5ABWA

Neutrophil elastase inhibitors for the treatment of (cardio)pulmonary diseases
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
218
structure length
215
Chain Sequence
IVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUTROPHIL ELASTASE
publication title Neutrophil elastase inhibitors for the treatment of (cardio)pulmonary diseases: Into clinical testing with pre-adaptive pharmacophores.
pubmed doi rcsb
molecule tags Hydrolase
total genus 42
structure length 215
sequence length 218
ec nomenclature ec 3.4.21.37: Leukocyte elastase.
pdb deposition date 2015-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5abwA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5abwA02
3QUMP 1O3OA 1TPOA 4A1VA 3A89A 3TH3H 1P2OA 5A8YA 2CGAA 2BD8A 2Y7XA 2ASUB 3S7HB 4ZHLU 3PWBA 1GJCB 5E2PA 1UTJA 1YPEH 3SU5A 3LJOA 1BB0B 1YPMH 3LDXH 4BTUB 1LMWB 3BIVH 3RP2A 1QCPA 2G52A 1TNKA 4QT8C 3V12A 1TGCA 1HIAB 1VCPA 2J2UA 1HAPH 3SV2H 5GXPA 4Z6AH 2ZFFH 3BG8A 1ZGIA 2A4OA 3DFJA 3UIRA 1SFQB 3N7OA 4DG4A 1OOKB 4D7FA 2ZG0H 1BTUA 1FIZA 2VVVA 1AFEH 1BTHH 3DD2H 3U8RH 4MQAA 1LHGH 3PYHA 3B23B 1O3DA 1NZQH 3ATIA 2H6MA 1ZR0A 2DE8A 2A2QH 1GMHF 1O2RA 1ABIH 2PGQB 3TU7H 1LHDH 4ZH8A 2GKVE 1PYTC 4VGCB 1KLTA 1PPGE 3LT3A 2GCHG 1OWEA 3OY5U 1O2IA 4E7NA 1FPHH 2HPQH 4X8SH 5SGAE 2FM2A 4CBOA 1A5IA 4E06H 4B71A 1C1NA 4Q7YA 3UREA 5EPNA 1SGTA 2VIOA 1O3EA 2CJIA 2P59A 1TA2A 2H5DA 2Z6BD 3R3GB 2ZHEH 1IQEA 2VU8E 3PLPA 5F8ZA 1IQLA 3RUOA 1UJ1A 4MLFB 5ESTE 1MKWK 3Q76A 1O3NA 2F9VA 2GZ7A 1OP8A 5EQQA 1V2VT 1IQNA 4INKA 4AB8A 4X2WA 1SLWB 2FI5E 1GG6C 2JETB 1FY1A 1O2NA 7KMEH 1D3TB 2BDCA 1NTPA 1ESBA 4WF8A 5E0GA 5C5NA 1PYTD 4FUGA 2Y5FA 1JRTA 1AY6H 2BD7A 2ZFPH 1C1SA 3AVZA 1FAXA 4RN6A 2XBVA 1FZZA 1GMCG 5DJ7A 1EKBB 1G2MA 1IQKA 3FP7E 4AFSA 4BOHA 2H9TH 2H9EH 1MU8B 3URCA 4ABJA 2EI6A 2FDAA 2C8YB 1C5UA 1RXPA 5GDSH 1FPCH 3ZVEA 1O3MA 1O2KA 4YT6H 1K1IA 2FZZA 2ZU5A 1D3DB 1VGCC 4UDWH 2KAIB 4DIIH 2GT8A 2AERH 1J14A 3PO1B 4X6PA 1AUJA 1ELBA 1MBMA 3QTOH 1ZHRA 2P3TB 4MVNA 1UVOA 1SGPE 3EQ0H 4MPUA 1PPFE 1A61H 1LQEA 1TRMA 1HAGE 4AFZA 3A88A 1EAIA 3UNRA 3KQBA 1G36A 2IJOB 1GJ8B 3VXFH 4KP0A 1F5RA 4Y11E 5AFZH 1SG8B 1MZDA 5AF9H 1AVXA 1EZXC 2P8OC 2C93B 1AI8H 3UQOA 4XBCA 3I78A 2A7HA 4YT7H 4OGYA 2XCFA 3MH7A 2CMYA 4MNVA 4BTIB 2VH0A 1O2UA 3RXAA 1VCQA 2UUKB 5G4BA 2UUFB 2BOHB 2G5VA 4NZLA 1IQJA 1N8OB 1V6DA 5F03A 1ELAA 5AHGH 1O3LA 2HVXA 2XC5A 5HM9A 1Z1IA 1ZRKA 3SV7A 4IBLH 1IQHA 3HK6B 5ETXA 5FXLA 3BTTE 1ZTKA 3S9CA 1ZSLA 3V0XA 1D9IA 3RMLH 2NU2E 1HIAA 3GCHC 1TGSZ 4OGXA 3GCTG 3UFAA 5C5OA 4ISIH 1BBRH 1TAWA 1UK4A 2Y5GA 3UPEA 1O3AA 2PHBA 5E0JA 3VB7A 1GHWH 3ATLA 1XMNB 3KF2A 2XC0A 2R0LA 3A7TA 1EOLA 2FOFA 1TPPA 2DE9A 5C67A 1MTWA 1LO6A 2BVSH 5C3NA 2XBWA 4TPYA 2A7CA 4Q2KA 2J95A 2ZGBH 4IN2A 2B5TB 1FDPA 2Q6GA 2ZCHP 1T4UH 4HTCH 2SGDE 1F2SE 1O5FH 1ZMLA 1WQVH 2QCYA 3M3TA 1DICA 3P8NA 3TK5A 4Y8ZA 1ELDE 1VITF 2FYRA 4NIWA 4B75A 1BBRK 1V2JT 2EC9H 4NA9H 1GHYH 1A5GH 5JBTA 4NSYA 1E35B 1VJ9U 3K2UA 7LPRA 1PQ8A 1MCTA 3A8DA 1RD3B 1AN1E 1AWFH 1NY22 2UWPA 4E05H 3HATH 4RKJB 1GJ7B 3EA9A 1GBTA 1WOFA 4ZHMU 3S0NA 4WMEA 2BY7X 4A1TA 3KIDU 1TBQH 2VWNA 3GYLB 1T8OA 2GMTB 1GJDB 1GBJA 1QNJA 1QA0A 4WH8A 1T31A 1YC0A 2BY8X 2GCTB 2VGCB 3MNBA 2Y81A 3Q3KA 3SV9A 1P05A 1ZPBA 2ZNKH 1ZMNA 4AYVB 2PR3A 3VB6A 1ELEE 3SQHE 2G4TA 2OP9A 2F9NA 1ZPZA 4VGCC 5EXLA 3SJ9A 1O36A 1YCPH 2AFQB 3GY2A 3K9XB 3RXMA 1EATA 2SGAA 5LH8A 2KAIA 7GCHF 2TGPZ 4XE4A 1YPHE 1C1UH 1OYQA 2BZAA 4ABFA 1G3BA 2F9UA 3B8JA 3P95A 2VJ1A 2P3FH 3BEFB 1F92A 3GY8A 3U1IB 4YM9A 1Z6EA 3M61U 1CGIE 4ZMAH 1GBLA 4UONA 4FUEA 3E0PB 8LPRA 3EDXB 1A1RA 2JETC 4XDEA 2EI8A 3VB4A 3SW2B 3A83A 1KSNA 4DURA 1EPTB 1SMFE 3F6UH 1VCWA 3MI4A 4OS7A 1LVYA 3RMMH 2A5AA 2FOAA 1IHTH 1KDQB 2NWNA 1YCPK 4D7GA 1SR5C 1Z1JA 2C8ZB 1TRNA 1UTPA 5ABWA 1KIGH 1O3GA 3UQVA 5T6GA 3T25A 1ZLRA 2C4FH 4D9RA 4CH2B 1Y3XA 1INCA 1JOUB 1XM1A 1G3EA 1Z8JB 1AD8H 4M7GA 1C4U2 4XBBA 3BTDE 3QN7A 2WUCA 1UTKA 1XKBC 2IN2A 3MU0A 4TYDA 3PO1C 1IOEA 1BMAA 2BDAA 3BG4C 5FPSA 1FLEE 4RSPA 4I32A 3F68H 1AHTH 2J9NA 2XC4A 4I8KA 5TCCA 4Y7AA 1UHBB 4YOIA 3M35A 1YPJH 1HAXB 3GOVB 2FO9A 1TALA 3ZZDA 2FEQH 2OC8A 1LHCH 4JK5A 2C8XB 4LK4A 4NWLA 2A4GA 4K1SA 1BHXF 1GHBF 1W3CA 2BLWA 4I8JA 5GWZA 2NU4E 3P92A 2QAAA 1O2LA 1HJ8A 1Y3YA 4NSVA 2BYAX 2PW8H 4BXWA 2TGDA 2OUAA 3IWMA 3E1XB 3L33A 1N8OC 2BD3A 4ABDA 1C1WH 2Y80A 3P70B 3PMBB 1G3CA 4PROA 2Y82A 4UFEH 6GCHG 5T3HA 1SGIB 2PGBB 3E91A 3Q00A 2XBXA 4MNYA 1E0FD 1BCUH 4MNWA 1P2MA 3SNAA 2Z7FE 1O0DH 4ZKSU 1AZ8A 1A46H 3D49H 3DUXH 3FFGA 3NWUA 3LGWA 3ATKA 3Q77A 5DP6A 5L2YH 2TPIZ 1K1OA 3ZZ9A 3E16B 2O8MA 1O2QA 2ZFSA 3SJIA 1DSTA 1OS8A 2ZCKP 3SOSA 5GCHF 4FVDA 4GVUA 1IAUA 1SHYA 1TX7A 2LNCA 5EQRA 2H5CA 1CA0C 1SC8U 2C8WB 2AH4X 2J38A 1C5WB 1WSSH 4DVAU 1BT7A 5C1YA 2PUXB 1HYLA 1OWHA 1S83A 3H5CB 1FY8E 2Z3EA 2Z94A 2BD4A 2C90B 3A7YA 1KLJH 2UWLA 3SZNA 1ZMJA 1QHRB 3ZZ5A 1GMDG 1H9HE 1N1LA 2UWOA 4DOQA 5E8EH 3STJA 4X1PU 1S85A 1L4ZA 3TJVA 4B2CA 4BTTB 1KY9A 1O39A 1XUIA 1D4PB 3JZ1B 4BAKB 1OWDA 8ESTE 1J17T 1O5GH 1WQSA 1BRBE 1O34A 4Y6DA 1A3BH 1EJAA 1KXFA 3Q3XA 3PROA 1O3CA 5AVDA 2OC1A 2QXHA 2WINI 1GHVH 4ISOA 1F0TA 3UOUA 1T8NA 1Y5UT 4ZKNU 1EZUC 2BLOA 3PV4A 1CGHA 1EPTA 2Z9LA 2GMTC 1CHGA 3RXKA 4Y8YA 1P8VC 1EX3A 1KXEA 4FUCA 3BIUH 1HAHH 1KDQA 2GCTC 2VGCC 1ZSJA 1H4WA 1KTTB 1XKAC 1C5MD 1O2XA 4Y79A 3OYPA 4NZQA 2EA3A 2FPZA 5EOKA 1O38A 1P01A 1C2HA 1HCGA 5L30H 1ZHPA 2F9OA 2XXLA 4U32A 1SVPA 1DWDH 5JBAS 2OBOA 1GI9B 3R0FA 1AU8A 1SGFG 3AAVA 1GGDB 3KQEA 1WU1A 3TNTA 5LPEA 2XBYA 3MMGA 4O3UA 5A2MH 2VB0A 1VITH 1WTHD 1HJAB 1YLCA 5HXFA 4MTBA 5T6DA 1FNIA 1F0SA 4NGAH 3AAUA 5DKMA 3TPIZ 3RXQA 1KXAA 1UHBA 2BLQA 1ESAA 1DSUA 1ZYOA 1GJBB 1ANDA 1KLIH 1S0QA 4B1TA 2BDGA 4X2VA 1W11U 1GMHG 1ELFA 1BTPA 3T2NA 1OWJA 2ZGJA 1C2JA 1O2YA 2FLRH 1GJ5H 2ZU4A 3GY5A 1KXCA 1GDUA 1DY9A 3MO9A 3SNEA 5TCAA 3SV8A 3ZVAA 1UCYE 5DP7A 1RIWB 1PPCE 1RTKA 1A0JA 2PLXA 3GY4A 1LPKB 2K1QA 1TQ0B 1NPMA 3DT0H 2WPIS 3P8GA 1AZZA 4FU9A 1PQ5A 2VIVA 4Y71A 1RS0A 1AUTC 1QR3E 3TGKE 2H1UA 4X6MA 3MTYA 4DY7B 1BQYA 5C20A 1D6RA 2SGPE 4R0IA 3I29A 2ANWA 2UUJB 1RRKA 1P0SH 2YOLA 3OU0A 2ZIQH 2YNAA 3FP6E 3O8BA 3U8OH 4LOYH 2Z9KA 3ZZ6A 4D8NA 4UEHH 3GDVA 2HGTH 1U6QA 1XXFA 4NA7A 1LVBA 1S84A 2ZKSA 1PPEE 1C5RA 1IHSH 1L0ZA 2EI7A 1Z71A 3D23A 3TGIE 4Q80A 2BXUH 3SUEA 3PMAB 1SGRE 1HAOH 1CSOE 3SU3A 4AX9H 1GVZA 1EB1H 1MKWH 1QL7A 4MNXA 2VWMA 6CHAB 4FUFA 3VFEA 1G2LA 1TA6A 1GCTB 4LZ1H 4HFPB 2A0QB 3VPKA 4JYUH 3ZYEA 4MDSA 4INLA 2FP7B 4WH6A 1MMJN 1WCZA 1P57B 3RXVA 1EXFA 1C1OA 1G3DA 1TNGA 4JZDH 5JB8S 1MBQA 2ZECA 1DLEA 1YYY1 1GBCA 1M9UA 5FPYA 1TE0A 2WPKS 2VH6A 1GBDA 1C5SA 3FVFB 2TRMA 3LH3A 5C2ZA 3D65E 1FY3A 5JBCS 4JZEH 4K2YA 3UR6A 1MTNB 3C27B 2G8TA 1XUJA 3LONA 1HAYB 4CREA 4X2XA 3A85A 1O2MA 1O2VA 4AB9A 2ZFRH 1Y3WA 2BLVA 5EGMA 1V2NT 3MNCA 3UY9A 2BDIA 4JYVH 2QN5T 1O2JA 1ZOMA 1THSH 1NRRH 3HGPA 3MFJA 1TBZH 1BUIA 4Y0YE 1HPGA 3IG6B 4WVPE 1RTFB 1Y5AT 1GI3A 4ZROA 2BTCE 3KGPA 4BAOB 2WV5A 3NCLA 2OLGA 1P9SA 1BZXE 4TY6A 5CHAB 4OS4A 3QX5H 4B2AA 2XTTB 1B5GH 2CF9H 1QRXA 4DIHH 1E36B 1O2HA 3RXOA 3QZRA 2GP9B 4UFDH 4JZFH 1GBBA 3RLYH 1P12E 3TITA 2QXJA 3RXGA 1P3CA 4I8HA 4X2YA 2GV6A 2JH5D 1FONA 1F5LA 3TH4H 3PTBA 1VITG 3E90B 3ENSB 1ORFA 2V3HH 2OD3B 3LGTA 4CHAB 1N6YA 2ZDLA 4I33A 1DLKB 1Z6JH 2HPPH 2R9PA 3EYDA 2GZ9A 5DK1A 3FZZA 2Y7ZA 3UWIA 2UUYA 4AYYB 2FX4A 1BMMH 2QC2A 1MD8A 2GT7A 1LPGB 4MG3A 1GGDC 2PSXA 1GBAA 2FTLE 3KNXA 1AB9B 1BDAA 2ZQ2A 2JH6D 2J4IA 4ISHH 1L2EA 3ITIA 2AGGX 3LPRA 8KME2 5PTPA 1AE5A 1UVUH 3ZV8A 4JZ1A 3MU5A 2FOCA 2O8LA 4H4FA 4IW4E 1DWCH 3E6PH 1IQIA 3ZZ3A 3T27A 2A7JA 1CT4E 4DT7B 1L1NA 1J8AA 2ZFQH 1Z8GA 1BRUP 4R8TB 1GHZA 3DHKH 2FYQA 4WXVA 3SJKA 1T32A 4UFFH 2D8WA 5GIBA 2BX3A 4Y76A 1DVAH 4B76A 1O5CB 1BJVA 1HNEE 3LOXA 2B9LA 4GHTA 2SNVA 4NFFA 1QURH 1EUFA 2V35A 2XNIA 1AKSB 2G4UA 3PLBA 7GCHG 3KL6A 4HGCA 1K9OE 1Y3VA 3DA9B 1MAYA 1MD7A 1XUFA 1AVGH 4TWYA 4I8LA 2OQ5A 3EA8A 2RG3A 1ELTA 5L6NH 2OCVB 2ZC9H 3GY3A 4YESB 1FJSA 4CRFA 3MNSA 1SI5H 5FCRA 3ELAH 3KN2A 2TGAA 1SGNE 3U69H 2A5KA 1HLTH 4BANB 3CS0A 3V13A 2BDYA 2ODPA 3VGCB 1DUEA 1OKXA 1C2DA 2O8UA 4ISLA 1V2PT 4CBNA 1UK2A 4NWKA 2TIOA 3PMHB 4J2YB 3RXTA 1QB1A 9ESTA 1OWKA 1C1RA 1PPHE 1C2GA 5DP3A 5T6FA 1ETTH 1W8BH 4A6LA 1FAKH 1TABE 2XCNA 3QDZB 2ZTYA 1D3PB 3PWCA 5EW2H 5A8XA 2LPRA 3K65B 2QGRA 3TJOA 2Y6TA 3UOPA 3A81A 6CHAC 4KTSA 3SU1A 1AFQB 2Z9JA 1GCTC 1TBRH 3TGJE 1NRSH 5FHTA 8GCHF 1C4V2 1LKBA 5JPMH 2WPHS 1NRPH 1O2WA 3RM2H 2BOKA 6LPRA 2ZPRA 4K8YA 2BZ6H 1TLDA 2XW9A 2SGEE 3E8LA 3GICB 1TOMH 2PKAB 1A0LA 1TPSA 2JH0D 1W12U 3RXRA 1HRTH 1BRCE 1NS3A 4KTUA 4X6NA 2EEKA 2ZO3H 3AASA 1FQ3A 3K6YA 3ZVGA 2VWOA 4CRGA 2FLBH 3M5MA 1SGDE 2VWLA 1ELGA 4CR5A 1QQ4A 1HXEH 1GHXH 1B0EA 1NO9H 1MTNC 2ZGXH 1Q31A 4YO9A 2HRVA 2W26A 3A7WA 1EASA 1C1TA 1FY5A 4AGJA 4Q7ZA 3GDSA 4Q7XA 1YKTA 2J92A 4AGKA 1BTYA 2ZFTA 3M5NA 1SQAA 2AIPA 3MHWU 1FN8A 1GHAF 1TB6H 2CV3A 1NROH 1WTGH 3MU8A 2B7DH 1C4Y2 1FI8A 1K2I1 1V2WT 3ATMA 4IMQA 3T62A 1W0YH 4AG2A 1QIXB 2AGEX 2W5EA 5EPYA 3ZVDA 2A4QA 2G55A 5CHAC 5GCHG 2ZGCA 2ZHWH 1EOJA 1O3KA 2QXGA 3KQCA 3MO3A 4UE7H 1SGYE 3H7OA 5LGOA 2B8OH 2STAE 5ESBA 4YLUA 3OY6U 5DP5A 1ZPCA 2WYJA 4WXIA 3A8AA 3SU6A 1Q3XA 1G30B 3EAJA 1K1NA 3QK1A 1A5HA 5FAHA 3SI4H 1P2IA 1GBKA 2R3UA 4NIXA 3SNCA 3U9AH 3JZ2B 2ZEBA 4X8TH 3RMOH 1VR1H 5HM2A 1TGTA 4SGBE 1AKSA 2HOBA 4AZ2B 4CHAC 2ZGHA 4FU8A 2BB4A 2VIQA 1F7ZA 1FN6A 3SN8A 1V2LT 4Z0KA 4IN1A 3RXIA 2F9PA 2GVFA 4YOGA 3SORA 1SQOA 4NCYA 1EZQA 2VIPA 4FU7A 3BSQA 3SU2A 2PWXA 2ODQA 1QBOA 2AYWA 1AB9C 2G5NA 5A0CA 5FBEA 1C1VH 2ANMH 5EXMA 1LKAA 2AIQA 2QF0A 3RXCA 3U1JB 3CP7A 3SO3A 1EP5A 3A8CA 1UO6A 2ANYA 4F4OC 1CVWH 2ESTE 1S82A 3A84A 3HKJB 3LU9B 3NUMA 3MYWA 3VB3A 5EW1H 1NFYA 2RA3A 2P16A 1C2LA 3SNBA 3SUFA 2V3OH 2J34A 4HZHA 2PUQH 4WJG2 1D6WA 2ZU2A 2G00A 3BTFE 2WYGA 3MNXA 1SFIA 1DS2E 4K69A 4GCHF 1SGEE 1NT1A 3BTGE 4UD9H 1HBTH 1VJAU 3OSYA 1H8IH 4O03A 2FIRH 2FI4E 2ZDKA 2D1JA 3ZZAA 3UR9A 3TVJB 4K1TA 1HB0B 1O35A 1XVOA 3LC3A 3PB1E 3UNQA 1BIOA 3BV9B 1JMOH 1TMTH 1HAVA 4O97A 2BVRH 3GCOA 1UK3A 1FXYA 2PKAA 1AE8H 3NK8A 3U8TH 1O2GH 3RC5A 1OXGA 5K0HA 1C5ZB 4X1QU 3M3VA 2ZDMA 3VGCC 3O8RA 2RCEA 3RLWH 2OQUA 2HNTC 1GI5A 1PQ7A 3UTUH 4FVBA 4IS5A 1NFXA 3BEIB 3LJJA 2BMGB 2R2MB 3MU1A 2XYAA 3A86A 2R0KA 2VIWA 1MZAA 2ZF0H 3GYMA 1CT2E 3WY8A 1DM4B 1P02A 2VNTA 2ZTXA 1DUAA 2THFB 1MH0A 1LVMA 1B0FA 5K7RA 2OBQA 2OC0A 3M5LA 1O31A 1AFQC 1YF4A 1P03A 1AIXH 2ZQ1A 1MTVA 3FAOA 4MPXA 4B73A 5FX5A 3MU4A 3SI3H 1DE7H 1TRYA 4JYTA 1GI6A 2VVCA 1BTZA 4H6TA 1C2KA 1XX9A 1ELCA 5FX6A 2Z9GA 3RXHA 5I46H 1C5PA 1ZJKA 5F6MA 3BEUA 2F83A 4FXGH 2G51A 2OINA 2FOBA 1E37B 1MTSA 2P3UB 3GDUA 2HALA 2H9HA 3EGKH 5BPEA 1CHOF 1V3XA 1SGQE 3RXBA 4Y7BA 5JDUB 1P04A 3S9BA 2ODYB 1QL8A 5DP4A 2FOHA 3BTQE 1DOJA 2ULLA 5HYOA 2XRCA 1TX6A 1TMUH 1EPTC 3H7TA 4AORA 1EAWA 1W10U 2ZCLP 1Y3UA 3A7VA 1GDNA 4I8GA 5A09A 1NC6A 3M5OA 4ABBA 2V0BA 2CXVA 1C9TA 2FS9A 3ODDA 1J9CH 1WAYB 4AOQA 2Z9IA 1YPLH 3SJ8A 4A1XA 3GCHB 1ACBE 2BQWB 3SHCH 1ESTA 1ZHMA 1LCYA 1QB6A 3A82A 1A3EH 1PQAA 1PJPA 1ARBA 3HPTB 1QRZA 1J15A 3M36A 3UWJH 1THRH 4O9VA 3RXUA 1V2MT 1FIWA 2GDDA 2TBSA 3NXPA 2I6SA 1NFWA 2SGFE 1TNHA 3HK3B 1TFXA 1S6HA 1O30A 1H1BA 3ATWA 3M37A 3EE0B 1P2KA 4K5ZA 4CH8B 1GJ6A 3OX7U 1C5NH 1G9IE 4IC5A 3O8CA 1Z7KA 4A7IB 5EQSA 2ZA5A 1CBWB 1Y5BT 2ANKH 4XFQA 2NU0E 1BBRE 1NN6A 3RM0H 3V7TA 1C2MA 1UTQA 1SOZA 3ZVBA 1O2SA 3TK6A 1OYTH 1LHEH 1BTXA 1O3BA 1MU6B 2QA9E 1XUGA 1YP9A 4YOJA 1W13U 2A1DB 3F1SB 1MTUA 4Y8XA 3E3TA 1ZTLA 1WUNH 4GPGA 2WPMS 2SFAA 5B6OA 3KCGH 4IMZA 1D3QB 3BTWE 4K3JA 3LGYA 3RMNH 4NG9H 3KQDA 2BM2A 2GDEH 4NA8A 4ABHA 2BX4A 3PTNA 3P8FA 1CT0E 4ZHAA 1ETSH 1AMHA 5C1XA 1F0RA 3UUZA 2BD5A 1DY8A 1BMLA 1OX1A 1TWXB 1TIOA 1T7CA 3F9GA 1LPZB 1X7AC 4I31A 2NU3E 1QL9A 4ZXXH 3W95A 1ZGVA 1GBEA 4ISNA 3SV6A 3PLKA 1TMBH 2O9QA 1P11E 2SNWA 2Z3CA 3QTVH 2F9BH 3EA7A 5JYIA 3T28A 4X1SU 2GZ8A 1ETRH 1FV9A 3A7XA 3TJUA 2AMPA 3RC6A 2ZPSA 3ODFA 3P17H 1KTSB 1ARCA 2RA0A 1JIRA 1BITA 4JCNA 3S7KB 3HKIB 3MH4A 3L3TA 4Y0ZE 4BNRA 2GX4A 2BD2A 3SGQE 2ILNA 3M3SA 2QY0B 2W7SA 1IQFA 4GHQA 5EODA 4RKOB 2BQ6B 5JBBS 2F91A 1LQDB 3PM3A 1P2JA 1ZJDA 4YTAA 4KTCA 1YLDA 1GJ9B 1GBIA 4AFQA 2PKSB 1XUKA 1S0RA 2FS8A 2VIDA 1HFDA 2GTBA 3K6ZA 3M7QA 4GAWA 4X1RU 1NU9A 3C1KA 2HLCA 3SGBE 1QJ1B 1TGBA 1XXDA 1EP6A 3GY7A 1MAXA 1PPBH 1P2QA 1A2CH 4WMFA 1O2PA 1PFXC 2ZWLH 2ZDNA 1HAZB 1F0UA 1TPAE 1C5XB 1K1JA 3BG4B 3TK9A 1HJ9A 1H8DH 4OS1A 2A2XH 1Z8RA 4CRAA 2BY9X 1GL1A 1UCYH 2PSYA 3ZZCA 4FUIA 1GJ4H 2AEIH 1HJAC 5E0HA 3BN9A 1PPZA 4MPVA 5LPRA 4NIVA 1THPB 2GCHF 3M7TA 4I7YH 1DFPA 1GI8B 2BY5X 4INHA 2B0FA 2CN0H 5I25A 1GL0E 4ABEA 5CMXH 8GCHG 3BTME 3SJOA 2HNTF 2ALPA 3QO6A 4LXBH 4UFGH 3RXJA 1O37A 4X6OA 1HXFH 2BHGA 1GI4A 1QRWA 1XVMA 6ESTA 1NFUA 4ZUHA 1W7XH 3MOCA 1FUJA 2A45B 4TY7A 3F9EA 2QF3A 1N6XA 3HGNA 1RIWC 2GGVB 1ID5H 2FI3E 1QFKH 1RFNA 1HGTH 1IQGA 1L1GA 1UCYK 1RTLA 2ZHDA 2TGTA 3BTKE 1TX8A 2FODA 3RXSA 1SPJA 5HMAA 3TIUA 2O8TA 3QZQA 1DT2A 1OP0A 1SBWA 3LH1A 4DCDA 5A0BA 1GMCF 2AGIX 2Q6DA 5DG6A 3L6PA 2J94A 2ZDVH 4ZKOU 1HDTH 3GY6A 3RDZA 1ZZZA 2P95A 2ALVA 3BTHE 3LGIA 1GHAG 5EG4A 2CHAB 2ZI2H 2AMDA 1CA0B 1C5QA 2PFEA 1MUEB 2RDLA 1J16A 4H6SB 1K1MA 3NKKA 1DPOA 5DP8A 3T5FH 1CBWC 1FMGA 1NM6A 1QBVH 1TNIA 1VZQH 3RXFA 1DITH 1SGCA 1C5VA 4IGDA 1P2NA 1YPGH 3LGUA 5EU8A 3TNSA 1C5TA 2Q6FA 1EAUA 3TH2H 1T8MA 1YPKH 4U01A 1E34B 1O3IA 5GPIB 2Q1JA 3LGVA 3SU4A 1SGFA 1B7XB 2C3SA 1TONA 2I6QA 3SGAE 2SGQE 4WMDA 1NRNH 1DXWA 1GI1A 1HAVB 1BRAA 1LVOA 1SLUB 3D62A 4ZXYH 5A8ZA 3O8DA 1SHHB 3KEEA 4NIYA 3ZZ7A 1OSSA 1TQ7B 1RJXB 2D26C 2HNTE 3IITA 1A7SA 9LPRA 1DXPA 1GHBG 2ZU1A 3VB5A 5A0AE 2BXTH 1ANCA 2XWBI 2W3IA 5JB9S 1O2TA 1P10A 5DP9A 1O32A 2WV4A 3RU4E 1EAXA 1MCVA 2ZP0H 2GV7A 4B74A 2PTCE 2QV1A 5J4QA 1GPZA 3GCTF 3STIA 3SU0A 1WBGB 2QXIA 4X8VH 5E2OA 1HUTH 3P8OA 3RXLA 2OC7A 2CF8H 3ZVFA 1QJ7B 1BJUA 1O3FA 4WY3A 1GWAA 1IQMA 1C5LH 4ASHA 1O5EH 2IOTA 3SHAH 4CRBA 2BQ7B 3ZV9A 2ZHFH 5F8TA 3DFLA 2QYIA 2FOEA 3Q3YA 3MH5A 4JZIA 2BDHA 1BTWA 4GCHG 1GBFA 1O2OA 2ZZUH 2QIQA 1AO5A 4FUHA 3I77A 4MPWA 1P09A 1UVTH 4WWYA 2HWLB 1K21H 5LPFA 1HV7A 3MH6A 4BAHB 2R2WU 1GI2A 2G81E 5IDKA 1AVWA 1BMNH 1LDTT 4OS6A 3SQEE 4U30A 1AWHB 4CR9A 1O5DH 4FUDA 3QLPH 3S69A 1MKXH 2PKSC 1MQ6A 1UTLM 1YM0A 3F9HA 1O3HA 4BXSA 3T29A 3SUDA 4BAQB 2ZHQH 4LZ4B 3SNDA 3CS7A 1L1JA 1JBUH 1TNLA 1CE5A 4B2BA 1W14U 4J1YA 1K22H 1YGCH 3ZZBA 4DGJA 1S6FA 2VINA 1H9IE 1UTOA 2Y5HA 4X0WU 3UNSA 3M7UA 4YLQH 1O2ZA 1C1MA 1K28D 1O3PB 7ESTE 1SLVB 3LKWA 4ZKRU 2FOGA 2Z3DA 1V2OT 5BRRE 4SGAE 1ZSKA 1F5KU 1G37A 4IC6A 4GUXA 5IYTA 1V2QT 4X8UH 4Y10E 1G32B 3A8BA 5HGGA 4H42U 1ANEA 2PTNA 1V2TT 2AMQA 3SUGA 1MKXK 1YBWA 2WUBA 3MWIU 5DPAA 4K60A 2R3YA 1CA8B 1OPHB 2YNBA 3RXPA 2M5TA 1QY6A 1SOTA 4O3TA 1CQQA 1O5AB 4E7RG 1T8LA 4GSOA 4AG1A 3QGJA 1EJNA 4NFEA 1BOQA 3FP8E 3A87A 1DWBH 1CGJE 1FY4A 1V2UT 3VXEH 5TJXA 4HI3A 1DWEH 1K1LA 1S81A 2NU1E 2BD9A 2STBE 4JMYA 1SQTA 1GVKB 1KYNA 1GJAB 1EZSC 5AFYH 1GDQA 1Z8IB 4AN7A 4XSKU 1GBHA 3AW0A 4KKDA 1TNJA 1CHOG 2A31A 1QTFA 4XOJA 1QJ6B 4K8BA 3CENA 1NESE 1NU7B 2F3CE 4D9QA 5FPTA 2D2DA 2FXRA 5FCKA 1BHXB 3GCNA 1MQ5A 3GISB 4A92A 3TJNA 2CHAC 3ZZ4A 3RU4T 1DDJA 3KHVA 1DX5M 3FZDA 4D76A 5L2ZH 1W7GH 1UTNA 2ZTZA 2A4RA 3LIWA 4YZUA 1ELVA 1HAIH 2A5IA 3QWCH 1SLXB 1P3EA 4ABGA 2W7UA 1UVSH 3B9FH 4ABIA 3A80A 1GG6B 2OTVA 1WV7H 1RGQA 1OP2A 1C5OH 1EQ9A 2GD4B 3G01A 1TYNA 3PMJA 1Q2WA 3W94A 2FOMB 2JKHA 4OS2A 3ZZ8A 3BF6H 2OXSA 1SB1H 5EXNA 1EB2A 1UVPA 1A0HB 1YPHC 5C1UA 1KXDA 1L4DA 1QB9A 4FUJA 5CE1A 2FTMA 2XWAA 3V3MA 1JRSA 4THNH 4ZAEA 1GVLA 4AFUA 3NPSA 4X1NU 1JIMA 3QGNB 4OS5A 1A4WH 4TWWA 1VGCB 4JK6A 5J4SA 1WYKA 1JWTA 3SBKA 4FUBA 3RU4D 4KELA 1UTMA 3A7ZA 3ESTA 2BVXH 3LC5A 4A5TS 1GI0A 5F8XA 6GCHF 3BTEE 3MO6A 5H4IB 3T26A 1GCDA 3RXDA 3RC4A 1C1QA 4DJZB 2PV9B 1UMAH 1TOCB 1T4VH 1C2IA 1GBMA 3ZVCA 1O3JA 1BA8B 4ABAA 5GJ4B 1Y8TA 4KGAA 1GI7B 4GLYA 1H9LB 1QA7A 2FESH 3S9AA 5DO4H 2ZU3A 1TGNA 2P8OB 4XBDA 2H2ZA 2O8WA 2A32A 3TLOA 1C2EA 4BAMB 1C2FA 2V6NA 1AQ7A 4F49A 1AGJA 4CRDA 1DANH 1W2KH 1LHFH 2IPHA 3RXEA 1ABJH 1LTOA 1O5BB 2P94A 3E0NB 3AW1A 3F9FA 1K1PA 4U2WA 1O33A 1ANBA 3VEQB 3U98H 2ZDAH 1GMDF 4ESTE 2BY6X 1E38B 4K1EA 1OWIA 1JXPA 1CU1A 1ZRBA 3URDA 4DW2U 2VVUA 1C5YB 2AS9A 3OTJE 4CRCA 1KXBA 1QQUA 1V2RT 1C1PA 2FWWA 1YCPM 1CO7E 1QBNA 1SL3A 4TPIZ 1C9PA 2W3KA 5DGJA 1V2ST 1Y59T 2FMJA 1XUHA 1QGFA 3NZIA 2P93A 2WPJS 1P9UA 1S5SA 1W0ZU 1P06A 1EJMA 3ZYDA 1NRQH 3P6ZB 3FANA 2ZPQA 1ZTJA 1SSXA 1V2KT 2WPLS 2DUCA 2FX6A 5FBIA 2BDBA
chains in the Genus database with same CATH superfamily
3QUMP 1O3OA 1TPOA 4A1VA 3A89A 3TH3H 1P2OA 5A8YA 2CGAA 2BD8A 2Y7XA 2ASUB 3S7HB 4ZHLU 3PWBA 4FETA 1GJCB 5E2PA 1UTJA 1YPEH 3SU5A 3LJOA 1BB0B 1YPMH 3LDXH 4BTUB 1LMWB 3BIVH 3RP2A 1E1RD 4F48B 1QCPA 2G52A 1TNKA 4QT8C 3V12A 1TGCA 1HIAB 1VCPA 2J2UA 1HAPH 3SV2H 5GXPA 4Z6AH 2ZFFH 3BG8A 3DSPA 1ZGIA 1W0JD 2A4OA 3DFJA 3UIRA 1SFQB 3N7OA 4DG4A 1OOKB 2PP6A 4D7FA 2W6ID 2QF5A 2ZG0H 1BTUA 1FIZA 2VVVA 1AFEH 1BTHH 3DD2H 3U8RH 4MQAA 1LHGH 3PYHA 3B23B 3FO8D 1O3DA 2VBCA 1NZQH 3ATIA 2H6MA 2XOKD 1ZR0A 3F0PA 4DT4A 2DE8A 2A2QH 1GMHF 1O2RA 1ABIH 2PGQB 3TU7H 1LHDH 4ZH8A 2GKVE 1PYTC 4VGCB 1KLTA 1PPGE 3LT3A 2GCHG 1OWEA 3OY5U 3KYGA 1O2IA 4E7NA 1FPHH 2HPQH 4X8SH 5SGAE 5HIZA 2FM2A 4CBOA 1A5IA 4E06H 4B71A 1C1NA 4Q7YA 3UREA 5EPNA 1SGTA 2VIOA 1O3EA 2CJIA 2P59A 1TA2A 2H5DA 2Z6BD 2RFKC 3R3GB 2ZHEH 1IQEA 2VU8E 3PLPA 5F8ZA 1IQLA 3RUOA 1UJ1A 4MLFB 5ESTE 1MKWK 3Q76A 1O3NA 2F9VA 2GZ7A 1OP8A 5EQQA 1V2VT 1IQNA 4INKA 4AB8A 4X2WA 1SLWB 2FI5E 1GG6C 2JETB 1FY1A 1O2NA 7KMEH 1D3TB 2BDCA 1NTPA 1ESBA 4WF8A 5E0GA 5C5NA 1PYTD 4FUGA 2Y5FA 1S6LA 1JRTA 1AY6H 2BD7A 2ZFPH 1C1SA 3AVZA 1FAXA 4RN6A 2XBVA 1FZZA 1GMCG 5DJ7A 1EKBB 1G2MA 1IQKA 3FP7E 4AFSA 4BOHA 2H9TH 2H9EH 1MU8B 3URCA 4ABJA 2EI6A 2FDAA 2C8YB 1C5UA 1RXPA 5GDSH 1FPCH 3ZVEA 1O3MA 1O2KA 4YT6H 1K1IA 2FZZA 2J98B 1D3DB 2ZU5A 1VGCC 4UDWH 2KAIB 4DIIH 3UAIC 2GT8A 2AERH 1J14A 3PO1B 4X6PA 1AUJA 1ELBA 1MBMA 3QTOH 1ZHRA 2P3TB 4MVNA 1UVOA 1SGPE 3EQ0H 4MPUA 1PPFE 1A61H 1LQEA 1TRMA 3PRBA 1HAGE 4AFZA 3A88A 1EAIA 3UNRA 3KQBA 1G36A 2IJOB 1GJ8B 3VXFH 4KP0A 1F5RA 4Y11E 5AFZH 1SG8B 1MZDA 5AF9H 1AVXA 1EZXC 2P8OC 2C93B 1AI8H 3UQOA 1VKYA 4XBCA 3I78A 2A7HA 3OE7D 4YT7H 4OGYA 2XCFA 3MH7A 2CMYA 4MNVA 4BTIB 2VH0A 1O2UA 3RXAA 1VCQA 2UUKB 5G4BA 2UUFB 2BOHB 2G5VA 4NZLA 1IQJA 1N8OB 1V6DA 5F03A 1ELAA 5AHGH 1O3LA 2CK3D 2HVXA 2XC5A 5HM9A 1Z1IA 1ZRKA 3SV7A 3SYJA 4IBLH 1IQHA 3HK6B 5ETXA 5FXLA 3BTTE 2KCOA 1ZTKA 3S9CA 1ZSLA 3V0XA 1D9IA 3RMLH 2NU2E 1HIAA 3GCHC 1TGSZ 3OAAD 4OGXA 3GCTG 3KYFA 5C5OA 3UFAA 4ISIH 1BBRH 1TAWA 1UK4A 2Y5GA 3UPEA 2L74A 1O3AA 2PHBA 2EQNA 5E0JA 3VB7A 1GHWH 3ATLA 1XMNB 3KF2A 2XC0A 2R0LA 3A7TA 1EOLA 2FOFA 1TPPA 2DE9A 5C67A 1MTWA 1LO6A 2BVSH 5C3NA 2XBWA 4TPYA 2A7CA 4Q2KA 2J95A 2ZGBH 4IN2A 2B5TB 1FDPA 2Q6GA 2ZCHP 1T4UH 4HTCH 2SGDE 1F2SE 1O5FH 1ZMLA 1WQVH 2QCYA 3M3TA 1DICA 3P8NA 3TK5A 2XNDD 4Y8ZA 1ELDE 1VITF 2FYRA 4NIWA 4B75A 1BBRK 1V2JT 2EC9H 4NA9H 1GHYH 1A5GH 4B6EA 5JBTA 4NSYA 1E35B 2K8IA 1VJ9U 3K2UA 3NRLA 7LPRA 1PQ8A 1MCTA 3A8DA 1RD3B 1AN1E 1AWFH 1NY22 2UWPA 4E05H 3HATH 4RKJB 1GJ7B 3EA9A 1GBTA 1WOFA 4ZHMU 3S0NA 4WMEA 2BY7X 4A1TA 3KIDU 1TBQH 2VWNA 3N7EA 3GYLB 1T8OA 2GMTB 1GJDB 1GBJA 1QNJA 1QA0A 4WH8A 1T31A 1YC0A 2BY8X 2GCTB 2VGCB 3MNBA 2Y81A 3Q3KA 3SV9A 1P05A 1ZPBA 2ZNKH 1ZMNA 4AYVB 2PR3A 3VB6A 1ELEE 3SQHE 2G4TA 2OP9A 2WPDD 2F9NA 1ZPZA 4VGCC 5EXLA 3SJ9A 1O36A 1YCPH 3PV5A 2AFQB 3GY2A 3K9XB 3RXMA 1EATA 2SGAA 3F2GA 2J98A 5LH8A 2KAIA 7GCHF 2TGPZ 4XE4A 1YPHE 1C1UH 1OYQA 4AC9A 2BZAA 4ABFA 1G3BA 1YY3A 2F9UA 3B8JA 3P95A 2VJ1A 2P3FH 2KCYA 3BEFB 1F92A 3GY8A 3U1IB 4YM9A 1Z6EA 3M61U 1CGIE 4ZMAH 1GBLA 4UONA 4FUEA 3E0PB 8LPRA 3EDXB 1A1RA 2IPQX 2JETC 4XDEA 2EI8A 3VB4A 3SW2B 3A83A 1KSNA 4DURA 1EPTB 1SMFE 3OEHD 3F6UH 1VCWA 3MI4A 4OS7A 1LVYA 3RMMH 2A5AA 2FOAA 1IHTH 1KDQB 2NWNA 1YCPK 4D7GA 4Q63A 1SR5C 1Z1JA 2C8ZB 1TRNA 1UTPA 5ABWA 1KIGH 1O3GA 3UQVA 5T6GA 3T25A 1ZLRA 2C4FH 4D9RA 4CH2B 1Y3XA 1INCA 1JOUB 4ACBA 1XM1A 2J5UA 1G3EA 1Z8JB 1AD8H 4M7GA 1C4U2 4XBBA 3BTDE 3QN7A 2WUCA 1UTKA 1XKBC 2IN2A 2JDID 3MU0A 4TYDA 3PO1C 1IOEA 1BMAA 2BDAA 3BG4C 5FPSA 1FLEE 4RSPA 4I32A 3F68H 1AHTH 2J9NA 2XC4A 4I8KA 5TCCA 4Y7AA 5DSFA 5IK2D 1UHBB 4YOIA 3M35A 1YPJH 1HAXB 3GOVB 2FO9A 1TALA 3ZZDA 2FEQH 2OC8A 1LHCH 4JK5A 2C8XB 4LK4A 4NWLA 2A4GA 4K1SA 1BHXF 1GHBF 1W3CA 2BLWA 4I8JA 5GWZA 2NU4E 3P92A 2QAAA 1O2LA 1HJ8A 1Y3YA 4NSVA 2BYAX 2PW8H 4BXWA 2TGDA 3DSGA 2OUAA 3IWMA 3E1XB 3L33A 3WWBA 1N8OC 2BD3A 4ABDA 1C1WH 2Y80A 3P70B 3PMBB 1G3CA 4PROA 2Y82A 4RT0A 4I86A 4UFEH 6GCHG 5T3HA 1SGIB 2PGBB 3E91A 3Q00A 2XBXA 5C0TA 4MNYA 1E0FD 1BCUH 4MNWA 1P2MA 3SNAA 2Z7FE 1O0DH 4ZKSU 1AZ8A 1A46H 3D49H 3DUXH 3FFGA 3NWUA 3LGWA 3ATKA 3Q77A 5DP6A 5L2YH 2TPIZ 1K1OA 3ZZ9A 3E16B 2O8MA 1O2QA 2ZFSA 1WDIA 3SJIA 1DSTA 3OEED 1OS8A 5CDFE 2ZCKP 3SOSA 5GCHF 4FVDA 4GVUA 1IAUA 1SHYA 1TX7A 2LNCA 5EQRA 2H5CA 1CA0C 1SC8U 2C8WB 2AH4X 2J38A 1C5WB 1WSSH 4DVAU 1BT7A 5C1YA 2PUXB 1HYLA 1OWHA 1S83A 3H5CB 1FY8E 2Z3EA 2Z94A 2BD4A 2C90B 3A7YA 1KLJH 2UWLA 3SZNA 1ZMJA 1QHRB 3ZZ5A 1GMDG 1H9HE 1N1LA 2UWOA 4DOQA 5E8EH 3STJA 4X1PU 1S85A 1L4ZA 3TJVA 4B2CA 4BTTB 1KY9A 1O39A 1XUIA 1OHHD 1D4PB 3JZ1B 4BAKB 1OWDA 8ESTE 2IJD1 1J17T 1O5GH 1WQSA 1BRBE 1O34A 4Y6DA 1A3BH 1EJAA 1KXFA 3Q3XA 3PROA 1O3CA 2YMSD 3CNRA 5AVDA 2OC1A 2QXHA 2WINI 1GHVH 4ISOA 1F0TA 3UOUA 1T8NA 1Y5UT 4ZKNU 1EZUC 2BLOA 2JJ1D 3PV4A 1CGHA 1EPTA 2Z9LA 2GMTC 1CHGA 3RXKA 3OTPA 4Y8YA 1P8VC 1EX3A 1KXEA 4FUCA 3BIUH 1HAHH 1KDQA 1NBMD 2GCTC 2VGCC 1ZSJA 1H4WA 1KTTB 1XKAC 1C5MD 1O2XA 4Y79A 3OYPA 4NZQA 2EA3A 2FPZA 5EOKA 1O38A 1P01A 1C2HA 1HCGA 2KFWA 5L30H 1ZHPA 2F9OA 2XXLA 4U32A 1SVPA 1DWDH 5JBAS 2OBOA 1GI9B 3R0FA 1AU8A 1SGFG 2AHME 3AAVA 1GGDB 3KQEA 1WU1A 3TNTA 5LPEA 2XBYA 3MMGA 4O3UA 5A2MH 2VB0A 1VITH 1WTHD 1HJAB 1YLCA 2RDEA 5HXFA 4MTBA 5T6DA 1FNIA 1F0SA 4NGAH 3AAUA 5DKMA 3TPIZ 3RXQA 1KXAA 1UHBA 2BLQA 1ESAA 1DSUA 1ZYOA 1GJBB 1ANDA 1KLIH 1S0QA 4B1TA 2BDGA 4X2VA 2K0QA 1W11U 1GMHG 1ELFA 1BTPA 3T2NA 1OWJA 2ZGJA 1C2JA 1O2YA 2FLRH 1GJ5H 2ZU4A 3GY5A 1KXCA 1GDUA 1DY9A 3MO9A 3SNEA 5TCAA 3SV8A 3ZVAA 1UCYE 5DP7A 1RIWB 1PPCE 1RTKA 1A0JA 2PLXA 3GY4A 1LPKB 2K1QA 1TQ0B 1NPMA 3DT0H 2WPIS 3P8GA 1AZZA 4FU9A 4XRNA 1PQ5A 2VIVA 4Y71A 1RS0A 1AUTC 1QR3E 3TGKE 2H1UA 4X6MA 3MTYA 4DY7B 1BQYA 5C20A 1D6RA 2SGPE 4R0IA 3I29A 2ANWA 2UUJB 1RRKA 1P0SH 2YOLA 3OU0A 2ZIQH 2YNAA 3FP6E 3O8BA 3U8OH 4LOYH 2Z9KA 3ZZ6A 4D8NA 4UEHH 3GDVA 2HGTH 1U6QA 5B6LA 1XXFA 4NA7A 2LELA 1LVBA 1S84A 2ZKSA 1PPEE 1C5RA 1IHSH 1L0ZA 2EI7A 1Z71A 5C0UA 3D23A 3TGIE 4Q80A 3FKSD 2BXUH 3N7DA 3PMAB 1SGRE 3SUEA 1HAOH 1CSOE 3SU3A 4AX9H 1GVZA 1EB1H 1MKWH 1QL7A 4MNXA 2VWMA 6CHAB 4FUFA 3VFEA 1G2LA 1TA6A 2EY4C 1GCTB 4LZ1H 4HFPB 2A0QB 3VPKA 4JYUH 3ZYEA 4MDSA 4INLA 2JIZD 2FP7B 4WH6A 1MMJN 1WCZA 1P57B 3RXVA 1EXFA 1C1OA 1G3DA 1TNGA 4JZDH 5JB8S 1MBQA 2ZECA 1DLEA 1YYY1 1GBCA 1M9UA 5FPYA 1TE0A 2WPKS 2VH6A 1GBDA 1C5SA 3FVFB 2TRMA 3LH3A 5C2ZA 3D65E 1FY3A 5JBCS 4JZEH 4K2YA 3UR6A 1MTNB 3C27B 2G8TA 1XUJA 3LONA 1HAYB 4CREA 4X2XA 3A85A 1O2MA 1O2VA 4AB9A 2ZFRH 1Y3WA 2BLVA 5EGMA 1V2NT 3MNCA 3UY9A 2BDIA 4JYVH 2QN5T 1O2JA 1ZOMA 1THSH 1NRRH 3HGPA 3MFJA 1TBZH 1BUIA 4Y0YE 1HPGA 2QF4A 3IG6B 4Q4LA 4WVPE 1RTFB 1Y5AT 1GI3A 4ZROA 2BTCE 3KGPA 4BAOB 2WV5A 3NCLA 2OLGA 1P9SA 1BZXE 4TY6A 5CHAB 4OS4A 3QX5H 4B2AA 2XTTB 5EIYA 1B5GH 2CF9H 1QRXA 4DIHH 1E36B 1O2HA 3RXOA 3QZRA 2GP9B 4UFDH 4JZFH 1GBBA 3RLYH 2OK5A 1P12E 3TITA 2QXJA 3RXGA 1P3CA 4I8HA 4X2YA 2GV6A 2JH5D 1FONA 1F5LA 3TH4H 3PTBA 1VITG 3E90B 3ENSB 1ORFA 2V3HH 2OD3B 3LGTA 4CHAB 1N6YA 2ZDLA 4I33A 1DLKB 1Z6JH 2HPPH 2R9PA 3EYDA 2GZ9A 5DK1A 3FZZA 2Y7ZA 3UWIA 2UUYA 4AYYB 2FX4A 1BMMH 2QC2A 1MD8A 2GT7A 1LPGB 4MG3A 1GGDC 2PSXA 1GBAA 2FTLE 3KNXA 1AB9B 1BDAA 2ZQ2A 2JH6D 2J4IA 4ISHH 4YXWD 3MQKC 1L2EA 3ITIA 2AGGX 3LPRA 8KME2 5PTPA 1AE5A 1UVUH 3ZV8A 4JZ1A 3MU5A 2FOCA 2O8LA 4H4FA 4IW4E 1DWCH 3E6PH 1IQIA 3ZZ3A 3T27A 2A7JA 1CT4E 4DT7B 1L1NA 1J8AA 2ZFQH 1Z8GA 1BRUP 4R8TB 1GHZA 3DHKH 2FYQA 4WXVA 3SJKA 1T32A 4UFFH 2D8WA 5GIBA 2BX3A 4Y76A 1DVAH 4B76A 1O5CB 1BJVA 1HNEE 2F4LA 2B9LA 3LOXA 2SNVA 4GHTA 4NFFA 1QURH 1EUFA 2V35A 2XNIA 1AKSB 2G4UA 3PLBA 7GCHG 3KL6A 4HGCA 1K9OE 1Y3VA 3DA9B 1MAYA 1MD7A 1XUFA 1AVGH 4TWYA 4I8LA 2OQ5A 3EA8A 3DSOA 2RG3A 1ELTA 5L6NH 2OCVB 2ZC9H 3GY3A 4YESB 1FJSA 4CRFA 3MNSA 1SI5H 5FCRA 3ELAH 3KN2A 2TGAA 1SGNE 3U69H 2A5KA 1HLTH 4BANB 3CS0A 3V13A 2BDYA 2ODPA 3VGCB 1DUEA 3F0OA 1OKXA 1C2DA 2O8UA 4ISLA 1W0KD 1V2PT 3WW7A 4CBNA 1UK2A 4NWKA 2TIOA 3PMHB 4J2YB 3RXTA 1QB1A 9ESTA 1OWKA 1C1RA 1PPHE 1C2GA 5DP3A 5T6FA 1ETTH 1W8BH 4A6LA 1FAKH 1TABE 1SQRA 2XCNA 3QDZB 2ZTYA 1D3PB 3PWCA 5EW2H 5A8XA 2LPRA 3K65B 3PV2A 2QGRA 3TJOA 2Y6TA 3UOPA 3F2FA 3A81A 6CHAC 4KTSA 3SU1A 1AFQB 2Z9JA 1GCTC 1TBRH 3TGJE 1NRSH 5FHTA 8GCHF 1C4V2 1LKBA 5JPMH 2WPHS 1NRPH 1O2WA 3RM2H 2BOKA 6LPRA 2QE7D 2ZPRA 4K8YA 2BZ6H 1TLDA 2XW9A 2SGEE 3E8LA 1FX0B 3GICB 1TOMH 2PKAB 1A0LA 1TPSA 2JH0D 1W12U 3RXRA 1HRTH 1BRCE 1NS3A 4KTUA 4X6NA 1NBME 2EEKA 2ZO3H 2WSSD 3AASA 1FQ3A 3K6YA 3ZVGA 2VWOA 4CRGA 2FLBH 3M5MA 1SGDE 2VWLA 1ELGA 4CR5A 1QQ4A 1HXEH 1GHXH 1B0EA 1NO9H 1MTNC 2ZGXH 1Q31A 4YO9A 2HRVA 2W26A 3A7WA 1EASA 1C1TA 1FY5A 4AGJA 3SZEA 4Q7ZA 3GDSA 4Q7XA 1YKTA 2J92A 4AGKA 1BTYA 2LP6A 2ZFTA 3M5NA 1SQAA 2AIPA 3MHWU 1FN8A 1GHAF 1TB6H 2CV3A 2HLDD 1NROH 1WTGH 3MU8A 2B7DH 1C4Y2 1FI8A 1K2I1 1V2WT 3ATMA 4IMQA 3T62A 1W0YH 4AG2A 1QIXB 2AGEX 2W5EA 5EPYA 3ZVDA 2A4QA 2V3MA 2G55A 5CHAC 5GCHG 2ZGCA 2ZHWH 1EOJA 1O3KA 2QXGA 3KQCA 3MO3A 4UE7H 1SGYE 3H7OA 5LGOA 2B8OH 2STAE 5ESBA 4YLUA 3OY6U 5DP5A 1ZPCA 2WYJA 4WXIA 3A8AA 2KX4A 3SU6A 4ZCNA 1Q3XA 1G30B 3EAJA 1K1NA 3QK1A 1A5HA 5FAHA 3SI4H 1P2IA 1GBKA 3FOAA 2R3UA 5DN6D 4NIXA 3SNCA 3U9AH 3JZ2B 2ZEBA 4X8TH 3RMOH 1VR1H 5HM2A 1TGTA 5KECA 4SGBE 1AKSA 2HOBA 4AZ2B 4CHAC 2ZGHA 4FU8A 2BB4A 1K0HA 2VIQA 1F7ZA 1FN6A 3SN8A 1V2LT 4Z0KA 4IN1A 3RXIA 2F9PA 2GVFA 4YOGA 3SORA 1SQOA 4NCYA 1EZQA 2VIPA 4FU7A 3BSQA 4M9FA 3SU2A 2PWXA 2ODQA 1QBOA 2AYWA 1AB9C 1KMHB 2G5NA 5A0CA 5FBEA 1C1VH 2ANMH 5EXMA 1LKAA 2AIQA 2QF0A 3RXCA 3U1JB 3CP7A 4P00A 3SO3A 1EP5A 3A8CA 1UO6A 2ANYA 4F4OC 1CVWH 2ESTE 1S82A 3A84A 3HKJB 3LU9B 3NUMA 3MYWA 4P02A 5KGOA 3VB3A 5EW1H 1NFYA 2RA3A 2P16A 1C2LA 3SNBA 3SUFA 2V3OH 2J34A 4HZHA 2PUQH 4WJG2 1D6WA 2ZU2A 2G00A 3BTFE 2WYGA 3MNXA 1SFIA 1DS2E 4K69A 4GCHF 1SGEE 1NT1A 3BTGE 4UD9H 1HBTH 1VJAU 3OSYA 1H8IH 4O03A 4B6FA 2FIRH 2FI4E 2ZDKA 2D1JA 3ZZAA 3UR9A 3TVJB 4K1TA 1HB0B 1O35A 1XVOA 3LC3A 3PB1E 3UNQA 1BIOA 3BV9B 1JMOH 4HG6A 1TMTH 1HAVA 4O97A 2BVRH 3GCOA 1UK3A 1FXYA 2PKAA 1AE8H 3NK8A 2WZQA 3U8TH 1O2GH 3RC5A 1OXGA 5K0HA 3PRDA 1C5ZB 4X1QU 3M3VA 2ZDMA 3VGCC 3O8RA 2RCEA 3RLWH 2OQUA 2HNTC 1GI5A 1PQ7A 3UTUH 4FVBA 4IS5A 1NFXA 3BEIB 3LJJA 2BMGB 2R2MB 3MU1A 2XYAA 3A86A 2R0KA 2VIWA 1MZAA 2ZF0H 3GYMA 1CT2E 3WY8A 4TSFD 1DM4B 1P02A 2VNTA 2ZTXA 1DUAA 2THFB 1MH0A 1LVMA 1B0FA 5K7RA 2OBQA 5F53A 2OC0A 3M5LA 1O31A 1AFQC 5FL7D 1YF4A 1P03A 1AIXH 2ZQ1A 1MTVA 3FAOA 4MPXA 4B73A 5FX5A 3MU4A 3SI3H 1DE7H 1TRYA 4JYTA 1GI6A 2VVCA 1BTZA 4H6TA 2KM0A 1C2KA 1XX9A 1ELCA 5FX6A 2Z9GA 3RXHA 5I46H 1C5PA 1ZJKA 5F6MA 3BEUA 2F83A 4FXGH 2G51A 1QZ8A 2OINA 2FOBA 1E37B 1MTSA 2P3UB 3GDUA 2HALA 4Z1MD 2H9HA 3EGKH 5BPEA 4RI0A 1CHOF 1V3XA 1SGQE 3RXBA 4Y7BA 5JDUB 1WXRA 3FN8A 1P04A 3S9BA 2ODYB 1QL8A 5DP4A 2FOHA 3BTQE 1DOJA 2ULLA 5HYOA 2XRCA 1TX6A 1TMUH 1EPTC 2V7QD 3H7TA 4AORA 1EAWA 1W10U 2ZCLP 1Y3UA 3A7VA 1GDNA 4I8GA 5A09A 1NC6A 3M5OA 4ABBA 2V0BA 2CXVA 1C9TA 2FS9A 3ODDA 1J9CH 1WAYB 4AOQA 4TT3D 2Z9IA 1YPLH 3SJ8A 4A1XA 3GCHB 1ACBE 2BQWB 3SHCH 1ESTA 1ZHMA 1LCYA 1QB6A 3A82A 1A3EH 1PQAA 1PJPA 1ARBA 3HPTB 4F55A 1QRZA 1J15A 3M36A 3UWJH 1THRH 4O9VA 3RXUA 1V2MT 1FIWA 2GDDA 2TBSA 3NXPA 2I6SA 5C94A 1NFWA 2SGFE 1TNHA 1COWD 3HK3B 1TFXA 1S6HA 1O30A 1H1BA 3ATWA 3M37A 3EE0B 1P2KA 4K5ZA 4CH8B 1GJ6A 3OX7U 1E79D 1C5NH 1G9IE 4IC5A 3O8CA 1Z7KA 4A7IB 5EQSA 3U28C 2ZA5A 1CBWB 1Y5BT 2ANKH 4XFQA 2NU0E 1BBRE 1NN6A 3RM0H 3V7TA 1C2MA 1UTQA 1SOZA 3ZVBA 1O2SA 1H8HD 3TK6A 1OYTH 1LHEH 1BTXA 1O3BA 1MU6B 2QA9E 1XUGA 1YP9A 1SKYE 4YOJA 1W13U 2A1DB 3OFND 3F1SB 1MTUA 4Y8XA 3E3TA 1ZTLA 1WUNH 4GPGA 2WPMS 4XD7D 2SFAA 5B6OA 3KCGH 4IMZA 1D3QB 3BTWE 4K3JA 3LGYA 3RMNH 4NG9H 3KQDA 2BM2A 2GDEH 4NA8A 4ABHA 2BX4A 3PTNA 3P8FA 1CT0E 4ZHAA 1ETSH 2M2AA 1AMHA 5C1XA 1F0RA 3UUZA 2BD5A 1DY8A 1BMLA 1OX1A 1TWXB 1TIOA 1T7CA 3F9GA 1LPZB 1X7AC 4I31A 2NU3E 1QL9A 4ZXXH 3W95A 1ZGVA 1GBEA 4ISNA 3SV6A 3PLKA 4RT1A 1TMBH 2O9QA 1P11E 2SNWA 2Z3CA 3QTVH 2F9BH 5EJ1A 3EA7A 5JYIA 3T28A 4X1SU 2GZ8A 1ETRH 1MABB 5C17A 1FV9A 3A7XA 3TJUA 5GNDA 2AMPA 3RC6A 2ZPSA 3ODFA 3P17H 1KTSB 1ARCA 2RA0A 1JIRA 1BITA 4JCNA 3S7KB 3HKIB 3MH4A 3L3TA 4Y0ZE 4BNRA 2GX4A 2BD2A 3SGQE 2ILNA 3M3SA 2QY0B 2W7SA 1IQFA 4GHQA 5EODA 4RKOB 2BQ6B 5JBBS 2F91A 1LQDB 3PM3A 1P2JA 1ZJDA 4YTAA 4KTCA 1YLDA 1GJ9B 1GBIA 4AFQA 2PKSB 2WHXA 1XUKA 1S0RA 2FS8A 2VIDA 1HFDA 2GTBA 3K6ZA 3M7QA 4GAWA 4X1RU 1NU9A 3C1KA 2HLCA 3SGBE 1QJ1B 1TGBA 1XXDA 1EP6A 3GY7A 1MAXA 1PPBH 1P2QA 1A2CH 4WMFA 1O2PA 1PFXC 2ZWLH 2ZDNA 1HAZB 1F0UA 1TPAE 1C5XB 1K1JA 3BG4B 3TK9A 1HJ9A 1H8DH 4OS1A 2A2XH 1Z8RA 4CRAA 2BY9X 1GL1A 1UCYH 2PSYA 3ZZCA 4FUIA 1GJ4H 2AEIH 1HJAC 5E0HA 3BN9A 1PPZA 4MPVA 5LPRA 4NIVA 1THPB 2GCHF 3M7TA 4I7YH 1DFPA 1GI8B 2BY5X 4INHA 2B0FA 2CN0H 5I25A 1GL0E 4ABEA 5CMXH 8GCHG 3BTME 3SJOA 2HNTF 2ALPA 3QO6A 4LXBH 4UFGH 3KQ5A 3RXJA 1O37A 4X6OA 1HXFH 2BHGA 1GI4A 1QRWA 1XVMA 6ESTA 1NFUA 4ZUHA 4ASUD 1W7XH 1EFRD 3MOCA 1FUJA 2A45B 4TY7A 3F9EA 2QF3A 1N6XA 3HGNA 1RIWC 2GGVB 1ID5H 2FI3E 1QFKH 1RFNA 2KCPA 1HGTH 1IQGA 1L1GA 1UCYK 1RTLA 2ZHDA 2TGTA 3BTKE 1TX8A 2FODA 3RXSA 1SPJA 5HMAA 3TIUA 2O8TA 3QZQA 1DT2A 1OP0A 1SBWA 3LH1A 4DCDA 5A0BA 1GMCF 2AGIX 2Q6DA 5DG6A 3L6PA 2J94A 1H8ED 2ZDVH 4ZKOU 2JJ2D 1HDTH 3GY6A 3RDZA 1ZZZA 2P95A 2ALVA 3BTHE 3LGIA 2YMSB 1GHAG 5EG4A 2CHAB 2ZI2H 2AMDA 1CA0B 1C5QA 3F3BA 2PFEA 1MUEB 2RDLA 1J16A 5KEDA 4H6SB 1K1MA 3NKKA 1DPOA 5DP8A 3T5FH 3W1EA 1CBWC 1FMGA 1NM6A 1QBVH 3GS9A 1TNIA 1VZQH 3RXFA 1DITH 1SGCA 1C5VA 4IGDA 1P2NA 1YPGH 3LGUA 5HKKD 5EU8A 3TNSA 1C5TA 2Q6FA 1EAUA 3TH2H 1T8MA 1YPKH 4U01A 1E34B 1O3IA 5GPIB 2Q1JA 3LGVA 3SU4A 1SGFA 1B7XB 2C3SA 1TONA 1BMFD 2I6QA 3SGAE 2SGQE 4WMDA 1NRNH 1DXWA 1GI1A 3EE7A 1HAVB 1BRAA 1LVOA 1SLUB 3D62A 4ZXYH 5A8ZA 3O8DA 1SHHB 3KEEA 4NIYA 3ZZ7A 1OSSA 1TQ7B 1RJXB 2D26C 2HNTE 3IITA 1A7SA 9LPRA 1DXPA 1GHBG 2ZU1A 3VB5A 5A0AE 2KR7A 2BXTH 1ANCA 2XWBI 2W3IA 5JB9S 1O2TA 1P10A 5DP9A 1O32A 2WV4A 3RU4E 1EAXA 1MCVA 2ZP0H 2GV7A 4B74A 2PTCE 2QV1A 5J4QA 1GPZA 3GCTF 3STIA 3SU0A 1WBGB 2QXIA 4X8VH 5E2OA 1HUTH 3P8OA 3RXLA 2OC7A 2CF8H 3ZVFA 3F2HA 1QJ7B 1BJUA 1O3FA 4WY3A 1GWAA 1IQMA 1C5LH 4ASHA 1O5EH 2IOTA 3SHAH 4CRBA 2BQ7B 1UW7A 3ZV9A 2ZHFH 5F8TA 3DFLA 2QYIA 2FOEA 3Q3YA 3MH5A 4FOUC 4JZIA 2BDHA 1BTWA 4GCHG 3ZIAD 1GBFA 1O2OA 2ZZUH 2QIQA 1AO5A 4FUHA 3I77A 4MPWA 1P09A 1UVTH 4WWYA 2HWLB 1K21H 5LPFA 1HV7A 3MH6A 4BAHB 2R2WU 1GI2A 2G81E 5IDKA 1AVWA 1BMNH 1LDTT 4OS6A 3SQEE 4U30A 1AWHB 2L6OA 4CR9A 1O5DH 4FUDA 3QLPH 3S69A 1MKXH 2PKSC 1MQ6A 1UTLM 1YM0A 3F9HA 1O3HA 4BXSA 3T29A 3SUDA 4ACAA 4BAQB 2ZHQH 4LZ4B 3SNDA 3CS7A 2J97A 1L1JA 1JBUH 1TNLA 1CE5A 4B2BA 1W14U 4J1YA 2HVYB 1K22H 1YGCH 3ZZBA 4DGJA 1S6FA 2VINA 1H9IE 1UTOA 2Y5HA 4X0WU 3UNSA 3M7UA 3UB0A 4YLQH 1O2ZA 1C1MA 1K28D 1O3PB 7ESTE 1SLVB 3LKWA 4ZKRU 2FOGA 2Z3DA 1V2OT 5BRRE 4SGAE 1ZSKA 1F5KU 1G37A 4IC6A 4GUXA 5IYTA 1V2QT 4X8UH 4Y10E 1G32B 3A8BA 5HGGA 4H42U 1ANEA 2PTNA 1V2TT 2AMQA 3SUGA 1MKXK 1YBWA 2WUBA 3MWIU 5DPAA 4K60A 2R3YA 1CA8B 1OPHB 2YNBA 3RXPA 2M5TA 1QY6A 1SOTA 4O3TA 5T1VA 1CQQA 1O5AB 4E7RG 1T8LA 4GSOA 4AG1A 3QGJA 1EJNA 4NFEA 1BOQA 3FP8E 3A87A 1DWBH 1CGJE 3VG8A 1FY4A 1V2UT 3VXEH 5TJXA 4HI3A 1DWEH 1K1LA 3WWFA 1S81A 2NU1E 2BD9A 2STBE 4JMYA 1SQTA 1GVKB 1KYNA 1GJAB 1EZSC 5AFYH 1GDQA 1Z8IB 4AN7A 4XSKU 1GBHA 3AW0A 4KKDA 1TNJA 1CHOG 2A31A 5EJZA 1QTFA 4XOJA 1QJ6B 4K8BA 3CENA 1NESE 1NU7B 2F3CE 4D9QA 5FPTA 2D2DA 2FXRA 5FCKA 1BHXB 3GCNA 1MQ5A 3GISB 4A92A 3TJNA 2YMSC 2CHAC 3ZZ4A 2WV9A 1DDJA 3KHVA 1DX5M 3FZDA 5EJLA 3RU4T 1W7GH 1UTNA 4D76A 2ZTZA 5L2ZH 2A4RA 3LIWA 4YZUA 1ELVA 1HAIH 2A5IA 3QWCH 1SLXB 1P3EA 4ABGA 2W7UA 1UVSH 3B9FH 4ABIA 3A80A 1GG6B 2OTVA 3AK5A 1WV7H 1RGQA 1OP2A 1C5OH 1EQ9A 2GD4B 3G01A 1TYNA 3PMJA 1Q2WA 3W94A 2FOMB 2JKHA 4OS2A 3ZZ8A 3BF6H 2OXSA 1SB1H 5EXNA 1EB2A 1UVPA 1A0HB 1YPHC 5C1UA 1KXDA 1L4DA 1QB9A 1YLNA 4FUJA 5CE1A 2FTMA 2XWAA 3V3MA 1JRSA 4THNH 2GJGA 4ZAEA 1GVLA 4AFUA 3NPSA 4X1NU 1JIMA 3QGNB 4OS5A 1A4WH 3N99A 4TWWA 1VGCB 4JK6A 5J4SA 1WYKA 1JWTA 3SBKA 4FUBA 3RU4D 4KELA 1UTMA 3A7ZA 3ESTA 2BVXH 3LC5A 4A5TS 1YWUA 1GI0A 5F8XA 6GCHF 3BTEE 3MO6A 5H4IB 3T26A 1GCDA 3RXDA 3DCLA 1C1QA 3RC4A 2PV9B 1UMAH 4DJZB 1TOCB 1T4VH 1C2IA 1GBMA 3ZVCA 1O3JA 2F43B 1BA8B 4ABAA 5GJ4B 1Y8TA 4KGAA 1GI7B 4GLYA 1E1QD 1H9LB 1QA7A 2FESH 3S9AA 5DO4H 2ZU3A 1TGNA 2P8OB 4XBDA 2H2ZA 2O8WA 3H09A 2A32A 3TLOA 1C2EA 4BAMB 1C2FA 2V6NA 5CHBA 1AQ7A 4F49A 1AGJA 4CRDA 1DANH 1W2KH 1LHFH 2IPHA 3RXEA 1ABJH 2KZ4A 1LTOA 1O5BB 2P94A 3E0NB 3AW1A 3F9FA 1K1PA 4U2WA 1O33A 1ANBA 3VEQB 3U98H 2ZDAH 1GMDF 4ESTE 2BY6X 1E38B 4K1EA 1OWIA 1JXPA 1CU1A 1ZRBA 2W6JD 3URDA 4DW2U 2VVUA 1C5YB 2AS9A 3OTJE 5HIYA 4CRCA 1KXBA 1QQUA 1V2RT 1C1PA 2FWWA 1YCPM 1CO7E 1QBNA 1SL3A 4TPIZ 1C9PA 2W3KA 5DGJA 1V2ST 1Y59T 2FMJA 1XUHA 1QGFA 3NZIA 2P93A 2WPJS 1P9UA 1S5SA 1W0ZU 1P06A 1EJMA 2KCAA 4OM9A 3ZYDA 1NRQH 3P6ZB 3FANA 2ZPQA 1ZTJA 1SSXA 1V2KT 2WPLS 2DUCA 2FX6A 5FBIA 2BDBA
chains in the Genus database with same CATH topology
3QUMP 1O3OA 1TPOA 4A1VA 3A89A 3TH3H 1P2OA 5A8YA 2CGAA 2BD8A 2Y7XA 2ASUB 3S7HB 4ZHLU 3PWBA 1GJCB 5E2PA 1UTJA 1YPEH 3SU5A 3LJOA 1BB0B 1YPMH 3LDXH 4BTUB 1LMWB 3BIVH 3RP2A 1QCPA 2G52A 1TNKA 4QT8C 3V12A 1TGCA 1HIAB 1VCPA 2J2UA 1HAPH 3SV2H 5GXPA 4Z6AH 2ZFFH 3BG8A 1ZGIA 2A4OA 3DFJA 3UIRA 1SFQB 3N7OA 4DG4A 1OOKB 4D7FA 2ZG0H 1BTUA 1FIZA 2VVVA 1AFEH 1BTHH 3DD2H 3U8RH 4MQAA 1LHGH 3PYHA 3B23B 1O3DA 1NZQH 3ATIA 2H6MA 1ZR0A 2DE8A 2A2QH 1GMHF 1O2RA 1ABIH 2PGQB 3TU7H 1LHDH 4ZH8A 2GKVE 1PYTC 4VGCB 1KLTA 1PPGE 3LT3A 2GCHG 1OWEA 3OY5U 1O2IA 4E7NA 1FPHH 2HPQH 4X8SH 5SGAE 2FM2A 4CBOA 1A5IA 4E06H 4B71A 1C1NA 4Q7YA 3UREA 5EPNA 1SGTA 2VIOA 1O3EA 2CJIA 2P59A 1TA2A 2H5DA 2Z6BD 3R3GB 2ZHEH 1IQEA 2VU8E 3PLPA 5F8ZA 1IQLA 3RUOA 1UJ1A 4MLFB 5ESTE 1MKWK 3Q76A 1O3NA 2F9VA 2GZ7A 1OP8A 5EQQA 1V2VT 1IQNA 4INKA 4AB8A 4X2WA 1SLWB 2FI5E 1GG6C 2JETB 1FY1A 1O2NA 7KMEH 1D3TB 2BDCA 1NTPA 1ESBA 4WF8A 5E0GA 5C5NA 1PYTD 4FUGA 2Y5FA 1JRTA 1AY6H 2BD7A 2ZFPH 1C1SA 3AVZA 1FAXA 4RN6A 2XBVA 1FZZA 1GMCG 5DJ7A 1EKBB 1G2MA 1IQKA 3FP7E 4AFSA 4BOHA 2H9TH 2H9EH 1MU8B 3URCA 4ABJA 2EI6A 2FDAA 2C8YB 1C5UA 1RXPA 5GDSH 1FPCH 3ZVEA 1O3MA 1O2KA 4YT6H 1K1IA 2FZZA 2ZU5A 1D3DB 1VGCC 4UDWH 2KAIB 4DIIH 2GT8A 2AERH 1J14A 3PO1B 4X6PA 1AUJA 1ELBA 1MBMA 3QTOH 1ZHRA 2P3TB 4MVNA 1UVOA 1SGPE 3EQ0H 4MPUA 1PPFE 1A61H 1LQEA 1TRMA 1HAGE 4AFZA 3A88A 1EAIA 3UNRA 3KQBA 1G36A 2IJOB 1GJ8B 3VXFH 4KP0A 1F5RA 4Y11E 5AFZH 1SG8B 1MZDA 5AF9H 1AVXA 1EZXC 2P8OC 2C93B 1AI8H 3UQOA 4XBCA 3I78A 2A7HA 4YT7H 4OGYA 2XCFA 3MH7A 2CMYA 4MNVA 4BTIB 2VH0A 1O2UA 3RXAA 1VCQA 2UUKB 5G4BA 2UUFB 2BOHB 2G5VA 4NZLA 1IQJA 1N8OB 1V6DA 5F03A 1ELAA 5AHGH 1O3LA 2HVXA 2XC5A 5HM9A 1Z1IA 1ZRKA 3SV7A 4IBLH 1IQHA 3HK6B 5ETXA 5FXLA 3BTTE 1ZTKA 3S9CA 1ZSLA 3V0XA 1D9IA 3RMLH 2NU2E 1HIAA 3GCHC 1TGSZ 4OGXA 3GCTG 3UFAA 5C5OA 4ISIH 1BBRH 1TAWA 1UK4A 2Y5GA 3UPEA 1O3AA 2PHBA 5E0JA 3VB7A 1GHWH 3ATLA 1XMNB 3KF2A 2XC0A 2R0LA 3A7TA 1EOLA 2FOFA 1TPPA 2DE9A 5C67A 1MTWA 1LO6A 2BVSH 5C3NA 2XBWA 4TPYA 2A7CA 4Q2KA 2J95A 2ZGBH 4IN2A 2B5TB 1FDPA 2Q6GA 2ZCHP 1T4UH 4HTCH 2SGDE 1F2SE 1O5FH 1ZMLA 1WQVH 2QCYA 3M3TA 1DICA 3P8NA 3TK5A 4Y8ZA 1ELDE 1VITF 2FYRA 4NIWA 4B75A 1BBRK 1V2JT 2EC9H 4NA9H 1GHYH 1A5GH 5JBTA 4NSYA 1E35B 1VJ9U 3K2UA 7LPRA 1PQ8A 1MCTA 3A8DA 1RD3B 1AN1E 1AWFH 1NY22 2UWPA 4E05H 3HATH 4RKJB 1GJ7B 3EA9A 1GBTA 1WOFA 4ZHMU 3S0NA 4WMEA 2BY7X 4A1TA 3KIDU 1TBQH 2VWNA 3GYLB 1T8OA 2GMTB 1GJDB 1GBJA 1QNJA 1QA0A 4WH8A 1T31A 1YC0A 2BY8X 2GCTB 2VGCB 3MNBA 2Y81A 3Q3KA 3SV9A 1P05A 1ZPBA 2ZNKH 1ZMNA 4AYVB 2PR3A 3VB6A 1ELEE 3SQHE 2G4TA 2OP9A 2F9NA 1ZPZA 4VGCC 5EXLA 3SJ9A 1O36A 1YCPH 2AFQB 3GY2A 3K9XB 3RXMA 1EATA 2SGAA 5LH8A 2KAIA 7GCHF 2TGPZ 4XE4A 1YPHE 1C1UH 1OYQA 2BZAA 4ABFA 1G3BA 2F9UA 3B8JA 3P95A 2VJ1A 2P3FH 3BEFB 1F92A 3GY8A 3U1IB 4YM9A 1Z6EA 3M61U 1CGIE 4ZMAH 1GBLA 4UONA 4FUEA 3E0PB 8LPRA 3EDXB 1A1RA 2JETC 4XDEA 2EI8A 3VB4A 3SW2B 3A83A 1KSNA 4DURA 1EPTB 1SMFE 3F6UH 1VCWA 3MI4A 4OS7A 1LVYA 3RMMH 2A5AA 2FOAA 1IHTH 1KDQB 2NWNA 1YCPK 4D7GA 1SR5C 1Z1JA 2C8ZB 1TRNA 1UTPA 5ABWA 1KIGH 1O3GA 3UQVA 5T6GA 3T25A 1ZLRA 2C4FH 4D9RA 4CH2B 1Y3XA 1INCA 1JOUB 1XM1A 1G3EA 1Z8JB 1AD8H 4M7GA 1C4U2 4XBBA 3BTDE 3QN7A 2WUCA 1UTKA 1XKBC 2IN2A 3MU0A 4TYDA 3PO1C 1IOEA 1BMAA 2BDAA 3BG4C 5FPSA 1FLEE 4RSPA 4I32A 3F68H 1AHTH 2J9NA 2XC4A 4I8KA 5TCCA 4Y7AA 1UHBB 4YOIA 3M35A 1YPJH 1HAXB 3GOVB 2FO9A 1TALA 3ZZDA 2FEQH 2OC8A 1LHCH 4JK5A 2C8XB 4LK4A 4NWLA 2A4GA 4K1SA 1BHXF 1GHBF 1W3CA 2BLWA 4I8JA 5GWZA 2NU4E 3P92A 2QAAA 1O2LA 1HJ8A 1Y3YA 4NSVA 2BYAX 2PW8H 4BXWA 2TGDA 2OUAA 3IWMA 3E1XB 3L33A 1N8OC 2BD3A 4ABDA 1C1WH 2Y80A 3P70B 3PMBB 1G3CA 4PROA 2Y82A 4UFEH 6GCHG 5T3HA 1SGIB 2PGBB 3E91A 3Q00A 2XBXA 4MNYA 1E0FD 1BCUH 4MNWA 1P2MA 3SNAA 2Z7FE 1O0DH 4ZKSU 1AZ8A 1A46H 3D49H 3DUXH 3FFGA 3NWUA 3LGWA 3ATKA 3Q77A 5DP6A 5L2YH 2TPIZ 1K1OA 3ZZ9A 3E16B 2O8MA 1O2QA 2ZFSA 3SJIA 1DSTA 1OS8A 2ZCKP 3SOSA 5GCHF 4FVDA 4GVUA 1IAUA 1SHYA 1TX7A 2LNCA 5EQRA 2H5CA 1CA0C 1SC8U 2C8WB 2AH4X 2J38A 1C5WB 1WSSH 4DVAU 1BT7A 5C1YA 2PUXB 1HYLA 1OWHA 1S83A 3H5CB 1FY8E 2Z3EA 2Z94A 2BD4A 2C90B 3A7YA 1KLJH 2UWLA 3SZNA 1ZMJA 1QHRB 3ZZ5A 1GMDG 1H9HE 1N1LA 2UWOA 4DOQA 5E8EH 3STJA 4X1PU 1S85A 1L4ZA 3TJVA 4B2CA 4BTTB 1KY9A 1O39A 1XUIA 1D4PB 3JZ1B 4BAKB 1OWDA 8ESTE 1J17T 1O5GH 1WQSA 1BRBE 1O34A 4Y6DA 1A3BH 1EJAA 1KXFA 3Q3XA 3PROA 1O3CA 5AVDA 2OC1A 2QXHA 2WINI 1GHVH 4ISOA 1F0TA 3UOUA 1T8NA 1Y5UT 4ZKNU 1EZUC 2BLOA 3PV4A 1CGHA 1EPTA 2Z9LA 2GMTC 1CHGA 3RXKA 4Y8YA 1P8VC 1EX3A 1KXEA 4FUCA 3BIUH 1HAHH 1KDQA 2GCTC 2VGCC 1ZSJA 1H4WA 1KTTB 1XKAC 1C5MD 1O2XA 4Y79A 3OYPA 4NZQA 2EA3A 2FPZA 5EOKA 1O38A 1P01A 1C2HA 1HCGA 5L30H 1ZHPA 2F9OA 2XXLA 4U32A 1SVPA 1DWDH 5JBAS 2OBOA 1GI9B 3R0FA 1AU8A 1SGFG 3AAVA 1GGDB 3KQEA 1WU1A 3TNTA 5LPEA 2XBYA 3MMGA 4O3UA 5A2MH 2VB0A 1VITH 1WTHD 1HJAB 1YLCA 5HXFA 4MTBA 5T6DA 1FNIA 1F0SA 4NGAH 3AAUA 5DKMA 3TPIZ 3RXQA 1KXAA 1UHBA 2BLQA 1ESAA 1DSUA 1ZYOA 1GJBB 1ANDA 1KLIH 1S0QA 4B1TA 2BDGA 4X2VA 1W11U 1GMHG 1ELFA 1BTPA 3T2NA 1OWJA 2ZGJA 1C2JA 1O2YA 2FLRH 1GJ5H 2ZU4A 3GY5A 1KXCA 1GDUA 1DY9A 3MO9A 3SNEA 5TCAA 3SV8A 3ZVAA 1UCYE 5DP7A 1RIWB 1PPCE 1RTKA 1A0JA 2PLXA 3GY4A 1LPKB 2K1QA 1TQ0B 1NPMA 3DT0H 2WPIS 3P8GA 1AZZA 4FU9A 1PQ5A 2VIVA 4Y71A 1RS0A 1AUTC 1QR3E 3TGKE 2H1UA 4X6MA 3MTYA 4DY7B 1BQYA 5C20A 1D6RA 2SGPE 4R0IA 3I29A 2ANWA 2UUJB 1RRKA 1P0SH 2YOLA 3OU0A 2ZIQH 2YNAA 3FP6E 3O8BA 3U8OH 4LOYH 2Z9KA 3ZZ6A 4D8NA 4UEHH 3GDVA 2HGTH 1U6QA 1XXFA 4NA7A 1LVBA 1S84A 2ZKSA 1PPEE 1C5RA 1IHSH 1L0ZA 2EI7A 1Z71A 3D23A 3TGIE 4Q80A 2BXUH 3SUEA 3PMAB 1SGRE 1HAOH 1CSOE 3SU3A 4AX9H 1GVZA 1EB1H 1MKWH 1QL7A 4MNXA 2VWMA 6CHAB 4FUFA 3VFEA 1G2LA 1TA6A 1GCTB 4LZ1H 4HFPB 2A0QB 3VPKA 4JYUH 3ZYEA 4MDSA 4INLA 2FP7B 4WH6A 1MMJN 1WCZA 1P57B 3RXVA 1EXFA 1C1OA 1G3DA 1TNGA 4JZDH 5JB8S 1MBQA 2ZECA 1DLEA 1YYY1 1GBCA 1M9UA 5FPYA 1TE0A 2WPKS 2VH6A 1GBDA 1C5SA 3FVFB 2TRMA 3LH3A 5C2ZA 3D65E 1FY3A 5JBCS 4JZEH 4K2YA 3UR6A 1MTNB 3C27B 2G8TA 1XUJA 3LONA 1HAYB 4CREA 4X2XA 3A85A 1O2MA 1O2VA 4AB9A 2ZFRH 1Y3WA 2BLVA 5EGMA 1V2NT 3MNCA 3UY9A 2BDIA 4JYVH 2QN5T 1O2JA 1ZOMA 1THSH 1NRRH 3HGPA 3MFJA 1TBZH 1BUIA 4Y0YE 1HPGA 3IG6B 4WVPE 1RTFB 1Y5AT 1GI3A 4ZROA 2BTCE 3KGPA 4BAOB 2WV5A 3NCLA 2OLGA 1P9SA 1BZXE 4TY6A 5CHAB 4OS4A 3QX5H 4B2AA 2XTTB 1B5GH 2CF9H 1QRXA 4DIHH 1E36B 1O2HA 3RXOA 3QZRA 2GP9B 4UFDH 4JZFH 1GBBA 3RLYH 1P12E 3TITA 2QXJA 3RXGA 1P3CA 4I8HA 4X2YA 2GV6A 2JH5D 1FONA 1F5LA 3TH4H 3PTBA 1VITG 3E90B 3ENSB 1ORFA 2V3HH 2OD3B 3LGTA 4CHAB 1N6YA 2ZDLA 4I33A 1DLKB 1Z6JH 2HPPH 2R9PA 3EYDA 2GZ9A 5DK1A 3FZZA 2Y7ZA 3UWIA 2UUYA 4AYYB 2FX4A 1BMMH 2QC2A 1MD8A 2GT7A 1LPGB 4MG3A 1GGDC 2PSXA 1GBAA 2FTLE 3KNXA 1AB9B 1BDAA 2ZQ2A 2JH6D 2J4IA 4ISHH 1L2EA 3ITIA 2AGGX 3LPRA 8KME2 5PTPA 1AE5A 1UVUH 3ZV8A 4JZ1A 3MU5A 2FOCA 2O8LA 4H4FA 4IW4E 1DWCH 3E6PH 1IQIA 3ZZ3A 3T27A 2A7JA 1CT4E 4DT7B 1L1NA 1J8AA 2ZFQH 1Z8GA 1BRUP 4R8TB 1GHZA 3DHKH 2FYQA 4WXVA 3SJKA 1T32A 4UFFH 2D8WA 5GIBA 2BX3A 4Y76A 1DVAH 4B76A 1O5CB 1BJVA 1HNEE 3LOXA 2B9LA 4GHTA 2SNVA 4NFFA 1QURH 1EUFA 2V35A 2XNIA 1AKSB 2G4UA 3PLBA 7GCHG 3KL6A 4HGCA 1K9OE 1Y3VA 3DA9B 1MAYA 1MD7A 1XUFA 1AVGH 4TWYA 4I8LA 2OQ5A 3EA8A 2RG3A 1ELTA 5L6NH 2OCVB 2ZC9H 3GY3A 4YESB 1FJSA 4CRFA 3MNSA 1SI5H 5FCRA 3ELAH 3KN2A 2TGAA 1SGNE 3U69H 2A5KA 1HLTH 4BANB 3CS0A 3V13A 2BDYA 2ODPA 3VGCB 1DUEA 1OKXA 1C2DA 2O8UA 4ISLA 1V2PT 4CBNA 1UK2A 4NWKA 2TIOA 3PMHB 4J2YB 3RXTA 1QB1A 9ESTA 1OWKA 1C1RA 1PPHE 1C2GA 5DP3A 5T6FA 1ETTH 1W8BH 4A6LA 1FAKH 1TABE 2XCNA 3QDZB 2ZTYA 1D3PB 3PWCA 5EW2H 5A8XA 2LPRA 3K65B 2QGRA 3TJOA 2Y6TA 3UOPA 3A81A 6CHAC 4KTSA 3SU1A 1AFQB 2Z9JA 1GCTC 1TBRH 3TGJE 1NRSH 5FHTA 8GCHF 1C4V2 1LKBA 5JPMH 2WPHS 1NRPH 1O2WA 3RM2H 2BOKA 6LPRA 2ZPRA 4K8YA 2BZ6H 1TLDA 2XW9A 2SGEE 3E8LA 3GICB 1TOMH 2PKAB 1A0LA 1TPSA 2JH0D 1W12U 3RXRA 1HRTH 1BRCE 1NS3A 4KTUA 4X6NA 2EEKA 2ZO3H 3AASA 1FQ3A 3K6YA 3ZVGA 2VWOA 4CRGA 2FLBH 3M5MA 1SGDE 2VWLA 1ELGA 4CR5A 1QQ4A 1HXEH 1GHXH 1B0EA 1NO9H 1MTNC 2ZGXH 1Q31A 4YO9A 2HRVA 2W26A 3A7WA 1EASA 1C1TA