5AB9A

Structure of the p53 cancer mutant y220c with bound small molecule 7- ethyl-3-(piperidin-4-yl)-1h-indole
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
195
structure length
195
Chain Sequence
b'SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Exploiting Transient Protein States for the Design of Small-Molecule Stabilizers of Mutant P53.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 50
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5ab9A00
3WTSA 2AHIA 3KZ8A 4IBZA 4IBVA 5AB9A 1HJBC 4IBYA 4XR8C 4IBQA 4MZRA 4GUQA 1UOLA 2X0WA 2J1ZA 1H9DA 4L0YA 3D09A 3WTUA 4IBUA 1EANA 5G4OA 5LGYA 4AGQA 3KMDA 4G82A 4AGNA 5A7BA 4AGOA 3WTYA 3D05A 4G83A 3IGKA 5KBDA 4LOEA 3QYMA 3QYNA 4MZIA 4IBSA 3EXLA 4AGLA 3TS8A 5AOIA 1EAQA 5LAPA 3IGLA 3Q05A 5AOMA 4IBTA 2J20A 2BIQA 4LO9A 2H1LM 2OCJA 3WTXA 3US0A 3D06A 4QO1B 4IBWA 4LOFA 3VD0A 2YBGA 2P52A 4AGPA 2BIOA 2J1XA 2AC0A 5ECGA 1HJCA 2J21A 2ATAA 2WGXA 3ZMEA 5AOKA 3D0AA 3Q01A 5BUAA 4AGMA 3D07A 2BINA 2IOMA 2XWCA 5AOLA 1TUPA 4L0ZA 2VUKA 2GEQA 1CMOA 2IOOA 1EAOA 5AOJA 1CO1A 1KZYA 1HU8A 2X0UA 2J1WA 4KVPA 3WU1A 2IOIA 2FEJA 3WTVA 3WTWA 2BIMA 1T4WA 1LJMA 2RMNA 1IO4C 4A63A 3Q06A 2BIPA 1GZHA 1YCSA 2J6WA 3VD1A 3D08A 2X0VA 4HJEA 3US1A 1E50A 2XWRA 3WTTA 4IJTA 2MEJB 2J1YA 1GZHC 3VD2A 5G4NA 4L18A 5ABAA 3EXJA 4GUOA 2PCXA 5G4MA 1TSRA 2ADYA
chains in the Genus database with same CATH superfamily
1PFOA 2HX8A 4QAMB 5GGRY 1X4YA 2IDSA 3LIUA 3MRKA 4QRPD 4B3VA 2PXYD 4N1CA 1S9KC 4Y5XC 1ZE3H 1RVFL 1F4YL 2BVQA 1TJGL 4ZUTA 1YMME 1NICA 4EN2A 4AXWB 3BQUC 1CE1H 2ZKXA 3EFFA 3MRCB 2DKMA 2BS71 4BIKA 5F7HA 2DPKA 1H3GA 4MRBA 4HKXB 4YO0A 2CIIB 3O4LE 4M1CC 2NY3B 3ZYZA 4IRJD 4F7TA 3GZPA 1XB8A 3SEPA 4EDXA 3AABA 4IRSD 1KGCE 3JWNE 2WWOA 5EO9A 2KERA 3QYMA 3PDDA 1U4FA 2YPLE 4TVSa 1XD0A 2YS4A 4RGNB 5L2KA 1X5KA 3VFMB 1YHPA 2OLDA 3B8YA 3CPLA 3G6DH 1QSEB 3BPOC 2XN9D 3MA9H 4S2SA 4IDJH 2JVUA 1A6ZA 3DROA 4CVUA 2YA1A 3T1FB 4S1DD 3QDMB 4L9DA 5INCB 3GT6A 2ZE0A 1EMTL 4BJLA 1RJYB 4HG4J 3ZR6A 3FNKA 3WN5C 1TMQA 4BSVA 1PPIA 2F15A 3QUKA 3T0WA 4TULH 4X6DE 2XN0A 3QIUB 2P52A 3FQTA 3PWJB 3VI3E 2JELH 2ZKHL 4GRLB 2I69A 5EBWA 3KLDA 4KNSA 3UZVB 1TNNA 5LDSA 2K9FB 1NGPH 4HS6B 5I9QB 4M9PA 3VD7A 1Z66A 7PCYA 1PZBA 1JXDA 4D8PB 5J6SA 1Q9OA 2V2TB 2XNAB 4N90E 4PG2C 2A2QT 4NN7B 4OF3A 3VU1A 2B5IC 1KWKA 4UU9A 1L4IA 1QBLH 2ID5A 2W60B 3TFKC 2WSDA 3QDGB 4PRHB 3L9EA 4M62L 2WNWA 2DWDB 1CGWA 3OG4B 2ZOKA 4ZXBA 3DX1A 2OS7A 2A9AA 4TRPH 1M7DB 4ZAKC 4NUPA 1DQIA 2X70B 3FO1A 3MLWH 4NQXA 4J23A 5DHYA 3WXVH 4Z7QE 2ZX8A 5MEPB 1LMIA 1NFIB 2TRYA 4JR9H 4PUBL 3BISA 1D7BA 1W0WB 2ITDA 1ZS8A 3MOBL 2WQ8A 4DSYA 1DN0B 3QIBB 1RJLA 1FV1B 3EKCA 4TV3A 4B3EA 1RV6X 4WY7L 3AXHA 3MLZL 3SE3A 5CSGA 3JTTB 3K46A 4MGXA 1RIVL 1ETZB 3FPXA 2JKWA 2GBAA 4H13C 4E9LA 2GJZB 4FFVC 5HYEA 3CSYB 3H9HB 2VDQH 4P2RB 4G7VL 5DR5H 1UH4A 2JJTC 4W9KC 5EU6D 1HHGB 4DKFL 1IC0A 5EEZA 1PLGH 5KAQG 4R2GC 2NTFA 4TUJA 3IDXL 2FIKA 3U6RA 4ZMLA 3V6FB 4NHUA 1SYVB 3QQ3B 2X4QA 1V55B 4HKJB 5FUCC 4BWUA 2XXFA 1OPOA 4NYLA 4O58H 1KB9J 1NGZA 4JFSA 5I76A 1KGIA 4HT1L 4YLQT 4JN2B 5C0FA 4E0RA 2IANE 5K9QI 5IQ7H 2APFA 4PJ9C 1ADQA 2FWOA 3A67H 3MRRB 1P0SE 2R0LL 3IKKA 1I3RB 1U33A 2DTML 3IFLH 5C0RL 2R59A 3MV7D 3LTVA 1WIOA 4P4KA 3ULVE 2NY3D 3GMNB 5BZDA 3P3TA 4CMHC 3S34H 2AI0H 5EO0A 4WV1C 1VACA 1IAKB 1UHVA 2BIQA 3LKPB 2D31B 3HC4L 3V0VA 3PYCA 4AV0A 4M6OL 3VE0A 2ZXGA 2QHRL 2HFFA 4RGND 2FSEA 4O9HL 4KI5D 1UB5B 5C92A 4GG6F 1QSED 4DZ8A 4U2ZA 3C5SA 3OGOE 3SGJA 1PZ5B 2GVYA 3MLVL 3QDMD 3WS6C 4RBPH 4ATWA 4ELKA 5HYSG 3KLQA 1H3WM 4XVSL 5HDOA 1T83A 2K7PA 1ZK9A 4IHOA 2UY7B 3L7EA 1CFQB 3K8KA 3DV6B 3HN3A 2Q7NA 3FT1A 3O2WH 5EV7A 1PIFA 1Y18A 2P48B 3EBGA 3QBTB 5EUKA 1KTDB 32C2B 4TTDD 2WQAA 4XNBA 2FYYA 1QNZL 3OJDB 3WS3B 1RPKA 2AXGB 4UILL 1BAFL 1NAMB 4U1JA 2FAUA 4MNGB 4XHQA 4XRCB 4BZ1A 2DBJA 1FZJB 1AHWB 4U3SB 4CC4C 3V7AG 3FU3A 2WN2A 3MRIA 3QCTL 2EDJA 4OI7A 4H1LG 1IEAA 3ZKNC 1HINL 1GSKA 1NCCL 4YFEA 5J1TC 5L8LB 1BG1A 2QLYA 2ICWI 3BDYH 3O9WB 3RE0A 3NJXA 2W65A 3QCUH 2F53E 4W9FC 3EXJA 1JZHA 4GO8A 2XIBA 2M26A 1T0MB 5FYLL 1EFXB 2GJJA 1TQBC 4N4YB 4LKXB 1FNFA 3AXLB 4XBEL 2VJ0A 3MRDB 3UIYA 3O3DA 2PW2B 1PX8A 2H6PB 2P9RA 4GEIA 4PV8B 2Y7SA 5CILH 2E74C 1AIFA 1KYOJ 3N3EA 3P3SA 2VLKB 4ACTA 4QUOA 1P7QB 2XFXA 1QHQA 2A83A 3IMUA 3EZ8A 1YQVL 4XPTL 4Z7NE 3O45B 1RQ5A 4G8FA 4D0DB 1HCYA 1CGSH 4Z8FH 1BQHB 5KSBA 3CFEA 1GKOA 5KSVB 2BRQA 3IB4A 2Y3AA 3L3GB 1FHNA 3SDXB 3SE8L 4HJ1A 1ZLEA 4QT5A 5T3ZE 4N6RB 1XR9B 1I9EA 3N44B 2L7JA 2Z7UA 5FECB 3IGLA 1F13A 3OQRA 4X9IA 4P5RA 4U6HB 3NJKA 5DC4B 1TNMA 4YC2C 1HSBA 3D0LA 1AO7B 3SBQA 5CF3A 5KVGH 3U9PL 2MFNA 2X6BA 3MNVA 2BXZA 5GRUL 1QEWA 5DFWH 1K5NA 1IC4L 1BD2E 3K72B 3HAEH 1E40A 3L3DA 3NACH 4HPOL 4X6BA 4TOYH 1J8KA 1TZGL 4R83A 4PU2A 3TEYA 4QCIA 1IBDA 5I8OL 3BP6A 1Y6NR 2ZXAA 4HLZH 8CGTA 2FO4A 1JTOA 4D9RD 4AM0B 4YHOL 4KRMB 5CXPA 4HVBA 1H6EA 2H3XC 1OTUD 2IPKA 4AMXA 2A77L 3FTYA 5K9OB 5KS9F 4XN7A 2ZIDA 3OKKB 2J5LC 2DI7A 1F97A 2YD7A 4A2LA 3HUJF 5FKPB 2MWCA 3WJMA 1LK3L 3DIFA 4C56A 2IOMA 3I3DA 1IGMH 1SLUA 3LH9A 1G9MC 1QI5A 5D72H 2IC2A 1TR7A 3GBNH 2O5XL 4FD0A 3HBQA 3RWDB 4WTWA 1MRCH 2EC9U 3T8MA 2VXUH 5TPWL 4PRAB 3FCTA 3QAQA 4KVPA 5GZNC 4FTVB 1G7PA 3RIAK 2NY2C 3LB6C 5F7LB 4DP8X 3MUHL 4JE0A 1WA2X 5L4FA 2BVYA 1NLDL 4NERA 4LNRA 4E41E 5DUPL 2DYPB 2YFOA 1E67A 1HSAB 2EO1A 1LO0H 4FFWD 1FIEA 4DP0X 4NO2B 4JKPH 4WO0A 3PGCA 5DK0A 4BEIA 2EH7H 4AQZA 3D2UB 4Y9GA 1VGEL 5MEQB 5IK3B 2QVTA 5HVHC 1RD6A 2C3WA 1AOZA 3BIBX 4Y9EA 5DMYA 1RHHA 3B2UD 4PHXA 3TEZA 5BO1L 3TWCL 1HT6A 3FU6A 3MBED 4G7YL 4HF5L 1IGCL 3WIIH 4K94H 3O9WD 4JFEA 3BD4A 1XF1A 3REWB 1CB4A 4AQ1A 3T77A 1CTOA 4M5TA 2Y25A 4NSKA 1E7UA 1VEPA 3K71A 3I02A 3VH8B 3T6ZA 3U46A 3I74A 3WMPA 3LRMA 2VIRA 1FYTE 1EFXD 3PABB 3HIZA 1NGWA 1HZKA 2AEPL 2YPVH 1S9WA 5JLZB 4AMKH 1E5ZA 2CU9A 1CFBA 2EDBA 2OSXA 3ELQA 3ZE1E 3MRLB 2MQGA 3NYKA 1W8NA 3D69A 2EO9A 2VLKD 4JAMA 1XXDC 4ZFGH 3U7WH 2A9NL 3T08A 2QVIA 5MENA 2CRZA 4XCFH 2L4OA 2QV4A 5ANMB 1JZ4A 2OQJA 2XA8H 1AGFB 4RIRA 2IAMB 1CFVL 2AAVA 4A1RA 4B50A 5AW5B 2ZF9A 1MW2A 4OZ4B 4N2OA 1U3HA 4JRYD 1KDJA 3LPFA 4M7ZB 5F96L 4R4FH 4M5YH 4ZMXA 1OE3A 2KLRA 1RHFA 2HUHA 1UWEL 5IB4B 2F19L 4PRDA 1HHKA 1D6EB 4L37B 4GSRA 3SGDI 1EO7A 4H25B 2A9MH 5AQ0A 4OVVA 1AO7D 3T6VA 5HDRA 3NGBC 3G5YB 4JRXE 3SYQA 3UMTA 3GBML 5AW0B 3ARRA 4GO6B 4A7SA 2BFVL 1TZ8A 4AEIH 1O6SB 5EIIB 4FE9A 1E8ZA 2RBLA 4O51B 2R0ZH 1JDAA 5C2UB 4N3TA 4FA8A 2VUKA 3O6FD 4E9XA 2NY5H 2WLIA 1IT9L 4WI5A 5C09B 4M03A 5CBEB 2CDGA 1BM3L 5JO5A 5FHAH 2FT8A 3KH4A 3NRFA 1OQXA 2DLFL 5GZOC 2J1WA 3BT0A 1H3PH 1WICA 3V5DA 4LEXL 2Z31C 1R5VB 5DZAA 2ZAIA 3PLYA 2B0SL 4I3SH 4OQTA 5GGRA 1T89A 3GGWB 4NBZB 1FDLL 3GMOA 3Q06A 1G0XA 3WKYA 1N8OE 1O5DT 2A6IA 1NGXB 4FTDA 4WCYH 5KSBF 2YAOA 3ARXA 3V0AC 1N2RA 1THCA 5T1KA 3I9IA 5J12C 3LEXB 4ZPTA 4LLWB 1XCTA 4L1LA 1BF5A 4ZMOA 3FU8A 5EZIH 4BA8A 3FHQA 2LAGB 3VFPA 2JK5B 3MSPA 5HI4C 1S8DB 2QEJA 2VXVH 3FF8A 1OCWL 3CFDB 2SEBA 1NH6A 4XXWC 1XMWA 1Z9LA 2DYPD 2QQLH 1H19A 3B2PA 3EG9B 1PBYA 1PY4A 5HGHA 3UXFA 1F02I 2EEXA 3KH3A 4N0FA 4HWEL 1OF0A 3NFPA 1KIQA 5DD1H 2MKWA 3ALWA 3UJTH 4YVUA 4GH7B 1CIDA 4TNVF 5AD0B 3T8XB 1T2QL 4JPSA 3L1OH 3U30B 1EIBA 4M3KB 1FFOA 1PDKB 3PV6B 2OXHB 4IRZL 3GMPB 2AXFB 1OIOA 5J1AA 4OBRA 1CL7L 3ME0A 2EACA 5FYJL 1U91B 4W9JC 3TZVC 1XGPB 3PIQA 2I25N 3SGEI 4KQ4H 1M6UA 4PB0H 1D9KB 1NBQA 2GKIA 2VYRE 2OFQA 5I0VA 2NY7H 1KJMB 1UGNA 2WXMA 3WHE1 2Z92A 1QTYT 3IJHA 4J3OF 1X9QA 4I3GA 2P49B 1XSOA 1I1FB 3PP4L 2NUPA 1QPXA 3FH5A 3H6AA 2EE0A 5E6YA 1CFMA 5IQ9A 2K3HA 2WCSA 4UTAH 4UV7L 1ET8A 2ADFH 2O1AA 2CGYA 4UM9A 3WO4C 1YDPA 4KQ3H 5D7IE 2CAKA 3DJRA 4ANVA 1YEFL 4F37K 4FGMA 1IKNC 5BJTA 1CDJA 2RA1A 3DJZA 2P5EA 2IH3A 4NXKA 2CHWA 1WLHA 2IAMD 1T03H 2ZPKL 4IRZA 4XO8A 1CD0A 2VMFA 1SEBB 5BRZD 5ID0A 1UCBL 4ICXA 5E0FA 3WNPA 4KKQA 4IIQA 2D7MA 3N50A 2ADJA 4BQ9A 4EQ2A 3VM7A 3WEXA 5TGBA 5IBLD 4GS7B 1HDMA 1LP9A 2DQFB 3AW5A 5H4YA 3EO0A 5L2KE 3NAAH 5DLMH 1B9ZA 3ESMA 4FNQA 4QHMB 4WWKB 2BS8A 4I13B 1OAQL 4KBPA 5IEKA 5DGRA 3PPSA 5D5MB 4JPIA 5IFJA 3A4EA 5HGAB 3KG5A 1E2ZA 4MA8H 4BH8B 2VO8A 4AQOA 1RFDH 2R0WH 3ZL4H 1MCWW 3UC0L 4KJYB 4R84A 1XGRB 5TDNA 3UPRA 1V7NL 2IPUK 5JXEC 4M6ML 2JJSC 4V2BA 1ZT4B 5DYOA 4LLUB 3ZBMA 3TH4T 3HAEB 2ZCLH 3QUMH 5C09D 3X2QB 3LIZA 3JZ7A 5E6RB 3DV4A 2D7OA 3OF6D 3MNWA 3FOMB 3GSOA 1G7MA 4TPRL 3P4OB 2IDCA 5C2BL 3U36B 3SKOA 5CEYB 2WM0A 3IVKA 4MVBD 2OMTA 1AY1L 1U95B 2VE6A 4DNLA 1BVKB 1UURA 4XX1E 4GMSH 2CO7B 4Z18A 3C5JA 5E23A 1P7KB 3FSVA 4WHTB 4XPAL 5HDBF 4W6WB 3ZDXB 3UAEA 4A2GA 4CAGA 1VFAB 2WXLA 2Y5EA 3ARFB 1HI6A 5L6YL 3GSVB 4Z7OE 1DSYA 2E47A 4AGQA 4UNUA 1E0OB 3VXNA 5BZZA 4DGIL 1BGXH 3ARSA 3RL1A 4XNUH 2IVFC 5DD6B 2GSGB 3QHZL 5JHLH 3DSNB 3LKRA 4FULA 4W4NA 3VXOA 1R33A 4PTTA 3ETSA 2YBRB 4YZFF 1FG9C 1GGCL 3TS8A 4Y19A 2GUOB 1KSRA 4OTXL 4XMLL 3A23A 1GPOH 2X4OA 4PJGB 5ESQB 3SOTA 3VGHA 3VGEA 3L95A 3VGFA 3W39B 4NDMA 4F7CA 1PQZA 4NKIH 1FNGB 2WZ0A 4NXSA 2VAJA 4I0PD 1WZ1H 3KPLB 5AG8A 2NNFA 1D9KD 1RZKH 2YBGA 4LLVA 3ZL2A 4GT0A 5JHMA 5C07B 2YXFA 4N6QA 2G75A 3BZEB 4U1LB 3SBWA 4TNEA 2FJFB 3AG1B 1AKPA 5A40E 1KNOA 3IJEA 5DJDB 5L4MA 3TA3A 1KIRA 4QXVA 2FGZA 3DGDA 4R4BB 3V4LA 5JHBA 2E6JA 3BOVA 3VW3H 2A4ZA 4KK5D 2HTLC 4ZMYA 3EH5B 1ND0A 2J7LA 4LDEB 3BZ5A 4AQAB 3ZTNH 5K39A 4E42A 1NL0L 2YK1L 1F56A 3KS0H 4XN9A 5E6IA 4PJIB 5I18L 3WAKA 1AGDB 1JL8A 1XGTB 5C1MB 2YGNA 3VFRB 4EIBA 4FQHA 4UTBH 2M8XA 4Q4IA 2VZ1A 4N25A 1U2CA 1XGQB 4PGZA 4DKDC 4DTGL 3GJFK 2J2ZB 2X4UA 1RI8A 4GP5B 1YEDB 3TGXA 4EZJA 4UB0H 1WH0A 4QXWA 4PJ7B 3RX9A 3VDCA 5B8CC 5CKAA 1T4WA 3W38A 5D93B 2DWTA 3V0WL 2ATKA 3QXWA 5HJBA 1CLZH 2DEWX 2ZAGA 5GS0H 4A2MA 4WWKD 2COQA 1A9VA 4YSTA 3BT2H 5E2UH 3IDGB 3Q2WA 4DGVH 4ZFFB 1Q9KA 3ULVC 1U8PB 1KCUL 1ODAA 4X6CA 2MJWA 3FYIB 4RLDA 1U3YA 3HHSA 5A6IA 1RK0B 2I9TB 4IDLA 4HIHA 1NC2B 3QA3B 1CDUA 4G9FB 2C1OB 1SBSL 3PDGA 2KDGA 4EQ3A 3SD5A 4JFFD 1RZ8B 4X4KA 1WRFA 4L0YA 1E9OB 1HZHL 4N86A 5GHWL 5I1HL 5IJCC 2OR7A 2R1XB 3APDA 1M56B 5MERA 1SXCA 1T2JA 1UWYA 3HNSL 1JYXA 2QKSA 3M88A 3OQ3B 1QW9A 3F5WB 5DJ0B 3SZKC 1BZ7B 3DVNA 3RUGF 4Y88A 3F7RA 3IAPA 3QIWC 4TUKL 1YEEL 5HYSA 5LWYL 1PYWA 4FABH 3FQYA 5IROA 4TQPA 2V3DA 5ESVB 4AE0A 3WFBL 1CLVA 4I48B 2AQ2A 3CC5A 3VXRA 5KWYC 4F9LC 3MRBA 5EUOB 2VDLL 4PRPA 1JSYA 3ARFD 4PJBA 2EIBA 2XU9A 2YEVB 4I9XA 4F57H 2UX6A 2FSDA 4RDQF 3GXIA 5IB1B 4GB9A 1NGYA 3PE9A 5SWZA 2J88L 2KPWA 4ZFOB 2GEEA 3UGXA 4P46B 1D5BB 1DLFL 5C0AD 3U9UA 1LE5B 3GJFB 3UTZB 3DMMB 3CSBA 3PHAA 2MOGA 3MRPA 1J0YA 5FYKU 4QTFA 3AS2A 3GHBH 2NY6C 1M53A 5E9NA 1KTLB 4A2FA 2FJGA 2FL5B 2K78A 3NRQA 4J4PD 3C5ZA 1WCBA 5F70A 3BVVA 1NKGA 2B8OT 3BVWA 2IADB 3QJRB 4K8RC 1XSIA 3INUL 1FJ1A 1A6AB 1IM9A 1TO4A 3FU7B 4EMZA 3MV9A 5HXMA 3HR5B 3V0EA 5DLLA 1DJXA 1CU4L 4HALA 4NQVB 4JJHA 3RIFK 1D7DA 1NMBH 5C07D 1H8LA 3WKPA 5BXFA 2BINA 3LKNB 4FQIH 4G6ML 1KCLA 5EZJA 4P5MA 4DEPC 2B77A 4Y4FA 4ZUSB 3VWKD 2JTYA 3BGMB 4UDUA 3V5KA 1BDYA 2PW1B 5IMLB 2E56A 3C12A 2PYEA 3KPNB 1OP9A 4AE1A 4F24A 2LAAA 3I6KA 3BZFB 3L54A 5D7LB 3HC0A 2FZ3A 1F8TL 2ZZUT 5F7KC 4ZUWA 3IKCA 4LDLB 1ZT1B 5L9DH 3J27A 3EOAB 1M2OA 2DDQL 2J12B 2NNRA 2WCGA 1DZBA 3L45A 3SKUD 5HHNB 4KO5A 3V6BR 4K7FA 3CN1A 4IEFB 3ARWA 2CCLA 3GO1L 3H3PL 2GPZA 1N7ML 3MCLL 5IEHA 4KDTC 2OYKA 2E76C 3O11A 3IF1A 1B0RA 3RNKB 1EPFA 4JMNA 1SM3H 2EINB 3NA9L 4S1RH 3EYFB 1OP4A 3PQYB 4AG4H 2N3JA 4MCMA 1PEZA 1YSOA 4CGTA 4Y5VB 2EIKB 2ADGB 1RZFH 2CLZB 5H37H 2BS9A 2Z93B 3ZYJA 1SY6H 3MBXL 5IOPA 2MCPH 3BC9A 4C56E 5I1GH 4DGYL 2FX8L 1YNTB 4LVHC 3B3IB 2HFTA 2NW3B 1BLIA 1QRNA 4Y5YB 3ZTJG 1TTBA 4MMZB 1NKRA 3ARGC 5FGCB 1FLRH 1I1AC 1OEZW 4G43B 3N2JA 2V7HB 2BC4B 2VL5B 3JV6A 2YGQA 4G72B 4MS6A 3SDCD 1YY8A 4C83A 2YPKB 3EXLA 4LAJH 1UYWH 4KZDL 1N5YH 5T33H 3WIAA 3C2AL 2V2XB 1DBBH 3MHZA 5JUEH 5JYMA 4K5OA 3CFCL 2A6JB 2IFFH 4F15C 3CZFA 3RFZB 4N8VG 2CQVA 3SIKA 2CE6A 2HPOA 4P5TD 5GGVY 5KAQF 3QFJB 1E8YA 3SPHA 2QT6A 5DFAA 1HH6B 1LEGB 3OAUH 4D7PA 1Z3GH 2X42A 2NXYD 3RKDC 3DX3A 4AGPA 1R3JB 5TJWK 3FUNA 3KWWB 3FTUA 1JFQL 3E1F1 2AJYL 5IW1A 2KZWA 4CU6A 2CHXA 5T1LB 2APSA 4PRID 2V7NA 3E6HA 5E94A 5F9OL 3WNMA 2XWEA 1MFAH 3VXPA 4KXZH 2IAAC 5CJOH 1MCPL 1UZGA 4QRTB 3V6OC 3ARDC 4YDVB 2CM5A 1VFBA 2UWEA 5TDPA 3DBXB 4X6CF 2OL3L 3WHXB 4Y16B 2DF3A 3CSFA 3KNBB 2H47C 3SKJL 4XBPA 1PW3A 2Z6FA 1NOFA 3G5ZB 1OSEA 1TEYA 1N3NB 2VERN 1SVBA 5MENE 1ETJA 5I1LB 4TQIA 4L8BA 2R2HB 3JWDL 5IGXL 2F1EA 3HPLA 2ROXA 2V4LA 5CLZA 4YHML 3RZWA 4YSDA 3UTSA 2DQHL 1XF4B 5ACZA 1HIML 4G6FB 5DJXB 4M48H 2XQBH 3UDWC 4A2DA 4ODSL 5KVEL 3CCHA 4UIMB 4BFIA 1I75A 2ZQKA 3MDJA 4UNTA 4XNQB 5D7LD 5JHDA 2C7UB 2Z4TA 1F6AA 4GI6A 2WO4A 4NWTH 1J87A 1JGLL 2HRLA 1A4KA 1ZMYA 4A7TA 1GGBH 4JN1L 5JPMB 3OKNB 2HN7A 5D1XB 3QQ4B 2AITA 4YZFE 3O3AA 4KTDL 2FT7A 4AIXA 2WQUA 4OSUH 3F12B 3CNKA 3ZE0F 5LXGH 4NQSB 1J0HA 2O4EA 4JZOB 1WG3A 4X6FA 3IU3B 4L4TB 5E56A 1K85A 3HE7C 3KD4A 2QSCH 4H8WC 4XBGA 1E3ZA 1YJDC 1IBBA 1MJUH 2O6PA 2QGBA 3RWEB 1L7TL 1U58A 3WTUA 3GINA 3UMNA 4IM8A 4X99B 1ETA1 4K7PY 4TTGA 3NZHL 4ODXB 2GW5A 3PQYD 1CLOL 3TONA 3U7YL 2PCPB 4A7GF 3LKQB 3NJNA 3D18B 3RX5A 3VXUD 4CL7A 5GRJH 4GAFB 4FHKA 3DXAE 4GXVH 1RSFA 4UIKL 1ZVYA 3H9ZA 5FGSA 3ZUCA 4CKQA 3EGDA 1JPSH 4GW1A 2KS0A 4PG9A 1T21B 1F3DJ 1E4WL 4LRIA 3H6JA 3TV3L 5CJQH 2ZTBA 2CO6B 3SODB 1FGNH 1T1YB 2E7BA 4HCIA 1A25A 3FFCA 1MVUB 3TIEA 1NBZB 4HIXH 1G9HA 2N7SA 2OR8A 1CDCA 2ORBH 5B7EA 3MLUL 1HJCA 1TVHA 1QWHA 2XXMB 5JMOC 4GLRI 1OGTA 1DBML 3QFJD 4BCZA 3UJJL 1VFUA 2XXGA 3NCYS 3S37L 4BXSV 4FLQA 3DRTB 5J5EA 1E4HA 1RULL 4JL1A 3W5NA 1O75A 1S7WA 4JO4L 4W6XB 3HE6C 1MFNA 3QZLA 4LBEB 3ZR5A 1OT1A 5EPMA 4FA7B 1HTYA 2P5WB 2F6AA 2WNKA 3H9SD 5T1LD 1MCBA 3X3GH 3DOSA 2X2JA 3JT2A 5K9JL 3QZBA 4OZFA 4FQ2H 3I9PA 3ULUH 1EAOA 3X1GA 1O5PA 1HEZB 1OSPH 1TVBB 2TRHA 3GSQA 3SE6A 5AENA 1KBVA 5BMFH 3DRQA 3GMRA 2CIKB 3RDJA 4ZMZA 2Y6SD 3OTTA 5IVZA 3Q2VA 3I6LD 2DH3A 3BESR 3DUUA 4Y16D 2MOQA 2X6CA 3QUGA 1FPTL 4NUJB 3LNHA 4TVPH 2C26A 5D1QC 2X3AA 4NC0B 3QAZC 4XODA 3QZWB 2OR9H 1WIPA 2CJ3A 4YN3A 2EDWA 4XZ4A 3VXMB 2O61B 5TF0A 4HK3N 3JTSA 2P5EE 4XNMB 4N2BA 3L7FA 3OJVC 4XNYL 3TO4B 2NX5E 1T7WA 2HFGH 2VM3A 2R7EB 1CL7I 2K6YA 1KBBA 4U05A 2VQ4A 3WFHA 4F80A 4XMKH 4G6FD 1U8MA 5IG7B 3CUPB 5IVXB 3BYYA 4HUWA 4PTUA 1G43A 5TQ2L 4APQA 5KOVC 2YKLL 1XB3A 3S96B 1JPGB 1LP9E 1W80A 2NNAB 2WKGA 2ZCHL 4LFHD 1DEDA 5CEZE 5D1XD 4BH7A 1GJUA 2ADIA 2YMOA 4GQ9H 4XVUC 3O0RL 3B9KA 5BS0A 2O5YH 2NNXA 2OSLB 2ZUQB 4L4TD 5F88A 2I24N 4FQJL 3X11A 4M5ZL 2TAAA 2R2BA 3WXWH 2BOCA 3VX1A 3QG6B 4MXWL 2WIIA 5E2VL 4HUCA 1MPAH 3U9WA 2N7AA 4QRPA 2PXYA 5MP6H 4FNLH 4WU7B 4DN3H 2Y2TA 3E1ZA 1MXGA 1SUJA 1INQB 2ZT9C 3U6XS 2TSAA 25C8H 4RFNB 5D2NE 5L2JA 1ORQA 1UD8A 3WOVA 5GS0D 1IAIH 2GCYA 5E9AA 2DLIA 2VABB 4RGOL 4E9WA 1FNSL 2I60H 1KCVL 1IBYA 1TMCB 4IRSA 4PJXB 1R5WB 3HOGA 4XB8A 1KIUA 3DYMA 1ASOA 3VTAA 1T1WB 4HOZA 2VDML 5LAXB 2G0KA 3PAYA 3V6ZB 3GMLA 4PGCA 4X80L 1A7NL 2XN9A 4FL4B 3T3MB 2G9HA 4MQ7A 3AY4A 2OZ4L 3OHMB 3JWNH 3SDDB 3HG1B 1KPVA 1JMXA 2QMJA 3T6WA 5I74C 3KYNA 5HGDB 3EOTH 1FORL 3C8KA 4HIJB 4X8JA 4Y19E 4OD1L 3WEMA 4W9LC 3S37X 1H8NA 1HL4A 2VH5H 2QPSA 5FA3A 1BMGA 3GS0A 5FHBH 3H42H 1NCDH 5IJBC 1MRDL 4FQQB 1PL3A 1IM3B 1XGUB 3L4VA 2P5WD 1E27A 3Q6FB 4LLDB 4UQCA 1MJJA 4OM0L 1MFCL 1U3ZA 2XIIA 4YIQB 1XGYH 1Z5HA 3MRFA 4L3FA 4DGUA 1LLAA 3I9GH 4LSPL 1BQ5A 1J86A 3L16A 2EEDA 1MCOL 1XR8A 2Z7WA 2DLGA 3GHPA 3MXWL 3MLRH 4GQRA 2Q2LA 4H40A 2VW6A 2OTPA 3FO0H 2HT2D 4FQXD 3SE3C 4POYA 3MKGA 1X5IA 2X4NB 1N59B 3EJZC 3LRLA 1CICA 4CBPA 2G3XA 1MW0A 1ZHLA 3A6CH 4UDTA 1LDPH 3RTQA 3UYRH 1EVUA 3MX0A 5F6IB 1JXJA 1FGVH 3S4SG 4MNQB 3SCMB 2ATPB 3P02A 5F7FA 4MYWB 4ZX3A 1WFTA 1JTTA 2FATH 5DJ6B 5D7KD 4MQSB 2V9UA 5CUSH 4F58H 5INDA 1TCRA 4ANWA 4FYRA 1LE9A 1BVLA 3UG5A 3I84A 3TBWB 3P0VH 1FO0H 2DI8A 5DRXA 4PJEB 3UPCA 5FOBA 4ZODA 4QXTA 3BSZH 5EU6A 4OF5A 3RAJH 4L3CA 2B1HH 4GUPB 1M4KA 2WBWB 4R0LB 4U1KA 4U1IA 3U1SL 5CGMA 5GSRB 2OMBA 5KW9L 1EZVY 3IXAA 4NRYB 4P4KC 3PGDB 5BV7L 3U0WH 2R0KL 1J1PH 4RISL 5E8DL 3MMEB 3QUXB 3WFDL 3RIKA 3KGUA 1JZEA 4MA1C 2CGRL 2CUAA 4A7QA 5C6TH 3ECBB 1PKQB 3DX9B 4LCUB 4P5SA 3B9VA 2ZOOA 3LHAA 2ICCA 3WEOA 4F91B 1FWXA 2XOTA 1VGKB 1E5CA 1WZMA 4PCSA 4BCXA 4AXWA 3MRCA 1RURL 1AZZC 4LGRB 4N85A 3FAWA 3TBTB 4F8PA 4EO5A 4HXBH 2IF7A 2V2WB 2IGFH 2Y9RT 5FF6B 4K3HA 4Y9FA 4HKXA 3SGJC 2CIIA 2EECA 2NLJB 5F7WC 3NIDE 1I8MB 2R69H 2ZCKH 2OJZL 1T83C 1BJ1H 1VB9A 1ZSHA 1KCRL 2Q3XA 3GXMA 4KJPD 1F4HA 3B5HA 3HAEG 3OHXC 3Q1EA 3P3YA 3GBDA 3VXRE 3WDHA 5DMKB 5CN2A 4O4YH 4D9LH 4PRPE 7TAAA 4PJBE 2XWBB 4HLZG 4XPFL 2P8PB 3BKJH 3VFMA 1S9XB 2FQFA 1UWXK 1QSEA 2YKKA 2YQ2A 3FU0A 3LN4B 1DVSA 3C5XA 3ULVH 3UYPB 4OI8A 5SWZE 3ZE0E 3G5XB 5FUZH 3T1FA 1UOKA 3GQFA 3QDMA 4LSTH 5INCA 4B7LA 5J57B 1RJYA 1SN0A 1UM5H 2WVVB 3HG1D 1BEYL 5FO9B 4KNUA 1KFAH 1JF1B 3QIUA 2CCVA 4XP4L 3BGFC 3PWJA 4G5ZL 4LXFA 4Z78A 4GRLA 3V7AE 5IREA 2YAPA 1IAOB 5DMGC 5IFHH 4F5CA 3UZVA 3VTMA 4XNXH 4YHKH 2GTWB 2V6HA 4GQZA 2J8UF 4HS6A 1IKFH 4GUOA 1IM3D 4C55A 3MV9E 4IIZA 3I2CL 4BWWA 2DTSA 5EOQL 4WSGA 2F8OA 4X7EC 2X4RB 3SYCA 5GISH 2L7UA 4EN3D 2V2TA 2XNAA 3L4TA 4CC1A 5CSBA 3CHPA 2ZUYA 3C60C 1GAFL 2B3IA 4FHJA 5IP4A 3O81A 2W60A 2XX0A 3CFQA 3QDGA 4PRHA 5FUOL 4ABUA 2DWDA 5DQ9B 2PYEE 1BFVH 3E8UL 3WG7B 3RVXD 3RJQB 1CYWA 1XEUA 1PD0A 4PLKD 3MLYL 4LU5L 1J8HD 1M7DA 4RWYL 1ZANH 5JIIA 5EU4B 2X70A 1AFVH 1FH5H 1KJ3H 5JW4Q 5MEPA 4CU7A 1NFIA 1BA9A 1OPGH 3H0TA 3TBCA 1IE5A 1W0WA 5I28A 2BXYA 5JPNB 3CHOA 4H8VA 4MNQD 1OP5K 3SCMD 2SODB 1DN0A 1DUZB 3QIBA 1FV1A 1S3KL 3K2UH 4WW2F 1SMDA 2WD0A 3JWOH 4N2IA 4NHCL 5DI8B 1JHKH 3JTTA 1CK0L 5F8RC 4AKOA 1ETZA 1FE8L 5CINH 4HZAA 2GJZA 3CSYA 3H9HA 4Y4KB 4P2RA 4DP6X 1PSKH 4KKCD 5AVQB 3ECQA 4GQQA 1HHGA 1R75A 4H4NA 2CDEB 4OZIF 1RP8A 2XYBA 4UBDD 5T1JA 3V6FA 1H3VA 1SYVA 2YC1B 3QQ3A 5DZPA 1PGRB 4FLSA 4HKJA 4JHUA 3MV8E 3L4XA 3QUXD 2QSTA 3RDTD 3CVIH 3T3PF 1M2VA 3V0IA 3P9MA 3ARBB 3E0GA 4U7SA 4G42B 1C1EH 4JN2A 4I77L 4FXTA 5A2KH 5ALCL 3TJEL 2E7MA 2YLKA 3AREB 1BQSA 3MRRA 1QFPA 1I3RA 3FU5A 3GPEA 2BJML 4J3OC 2FT6A 2XTJC 3QXDB 2WVSA 1UZ6F 2QQNL 2FB4L 2XX1A 1WTLA 3GMNA 2QLVB 4TLTA 3ZE2E 3U82B 1L9MA 4WTZA 3ZMNA 2ZKMX 5BVPH 1IAKA 3LKPA 1DBJL 1KIPB 3QFDB 2D31A 4JFDD 4ENZA 5ISZD 1A6UL 3L1FA 3EADA 2ZYIA 1YPZF 4JPWH 3TJPA 5HGBB 2BZDA 4WHCA 4XGZB 1NAML 5AKSA 1J9QA 1ZLWK 1UB5A 4UQ2B 3TASA 4CGUB 5TE4H 3CVHB 2C7FA 4PWJA 4MJ6B 3LQAL 1J5IA 1PZ5A 1YQ2A 4AWJC 4Y2DB 2ZOLB 1RIUL 2ADYA 3EGSB 5JDJA 5C0CB 3AG2B 3LY6A 5KVDE 2OCCB 3ZZLA 1QUNB 2UY7A 5D70H 4GIPD 4J3XA 2JMRA 1CFQA 3TO2B 3DV6A 2R56L 2UWEE 1IBGL 3FMGL 3QVAA 4GI9A 1MCKA 5J13C 3NJHA 2Y23A 4KH2A 4IU2B 3ILDA 3QPQD 1KTDA 1RJCA 32C2A 3IAGC 1NCWH 1N12A 5JQIB 4YSAA 1GJWA 3OXRB 4DIXA 1EHKB 4DP5X 3QI9B 3QORB 3FQUB 3OJDA 3WS3A 2AXGA 2WP3O 2E4FA 2G4EA 1NAMA 4MNGA 4XRCA 1FZJA 1AHWA 1Q0XL 3HMXA 4U3SA 4B9FA 5IESH 5IBTL 4I9WE 2D73A 3UTSE 1M7UA 3ULUD 1UD2A 2VZ3A 2UZIL 2QKIB 4DN4H 3O9WA 3PXHA 4KKNA 4NUGH 5JHDE 3L48A 4J39A 1MY7A 1NCBL 4GRWE 2FQEA 2X87A 5DHVB 3VB9A 2F9BT 3DX6B 4KI5F 4BQCA 4TVPD 3DO7B 1T0MA 1EFXA 3ZK0A 4LKXA 3T2PA 3AXLA 2MH4A 3QHFL 4NWUH 3MRDA 2PW2A 1EZLA 1LO5B 1U3HC 2H6PA 2PPFA 2X3CA 4HUMB 4PV8A 3WDIA 2E9GA 4EUPH 2DBLH 2VLKA 2WINB 2YD1A 4JFHD 1E4JA 1RLBA 5C0NC 1P7QA 1DR9A 3T2NH 4K5MA 4JY5L 3FUDA 1QP1A 1CE1L 1QEXA 1U3JA 1CDHA 4OJAA 3F8UB 3O45A 4D0DA 2ZYRA 5E9DB 5HYQB 4YMPA 1BQHA 3FQXB 5E6UB 1JZJA 2ZOTA 4GIOA 2D9QB 4M7JH 5KSVA 4O2EB 3L3GA 2EEFA 3SDXA 3HHMA 4ELMB 3OAZH 5GXBB 3AU1B 1XR9A 4N6RA 4L1DA 2WB1A 5DFVD 3ZTEA 2Z8VC 1A6VH 1E9PB 4HP5A 2H32H 5FLUA 4K7PX 4ZUVB 4EI5B 5FECA 3KCWA 2FE0A 4U6HA 1EO5A 3ARBD 3G6DL 1M1SA 4TL5A 3MA9L 4QRBA 3FF7A 1PX4A 4IDJL 3TOPA 4GAGH 3DI3B 4B95C 1D5IH 1AO7A 2RMNA 2EIMB 3FRPB 4YS4A 4HCRL 4WFHE 1E5UI 3ARED 2W0LA 2BVUA 3FFCE 3WUZA 1YJDH 2DQEH 3K72A 4OU3A 4TULL 5GGTH 4EE2A 4PJAF 2Z64C 2JELL 5EU5B 4FZEH 4PLJC 4AM0A 4OZGF 5J06A 1NGPL 4XX5A 5EU7E 5K9OA 2WWMC 3QDJB 3OKKA 4KGJA 5B3JE 1A02N 3GLZA 5FKPA 4FG2A 4XCNB 3CFBB 2DJMA 3MRQB 4AVKA 5HP5A 4LSSH 1YMMD 5C0BE 1U8NB 4X5PA 3Q9PA 3GXUB 4DP4X 3CD4A 3TCXA 2HVJB 3O4LD 5C0CD 4O5LH 3RWDA 2EXYD 4CMMB 3Q1SL 5DJCB 1CZ8H 3RVWD 1KXVA 4PRAA 1KGCD 4FTVA 2WTRA 4ZX4A 1OGAE 2XACC 4TRPL 4Y9BA 2YPLD 2BSED 2EYTB 3MLWL 1J10A 3WXVL 2ARJB 4NUMA 2YO3A 4CILA 2DYPA 4HIEB 5IHZB 2EILB 1HSAA 1JZFA 4JR9L 2LQRA 4NO2A 3QI9D 2WLMA 1XL4A 5L7XH 3D2UA 2WN3A 3ATAA 5MEQA 5IK3A 4LSRH 3L1EA 4QRSB 5SWSB 1JHTB 4Z7UF 3BLPX 2XBDA 4PD4J 2VDQL 4XP1H 5DR5L 3REWA 4PM1A 1J1OH 3VD5A 1PLGL 1K2DB 1MVYA 3SDAB 3VH8A 5B1JA 4YDLB 1P84J 5EFIB 2QADB 4JQXA 3PABA 1UH2A 4NZRH 4X4ZA 3TN0D 3SPVB 4U1GC 5BS0E 3BZ4B 5JLZA 3HBGA 4F8QA 1NM9A 4RGMB 3FB8B 3O0LA 4IIQC 3MRLA 2L3BA 3HKFA 4OUUB 5IQ7L 4R3SB 4PP1C 4NBXB 2J71A 4M43H 3LN5B 3A67L 4LFHG 5ANMA 1WA0X 1AGFA 2IAMA 4TUOB 2WVUA 4WUKH 4WEBH 5CLXA 1OAKH 3UTTB 1B0WA 3S34L 3G6AB 2AI0L 4OZ4A 2ETWA 4MAYB 4DOHE 4AITA 1N64L 1P1VA 1SDYA 4JGJA 3KBFA 1N10A 1PD6A 1WF5A 4EI5D 3S98A 1F1AA 3NPSB 3P4LA 5IB4A 4XVOA 1BYNA 1PJ9A 1D6EA 4L37A 3VQMA 3CTTA 4H25A 4PJHF 1I3GL 4BUQA 3KCPB 1Z5LB 2VR6A 1R5IB 3G5YA 4Y9CA 1U8HB 4TN9A 3S35H 5HGGS 3II3A 1KEGH 2OW6A 1O6SA 1Z3RA 3RBGA 1WBZB 5EIIA 4J3VA 3X3FH 4F7MB 4O51A 4ADGA 5HJDA 3EYOB 4N8PA 3CSTA 1G6VK 3O2WL 1TT6A 2NY1B 5C09A 3ZZQA 2W80C 5CBEA 1VA9A 4AI7A 3MOAH 3GKZA 3OF6A 3KEHA 2AMGA 4HWBA 1X6LA 2V17H 4JUTA 2X1WL 2IAND 1R5VA 3BPNC 3F05A 1L7IH 3QXAB 3GGWA 3UABA 3S3DB 2HSIA 1ZCRA 1NGXA 4YHYC 1BD2B 5FDYA 1F1GA 5F72S 3ULVD 1W72H 4TSCH 1I3UA 3SDXF 3LEXA 4LLWA 1KPUB 1A66A 5KN5B 3QCUL 2JK5A 2FWSA 1H8OA 4V2CB 1S8DA 1GR7A 3CFDA 1FLTX 3VRIB 5IMMB 3EG9A 2NXZD 5TE7H 3KL0A 1AZUA 3HI5L 1OM9A 2OP4H 5CJBA 3PL6B 3WYRA 4H8UA 3MUY1 4YBQC 2GK0B 5CILL 3X12B 5AD0A 3WEBA 2OYPA 3T8XA 3SBWC 1HCVA 4R4ND 3TURA 1PDKA 3PV6A 2OXHA 1QSFB 3GMPA 3TA3C 2AXFA 2G60H 1XAUA 1ACCA 5FM5M 2MTPA 2NR6D 1U91A 1XGPA 3QZWG 1CGSL 4Z8FL 1FA4A 4KKAD 4U7MA 3HC2A 5K1VA 4J3BA 2BERA 4E41B 1D9KA 1R1CA 4W4OC 4WO4B 1ZLUK 3SDAD 3UL4A 3W9EB 3C6EA 1Q9LB 1J0JA 1KJMA 1QBMH 3PRZA 3PS6A 4CDHA 1YO4A 1OARH 2V5RA 2HT4D 2L04A 1AR1C 5BUPA 1I1FA 4KDVA 3LZFL 5I1IH 4XPGH 5LDUA 2X40A 4WW1B 3AJ7A 4I0CC 4LQFH 2EKJA 1RPUA 3IDIB 5KVGL 1GZPB 2H3KA 3U0TB 1KJVB 4FQCL 1OF2B 4KU1A 3HVNA 5AZEH 3D9AH 2F53D 3NACL 3EJTA 4TOYL 2XYCA 2OJ1A 5JIHA 1D7FA 1SEBA 2WXHA 3PJLA 4NC2B 1FYTB 3C08H 4FN0A 4KROC 3FS9A 3NZ8B 4MAYD 3O41B 1EZVX 4N8UA 1OTSC 3MNMA 4O2FB 3SO3C 1DE4B 2V5MA 2X1QA 2XICA 2DQFA 4X0KB 3MODH 4GXFA 1M42A 1ADQH 4L9LB 4KK8C 2D4FA 4QHMA 4WWKA 3CWGA 1QSEE 4AGOA 1XWVA 3VO0A 5D5MA 3V9CA 2VJ8A 5D72L 4JG9A 5HGAA 1AAJA 4Z0XB 3GBNL 4BH8A 3S8WA 5H37G 1MRCL 4Q52A 1AQHA 4JKNA 3HBZA 1O7DC 2VXUL 1HNGA 4KJYA 1XGRA 2CKBL 3ARVA 3T5WA 1UOWA 2Y7NA 2YXVA 1ZT4A 3F65A 4KMLB 4LLUA 4W9EC 5IROC 4X6EB 3KEDA 3HAEA 1OD9A 1KXQA 2X4PB 3P11L 3KE0A 4PS7A 4ONHB 5FM5O 4JB9H 1M9WA 4OCYH 3FOMA 1LO0L 4F5CE 3MACH 3P4OA 3DGCR 3TNMB 4Z3TA 4YXKL 3U36A 5CEYA 5AVZB 2OPCA 2EH7L 4P49A 2XY2A 1U95A 2X9ZA 1BVKA 2PETA 1CGTA 1BD2D 2CO7A 5GS2H 1G5AA 1CR9H 1P7KA 4WHTA 4B96A 1VFAA 3ARGD 3WIIL 4K94L 3COOA 3GJEB 1N0XH 4OCMC 4PRHE 1FP5A 3ARFA 3QDGE 3LMJH 2YRLA 3RZCD 3GSVA 2XWDA 3H55A 3MYJB 4ALAL 5MI0C 1K3ZA 1ILUA 5KTEH 4ZNEA 1VPOH 4BZ1H 4J6RH 5DD6A 2GSGA 5C0AA 5LNDA 1UD4A 3DSNA 3PL6D 4FEIA 4DK5A 4XTRD 1GOHA 2YBRA 2YPVL 4I87A 4AMKL 3MAWA 4P59H 4NCC1 4Y4FC 2GUOA 2KZBA 4J4PA 4ZFGL 2D7NA 3U7WL 2IBGA 3WAJA 6FABH 5ESQA 2BY1A 4XCFL 2XQYG 4FKHA 3W39A 3X14B 2XA8L 4E9QA 2UUDK 2K6WA 3TESA 1FNGA 2XV6B 1J8SA 3DIDA 3VM5A 3KPLA 3KPSB 3FH7A 5KSAC 3RI5K 4E41D 1W8OA 2NZ9C 1WAPA 4P2RE 4DVRH 2CR6A 2D7TH 3IDYB 5C07A 4GAAA 1BVNT 1JZIA 3VD9A 3OKOB 3CZEA 4NPKA 3BZEA 4U1LA 1QFWH 2FJFA 4R4FL 1BWWA 4XMPH 4M5YL 5DJDA 2R9HD 4R4BA 3F64A 3ARDD 5L0QB 1MAJA 3RVTD 2A9ML 2OTWB 2OZNA 1GXEA 1Q0YH 4QR7A 1HVXA 2F68X 3NT0A 3JYCA 4MBOA 4AQAA 1ZTXE 4XPHH 2EE9A 4OFDA 4NZ8A 4AEIL 4BM7A 4KDWA 2FX9L 4HWZB 4PJIA 1AGDA 1XGTA 3BAIA 3NIFB 4RFEB 5LGKA 2O6DA 3VFRA 2R0ZL 4Q2ZB 1FYTD 3LS5H 4NRZB 2Q3ZA 4RZCB 1XGQA 5EWIH 3WTYA 2NY5L 2J2ZA 3VGAB 3FT9A 3MJ8B 1YEDA 5FHAL 1EO8L 5DC0A 4PJ7A 2ZWZA 1QRKA 4HFWB 1H3PL 3UBGA 3O8XD 2PWFA 4I3SL 4BFGA 5F1IB 2AK1H 2XV0A 3OKLB 5C8JB 1YYCA 1MRFH 3IDGA 1FZOB 1RUQH 4WCYL 3JVGA 3QO1B 4U33A 2ZX6A 1OCRB 4X5WB 4Y2OB 5FWQA 4DO4A 3TEUA 4ZFFA 1V3KA 3CDFA 1U8PA 2E7LA 5BOPA 4POZD 2PPEA 5AL0A 1RK0A 2I9TA 5EZIL 2FQDA 4YXLH 1NC2A 1XIWC 3QA3A 1YUKB 3BEWB 4IQHA 3VI4F 1N0LA 2C3HA 1DJYA 2VXVL 3GM0A 4G9FA 2C1OA 2X3BA 2YJQA 4KVNH 4K5PA 1UXSB 3CVBA 1RZ8A 3OMZA 1PG7X 2QQLL 2VC2B 1M05B 1QSVA 2VQ1B 3BVTA 4PR5B 1E9OA 4KZEH 2ILLA 1OT4A 4NO0B 2R1XA 4B9JA 5DD1L 4RMBA 1AS6A 4JRXD 1ZHNB 3UJTL 1QZ1A 5D1ZB 1IL1B 5DJ0A 3F5WA 2FJUB 1BZ7A 3L1OL 5AOLA 4MNGE 2YA2A 2PO6D 5DSCB 5ESVA 5FFOA 3KJ6H 4I48A 4WNSA 4MDRA 5EUOA 3TA4D 5HSFA 2UY6B 4J2XA 1W72B 4KQ4L 4PHZA 4OJFH 4PB0L 5J6HB 5IB1A 4POUB 4BHUA 4X98B 4IBLT 4ZFOA 5FYKE 5EEXA 2NY7L 3VD3A 3UTPE 1KJ2H 4P46A 1D5BA 1LE5A 3GJFA 3UTZA 3DMMA 4UOQA 4Q9RH 3KS0J 3QYCA 1UEMA 4GYBA 1KTLA 5KOMC 2FL5A 3T04D 4UTAL 2ADFL 4W9CC 3W2DH 1TSHA 2MCMA 3FTWA 2IADA 2HP4A 2YUZA 3E9UA 1A6AA 3FU7A 5IBUG 2A74B 3HR5A 1DQLH 3KPSD 3A4AA 1TG8A 4CKVX 4HOXA 5AB9A 4NQVA 3QNZB 3W3BA 5JIQA 3TCLB 1KT2B 1WAAE 3HC3L 5T5NG 3POCA 3LKNA 2E8YA 1EEQA 1SJEA 1DQMH 2BSCA 2Z8SA 4ZUSA 3BGMA 1NCOA 3SDXE 2EIEA 2GG1A 5B1BB 4YR6B 2PW1A 5IMLA 1URLA 3CZJA 3ZO0A 3KPNA 2AMUA 1SFHA 3BZFA 3ZDXF 5D7LA 1B90A 3FT2B 3NAAL 5DLML 4K9JA 5KUKA 4GKZB 5D8JH 2WC7A 3JWDC 5F9WC 3E2HC 3T4YB 1ZT1A 1JGVH 3EOAA 3WFEH 4IW4C 1AO7E 5HHNA 1PZDA 1DYZA 3JUYA 4MA8L 4FG0A 4JFXB 3G08B 4IEFA 4QF1B 1QPPA 1RFDL 2R0WL 3ZL4L 2EVGA 1QOKA 3B2VH 2NW2B 3HZVB 2E5EA 2MCAA 3IDMB 3TH3T 4LO9A 1BXUA 3RNKA 4CNIB 3UTQB 1OSYA 2ZCLL 3DUSB 3LH2H 3QUML 3NJVA 1D5ZB 4QO1B 5DK3A 3JV4B 5DO2D 3EYFA 3NJJA 3CZNA 3FUMA 3PQYA 3EAKA 3L81A 3PWVB 4JO1H 1A3LH 4YSRA 5CCGE 4Y5VA 5IFAH 2BNUB 2ADGA 2CLZA 2AQRA 2Z93A 4XXDB 4Y4HB 4H26B 3CX5J 4BA0A 1AYOA 4UYQA 4GMSL 1HCZA 4ACPA 1YNTA 2RGSA 3B3IA 3NQIA 2NW3A 1EVTC 4NQDE 2IWEA 5FPIA 3ZQ9A 4MMZA 4MS8D 5E2WH 1T1XB 2NY0C 3ULSB 4G43A 4QIRA 3THMH 3VDAA 2ZG3A 2V7HA 2BC4A 2VL5A 1WWWX 4M61B 4DKEH 1MIMH 4YHPB 4FTVE 1MH5B 1C5DB 1INDH 2YPKA 1BGXL 2AABH 4OQTH 1NANH 5AB2A 1AE6H 4XNUL 1TZAA 5J56B 5J7CC 5JHLL 2V2XA 3MRJB 1BFOB 4HIPA 4P3WA 2A6JA 5D1ZD 4IKIA 3NTCH 5FO7B 3L3HB 4PJIF 1BREA 5JIMA 3RFZA 4K07A 5AAMA 1DQQB 3BQUB 3NESA 5SWQB 5JR1L 1GPOL 4CJ0A 2Z7ZA 1S78C 3QFJA 5SX4H 3JWNG 3S48A 1HH6A 6TAAA 1I7TB 1LEGA 5CR1A 4NKIL 2CK0H 2CBPA 1R3JA 1UKSA 1WZ1L 3KWWA 1XH2A 2H3NB 1RZKL 2CXKA 4PJ7F 4LCIH 3P2TA 2WBXA 3I50H 5T1LA 4JO5A 3FQWB 1M57B 1Q72H 4JZNB 4P0DA 3CHXA 3GYRA 3VWJB 3FT3B 3N43B 4LE8A 7FABH 2WXPA 5DHXB 1FI8C 3MNDA 5E5UB 2VDKH 2DM3A 4C57C 3VW3L 1ZD6A 4QRTA 2DQDH 4YDVA 3UZEA 4MD5B 4OLWH 4YZWA 3DBXA 3WHXA 5KYYB 5AKTA 4Y16A 2VMJA 4KO9A 3KNBA 3NJGA 3ZTNL 4LDCA 1FVDB 3G5ZA 2WCPA 3FUJA 1N3NA 5I1JH 2CA4A 4AGNA 3MRMB 1LD9B 3W57A 4G82A 4ZXBD 5I1LA 3GXPA 5KYUB 1MFUA 4FLOA 3IGFA 4FXGC 4GW4B 1ML0A 5ANME 4UTBL 1GHFH 2R2HA 3QDAA 1MCSA 2IQ9H 3W0WB 4WFGE 5HI3D 1NCAH 3Q8EA 4XNZC 3VFTB 2F5AH 1TYEB 3B9KC 2DM4A 4PSRA 3UCRA 3ZN6A 4UB0L 1NBVL 2CALA 1X7SA 2YWZA 1H8SA 1XF4A 5FGBC 5DJXA 4BFKA 1B2WH 4UIMA 4XNQA 1ZDQA 3WY2A 2C7UA 5FK9B 2PXYC 3IPEA 3IXTB 4LVOC 5EUOF 1EEYB 1DO5A 5GRZA 1MHHB 3BT2L 3OKNA 5E2UL 5JPMA 4HJTA 4LARH 5D1XA 3QQ4A 3ZY7A 3BWAB 2BHFA 1JWSB 2AQSA 3F12A 3EZJB 4NQSA 4JZOA 3DSFH 3IU3A 1V3LA 4L4TA 4DH2A 3B8SA 2X38A 4HPHA 5HDLA 4LCYB 3CSPA 3RWEA 5H4ZA 3TFBA 4IRJC 1KGYE 3S0PA 5KANG 2FWLB 4X99A 3MLTB 2PP8A 1D5MB 4IRSC 1LHZA 3W82A 4ODXA 4UTBA 2K45A 3VB8A 5CEZH 4B9PA 1FVEB 4Y89A 2AK4B 5A16B 4I8DA 4DESA 5I0DA 2PCPA 3U4BH 3LKQA 3BIAX 3D18A 1KV3A 2PR4H 2F54B 2P80A 1QAWA 5E99H 1EZSA 4JL2A 5SX5K 2AJUL 4S1DC 4FABL 3B9DA 3D4CA 4WW2C 1T21A 3W9DB 3KHOA 4NO3B 3VMPA 4X9FA 3LIZH 43C9B 4MKTA 1QPKA 4X0NA 4F57L 4R2GB 1T80A 3WTVA 4JVWA 1UZ8B 2JE8A 4E9RA 3LX9A 2CO6A 4UT9H 1K4CB 2BW5A 3CSGA 1KMGA 1T1YA 4UMGA 1UEYA 3VD1A 3D08A 6PCYA 1MVUA 1ES0B 1YEJH 2EZ0D 4JBSA 4PWFA 3I6SA 5I1EH 1NBZA 1N8ZB 2XPGB 3GHBL 1RU9H 4KTGA 4JFTA 1XX9C 2F5BH 4XVTH 1SMOA 3VA2C 3BP7B 3O6KH 1SOKA 1D5RA 4BQ8A 3SQBB 5EF1A 1GYWA 2OMVB 3U25A 4ZMQA 3KBEA 4X8GA 1FAIH 1LO2H 1DEEB 2VZVA 3DRTA 4U6XB 1H3UA 3L17A 3MO1B 4ZTPH 5GS2D 1CBJA 2ZONA 2WQVA 4LBEA 3L2LA 2GFBB 1NMBL 2P5WA 5ENWB 1UATA 4FQIL 2DRUA 3VWJD 1CICC 1J12A 4L4VE 1FF5A 2LHAA 2Z4QB 3H56A 1KY6A 2GJ6B 2M83A 4GXUM 1HEZA 1TVBA 1YY9D 2R51A 5L4IA 2CIKA 1KJ2B 4KKLD 4MD0B 1P4UA 5TFSH 2MNUA 3ZKSD 1A14H 3M8OH 3U1PA 1BFTA 1NDGB 1NPUA 3FONB 4NUJA 5L9DL 3VYOA 4H8HA 3T0VA 2YMXH 4E68A 5IHUL 2Z65C 3QZWA 3C8HA 2DIBA 2C9PA 3L6FB 3VXMA 2O61A 4LOUD 3D06A 4XNMA 3K6FA 3O6LH 4DGWC 4L4JA 4QI3A 3TO4A 1SM3L 2R7EA 3SD2A 4S1RL 1EV2E 4A67A 2EC9T 4WWID 5T3XE 4G3YH 2GIYA 4AG4L 3CUPA 5IG7A 1G0DA 5IVXA 3JV5A 3MCKB 3WJLA 1J8RA 1F1DA 4N26A 4C47A 2XI9A 4NFDA 1USZA 1RZFL 4X5XB 3S96A 3QUYB 1JPGA 3EF4A 1IQWH 2X88A 2MCPL 2OMXB 5I1GL 2NNAA 4AQ8C 5I6XC 2RD0A 3IMTA 5D5ME 3MBWA 1AACA 2CG9X 3QWRD 2OSLA 3SBRA 4AEEA 1FLRL 2NY3C 1UB6B 1UGKA 4AT6B 4M93B 1GVIA 3QG6A 3VGDA 2KHAA 1TQBB 4G9DB 1DVFB 2NYZA 4PAZA 5GRVK 1ZXKA 2Q5BA 4NQEB 4WU7A 1UYWL 1SDAB 3CBRA 1N5YL 4N2NA 5T33L 1L3NA 3CN0A 1DBBL 2F74B 1INQA 1CF1A 4RGNC 5JUEL 2MKLC 2F54D 3LD8C 4KI5C 4LLYB 2IFFL 4KY1L 4EZKA 1GCYA 1DLHA 1VSCA 5BV7C 2RCSH 3UBXB 4N2KA 1JI2A 1TQSA 4KWUA 3OAYK 2DY2A 3F01A 4LEOB 2A7BA 2ICEC 5GJTH 1FN4B 2VABA 4YDZA 1SY6A 3V0JA 3WJJA 3OAUL 4QKXB 1ESOA 1CLCA 4PJXA 1R5WA 4LVEA 3ZDXE 1F86A 2XZAH 3MV01 3GHEH 5L8KB 2PLTA 1T1WA 2ENSA 3TX4A 5LAXA 4WKXA 3V6ZA 4RESB 5DZLA 5CEXB 1JF5A 3SGKA 5KBLA 1FUNA 3ERXA 4TTDC 2P4AB 1MFAL 4XI5D 5B1KA 3UO1H 2X0WA 4ZNEE 2WSPA 3DXAB 3APCA 3SDDA 2ZXEB 2ZXBA 3HG1A 4IBUA 1AZNA 2YUXA 3U1QA 2EE2A 5G55A 1RZGB 2YSTA 3FO9B 4GT7A 4OM1H 2FCBA 5EC1B 3WLWD 2Q20A 2RFXB 3DX7B 4NN7C 3HLKA 5HGDA 4HIJA 3P2BA 2Y06H 1DJHA 2F7OA 1RH8A 2JKRM 4PJGE 1X9LA 1FYHB 4OV6F 4FQQA 5ECJE 1IM3A 1XGUA 1A3RH 4YSUA 1ZLSL 3Q6FA 3PF2A 4LLDA 1DANT 4W81A 5BQ7B 3Q05A 4HC1H 3CBJB 4YIQA 2VXQA 1Q1JH 2GJ6D 2JFCA 1NOAA 4M48L 2XQBL 4I88A 1XH0A 1CD1B 3VRLF 3WFCH 4HOMA 4NWTL 1NBCA 2ISDA 1WITA 1GGBL 4L2YA 5H2BB 1GOGA 1KENH 3WO3B 2ED7A 2X4NA 1N59A 2YQ3A 4NZFA 4OSUL 1E3FA 4XVJH 1NSNH 5LXGL 2DQUH 2VLRB 3D12B 5CHNB 3K6SB 1QLEB 2VLLB 4F7PB 4PLNC 3F7PC 4OD3H 2QSCL 1OLZA 3GSNL 1MJUL 1EHAA 3LEYL 4MNQA 5CZXD 3SCMA 1R3LB 2ATPA 5CJ8A 5GRWA 2JJWA 5IUSA 2P24B 1KBGH 5DJ6A 2FNBA 3IN0A 3PJSB 3EYQD 3OGCB 5GRJL 3CZLA 3TBWA 4EUPG 3QUYD 5EB9A 4PJEA 5DQJB 4GXVL 4P3CH 4FEMA 4AVJA 1Z7JA 2C9XA 4ABVA 4ZOEA 4Z95H 1JPSL 4NKDB 3H9YA 1BYPA 4GUPA 1NDTA 3C75A 4JE4B 4R0LA 4JNXA 5GSRA 3KBHE 3IPFA 2NX5B 5CJQL 3FB7B 4NRYA 3PGDA 2LFGA 3MMEA 3QUXA 2ZX9A 1RZJH 4M4RB 1Q9WB 1HAWA 1CXHA 1GYCA 1DVFD 1NMCC 2WAHA 3K1KC 5C0JB 3ECBA 1PKQA 3DX9A 1OTUC 4LCUA 4G9FE 1JDDA 5KBMA 3ABKB 1VKXB 1VGKA 4HIXL 3SYPA 3FUFA 3VVVA 3ALPA 3TBTA 3AM8A 1SJMA 3IBEA 3BWUF 2V2WA 4XBMA 5FF6A 3RTLA 4S1QL 2VQTA 5EEYA 3DJ9A 2NLJA 1MI5B 3R19A 1V3MA 2XBZA 3W11D 4P4RB 1QR1A 5ISZA 1USQA 3F58H 5DMKA 4HAGA 4ONOA 1PLAA 5EUOE 5ICUA 1GJIA 3VFWB 2XWBA 2P8PA 3MA7B 1S9XA 5IVXF 3X3GL 4XN5A 3WMSA 3LN4A 3D05A 4FQ2L 1NGQL 2FK9A 4NS0A 3SDYH 3UYPA 3ULUL 5KBDA 4HU2A 3G5XA 3ZL1A 2X44D 4FFWC 1OSPL 2OBGA 1I3VA 1D7CA 3DXAD 4LGSB 4XWOC 5D2NB 4YH6A 4X2UA 5BMFL 4ZMTA 2WVVA 1UACH 3EYVB 4N1EA 5IJDC 3BH4A 3QUHA 5FO9A 3TLRA 1HZLA 4PY8J 4CN1A 1JF1A 4P99A 1JGDB 4JRLA 2O5ZL 5T1KD 3LQAC 3B2UC 2ZP9A 5J6GB 3IWVA 5BQDA 2OR9L 1IAOA 2YAMA 3MBEC 3PPEA 2BNQB 2KC0A 2GTWA 3O9WC 3ZMRA 4PVNA 5C71A 5LLIC 4BD4A 1R0AH 3KDMB 3RL2B 3S8GB 3OR6B 5KVDH 3ZQXA 2ESVE 1A6WH 2C9RA 3X13B 2LVCA 2HFGL 2X4RA 5HHPB 2MPAH 1NM4A 1XTMA 4WKZB 2ZXQA 1AR2A 4D9QD 1RPQA 2DQGH 4XMKL 2Z31B 2WKOA 4LHUB 5IB3B 3NZUA 1SF5A 5DQ9A 2ZUVA 1QYGH 5KZCB 4PJXF 4IMKA 4TVUA 5D7LE 3NFNB 4YFDB 3B9AA 4GQ9L 5J12B 3F2LA 1RAMA 5EU4A 3MQIA 1Z9OA 3LHPH 4K3GA 3A47A 2O5YL 4WUUE 2QZQA 5AOJA 3WXWL 5JPNA 1TF4A 1DUZA 2VM9A 5ITFB 2OULB 1EGJA 1MPAL 3IBOA 5E95B 2WLKA 4FNLL 5MP6L 5DI8A 4DN3L 1YAIA 1C9SA 4GRWH 4UQ3B 1HYSD 2BY3A 4QRUB 1BJ1J 3PQYE 1VF5C 25C8L 2PWGA 5K93A 5JZ7D 4Y4KA 1JMZA 4Q7DA 3QH3B 2P7TB 2CLVB 2F8VA 4EZMA 1IAIL 3K6SA 2CDEA 3P30H 2J44A 2I60L 3QK0A 2R8SL 4X7DC 3FUEA 2YC1A 3A21A 5LNGA 2OMYB 1ZE3C 2NX5D 4LIQH 3RJOA 4JANB 5IF0B 5FGCE 5DWPA 2JKSA 1QHPA 3GMQB 3ARBA 1CVRA 1CGVA 3EYSH 3IDJB 2MIZA 4G42A 4IS6B 5CCKH 1URIA 2H9GB 5DMIH 2VSCA 3AREA 1OCZB 5CEZD 1EHNA 3QXDA 5A7BA 4HISA 4YAQB 3WO4B 2VQUA 2ZJSH 4NX0A 3VFUB 3S3CB 3EOTL 5F9JB 3G5VB 4QRQB 1KIPA 3QFDA 4Z7WB 3QFJE 3NIGE 3H42L 1NCDL 1KXVC 4H0IA 4UZUA 5FHBL 5HGBA 2YD4A 3T6QC 4EBQH 4AVHA 4MMYB 5TTRA 1E9QB 4UQ2A 4PJFF 3MREB 3CVHA 4MJ6A 3VAEA 3VG9B 5LGHH 5I17B 1X7TA 1XGYL 5J11B 4PW3A 5AVTB 4AIOA 3ARTA 3I9GL 4PJEF 4QHLB 4Y2DA 1MN4A 1OAXH 2ZOLA 3NSXA 4QPEA 2D0GA 2O6FA 3EGSA 2CGZA 1T22B 3MLRL 5C0CA 2K4AA 3NIDB 3UC2A 1XT5A 4YOKA 3FO0L 1TLKA 1A7PH 1QUNA 4LPVA 2R1YB 4OLUH 1DSFH 4YK4B 3TO2A 3ZKXC 1X44A 1NUGA 4TL4A 1EUTA 4AYBA 4HJSA 3L9YA 2QSQA 1WC7B 2BSEA 4KKBD 3VUAA 4NJ9H 1BJ8A 5E8NA 4ERSH 4IU2A 2IIJA 4QTIH 4OZFH 5B38B 3EHBD 3UYRL 1KB3A 1LDPL 2EE3A 1U8KB 3BAKA 3K2KA 3OXRA 5F7YC 5BZXA 1FNAA 3QI9A 3F84A 1FGVL 3FQUA 3JV0A 2WQWA 3QORA 4KRPD 3T9WA 5B1JC 3BVNB 4XX1G 4I18B 3GRWL 2FATL 4JQXC 5D2LF 5BVJB 4K15A 1A47A 4N2AA 4PCKA 4F58L 1Y7VA 2MQ3A 3BMWA 4LHUD 4Q14A 4PYGA 4V33A 1Y6KR 3P0VL 1HILB 1FO0L 3AFLA 4Y19D 1SXNA 4GKNB 2QKIA 3RURA 3R18A 5KZCD 2LTQB 3QEHB 3VMNA 2Y72A 5JW4N 1RY7B 1E28B 2GABA 3BSZL 3N5AA 1SOSA 3DOIA 2WUBH 3RAJL 3IFNH 3GS7A 3GPSA 5DHVA 4N22A 3DX6A 2QVKA 5DZOA 2APTA 2IAMC 3DO7A 5LG1A 3WI9A 2Y5QA 3U0WL 1J1PL 4UAOC 4C4BA 5LGJB 2X9WA 4HIIB 3WIHA 1LO5A 3R06B 3K3QA 5C6TL 4JFOB 2OI9C 4YFLF 3MJ7B 2WINA 5G4MA 3RVUD 1EJ6A 2FJSA 2HJFB 3N1QC 5IBLC 2VRQA 4XP5L 1UD6A 1J11A 4TNWK 5D55A 1BIIB 1E4XH 2FHFA 4HXBL 5E9DA 3ARQA 5HYQA 2IGFL 2WQSA 1UFUA 1G6RB 3FQXA 1UWFA 3LXBA 4LPUA 5E6ID 2YUVA 4O2EA 1S7UB 2FQGA 2R69L 4ELMA 3MU3A 4HMEA 1P1ZB 3AU1A 3GS4A 3D4GA 2HT3D 4HJUA 3FQRB 4O4YL 4RWHA 4D9LL 1F45A 1E9PA 4EI5A 3OZ9H 4ZUVA 1R46A 3BKJL 4N0CD 4JKKA 5FKAB 1YEKH 3ULVL 1FFRA 3D52A 3ULUF 3S5ZA 5FUZL 3FRPA 4MQXD 4LSTL 4L2LA 1J0ZA 4L29B 4UQDA 4EVNB 3VD4A 4DP2X 2H4EA 1CBVH 1KFAL 2ZUXA 4MVBC 4NRXB 2BVTA 2XY1A 3S3JA 3D5OF 1IGFH 1GW6A 5EU5A 4I5BB 2KQNA 3PWUB 2HAZA 3MV8B 2I5YH 2G30A 4R7NB 3SO5A 4WK2B 4A2EA 4ADJA 4XNXL 1JOIA 4Z7VB 1IKFL 2O5NA 3QDJA 4S0TD 5F3BB 4A2HA 3I6GB 5CJXC 3UAJD 4XCNA 3CFBA 5ICYB 3MRQA 2CHNA 3F00A 3CMOL 2P5WE 1MFBH 5B8CB 3TF4A 1U8NA 2DEYX 2XPZA 3K5SA 5M95B 1BAWA 1W91A 2CBTA 1IBFA 2NSQA 4Q0XL 4B0MB 2HVJA 4RNRA 3ZE2B 4NO5B 4CMMA 4UOW0 5DJCA 2DMGA 4UNIA 4LPCA 1VZGA 3ESPA 1F2XK 3F7VB 4FG4A 4MLIA 3VXRD 2Q6WB 1JP5A 4QNPF 1ZANL 2EYTA 3FQ4A 2WB7A 2H5UA 4PRPD 5IMOB 1TETH 1AFVL 1FH5L 2ARJA 1KJ3L 4HIEA 3WIFB 5IHZA 4OZHF 4I0PC 2BLFA 2VISB 3VXME 3D25B 5SWZD 2VAAB 1D9KC 1L6PA 5B21A 3KW7A 2FD6H 3K7UA 1DDHB 1MJ8H 1JHKL 4QRSA 5SWSA 1JHTA 3NCEB 2VWEC 4F7KA 2WANA 3SPIA 3HI6H 5C0EB 5CINL 2DQ6A 2DW5A 3WN6A 5AG9A 1XMEB 2NR6A 3C5ZD 3GNMH 3QIWB 4FNPA 4KK5C 1T5WB 1PSKL 3VSUA 1ZV9A 4QOKB 3MR9B 1B0GB 1X5JA 2IH9A 1K2DA 2NY4B 3MV9D 3AQXA 3SDAA 4O2CB 2Z3FA 3ML8A 4OV5B 1I7ZA 5EFIA 2A0LD 3SPVA 3STZB 3BZ4A 4GFTB 3ZVVA 3VX0A 3CVIL 4DPCX 1I31A 5BRQA 3FB8A 2D4DA 4D0CB 1C5BL 1A4AA 4KZCA 1C1EL 4OUUA 2PYED 3R4RA 5HJGA 2NY6B 4R3SA 1MCHA 4IJ3B 4GS7C 5H94B 3LN5A 4EDWH 1Z0MA 1U2YA 2JWYA 4M1GH 4RA0C 5T3ZL 2RAMA 1MVFA 1SXBA 5C86A 1LQSR 4TUOA 2OV0A 4WWKC 3QQ9D 3DURB 5DUBB 4PV1C 5JXAH 4AGLA 1EZUA 2ICWB 3UTTA 5IHWA 2C1PB 3G6AA 5BVPL 1CIUA 4MAYA 5GGSB 4NN6B 2GT9B 2XSKA 5IHHA 5E08H 3RA7H 4JPWL 5C70A 2H0EA 4PJXE 3Q8BA 3MC0A 5TE4L 4L3EB 4N8CH 1T66D 4X6DF 3KCPA 3KL3A 1Z5LA 1BEXA 3VI3F 5KVMC 1R5IA 2UXTA 1CXFA 1MCRA 1U8HA 3E6FB 2XG4B 3T3ME 4BE6A 4RX4A 1G94A 3OB0K 5D4QA 1WBZA 3GK8H 2XVBA 4G8GB 4L8DB 1T5XB 4G8AC 4F7MA 3HG1E 1MW1A 2YMTA 2GTZB 3L9RB 3LEVH 2EVHA 3EYOA 4YDKH 3HMWH 4HUXB 3P4NB 1BWMA 3MV8D 4HFUH 3N0AA 2EDKA 3KXFB 3ARFC 4MCNA 1NCWL 4J3UA 4YX2H 5TQ0H 2FECL 4I2XB 4NNPH 3WENA 5KYXB 3KYAA 1SEQH 3S3PA 4ZRGA 4R7XA 3N1PC 5IESL 1BD2A 2HRGA 4JS7A 4E9YA 3EO1A 4Z7QF 3OL2A 2BSSB 1J5HA 3CIQA 2R23B 4DN4L 4DT2A 1KACB 1E5YA 1RKRA 4J4PC 1TJGH 1KPUA 4NUGL 4WFEE 5KN5A 1S7RB 2AEQH 1YECH 2E9JA 2H41A 4OBSA 5IKCB 4KXZI 1OT2A 2DQCH 4LMQI 3QWNA 3VRIA 4Q74A 1BW8A 3PP3K 1SVCP 1JPFB 3PL6A 1FFQA 1MREH 1Z5YD 1KZQA 1AP2B 4K94C 3X12A 1O9VA 1WQVT 1WV7T 1S46A 4MXVE 2DBLL 4MNQE 3OLDA 4MFHA 3VWKC 3WKNA 4FXKC 4W68A 3ML9A 1QSFA 3DJTA 1XZ0B 2COVD 3T2NL 4F15B 1TITA 1FAKT 1WZKA 5GGVH 5C0GB 1OGAB 4FJ6A 2K8MA 5DD5H 1SVZA 4ZZKA 4XMWA 2DN7A 4E41A 2NY4D 4WO4A 1A8ZA 1UOVA 3W9EA 3R1GH 1Q9LA 1JAEA 4ZO6A 3HFFA 3IGKA 5D6DC 4ETQB 4Z7AA 1A6VL 2N0MA 5KSUB 1XZWA 4FNSA 1H5BC 4OFVA 4WW1A 2MOVA 3ULVF 3UTSD 4GAGL 1D5IL 3IDIA 4AYMC 3ILEA 5I73B 1GZPA 2HKHH 2YAEA 4NB7A 1PFCA 3U0TA 1KJVA 5D93C 1OF2A 1PKQE 1DQJB 1ZEAH 1YJDL 3PNWB 4ODTH 5LCVA 5JHDD 1G84A 2DQEL 3MGOB 5GGTL 3GXDA 4X4XB 3ORJA 1FYTA 3JVGC 4FZEL 3NZ8A 4YHZH 3NK4A 1PAMA 3O41A 2R4RH 2JKIS 4O2FA 4O02H 2E7LC 5J0BA 1ZTXH 2YD6A 2AANA 3KPTA 5ISZE 1FL6B 3JZYA 3IMWA 4W9IC 1MCLA 3R0MA 4X0KA 43CAB 4R5TA 4L9LA 4RMUA 3SPJA 4LSSL 4YBLB 3SDCC 3Q7JA 3UG3A 1NZRA 4HEMA 4OFPA 5PCYA 2A6DB 1SHMA 3WV0A 2A9BA 3UBXG 2NY5C 5JTWA 3L4YA 4Z0XA 1LM8V 4O5LL 1IGYB 3ZHDA 4R90H 4G8GD 3B4NA 1CZ8L 2P47B 3LDBC 5ID1B 1KFGA 3OBAA 3N1FC 4FCAA 4YFLI 2ZOUA 5LQBH 4P5TC 5MHSD 4X6EA 4H20H 1NCHA 4YL9A 1LILA 3HE7B 4JQVA 2X4PA 2XHNA 3KXFD 2BP5M 1NFDE 2NXYC 4ONHA 4ZTOH 1LJMA 2NQ3A 4K7PH 3ETBJ 3TNMA 9CGTA 4U1SB 4WFHD 2I07B 3QP3A 3QNYB 5L7XL 2X0VA 4ZS7H 4PFEA 5D71H 2PPAA 1ZAGA 2DAVA 4LSRL 5DA0B 4KNQA 4U1NB 3IJ9A 3QRGL 5KVFE 4HJ0D 4H2CA 1ACZA 4LAQH 1GGTA 4GSQA 1G4RA 3F7YB 2XRAH 2QVFB 4XP1L 1SN5A 3L4WA 5DWUH 1J1OL 2MNJB 4L8CB 3ESOA 3MTRA 3MYJA 1D6VH 4N5UA 3V0FA 4PMFA 2FLBT 1ZA6B 4W9GC 4N20A 3VU2A 2BNRE 4NZRL 1J05B 5C0BD 2YN5A 3B6SB 3HMXH 3QXUA 4TVPE 4S10A 4Z7NF 4M7KH 4ZDHB 2D0FA 3KMDA 3D51A 1RERA 4JM0A 3ARYA 3KVDD 4M43L 1NJ9B 2VR7A 5JIDA 2LR4A 5FYKH 3X14A 1UD3A 2IWGA 5CO1A 5IV2B 1OGAD 3MLVH 4WUKL 3O3UN 3EH4B 4WEBL 3CAFA 3KPSA 1OAKL 2YGVA 3L1GA 3UOAB 1GGYA 1TPXB 4ZSOB 2CO4A 3HE6B 1ZDSA 1GMIA 3OKOA 5C6WH 4P07A 4OLYH 2HX7A 4RVBA 1F90H 5ESAB 3PCYA 2EDQA 1OHZA 2FHCA 3FSAA 3OKEB 5B3SB 2QPFA 4WI7A 4Z0BH 2YRPA 4UQEA 5B39B 3RPIB 2OTWA 2BZCA 4MASA 3D50A 2KKQA 1GYUA 4NOFA 3S35L 4APQD 2WWKT 1KEGL 1IJNA 2QL1A 4HWZA 4PJ8B 2VSKB 4PJDB 3NBNA 3X3FL 2B1AH 4RFEA 1UADC 4ZO9A 1BBJB 2E75C 4Q2ZA 2LU3A 3QAZB 2LU7A 4NRZA 5FW7A 4RZCA 4DJMA 2VOTA 5BS0D 4G1MB 5B7MA 3MJ8A 3OPUA 3GLDA 4MMZC 3RNQB 2EQDA 4M29A 3V79C 5EO1B 3HRZC 4HFWA 2V17L 3BZDA 4B27A 3HS0C 1IAII 3CDCA 4PI0A 3MPCA 2V9TA 1HU8A 1L7IL 1A6PA 2OCFD 5D7IA 5F1IA 3KPRB 1CF8L 12E8H 3OKLA 5C8JA 1FFNB 2QFPA 5D96C 1FZOA 5F7DB 3QO1A 4X5WA 4Y2OA 4TSCL 4OVUA 1UWGH 5C0CE 2BVQB 5AAMC 4PLOB 4W9ZA 3BEWA 3K8LA 4IJTA 5EEVA 1E4KA 1OQOA 2HA1A 1T0NB 4LASL 3GEWB 1UXSA 3H3BC 1M05A 5TE7L 2ZX7A 4PR5A 4NKOB 4NO0A 4E2OA 4OAWB 5DJAB 1T1ZB 1ZHNA 2J6EH 2NYYD 2VW4A 4RA3A 3NCJH 4IBQA 5D1ZA 1IL1A 4MZRA 5CD5D 1TENA 3TCTA 3KWXA 4HETA 5HHVL 1HEHC 2G60L 4ORZC 4BZ2A 3QJUB 5DSCA 2MCG1 2Y6SC 4KMQA 2BDNH 3GI9L 2UY6A 3DK0A 3UZEC 3IYLW 4HDIB 1W72A 4TUUA 4Y16C 5J6HA 4X7SH 3Q2NA 4X98A 3ZE1F 4F9PA 1TZHB 5IQLA 5FLVA 1ODUA 1QBML 1OARL 5I8OH 1H15B 2HZHA 2JB6B 2CR0A 4OY9A 2K8QA 4EIGB 5I1IL 3N9GL 4XPGL 4IBTA 1CXLA 2OMZB 2CM6A 4LHUG 2A77H 4ANUA 2A99A 4LQFL 2DQIH 2AF2A 5DK2A 2DJ4A 5JORB 1RZKC 3BSGA 4PY8I 5I19H 1KYFA 1PG7W 4L1SA 1DTUA 2YZ8A 3HHRB 5AZEL 4YNYB 2IXQB 2A74A 3EBIA 1OGPA 3GSRA 2V37A 1QLRB 3QNZA 4QXUH 1KC5H 1HWHB 5E9DE 3TCLA 3C08L 1I8LA 1KT2A 5D1XC 5DQDH 4HOWA 1CICD 3HS9A 5TPWH 4HX1B 3RTQD 4BGLA 5DO8A 2NCMA 2HTKD 3PDOB 4DPBX 4YR6A 4ELME 3QJOA 3Q3GB 4ABQA 4F8TA 1MCDA 4AIEA 3RU8H 4J12A 1Z9SB 3DO3A 3MODL 3MRHB 1ADQL 4UANA 3FT2A 3ZZSA 4JQIH 4PVBA 4GKZA 3A5VA 1FFTB 2EDTA 3T4YA 2N59A 1OXYA 3S3SA 3F6LA 3S35X 2DD8H 3LNGA 5KS9B 4JFXA 3LNIA 3G08A 1V8HA 4FJZA 4HEPA 4HGKC 4PJ8D 4QF1A 4WJ5B 1LK2B 4WVRA 3HUJB 3PHOB 5EORH 5FC9A 2NW2A 3HZVA 3WNOA 5BO1H 4CVXB 4NQUA 2KPNA 4F93B 1WHPA 3IDMA 5GS0C 4CNIA 3UTQA 3CX2A 1UXMA 3DUSA 3CN3A 4GOSA 4QO1A 1D5ZA 3JV4A 3CLFL 1YCSA 2K70A 1J48A 4JB9L 4OCYL 1TTAA 3PWVA 2OSWA 3MACL 1FC2D 2J73A 1A7QH 3QDJE 2BNUA 4LOVA 4O02B 3KPRD 1U3NA 4XXDA 4Y4HA 5T1DH 1QFUH 4H26A 1S7TB 4JM4H 1Q94B 2Z1KA 4F33B 4OCXH 3EOBB 3OD3A 5F3FA 3TPKA 1CR9L 1RZQA 3ZHNA 3L5HA 2VDPL 4LKCA 4NJAH 3QSKB 1EK3A 4E0RB 3DHMA 1N0XL 4ZO7A 1T1XA 1A4JB 3LMJL 3ULSA 5HBBA 1R19A 1H9DA 4HWBH 1ADWA 4HAFA 3AWFA 4M61A 4YHPA 3V4VH 3UEZA 4JPVH 1MH5A 5KTEL 1C5DA 3PWLB 4EF3A 1VPOL 1JE6A 4FLRA 4ETYA 4BZ1L 4J6RL 1NIBA 2BVPB 1VACB 2G3NA 2YA0A 4MA1B 3MRJA 1BFOA 4FFZA 4ONFH 3BSHA 5F7NC 4N9GB 8PAZA 4HG4K 4NNXB 4P2QB 4P59L 4ZPVB 3C87A 3WLBB 5FO7A 3L3HA 5C3IA 1PZAA 2F19H 1DQQA 3BQUA 2CO2A 5SWQA 2AJ3B 5E1HB 1HQ4B 1NPNA 1KULA 1I7TA 5SWSE 2OTUB 5AOMA 3T2OA 3QIUD 2BFVH 2HT2C 4FQXC 4GRLD 4IMLB 3CXHJ 5B38G 2H3NA 3WY1A 3UGUA 2D7TL 3BWUC 3OHXB 4ZOAA 4Q6IC 1AH1A 1LMKA 3FQWA 3DGGB 3VWJA 4JZNA 1NPJA 4PBWD 1QFWL 3TBSB 3FT3A 4DHLA 1ZLDA 3CZSA 5D7IF 1XEDA 1T20B 3QQDB 2OKMA 3LJ3A 2K4WA 4I1RA 3H8NA 3MLPA 1FRGH 1Q0YL 3SBPA 3B37A 4MD5A 3QG7H 5KYYA 3CLWA 3GZOA 4XPHL 4PRHD 3QDGD 4XWGH 3ZMEA 1FVDA 4F1SA 1FDLH 3E3QC 2VZTA 3MRMA 1KGXA 1LD9A 3NK3A 4TNVK 1GYAA 2UVFA 5KYUA