA 4XCFH 3RGVB 1CFTB 1KELL 2X7LB 4KI5C 4ANVA 4JQXA 5KSAA 5E5RB 5DURD 2WZ0A 3B9KC 3O0LA 4N2LA 1X7QA 4N0RA 4HKBB 2KDGA 2VDOB 1ZV5A 2OYKA 2PYEB 1A1MA 4TLUA 1A1NB 1HL4A 3MO1B 4QY8A 3T0ED 3L3HB 4P4KC 4QRRA 4E42A 2HKHH 3B2UD 4OUUB 4QJ3B 3F7PC 4XVSH 4MGXA 4Z7VA 1IGTA 1JERA 4PI0A 2F5BL 2XJLA 4KNTA 4IMKA 1ORSB 1FNEA 3AY2A 5H4ZA 2JMRA 1RUKH 4GRLB 5AW0B 4B9FA 2Q6WA 3HR5B 5GGQL 1C9SA 1T5WA 2L8AA 3F7YA 5AB2A 1LK3L 3GXIA 3SDCB 4KOBA 2W1NA 1J5OH 1CL7L 2ZOKA 3BN9D 4H0GA 5L9DH 2I5YL 3O8XD 3WLWD 1IEBA 1R5WA 3IJHA 5GSRB 1NKGA 1TNMA 2F8XC 4NJAH 3HN5A 5KN5A 2Y0SA 2NQCA 5HHPA 3L4WA 4N1CA 4CMMB 5KS9F 3DO7A 2P5EB 3MJ6A 3PS6A 3BCFA 3M7OA 4HCRL 5HI3C 2XG4B 2OP4L 3DX9B 4DQOL 3NH7H 1P5UB 1NGWA 4HIIB 2YZ8A 3WFDH 4B97A 3K1DA 5F7FA 1PG7L 1Z9MA 3QCVH 4TTGA 4PRDB 3TT1H 4QEGA 4B0MB 2R7EA 4E2OA 2OXHB 1G9EA 5HGDA 3U83A 3V6OE 5LNGA 3O3EA 1PKQB 4MYPA 2OSWA 2N4IA 2EIZB 4KDVA 3C9NB 5EB9A 3KGSA 1RIHH 2HTLC 3W1ZA 3VACA 2K8MA 3VDCA 3KJ6H 4PRAB 3U1SL 4Z9KB 4AW4A 4ZMPA 4XAKD 1QFWI 1KCRL 2O6CA 3QRBA 1RKRA 4XC3L 1SXAA 1TJXA 4KDWA 4NWTH 1OGTB 3CE1A 3O3EB 4JCWA 5CU9A 1JP5A 5DVPA 1CFSA 2IJ0C 2C7UB 1T0NA 3UBXA 1W0WA 1TFPA 4G6JL 1D9KB 4OZFA 5MP6H 4ODXA 1F4YL 4RFOH 4GB9A 3QNXB 4EKXA 3DX2A 3AS1A 4AYBA 2WGNB 3INOA 5AVQB 3QPKA 1C16A 5DEZA 1C16B 4HALA 2B0SH 2K4AA 4LVOC 3BXNB 5JW3H 1BYNA 3NEOA 1CLVA 3QZBA 2CIKA 1ZA3B 3QS2A 4TSCL 3WUZA 2E7DA 3SKNA 4I3SH 3KGTA 2F53E 5JNYB 4HW6A 1F3DJ 1XZWA 2X40A 2VDQL 3T0EE 4OFIA 3RVXD 4LVHB 3LNEA 1R33A 1TUPA 5E6YA 5CCKL 3LD8C 5CCGE 3IXAA 1SQ2N 4I48A 1WBXA 1N8ZA 1NJ9B 2VDNH 5C0BB 4H13C 4LRNL 3VTTA 4YSUA 4IGBA 4GMTL 3GPEA 4MWFA 2ZOTA 4AE1A 1KPUB 1Y6NR 3MGOB 2GY7B 4ZPTA 4AKQA 1I1CA 5KBLA 2DQIL 3MRJA 1EVUA 2P5PA 2RH0A 5E8PA 2EDXA 1XGTB 2XUWA 2P26A 1BV8A 3C8KA 4CVUA 4HUVB 2DQFA 3KWVA 3K2UH 2OSXA 3OSVA 4FQ2L 4N0YH 3M1BB 1S9WA 3QUZC 1DVQA 2WN2A 5DCCA 3GXTA 5E6RB 4ALAH 1WEJH 2WLLA 2JCCB 4FQQB 3WUWG 4BFKA 1DQVA 1JNLH 1RUQL 2F5AH 3EOBB 1AR1C 1R5VB 2C9AA 3P0GB 4KU1A 3T65B 2J6EH 4ZYKB 2G9KA 4J3BA 3RBSA 3B9KD 4MB3A 4HWBH 4N3TA 3PAUA 3D25B 4WVRA 4Q14A 4DW2L 4EOWH 3CD4A 2GJPA 1BG9A 3BQVA 3ASWA 3G04A 3KCPB 3LEYL 2NR6C 4WFEE 3UEQA 4BH7B 2MOGA 3ESPA 3CH1B 3V7MA 2FJGA 5E8EA 2R15A 4WLCA 2UYLA 3OKOB 4I0KA 3B9EA 1K6QH 2NY5L 4N6RB 3KL0A 4IKJA 4FLHA 3BZEA 1TIUA 4M7JL 4MMXB 5GS2D 4LDOB 5IJVA 3BRDA 1MI5B 2DKSA 4PB0L 3SDAA 1HWHB 4O02B 2JB5L 4EKJA 3TCLB 5K9KB 4KKLC 3FRUA 4YHYB 2BS9A 3CVHH 5FFGA 3MA9H 3ME0B 1EZLA 2FWOB 2IPKB 1J1PH 2ZWNA 1DQLH 5KG9A 2EIZA 3FQWA 1SXBA 3QIUD 5F7EH 2VC2L 3BPCB 1S5IH 5LCVL 1NC4B 2MPAH 3GS0A 3OHXC 2EILB 1MVUA 2B9AA 5EIQA 5HYSG 5CINL 2AZUA 2QKIA 4JPWL 3JWNH 3N06B 1VF5C 4QNPF 5E24E 2CO7B 3QGVA 2ZNWA 4OTXH 4Z0XA 5JYMA 1IGFH 2VT0A 3C8HA 3DJSA 3MRJB 2VZSA 4JFYA 4MLIA 2PCFA 4M8RA 4YDKH 4Y2NA 3UC2A 4PQXA 5CFAA 3ISWA 3MACH 5L4JA 4UBDD 1KJ2A 4PRPE 1Q9OB 3KNBA 1LVEA 5CGMA 4OJYA 4B9JA 2UZIL 5DHVA 1HAUA 4O2EA 1WSST 2J57A 4Y16A 5T33H 4ES9A 1AO7B 2IQ9L 4EZJA 1IC1A 4QRSB 2DD8L 4ENZA 5BS0A 4OZGF 1ONQA 4GKZB 5EOQH 2P49B 4F9LC 4UM8A 3QEQB 5E1AB 5H35A 1C12A 2XPGB 5FCUL 3VXRB 3DDGA 2CRMA 3BD3A 4LOVA 4QHPA 1RP9A 4G59C 1AP2A 4DW2H 1IBGH 3HE6B 4FYQA 4TSAL 3JVFC 4WWID 3QJQB 3K8KA 2FECL 3G9AB 1E4KC 3JVGC 3LXAA 1PZ3A 4I2XB 2O26U 4HX1B 4AENB 2OFQA 4OLXL 4ZMTA 3SO3C 3ROLB 3PP4L 5E8OA 3GTNA 4X8XA 3N04A 3L9YA 4MA7L 4HMDA 3EKCA 3PYCA 2YN3A 5FHAH 3WYRA 3C12A 3BE1L 5IHLB 1BZ7B 2H0PA 4G9DA 4KAQH 1EGJL 1S7WB 4X4YB 3GJFH 4JFEE 3E8UL 3EF4A 4FLSA 4BFIA 5J8OA 5B38B 3RWGB 4ABWA 2OM5A 1PD6A 1JOIA 1RJLB 2DQIH 1DO5A 4FABL 3ZE1B 4MJ5A 3BPNB 4XNMB 4FL4C 1IM3B 4Z1PA 4MXQD 2EACA 4NIKB 1WA0X 1QABA 2WBXA 1R5VA 1NMAH 2IOIA 2R0LH 4GIOA 3ZKMC 1N0LA 1QOKA 4PJGB 1A3LH 4JG0L 4RGOH 3ZE0B 1MCDA 4YWGH 3UCQA 3ZYOA 1OCWL 4P9ML 2L04A 3AC0A 1P7QB 5FO2A 3WFCL 5JR1H 3DHMA 5T3ZD 4HCIA 4LESA 5C0FA 4DK6A 1YC7A 3IBOA 1QAWA 1Q94A 4JM2B 3I50H 5FECB 4I3RL 3LNGA 3SBQA 1IVTA 1VFBB 2DF3A 2F74A 4H44C 1CDJA 1CGSL 3M1OA 3OJDB 4A7VA 4FKHA 3OPZH 1H5BC 3JYBA 1DJHA 4KJWC 2YGOA 1A6UH 4WTWA 1A02N 2XDHA 4RNRB 3I50L 5JDSA 1QNIA 4GP8B 1LM8V 4J2QA 4LVEA 4GUQA 1QX1A 1VSCA 3VSVA 1QBML 2JJSC 3L5WB 3ASOB 4HLZH 4ATWA 3U2SA 1DUYA 2AITA 1DANU 3L1OH 5I5JA 5F88B 5ILTL 4MNQB 4EIZC 3ZQWA 1CBVH 5E1IA 4RISL 3LEXB 5KOVC 1SHSA 4N2OA 5DRXB 1NL0L 1T5XB 4ZW7A 2FH8A 5DUPL 5T3ZL 3T9WA 4HIEA 4P23D 2WWKT 3H42H 4NXSA 1DO6A 1M7IB 2X2YA 4O2FB 2GT9A 3V4LA 2WANA 1U30A 3EYOB 5HYQA 5JUEH 1YDPB 2P80D 1NCBH 2WWMC 1K8DA 5JTWA 3ZX1A 4DP1X 3FH8A 3LS5H 4TN9A 1XSOA 4YLQT 5ALBH 4Z3TA 3DNKA 2NY4D 2XKNA 4K8RC 4YDVB 4I3GA 3ZUNC 3HZKB 3ARED 5ABDE 5ETUB 3FH7A 8FABA 4EI0A 8FABB 1I8LC 4YXLH 1M1XA 4B3VA 1RUAL 2UVFA 2BVOA 4PJ9B 4K9JA 2HCZX 3PL6D 4Y1AB 1AO7A 3UZEA 2A6KB 2JQZA 3B7YA 3HC4H 1UJTA 5I1IH 2B3RA 3EXJA 5T3XE 3QJFB 1WGOA 2DLEA 2LLGA 4BHUI 1K5NA 2EEBA 3BLKA 4XOCA 4F9PA 2Q86B 1L9TA 4KUZL 3LNIA 2B7DT 1ETB1 3TZVD 3DRTA 3MV9D 4P48A 1T04A 5K1VA 5GIRA 5KW9H 1RZPA 3TL5A 2NY4B 3IMBA 5K39A 4L05A 3D7PA 2D0HA 3Q2LA 3RPBA 1WBZA 4MD5A 3QUXA 4HLZG 4FNTA 5BCAA 4Q9QH 3FU8A 2AEQH 1ETZA 4OJAA 2UXFA 1I7UB 1CXEA 1FQ9C 3BGFC 4RAVB 4G2AA 3QA3B 4L4JA 4X7DC 5BZZA 4DCQB 1YMHB 5IFAH 4MDJA 4YSEA 3CC1A 1OAYL 2VDPL 5KTEL 1JYWA 4JRYE 2CWRA 3I9GL 3DETD 1EJOH 1ZJBA 4NQXA 1T7ZA 4ZFQA 2YPVL 4YDKL 1EEZB 3U7AA 2DQEL 4F7CB 2VN7A 3JT0A 4WEBL 4Q74A 2PWGA 4AGNA 4ETQB 1Z9NA 5AENA 5CJ5A 4L5FH 35C8L 3EYFA 3JTTB 2Y9RT 1NOLA 4KK9D 3T08A 5J11B 1XTLA 4GAFB 2RGSA 3IDJB 3P69A 4N8CL 5EU7E 3HPLA 3S34H 2E6PA 2F58L 3H9ZA 4UIMA 3O8XA 3D39E 4BFNA 5HYEA 4KJYB 3U0WL 1E4WL 1QASA 1RZ7H 1MFVA 4KV5E 1JWSA 2P5EE 1MJUL 2FT6A 2NNRA 3LPPA 2FHBA 3FYEB 3FFCB 4M5ZH 1ZLWH 1I1AA 3LKPA 3NT0A 2IPUK 4DVRH 3NAAL 2A74A 3MU3A 1F4HA 1P7QD 2WMPA 4XAWH 5J57B 1N2RA 5HJ3B 4Z23A 1IIIA 3QJVB 5IHHA 2X4OB 5F0JB 2X4NB 1RURL 1TJGL 1UKTA 4BQBA 1N6UA 3NFSL 1F02I 4XPFL 5DR5L 1UA3A 1KYFA 3C60A 1J9TA 4M6OH 3L4YA 2ZKWA 3HFFA 4QOKB 2YIHA 5FDYA 2Y7MA 2VR9A 2XI9A 1G1OA 1VERA 2J4WH 1OTUC 1G4MA 1V27A 5I2IB 4L29B 4FFWD 1J87A 1E27B 3IBEA 1WHPA 6PAZA 1JFQH 1JWMB 4LCUA 3BQUA 4X6BA 4BZ1H 5DHVH 1ROWA 2I9LA 3K81A 4R0LC 3FO0H 4OQTL 5CM1A 2IDFA 5GGRA 1AXTL 1TQBC 5FM8A 3CFEA 4AYGA 4KZDH 1OZUA 3MA7A 2DQDH 4JMNA 1P2CA 4LLWA 3D51A 1MHPL 2OJZL 4F58H 2YJQA 3O0RL 4PP1D 3QORB 2R2HA 1NAKH 5D7SH 2XRAL 2ADYA 3ZE0F 4PJCE 4DZBB 1AGCA 1AQDB 1G7HB 3V0AC 3VE0A 4UT6H 1MQKH 2JI3A 2IGLA 3DX3A 2W94A 1NBZA 4Z8FH 4LBEA 1IJ9A 3W0WB 3ZTNH 2JKXA 1KTBA 2HB0A 1S9XB 3BWUF 5DJ2A 4KITB 3D52A 4RX4A 4LASH 4XVUD 3DX1A 3D1MC 3JZ7A 3ARSA 4XP6L 1BVKB 2BSTB 5IREA 3L4VA 3DRTB 3ASNB 2VDMH 5HGAA 2OCFD 2R0WH 4JY4B 1G6RL 4YSDA 2NW2B 2A1WL 2P24A 2EDYA 1MHEB 3U4EB 4C4UA 2VGLM 3C5ZA 4GRMB 4FLRA 1PKQE 3CU7A 5B8CA 1B4JH 1KULA 4RFNC 5JORB 3K1KC 2GJ6B 1CD1B 2X10A 5DFTA 1DJWA 1EUUA 1Y7VA 2PETA 3X1BA 3D85A 4UV7L 5DO2D 3I75A 1QHQA 3G5VB 4JFTA 2Y2WA 4Z78A 5EZIH 3U2IA 2CO3A 2EECA 2FSDA 3LN5A 4PJ9C 4YS4A 3M1CA 3HLAA 2E4FA 3AXIA 5SWQA 1BJ8A 1CGXA 2GSGB 3QWRA 3SYCA 2EUVA 2R0ZL 3X2QB 1CE6A 5BXFA 2O61A 5F44A 4AGQA 1T03H 4ATTA 3MRNA 1XXFC 4Q0XH 4M6NH 3AWGA 1NKOA 4TQ8A 3VD1A 1JTTA 1G1CA 5CUSL 4AZ8B 3NSYA 2VW4A 2Z8SA 3F6IA 4HZAA 3MLSL 3KPQA 1AXIB 4UQ2B 4WHTB 1N5YH 4I0PC 1QKZL 1I3GH 3IWVA 3RGHA 2XRAH 1YQVH 2DIJA 3HB3C 2JNZA 3BP6A 2B15A 4NM8H 2BSRA 4L2LA 1NUFA 2XN9D 4L9LC 4NZDA 1RK7A 2H26B 2P5WD 5BOPA 2VKWA 4R3SB 2HRHA 4PFEA 1DFXA 1XGPA 1ZHLB 3QUGA 1QW8A 4MX7A 4AC2A 2YD4A 4X4ME 1YPZA 3IDNB 4OLWH 1YNTB 3EHBC 5CBEA 1I3GL 3L3HA 3B3BA 3N42B 5IUSA 4F33A 3WI9A 3L3KB 3QEUB 4AQ1A 1GTNA 4AWJC 4PS3A 3MODL 3BAXA 1WFMA 3V0IA 2VC2B 3IFNH 1A3ZA 3MGTB 3IJYA 5E2VL 5DC9B 1S7RB 1P5VA 3KDPB 5F9DC 5E1QA 2ADGA 3QUYD 3QJUB 4P4RA 3GSQA 4Z7QE 3VXSE 3CVBA 2ZOLA 4GKOA 3MKGA 3QEHB 1M53A 5IJKC 2OJZH 1MHPH 2IFFH 2DMHA 4HUWA 4OKDA 4ZUSA 1ZGLB 5LO7A 4JB9H 4MB5A 4M6AA 1MWAH 4O58L 4FTVD 4QWWC 4ERSH 3NN8A 4XMWA 5E23A 3FFCD 2QGBA 3FB5A 4RVBA 2P8MB 4WUUB 1TCRB 2M83A 4R7XA 4BKLA 4M5TA 2XLLA 5CZRA 3K6SB 4ZFFB 3P4MB 3CUPB 3MUGA 3CUPA 4M5ZL 5F9JA 3RTQD 5F9JB 2UV3A 1BPLB 3AREB 4G6KH 4H5SA 1WFIA 4RMBA 3BMWA 4XHQA 1QFOA 3NN8B 2C3HA 2BXZA 1YEJH 3SY0A 1KCVH 2HVKB 4XCFL 4EZMA 5HYFA 3DUSB 4ODHH 5IY5B 4XPFH 1SPDA 4G1MA 5HDBE 3VYPA 3P4NB 5DTFA 2R0WL 1E5ZA 2BS71 2UZXB 3P9LA 5T1LD 3STLA 3IGFA 4Q9RL 1SXSA 2QSTA 4PP1C 5ITFB 2PPFA 5LGHL 1KPVA 3EYSH 4FMKA 5J1AB 1MHEA 4LSVH 5J9PB 1MIMH 4U1IB 1SMOA 4AM0A 3GLEA 3HHMA 5HGBA 3VNZA 1MWOA 1OAYH 2QADD 4B9IA 5C71A 3TO4B 4S0SD 4AQ8C 3AACA 2EVJA 1FL3A 3OV6A 3TCXA 2CPCA 5AL8A 1A4BA 2VAAB 2YRZA 2YEZA 3ORJA 5EU6D 3SGJA 4AI7A 3PIQA 3S5ZA 2NMSA 4YO0B 3O0RH 5CLZA 1X4ZA 1BEXA 4W93A 5G4OA 3KGUA 3UBXI 2J73A 1KJMA 2YLHA 5EZPA 1HQRB 2BNQA 3IWUA 2HH0L 1U3YA 4J3UA 1A1OA 3KPRB 4P5SA 3C5SA 3FZUD 2W5PA 4D9RD 2UXGA 3MNZA 1X5ZA 3I3BA 5GZOC 2WXKA 1NTDA 4MAUL 4K07A 4AZ8A 1OSPL 3V7AE 4FHJA 1KGXA 3V55A 4P07A 3HEIB 3MRDA 2VXVL 1ZA3A 3H9HA 2QQLH 1T89C 4PGDA 1DZBA 4TRPL 3SDYL 1M42A 4NHCL 3TJHD 3KPPB 4QHMA 3F7YB 3NFSH 1M7IA 1PL3A 3ATEA 3RZCC 3MA7B 4FXKA 1IAKA 3HNTH 2F68X 4FABH 2Q3ZA 1J1XH 4A2DA 3MUUA 3OXRB 3LQAL 3DXAD 5EH1A 3QK0A 3X1EA 4RZKA 5AAWC 4WU7A 4G6ML 1BJMA 1MCSA 1P4UA 2EP6A 4Y2DB 5BV7B 4D0DB 5AYUH 5I5RA 5K9QG 1KZQA 3BUQA 1GGBH 1RUAH 1E8XA 2O5ZL 3O2WH 2EEFA 1NGYA 3MLWL 4MFHA 4OLXH 5FYJU 1JNHB 3CFMA 2PYEE 1DN2A 1H3TA 4CGUB 1IM9D 2QSQA 4FC3E 1SYVB 3OPZL 2XWCA 3OF6D 1YMMD 5F9AC 2HWZH 2AJUH 4PG9B 4MA3A 1FGNH 1FHGA 2D7NA 3R4DA 3BAKA 2VL5B 1AO7D 3HE7B 2RTTA 3WEAA 1FAIL 4OQTA 4WZ9A 1AHMA 4Q9BA 4NP4H 1TLMA 1QPPA 3CFKB 3L5HA 4A2MA 5IQ7H 2E86A 2AEQL 3L16A 5DRWA 2KZKA 3GSVA 4IRJC 4F7TA 3L13A 4KO6A 1A3RH 3KDMB 4XX1G 1F6LL 1OAJA 1EHAA 3BP5B 3V2AR 1MCWM 2K7QA 2ZYHA 5DTFB 4ETQA 5IW3A 3CWGA 4PJ5B 1KIUA 3MRHA 1J9SA 3IM1A 2ATPA 4JUTA 4NN7C 5I1HL 3EG9A 4QWWD 4B41A 4RRPA 4LLVA 4OZFH 3GRWL 1MCLA 3MLZH 2HT2C 4YAQB 5ADOL 3M6DA 1R3IL 3TBYA 4X80H 3GI8H 1D7CA 4E0RA 5DD6A 4GLRI 2ZYIA 4LVHC 2X6BA 4JRFA 1QEWA 4EAEA 1TR7A 3ULVD 2H1PL 1DBMH 4UQIM 1F86A 2UXTA 4LVOB 3PGDA 3IU3B 2IQAB 4CSTA 4RMSA 2Q3XA 3VFPB 5F1OB 4CN4A 2CHZA 2FE0A 4X7SH 2V2WA 1H0DA 4Y7MA 3TVMD 2O5NA 4A66A 3B37A 2AXHA 2P42B 3QP3A 1DQMH 4KK8D 3AQYA 5HJGA 4RRPM 4ZNCD 1I1YB 5D1XA 1ZHNB 5DWUH 4UINH 4XTRC 2E27L 3KPRE 3QPQC 3CVIL 4G8FA 3TNNB 3B3IB 3IGKA 3N41B 1Y18A 3HG4A 4W81A 2MCMA 4XNQB 3UL4A 4P2QB 2Z3FA 5D2NA 4PGEB 2CLZB 3VW3H 3IXTA 5LJYH 5ISZD 3ESOA 4NQEB 4ZX3A 4DKFH 4PJIA 2EEAA 3ZTCC 1J11A 1NMBL 1V3KA 3HUJF 3PHSA 3QSKB 4U6VH 2IDUA 2X1QA 1J8HD 3JTSB 4JRYA 2J8UE 1AVAA 4YDJB 4BQ8A 1A6TA 1RJZB 1VZIA 4FFVC 3SKOA 1UJ3C 2MPAL 1O7VA 4BV1A 1C5CH 1AGCB 1AQDA 3T8XA 1G84A 2CLVA 5L2JA 1NCCH 3HCVA 2C5DC 4YSQA 1KIUB 3MRHB 3L5IA 4AKPA 2ZF9A 1P6AB 3BVNB 5AG8A 2VJXA 3O6KL 1B2WL 1NA8A 2PPDA 1MFEL 4MXVF 2IC2A 3FT4B 3ILQD 4UIKL 3KPSA 1DBAL 1M2VA 1OGAB 2ICEA 3DROB 1OAQH 3VFSA 5ALCH 1A6PA 4NEHB 2KT6A 1CICD 1QVOB 2DQJH 2PCPA 5IHZA 4Y0GA 3ZHLA 4XNZB 1G4RA 4L1BA 3KLAA 1USZA 1HHIA 2V5SA 2HT3D 4Y16D 4QRRE 1UFGA 3RDTA 4PJ8C 4PG2A 3TOPA 5JORA 5B7EA 5EU3A 3LRHA 4KNQA 3V5DB 4G6KL 3AU1B 2H8PA 3T4YA 5B1BB 3O4LD 3RGBA 3PP4H 4JFFD 2XN0A 4LSRL 2V2TB 3I75B 2E5EA 5FYKL 2LABA 3BO8A 4BQ6A 4IU2A 5CIPB 3LEVL 3WY1A 5FLVA 4MAYA 4N2EA 4R2GD 1KLFB 3IMUA 4LPTA 4MJ2A 1LEKA 3O2VH 3RVWC 1H19A 2DYRB 4M48L 4HJUA 2RALA 4X83A 2LU7A 2EVIA 2AKRA 2JB6A 1Z5HA 1IC7L 3MLRL 2ZUQC 3HE6D 1V3LA 1U3HC 4IIZA 4XNUL 4N28A 3PHOA 3FCGA 1F58L 1KBGH 4KRPB 3JWOL 4ZZKA 5FFLA 2Z6FA 3SGEI 4J12A 4P3CL 4PD4K 1OL0A 4N5EC 3X13B 1CDHA 3F83A 4IRJD 1BQLH 5AOMA 3AWEA 4JHAL 2O30A 2WQ8A 3D4CA 4I5BA 4RMQA 2MNJB 3QFDA 3RNQB 4KXZH 3WO4B 4E9XA 3MACL 4XMLH 4KXBA 3MYJB 1BM7A 2NTSP 3DSNA 3FB8B 3BH8B 5E1GA 3VXUB 3P3YA 3QYMA 1RUML 3O45A 4KK5C 3H9SE 1PX8A 1QRNA 1SJEA 3U9WA 3U4KA 5CXPA 4JFFA 3C6LC 5BPPA 2AJZA 3VG9B 2NYYD 3RVUD 1A2YB 1UWXK 3OAZK 3RY5A 3MRGB 5FF6A 4KXAA 3S2AA 5IMLB 5HHMD 1PKOA 3A24A 4GAJL 5JA9A 5ESAB 2JJTA 1CL7H 5L9DL 3R0NA 3WMPA 1B0RB 1KTLA 1Q8MA 3BGMA 5DHMC 3REVB 4BHUA 4FL4B 3BPNC 3BEWA 4U05A 2Q10A 3SDYH 4XPGH 5IOKA 1G7MB 4PJDE 5I75C 3PU7A 2AJSL 2BJML 4XTRD 4NI6A 3FUJA 4BRJA 3TBWB 2DM4A 4JHVA 2KMWA 2VMEA 3NCMA 3CPLA 4HIHB 3TBVB 4TUJA 5KJRL 2G5RA 3FU0A 2IBBA 4BDVA 3UTTA 2YXVA 2PO6D 4JY5H 5DURB 1GVIA 2DQMA 4K55A 4QF1A 3TWYA 5ABAA 5HI5C 1DR9A 4XB8A 4NNYA 4JPVH 3RY4A 4JLRB 1UUNA 3E9TA 4NQDE 3SDAB 5ITBL 2H1XA 2C3GA 3O41B 4PHZA 5DK2A 4ELME 5DK2B 1E8WA 3CN2A 4QO1B 3L3GB 2GUYA 3MOAH 3MUJA 1H8NA 3NACH 2GSGA 2NY3C 1FNGA 3JYCA 4CGTA 4IRSD 3W9DA 3GO1L 1OF0A 4AX3A 5LCVA 1QBLH 4HJ1A 4HZLA 1AY1H 3UTQA 3SJVA 5C0IB 4OZGB 3PABB 1F11B 5DQJA 1OP9A 1U92B 3NCBB 4P5RA 1IBFA 1NEZA 3BDXA 3F05A 4PJCA 3QWOB 1HL9A 1T1ZB 3DK0A 4IBQA 4Z95L 4PJGE 1QYGL 3U46B 3NJNA 1JTOA 3U9UA 2X44D 3NJFA 1AD0A 2D0FA 4JGUA 4HPYH 3KYAA 1P4BL 3F7KA 5EBLB 2X9YA 4XP9H 5TE6H 3TZVA 3OC5A 1NLBL 3W2DL 3KW7A 1JV5A 1MF2H 4JFXA 4PUBH 1CIUA 2DLTA 2KPWA 5J1TC 4A04A 3WFDL 3OHXB 1E4HA 1JNNH 2AXJA 4JN2B 4JN2A 5EORH 1BFOB 5C0BD 5PCYA 5HHXL 1MFDL 2NNXA 2CLZA 5C1MB 5KVFE 1LQBC 1SLUA 2UZYA 3FO0L 1NC2B 4OQTH 5AOZA 2F7RA 3STZA 1Z7JA 2QHRL 1MWAL 3HHSA 1CYGA 1PMYA 2YAOA 3SPCA 1ZSDA 3MQIA 4GLRH 2E7LA 3R7RA 4XR8C 4FA8A 2R0KL 1RZKL 3ABKB 1IGCL 3EF7A 1RHHA 1SF3A 4S0HA 1D6VL 2NR6D 3N91A 1MF2L 4XPHH 3VFRA 3BFWA 3DSFL 3IVKA 1A7QH 2YPKA 3ZE1F 1KACB 1QFUH 3IDYC 3OKDA 1QSFD 1ZK9A 3BDYH 5DJ8A 1XL6A 1QSFE 2D9QB 4QRTA 2EIMB 4WW2B 1KGYE 2N7SA 2GK0A 1GIGH 2YA2A 1KXTB 4FEIA 4NNYB 3FUFA 3BUTA 3RVVD 1DJZA 1E5UI 5AKSA 3MUZ1 1YEWA 4NBZB 3KPSB 3GB7A 1GMEA 5SWSD 5IEKB 4JFZH 3MNWA 4JG1H 1MJ8L 4JM2F 4P59H 3CMGA 2GFBA 3APFA 3WE6A 1FJ1A 1CFBA 4U0QB 3B43A 4U3XA 1MPAL 2Q5BA 3BKJH 1Q0XL 3PG2A 3IGLA 3G5ZB 1T6WA 4FFTA 3DX7A 1J8HA 3U0TA 1BD2E 2CHXA 1XEDA 1C1EL 1MCNA 2J7LA 4IBSA 4WO0A 5EDXA 2KKQA 2VYRE 3ELQA 4XB7A 3VWKC 2VWEE 1G7MA 5E5MA 2XWJA 2YXFA 4CUCA 3MLSH 3LHPH 4M93C 1JZIA 3QFJA 1PFOA 1Q0XH 4FQQA 3K4ZA 4PRIB 1XR8A 2OP4H 1N4XH 2CMRL 3SYOA 5LDUA 4LP5A 3G5YA 3VX1A 3QC6X 4FNPA 1SJXA 4PRAA 2OTUB 3V6OA 3QNZB 3P0YL 2PP7A 5F0MB 1JGEA 2VDMB 2VABB 3D2TA 1SVZA 5D7JB 1YCSA 2BHYA 5F7DB 5H37H 2QBWA 3ETBJ 4XCCL 3ZDYB 4P2RE 5FUCE 2DWYA 3MBEB 2YEZB 3PGCA 4S1RL 4YXKH 1U4EA 5IF0B 1HTYA 4N90E 4NZJA 5T5FH 5IG7B 5TE7H 1KBWA 5JW4N 3FTZA 3UIYA 2ZWZA 1DZ0A 3P77A 1XGUB 4HK3N 3QDGB 3TEZA 3LZFL 1IGYA 1EFXB 3S7GA 4HZLB 4JO3L 1OPOA 3DXAB 3MVSA 1V8HA 1LO4H 4IYKA 3SJVD 4UNVA 1XSJA 2R2HB 1C7TA 4F8OA 1KY6A 3PP3K 5F7WC 1M05A 5DSCA 3ME0A 4I88A 1YLBB 2G3ZA 4YVUA 1C5DA 3LZLA 1P2CB 4XP6H 2CO6B 5LDSA 1FHNA 4UYPA 5ECGA 1VPOH 1DVFC 3NCYS 4LASL 5BJTA 3MJ9A 5F21B 3T3MB 2XQBH 1TOXA 3GB7B 4PGZA 3TN0D 1M05B 5DSCB 5JHDB 2VZ3A 4OR1A 5E8OB 3L17A 2A6JA 3ULSA 3MAWA 1IX2A 1PU0A 3MFFA 2W0LA 1A8JH 1DBBH 1LDSA 1X6LA 2WLIA 4P3CH 5KSUB 2HLFC 1PIFA 1S7TB 2APWA 3JWOH 4FG6C 1JD7A 3Q05A 4PLJD 5KEZA 2EXSA 4LNVA 4MMZC 2DPKA 4NQCE 1IC7H 2ZKHH 3MLRH 2HX7A 2X1WL 3VFGH 3O11B 3FS9A 1GSKA 2PUQT 4HUWB 2WVSA 3ARGA 1XZ0A 3IU4L 4JANB 5IVNA 2BMKB 1Z66A 3NACL 4G9FD 4Y9FA 1XH2A 1W72L 4QXWA 1O9WA 4PRNA 3W37A 4P4RB 1OE3A 3B7RL 3IGAA 4E9VA 1W72B 1L6XA 3PDDA 5AUMB 3P9MA 4HHAA 1ZPUA 4HHAB 2XETA 2IG2H 3ZIYA 2DMCA 4H1LA 2BP8A 4X6FA 2CALA 1G6VK 2X5PA 3DPBA 3S96B 3SBWC 3QQ4A 4GAJH 2I7SA 3V0GA 1F6AB 5J1SC 4J3OG 1B0IA 4X0KB 3QIWB 2B3IA 3CZSA 1YMMA 5LXVA 2AV7B 3Q6FB 4HGWA 5I73B 4HSQA 4X8CA 2Y7NA 2YSSA 2ZSVB 3KXFD 3VXRE 2VDML 2GBAA 3O3AB 1IKFH 1DDHA 1NMCB 3F8UB 5A2AA 2QTEA 2VDRL 1YUHB 2AJSH 2BJMH 2GVYA 2ITCB 1TQCB 1N6QL 5BMFL 2IAMC 1BZ7A 4G9DB 4N20A 3QWQB 4DN3H 4UIKH 2K45A 1Z5LB 1MFEH 1TZHA 1UXSA 4HUMB 2UWEF 1FC1A 3O6KH 3NZUA 1A5FL 3P3SA 3CX5K 3PY9A 4HXBH 4YFLI 1QI4A 2PO6A 1NBVL 2W95A 4XZ4A 3FYIB 1KWGA 3M07A 4X5LA 3I9AA 5BJTB 4XBEL 3GZKA 3Q5TA 1MI5A 3FT0A 3KE0A 3QW9A 5DEGA 4FTVB 1ZEAH 5I1DB 2VDOL 4TKWA 2NW3B 3WEXA 2J88L 3B9KB 5A7BA 4L8DA 3GSWB 3BZDA 4OLZL 3S5LG 5ENWA 2VN4A 3EO1A 2YWZA 3GMQB 2X4NA 1MCPL 1KG0B 2DQCL 3QT2A 3LN4B 3QG7L 3TWCH 2I25N 3RU8L 3VD4A 4XN1A 4BINA 2WQXA 5FYKH 4GO9A 2CUAA 5GGUB 2NPLX 5LHDA 5HVGB 4ZUSB 4R97B 2H2SD 3UBFA 3OZ9L 4IIQB 4EMZA 4PPTA 5IJDC 5F7HA 5F96L 5DHYB 2J4WL 2PXYB 1W8EA 4CADB 3OR7A 3ETTA 3ARDB 1KOAA 4MS8C 2ZF8A 3KPMA 5DDHB 5F1KC 3WEBA 2ILLA 5HPMB 1U3ZA 4WO4B 2Z93A 3I02B 4V2CB 5GRVL 1KGWA 4PCSA 3EH5B 5EBMB 4FFZA 2ESVA 5IMKB 2Q20A 1U8PA 2DD8H 2BVYA 4L23A 2EEDA 4AYFB 3AFLA 5FYJL 2GTWA 4Z5RA 4BZ2H 4E9QA 5CBAB 1DJYA 4PY7B 2VM3A 1RZJH 1V5JA 3DMMD 5MERB 4CJ1A 1FG2B 3SDXA 4KKQA 3CCHB 4ZDHB 4L8SA 1TTBA 2ZX5A 1T5XA 1R1CA 3LXBA 5BRZA 1RPQA 3GBMH 2P5EA 1XH3B 2GIXA 1M57B 4J6RL 5GZOD 4BWTA 2WWMD 4DCQA 5L2KE 2EUWA 4TF4A 4ELKA 5ICXB 4U4BA 3O4LB 1DVFD 1SFHA 1X9UA 2WGXA 4L8SB 1EXUB 4PJHF 3CLFL 3OKLB 2HVKA 3QRGH 2N1KA 1KXVC 2I9TA 4ZUTB 2ITDA 2WZ6A 4FFYH 1XGRA 3VXMA 3VRLF 4RGMC 2W9EL 1AKPA 4YR6A 3H1ZA 4PG9A 2GPZA 4OUOA 4XAKE 3B7TA 1EJOL 5BQ7A 4JDEA 1HEZB 4FQ1H 3ARGC 4WI7A 3K46A 4LGRB 4RISH 5F0PB 3CC5A 2D7TH 3QC5X 1KYAA 3CZUB 4NUGH 3RG1C 1GHFL 3PFUA 3L2NA 3MRLA 4Y1AA 3AXHA 1ANUA 1UVQA 1KIQB 4GG6E 2NSXA 1BQ5A 3S35H 2P45B 5TTRA 4GKSB 2P5WE 2VXTH 5A2BA 5CWSB 1T2QL 2OMVB 4KKAC 2OMVA 1QLFA 1DQML 4JKNA 2BO0A 5GSVA 1ACCA 3U7WH 2V37A 4G43B 3T3MF 3VMPA 4HOWA 2OMTA 4JDVB 2P8LB 4P57A 3S3CB 4KMQA 2OZ4L 4LGPB 4O02A 1JZ3A 4XCYB 1DVYA 4GAAA 5E00B 2O5ZH 1OEZW 3O2WL 3ZK0A 4KKBD 3QZMA 1MLBB 3RVTD 2M26A 5TF1L 5AYUL 1WEJL 1RH8A 1EHKB 5B7FA 3HC2A 5JHDE 1NMAL 2ZXDA 2B4CL 4JN1L 5MEOB 4XBPB 4DWHA 4QHMB 4EQ2A 4M8QA 3BSHA 3N0PB 2EIEA 2XTJB 2VXQA 4F2MB 3MN8A 4F2MA 5EU4A 4NQUA 1SM3L 1BWWA 5I1HH 1U58A 4LXFA 2HMIC 2FX9L 2K6WA 3AWFA 3LPWA 1WWBX 4PGCB 1I8IB 3UAJC 1ASQA 1GAFH 1HYSD 4D0BA 1NL0H 2FGWL 5F8QC 2JV6A 5T3ZH 3BH9B 4PJBF 1RJYA 4GG6F 5HY9B 1I82A 1PZ5A 3GHPA 4HWNA 2QPSA 2F53D 2O6FA 1MAKA 4JPQA 4YNYB 2QR0B 2W65B 4BCXA 5ISZA 4BSWA 5C9KA 3QUKA 2VZOA 3F7LA 3FB6B 4KKRA 3ULUC 5FA3B 2H6PA 3OJ2C 1VFOA 5AWNL 2WHVA 3IDIA 5H94B 2C9UA 1A6UL 3DTDA 5I8EA 3W5MA 1OTUD 2J56A 2NY7H 4E41E 4KZEL 3BKCL 3N43F 2D2CC 4HIQA 5I2IA 3BZ4A 3Q44A 4LSPH 5IWLA 4JQIA 3JV5A 1KYDA 2H2SC 4OIBA 1DQDH 4X6EA 4WI0B 4PMEA 2PYEA 1DJGA 2BDNL 1GKOA 5AWNH 3C60B 3P4LA 4BUHA 1A66A 3EH2A 2ZAIA 2WY3B 1QSED 2Z31C 5D4HA 2V3FA 2WQUA 3GMLB 3SDDA 2IQ9H 4BA8A 3ARRA 2GTZA 1WZAA 5CD5C 4MJ6A 5CN3A 3AXLA 3QQNA 9CGTA 4AYMC 1GYVA 3QR1A 4G80A 4UT7L 4XHJC 1T20A 1KCRH 3S36X 2R0LL 3QCTH 1ZT1A 3TCLA 4BZYA 2FJGB 4OLVH 4QRFA 5E8EB 5C3TA 1GH7A 3CSGA 2FATL 1TSHA 3BAIA 2HVBA 2JF1A 4HVBA 2HWZL 3EJYD 3JTTA 1OVZA 3EYFB 2F2HA 3ULVH 1ADQL 4WNQB 4JLRA 3UZVA 3QI9C 5C0GB 5KN5B 4YIQB 2B4CH 4JN1H 3HPLB 3PUCA 4UIMB 4EDWH 4WFGD 3T4AC 4UDUB 4Z7VF 1XBRA 3FOLB 5I76B 4XMXA 4MA7H 1I9JH 4NZFA 5D1XD 2EIJB 5GZND 5EO1A 4G5ZL 4NT6B 1KFAH 1YRKA 2B39A 4YK4C 3IJ8A 2EKJA 1HHHB 2Q3AA 3TV8A 5F8RC 2ZD0A 4KKCC 1Z2KA 4X4XA 2EUXA 1ZE3H 2F74B 1RZQA 4TUOB 4HOXA 4ZXBC 4MX7B 1K5WA 2CPUA 3IFPB 4C4BA 3ARDA 3IDXL 3MRPB 1KIRB 2Y36L 1KIRA 1HHHA 1TXKA 3FTWA 5ESVA 4F1SA 2WP3T 3LYRA 1ZHNA 2WWOA 2CJUL 2DI7A 3QUML 2Q8BL 4D9QD 1FSKB 4FFYA 4NZ8A 5IQOA 3AUVA 2OQJA 5DK3A 4OJFH 3MV7E 1WD8A 2VLLB 43C9A 5I1KL 1QUPA 1CU4H 4NPYA 3JWNC 1SN2A 4M4RA 5J5EA 1YHPA 3PFQA 1X4YA 1N7MH 4YSTA 5IEHB 1T7XA 3FF8A 3SYQA 3VH8B 1Q38A 2F9BT 4GXFA 1ZLUH 1XF3A 4LDEB 4U3HA 3SE4A 1YDPA 3FMGH 4TQIA 3WJJA 4LLWB 5IIEB 4XXWC 2HLAA 1XQ4A 5CAYB 1MRDL 1UYWH 2DM2A 4ODHL 3MV8B 5LBSL 4HJSA 5CGTA 2WSKA 3UG4A 3K6SA 2XWZA 3DV6A 2FJFA 3TS8A 2ESVD 4HC1L 3BVNA 1F97A 5F3HB 1Q9KB 5FV2A 4BGLA 1TNNA 2NY1B 4U1HA 4PJFE 2VDLH 5IJKA 1JN6A 1MXDA 4FQXB 4NRZB 1GGCL 3OR6A 1TJIH 2IADA 1FE8H 4XNXH 2CRIA 3QXVA 4XXDB 3UAJD 5D6CB 4JY4A 3QBTB 1HYSC 3DJRA 2VDQH 1FLRH 1E6OH 3BEWB 1XCQB 4TUJB 2WLYA 1ZMYA 2R7EB 1WS8A 4MD5B 1J8SA 1Z9SA 1R75A 3HE7A 3I2CL 5BNXD 1BBDL 3L3KA 4AQ1B 2F53B 3ZO0A 3OAZH 2WVTA 5GJTH 2OMUA 2XZCL 1WK0A 5DD0L 4YBQC 3C08H 4HAFA 4ACPA 2MKLC 4X0KA 1IM3D 4FTDA 5LWYH 2X28A 4GMSH 2DI8A 2ZXBA 3VXUD 4OLWL 2F7IA 4KZ0A 4NZUL 5ADPH 1KEML 1ZHBA 5H4YA 4LRIA 5IROC 3QJOA 4N2CA 1JI1A 4UTBH 1HILB 1NWOA 1IQDB 2WP3O 1K4DA 1KLUB 2NY6D 4H8QA 4W6XB 5DJXB 1SMAA 2YEVB 4Y5YC 4EVNA 4QXUH 3D33A 1E4XH 3V52L 1L7TH 2E56A 3QJSB 5T1LA 5I1AA 1MCOL 2K6YA 4J3OH 4LKXA 3T5WA 3F84A 1AHKA 4XVJH 4NKDB 1UD2A 1P84K 2F8VA 3DURB 3GMRA 3SE4C 3WV0A 2XWDA 2HA1A 4H0IA 2MQCA 5BZXA 3ARBA 4M5SA 3GSNA 3PCYA 4JO8A 3RWHA 3RIAF 3W11C 3WJMB 5I1LA 4PWKA 4HXBL 4I5BB 3WGUB 5DEGB 4FI8A 5JHLA 1LEGB 3V52H 3MRFA 4HMEA 2Z7WA 1KV7A 3PF2A 3GLZA 1KCUL 2A83B 4JFPB 3UYPA 2NUTA 3ARFA 4H88L 5FDWA 3O2DL 5F72S 1ID5I 4KMLB 1M6OB 1QSVA 4JL1A 1XO8A 3ECWA 2G0KA 1TQVA 4KO9A 4YHMH 3RGVA 5AKVA 2WLNA 4LAQH 4UANA 4WWOA 1HHJB 1WG3A 1UB5A 1C08B 1WAAA 2AEWA 3FU7A 4Q6IA 4E5XA 1KC5L 1Y1DA 4O2EB 1FORL 3IF1A 4ALAC 1WWWX 2G2NA 4YK4B 4N22A 4MD4B 2ISDA 3CNKA 1VADB 2NYZA 3HBZA 5DD3H 3CZFB 3EXLA 1T7YA 3HOGA 2HN7B 4JVPA 2WSPA 1NAMA 3MNZB 1CXHA 1XVSA 4Q2ZB 3FN3A 3HZ3A 4YHIA 2JCCA 3T4AB 3HIZA 3TBSB 4DZ8B 2GG1A 2PABA 4JZJA 4C59B 4I13B 1HQRA 3BWSA 5DZVA 4CVZB 2HVJA 1UB6B 4TNEA 3VD9A 3MJ9H 3TF4A 2IXQA 2HN7A 2DWEA 4QTHA 3WKQA 4FDWA 3NAAH 1ZVSB 4Y4KA 2QFRA 4DZBA 4H8UA 5DRNB 2CLVB 2FEEI 1V7MH 2X6VA 4Z8FL 5AAMC 1WC7A 1JV2A 4PJ5E 1WV7T 4IEFB 4KTYA 5FGBC 3U0TB 1ACYL 4YDJA 4PJ5D 5DUML 2G5BA 1EXUA 5FFOA 2J5LC 1E4XL 5BOJA 3BP5A 3T0DA 1YO4A 3D06A 5J7CC 5ICYA 2WM0A 1JZ8A 3AM8A 3D18B 1WC7B 2QSCH 2A7BA 4NN5B 1NCJA 5D2NC 4ZQTA 3UTQB 3GGWB 4JKWA 4WJ5A 4JFZL 1MW1A 2EDTA 1RZGB 2FJHB 2JSFA 1GZPA 3DUSA 5EOCL 5C7XH 5IW6B 4OJFL 2HUHA 2VQ1A 4H1LH 4M03A 1NICA 1JFHA 2HX9A 5DFAA 3ARDC 4O4YL 2C9VA 4Z7UA 1ORQA 4S0TD 2BRRH 1QBAA 4WHCA 2ZXEB 1GR7A 4X9YA 4TYUA 4PJHA 1FLRL 1ZSDB 3JUZA 4NX0A 1LJMA 3ZKXC 1TJGH 3B8YA 3GMQA 1MJJB 3H9YA 3IF1B 2ETWA 3LCYA 2CBQA 3V7AG 1ZANL 2QQKH 3MBEA 1FZJB 3ELAT 3HC3L 3TJHC 3PL6B 4Y1AD 3RIAK 4OFDA 4LEBA 2CKBH 4APQD 1KFAL 2P8PB 4RSYA 3V8OA 1V3JA 4DEWA 2OQJB 5JOFA 4KC3B 2WZPD 3LTVA 3PQYA 2BY0A 4WK4B 2FSEA 2CCLA 2EZ0C 3FO2A 3TN0B 5FA4B 3MV8E 4NB7A 5DS1A 3HPJB 5HPOA 2DJUA 3GEFA 5JHLL 5DJCA 1BOGB 5TDOA 4ENED 3KXFE 1AYOA 1M6UA 1T22B 4GRWH 4DFHA 2R69A 5AW1B 3S35X 4KHXL 5DHDA 2XNAB 4UV4L 5F71A 5CZVL 2VERN 4OGYH 1BVZA 1NANI 5FYKD 1HIMH 1NCDH 4L3EE 4OCRH 4ZSOE 1VCBC 1NMCC 4JFFE 4HYTB 3TVMA 4PP2B 2R2EA 5HD8C 3E1ZA 5E70A 3WE6B 4M3HA 1IAIH 5DT1L 3TA3D 2GITA 1B90A 3MBED 1T66D 4FRWA 3MX0A 3MLXH 1QHPA 3BDYL 4LLYB 5MENE 1XCTA 4U1KA 1XD1A 1EK3A 4KQ3H 4C56E 4F9PC 2PW1A 4TOYL 1JIBA 5T1MB 1SEQH 3B3IA 2I60L 5EU6B 1IZKA 3ARGB 4JANA 2OCJA 2FLBT 3JWDH 4YX2L 4DN4L 2YD8A 4MJ5B 3ZE0E 3TTYA 4OZIF 1UEMA 5ECJE 4A2EA 2OR8A 5KJ4A 2VITA 7CGTA 4XNYH 3IDUA 2H32A 3MLTA 2HKFL 4PJXB 2ADIB 1ZGLP 4PS8A 2VDKB 3IFOA 1TF4A 3H2PA 5F7AA 4EXKA 3K80A 3C6EA 4P2QE 3GMNA 1F8TH 4TSBL 3VD0A 3CDGA 1KTCA 3ZGHA 3ZL4L 5JPMB 2V7NA 5DZNA 3X3FL 3AT8A 1EZUA 1PX4A 1YUKB 2RB8A 1DSFH 1IFRA 3LSOB 4GAYB 1I7TB 3QAZC 4M62H 3ZDXB 2DTMH 3PWNB 3NA9H 1VGEH 4AQEA 4H8VA 1BZQK 1HESA 3KPSD 3VNYA 1N9PA 3G7TA 1A4JA 5B1AB 4UT9A 4NO0A 1XDTT 3RTQB 4YAQA 3ULAB 1CG9A 3IFLL 2EXWD 3MRFB 4NKDA 3RKDD 2BSRB 2JJSA 1X44A 4P0DA 3WNMA 3GO1H 4EJ1C 4WO4C 4EEEA 3KPRD 4L8CA 3L1OL 2WVVA 4FGMA 1X6NA 5I18L 4Z7WA 2ZUTA 2DLHA 3DO4A 1TVHB 1XIWD 4GQ9H 3PAYA 1FN4A 2GAZB 4WY7H 2G9HB 3RWJA 1BCIA 3DTXA 4OF7A 1JGLL 4HG4K 5KBKA 1TZ8A 2D9CA 3HZMA 5F70A 1E6JH 3KNBB 3ARPA 4WWKB 4KQ4H 4M61A 1ZLSL 1IKOP 1A0QL 3QUYB 4OCSL 3AY4C 3VXRD 2GQHA 2YSTA 3FQ2A 4KJPC 3TCTA 4LLUB 1S7RA 2NY7L 4BA0A 1XV8A 1OD9A 3U0PB 3B56A 5FCUH 5FUCC 5JHMA 2X6UA 4XO9A 4J8QA 8CGTA 5CJOL 4LMQE 4YGVA 3T2LA 1ND0A 3P02A 1Q9OA 2AQ3A 1HHKB 4GO6B 3QEUA 3O3BA 2YPLB 1U8PB 3CN0A 4NRYB 1IGTB 5ILTH 4AYID 1PY4A 4TUOA 3REWA 5BUAA 4JFYB 3V4PH 1EUTA 1WCQA 3EFDL 1HJBC 3VXQA 3MO1A 1TYEB 3MJWA 2L0DA 1FV1B 6TAAA 4QOKA 3FONB 2PO6C 2WKOF 3VFWA 3EGDA 3VWKB 4N5ED 4NC2B 3H3BC 3UP6A 2YUVA 4LP8A 3LY6A 5AKTA 3ZSSA 5E08H 1LO2H 3V4PA 3BIKA 1TQCC 3HBPA 3OGOE 4FCHA 2X4TB 2BOBA 4I18B 4YZFE 1QRND 3MR9A 3W3BA 3HC0A 3ROLA 2Z4QA 4G3YL 3P4NA 3VXOB 6FABL 4ZFFA 4K7PH 4UB0L 3CPUA 3RWIA 4HK3J 2Q7NA 1P5UA 1K8DB 4HIIA 4HJ0C 5T1JA 1A3LL 2WYZA 4E9WA 2VQUA 3NK3A 1THCA 3MA9L 3T09A 4FTVA 4CBPA 1OALA 4WJKB 3BN3B 4JDEB 1FBIL 3SDDD 1YEDB 1S78D 4KGLA 3B2VL 2WV3A 3LNDA 3Q8AA 4PB0H 1DVSA 2ICEB 5FIEA 4NJ9L 3RBGA 2WZ5A 1FFOA 1SHMA 4NKOA 2HJLA 4A2LA 1U8MA 4Z7WB 2MQ3A 3LKSB 3QZOA 4R8WL 1HX0A 2YFNA 3QB7C 1RZKC 1XF2A 2W0FA 3S37X 3TNMA 3DIDA 5L8LB 4GXUM 4U6VL 1Q9WA 5FKAA 1NCAL 2IIJA 2LTQB 2OJEA 5LG1A 4EUPA 5CEXB 3PDGA 1WTLA 4J4PC 2QVMA 3IJEB 4GAYA 4XZUB 2E7CA 4Y5VC 2ERJC 3WNPA 2CDFB 2EH7L 2GI0A 1K8IB 4YHLH 3AG2B 4NERA 5FM5M 3ZT6A 1ZT4B 3PQYE 2ITFA 2IWGA 3I6LD 5EFIB 3NA4A 3CLFH 3IETA 4H4NA 3A0OA 4FN0A 4IRSA 1ZEAL 2AJXH 5I66A 5KVMC 4AZUA 1YJDH 4XBEH 2ZJSH 1FNGB 5KVFH 2VN5A 4I48B 3VGFA 1YAIA 3ZHNA 1ITCA 3P3RA 2BY3A 3RNQA 4RSVA 1AI1H 1T5WB 3CFEB 3C8DA 3VXOA 3RA7L 4JL2A 4A7UA 1S3KH 2VH5H 5GRVK 1S3RA 5TK4A 4AY0A 2FX8H 3A47A 1T3FB 3CBRA 6FABH 2HT2D 3MKKA 3QHZH 2WUCH 5IK3A 3GJEA 1F90L 3OKLA 4BH8A 3VJ6B 4I3SL 2FYVA 4ZO7A 4TNVK 5B8CC 2DQGH 4XVOA 4LHUD 4Q56A 2D3VA 3L54A 4GEIA 4R83A 2VL4A 3QIWD 3FBKA 4FI6A 5F93C 3ZQ9A 5D6DA 2X53A 5JW5A 5TE4H 3R18A 1MHCB 2ARJQ 3ARFD 2CJSA 4GKSA 2X7LA 4P2OC 3SKUD 3BAEH 2DQCH 4FQLL 3RE0A 1NOAA 4KXDA 1CQKA 4ZMNA 2TRHA 1QMUA 5DEFA 3MRLB 2IMNA 2BW4A 2RACA 4R4FL 4PRBA 1FCCA 2E27H 4J28A 5DRWB 4F7TB 2FVNA 1T80A 43CAA 3WCYA 3IGAB 5I16A 1ZJAA 3WBDA 5FECA 3MBWA 3U1SH 1JF6A 2FQGA 1A7RH 1U95A 2OMUB 1A0QH 4OCSH 4RMTA 2G4EA 1AGFB 4OJDH 2IANE 5GSRA 3GHBL 3W39A 1NAML 4YQXH 2ENYA 4J8RA 4F7MB 1YEEH 3NIDE 5AVXB 5K59F 3KPLA 1UKQA 5B3JE 3D87B 5BMFH 3ZTJH 1BF2A 4F7CA 1OP3H 1G7HA 1A4KB 1BPVA 1BZ9B 5GHWL 1CLCA 1MREL 2D7QA 2PLTA 5LBVA 3W9DB 5A6IA 2FLMA 5DS8A 3IJHB 4E9SA 4B0MM 2CIKB 3L4ZA 3ZL2A 5ITFA 5KANG 1UM4L 3EDEA 4DJMA 1RLBA 2QKSA 4XRCB 2MSPA 5G5DB 1QR4A 4XBPA 3NABL 3QDJB 2P44B 3IMSA 1D5XB 2G2RA 4JO3H 4TTDD 3UXFA 2VUOA 2MTAA 2ICWB 3MI6A 1NM4A 3MV9E 5T3XL 2CCWA 1U3HB 3X1NA 5CGBA 1WF5A 5BRZD 3FQTB 5SX4I 3FTVA 3OMIB 1F3JA 3CFQA 3MRQB 4TL5A 1CICC 3PJNA 3HMWL 2PN5A 3U30B 3W9EB 1IRAY 1FNLA 4PJDB 5HHQB 3TLRA 1X9LA 3BO8B 1ICTA 4Q8BA 4JRXA 1JI2A 2XVBA 2G2RB 1ZD6A 3JWDC 1F0LA 2Q9OA 2YD6A 5DZ9A 2GJ6A 3ETSA 4J5VA 3IK2A 2P52A 4LPYA 8PAZA 1B4RA 3D30A 4X6EB 4DK5A 3K74B 4XO5A 4PWGA 2F7PA 3D69A 2YRBA 2EE0A 4GXVH 1GGIL 5GGVH 3FT3A 2CG9X 2ZXQA 4PJHB 5JW3L 5I6LA 1I75A 2CMRH 1N4XL 2GBTA 3O8XC 5CJQH 4L2YA 1IZJA 1AMXA 1JGLH 2AJ3A 4ZX5A 4A7GA 2SEBA 3TT3L 4B53A 4KTDH 4R96B 1NCOA 1PG7H 4Y2OB 2FECI 3VE0B 3N1GC 3CHRA 4GFTB 3TYGL 3FTGA 4CW1B 4QRUA 1QRNB 4MQTB 1NFIA 2FEJA 1OARL 5DJ6A 1XF4B 4ELKB 5SWZA 2Q0ZX 2RJMA 3KYOA 4N4YB 4ZBJA 1EGJA 5TPWH 2CGRH 4KKLD 2WKOA 1GY1A 2IDSA 2QSVA 1FO0A 3IEAA 3Q06A 2B4CC 1HU8A 1B88A 2FEDD 2XKUA 3IAQA 3KXFA 4PV1C 4C4KO 3HFML 4ODTH 3F6JA 5ISZE 1OIOA 3NCYP 1AZNA 3FO9B 3IXAB 3KLLA 5DVMA 4IOIA 3SHSA 2OXGA 4IOFC 4X9BA 3F65A 3OKMB 4P2QD 4TRPH 2F6AA 2DLFL 4XMVA 2E7LC 3NIGE 1DVUA 4JO4H 3RL1A 5IQ9B 1M2OA 2E47A 5MEPB 4G7YH 3CHQA 1DE4A 1QPXA 2WBWB 3UTZA 1FJ1B 3V6FB 3F7VA 4BXSV 1MXGA 3ZDZE 4HCRH 2N59A 2BVUA 5T1DH 2Y7SA 2YBGA 3FQNA 1AH1A 3FSAA 3TTSA 2JJTC 5CIPA 1CQYA 4XN2A 5CP3H 3UPRB 2CCVA 1JZHA 3DI2B 1U42A 4IDLA 4Q6IC 5EU6E 4CVXB 2EYTB 4JREB 2A4ZA 4PWHA 1YN6A 1OTTD 1SY6A 2WO3B 2I5YH 1NGZA 5BRQA 3SDXF 5C70A 1KG0A 3UC0H 3VG9C 4MS8D 1BLNA 5E99L 1ORQB 1IU1A 3ARFC 3PHQB 4PLKD 3PHQA 3NRQA 3OPUA 3CHPA 3HW7A 3AS0A 4R6UA 5B8CB 3DBXB 4EIGB 2RCSL 3FCTA 2X4QA 4KPHL 2FL5B 4ODUB 1P7HL 1UWGH 2FDBP 3RY6A 3OKKB 1MJ8H 4JHUA 1URLA 3CDZA 5I8CA 1O6SA 1H8LA 1D3CA 2A73B 2X4RA 1EIBA 1UXSB 2BVPB 3EYSL 3O6ML 4I77H 4MAYD 3LH9A 3NBNA 2XZAL 3WFZA 1P1ZA 2DIAA 1LWHA 2J8UB 3T0EB 4PJCB 3P30H 1DEEB 3WFBH 2JFCA 3N85L 3OX8A 3LVEA 5F7KC 1WBXB 3BKYH 4FKKA 4F92B 5KVGL 1YPZB 3IDNA 4WHTA 4ZFOL 2W80C 1G6RB 3ZDZF 3NJMA 1ACYH 4R90L 4PJEE 3VD2A 5KVGE 5DK0B 5C9JB 1TEGA 3WS3B 1HSAA 1IGCH