5ABWA

Neutrophil elastase inhibitors for the treatment of (cardio)pulmonary diseases
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
218
structure length
215
Chain Sequence
b'IVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUTROPHIL ELASTASE
publication title Neutrophil elastase inhibitors for the treatment of (cardio)pulmonary diseases: Into clinical testing with pre-adaptive pharmacophores.
pubmed doi rcsb
molecule tags Hydrolase
total genus 42
structure length 215
sequence length 218
ec nomenclature ec 3.4.21.37: Leukocyte elastase.
pdb deposition date 2015-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5abwA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5abwA02
1V2MT 4B73A 4K2YA 1FY5A 2GCHG 3VPKA 3EAJA 2XRCA 1D3QB 1P3EA 4MPWA 4IBLH 1NO9H 1MU6B 1H9HE 1IAUA 2EEKA 4E7NA 2VVUA 1C5NH 2TGTA 1WV7H 1O2OA 3B23B 5T6GA 4K5ZA 1TALA 2ZQ2A 1C5TA 1SGNE 3PLPA 3A85A 1IHTH 1B5GH 3KN2A 1BTYA 1Z8JB 1UO6A 3LIWA 2WPJS 1YPLH 2CF9H 5FPSA 1GMHG 1TNIA 2CN0H 3K2UA 1V2WT 1LQDB 1O36A 2BVSH 3IG6B 3KQBA 2A1DB 4FUDA 4X8VH 4Y71A 1C5VA 1ELBA 3QGNB 4AG1A 1PJPA 1FY1A 1FUJA 4I8LA 4NIXA 4JZIA 4AYYB 2ZNKH 4IC6A 1QJ6B 1C1QA 2H9TH 2ILNA 4ZH8A 3SQEE 1TRNA 3RLYH 1C5LH 1C1TA 2Y6TA 4ZHMU 2WUCA 4OGYA 1UTQA 3F9FA 1QQ4A 3G01A 2XC4A 4E7RG 3F9GA 1O2RA 1C2DA 3GCTF 3VXEH 3TK6A 2I6SA 3JZ1B 1YCPM 2XWAA 3M36A 1H8IH 5GCHF 3SNDA 1NRQH 1IQGA 5FPTA 1UCYH 4CBNA 4CH8B 1AVGH 1GHWH 2CXVA 3ZYDA 1Y3UA 1ZRKA 4WXIA 3BTHE 3H7OA 1MBQA 1O3NA 1ZTJA 1ANCA 1GPZA 5GIBA 3P6ZB 1SGDE 1WAYB 1GHAG 2ZTXA 4DT7B 1O5DH 1DITH 1QB9A 2P16A 5L6NH 2D1JA 2J9NA 2QV1A 3ITIA 2ZTZA 1KXFA 1S83A 3ZVDA 1WOFA 1HAVA 1ZLRA 4ISLA 2TGDA 4TPYA 2BVXH 1JIMA 1RIWC 3E0PB 5EXLA 4GHTA 2OCVB 2C3SA 1VCQA 3M61U 4Q7ZA 1IQMA 3AAUA 1LKAA 4WY3A 3A82A 1ZR0A 4XE4A 3LDXH 1PQ8A 2YOLA 2OC8A 5T3HA 1ANEA 3A89A 1FI8A 1C5SA 2BDGA 4FUBA 5JPMH 1WTHD 3M3VA 4IC5A 4UE7H 1OYQA 1UTKA 3R0FA 2ZDKA 4YLUA 3DT0H 3S9BA 1E35B 1GHVH 1EASA 1C5ZB 1RTFB 1MU8B 1MTWA 1KLIH 1O5GH 1TX6A 4YESB 2ZZUH 1NZQH 3BEIB 2Z6BD 1BDAA 4LZ1H 1GJBB 1HAHH 4WH6A 3VB6A 1F2SE 1GL1A 2GP9B 3MU0A 1G36A 4DGJA 1N6YA 1ZMJA 5GPIB 1HAPH 1T32A 2FOBA 2KAIA 3PMHB 4D76A 2AEIH 5A8ZA 4O3TA 2WINI 1AVXA 5FHTA 1BA8B 1V2OT 1V2JT 4DY7B 7GCHG 5FBEA 2GZ8A 1LHDH 3FP7E 4FUIA 1O2LA 2ZC9H 1DOJA 1DWEH 1YLDA 2Z9JA 4NGAH 5DP7A 1K1PA 1GVZA 2B8OH 1GGDC 2PTCE 4B2CA 3U69H 3KF2A 4U01A 4DIHH 1HIAA 1O5FH 3SJKA 1HJ9A 1A5IA 5TJXA 1FPHH 2BY7X 1P2QA 1BMAA 2ULLA 3KHVA 4KTUA 2A45B 1CBWC 3TJUA 3MNXA 2GCTC 3PWCA 1YPHE 1LPKB 4A92A 3V3MA 1GBHA 1NFWA 2BX3A 1GDQA 1O2ZA 1SHYA 1ELAA 1NY22 1BTWA 3BTTE 3RUOA 1NRNH 4X6PA 1AY6H 3E8LA 1KTTB 5F03A 3SV9A 1V2TT 2PKSB 2SGQE 1Q2WA 1EOJA 1HXEH 3RU4D 1FLEE 4D7FA 1YCPK 5J4QA 1XKBC 1YPGH 1RIWB 1QA0A 1O35A 4IN1A 2OC7A 5C20A 1WYKA 1UCYE 4Y10E 4MNXA 1O39A 2V3OH 8KME2 1BMLA 1KSNA 5EPNA 2BHGA 1Y5BT 2G51A 3OYPA 1VITG 4OS7A 2QN5T 2XCNA 4H4FA 1RJXB 4ZHLU 1D3TB 1P01A 2BOHB 4IGDA 4Y79A 1V2UT 5DP5A 2CMYA 1F5LA 3DFLA 1P8VC 2VIQA 1OX1A 3LC3A 5DP3A 1HPGA 2K1QA 3V13A 4X6OA 1NTPA 3A83A 3EDXB 3LH1A 1J9CH 2ZHDA 1MZAA 4KELA 1BHXB 3RXUA 1W13U 3PB1E 5DP4A 1ELCA 2FIRH 2Q6GA 1HCGA 3GY4A 1TRMA 2OP9A 2ZEBA 3SI3H 1G3CA 2C4FH 1FN6A 1HNEE 1YM0A 2JH6D 3NUMA 4OS1A 2GDDA 3TNTA 5FXLA 4Q7YA 3CENA 1UJ1A 1BRUP 1F0RA 1O38A 4GUXA 1VITH 9ESTA 1NM6A 3M5NA 1S0QA 1GJ9B 1OXGA 2NU0E 1C2LA 1ESAA 1BJVA 1GGDB 2Y5FA 1QNJA 3RXIA 5JBCS 1F0SA 1YPMH 2DUCA 1UTJA 1LTOA 1VCWA 3SU5A 2ZGBH 1JIRA 8GCHF 3RC6A 5EG4A 1AKSB 3ELAH 2ODPA 3M5LA 3GYMA 1CBWB 5C5NA 3SV8A 4B1TA 2GCTB 5HM9A 4CR9A 1JBUH 2C8WB 3F9HA 1DWBH 1O2SA 1TBZH 1GBEA 4WJG2 1KXCA 2O8UA 2P3TB 3A86A 2FZZA 4ABHA 3SGAE 2FX4A 1XUJA 2QIQA 5J4SA 1ZTLA 1L2EA 2ZDVH 1QURH 4FUCA 1O3JA 1A0LA 2ANMH 3SW2B 2H1UA 1ABIH 1EPTC 2HRVA 3NK8A 4U2WA 2GCHF 2XC5A 2BB4A 1S6HA 2R3YA 1P11E 1G3DA 4IN2A 1SI5H 4UD9H 1P2KA 4ZAEA 1TOMH 1P10A 4B75A 1EX3A 1TGSZ 3FVFB 4DCDA 1PYTC 1XVOA 3TH3H 3U1IB 2FXRA 1O0DH 1AWHB 2G4TA 1JRSA 2VIVA 3GY5A 5TCAA 1A1RA 3RXTA 3RMMH 2PKAA 2PLXA 3BEFB 2ZFQH 1KTSB 2TGPZ 2WV5A 3H5CB 2CHAB 3ZZ7A 1F0UA 4INKA 2GT7A 5HXFA 3W95A 1A2CH 3MU8A 1Y5UT 1W0ZU 2Y7XA 2B9LA 4BAHB 1GBJA 3C1KA 3RMOH 1BBRH 2W5EA 1A5GH 3FAOA 4I8JA 1ARCA 4CH2B 4JZFH 1IHSH 1MUEB 3STIA 2JH5D 1B0EA 5JBAS 1E37B 3ZV9A 1A4WH 4BTIB 2CJIA 1NN6A 2VWNA 1S84A 3KQDA 2AIPA 3EYDA 3L3TA 3U8TH 2GMTC 1BMNH 3PMJA 4FUEA 1FY4A 1EATA 4NA9H 1OOKB 1G3BA 1ZJKA 1O3HA 3ATWA 4TWYA 4X0WU 3GISB 1JOUB 1NRSH 1UVPA 4BAQB 1ZMLA 4MDSA 1O30A 3QDZB 4H42U 1GMDG 4XSKU 2G4UA 3U9AH 1AHTH 2GZ7A 2ODYB 4X1SU 3ESTA 1GL0E 2R0KA 1FY8E 2ZPSA 2FI4E 1F7ZA 2AYWA 1FAKH 1L4DA 5EODA 1O2YA 3LGTA 1KDQA 4YTAA 2ZQ1A 1EUFA 1TNJA 2D8WA 1WQVH 2BYAX 2FOMB 2ANWA 4F4OC 2ODQA 1OWJA 3F1SB 2A5IA 2BX4A 3PO1C 4IW4E 1D6RA 5DP9A 2BD4A 3LJOA 1C2HA 3A7ZA 1NFYA 2ZDNA 5C1UA 2NU4E 4U30A 1UVUH 2ZGJA 3S7KB 1C5YB 5EU8A 1AMHA 1JXPA 2P3FH 1AQ7A 2AS9A 1ZHPA 1LHGH 2TBSA 4ZKOU 1QBOA 2SGAA 2ZU5A 2FMJA 3MNCA 3O8BA 3ZVCA 5C5OA 1D9IA 1DSUA 1EPTB 2F83A 4NWKA 1P02A 4AGJA 2H9HA 1Y3WA 4NIWA 4BTTB 1MTVA 3RXKA 2BDBA 1DX5M 3URDA 1GWAA 4K3JA 5A0CA 4I8KA 2F9UA 3GDVA 4TWWA 1HGTH 1DY9A 4BAKB 3LGIA 1L1GA 3RP2A 1HAOH 1AIXH 3BTME 2UUKB 1SLVB 1NT1A 2RCEA 5A09A 3A7WA 1YBWA 3U1JB 2Y82A 2Y80A 4AG2A 3SU4A 2P95A 1HLTH 3P70B 1G2MA 2UUJB 2VWOA 5HGGA 1MQ5A 3ODFA 3RXLA 3O8RA 4X8UH 1LVYA 1ANBA 1V2VT 2TGAA 1SHHB 4X1QU 2ZHQH 1Z8RA 3GY2A 1PYTD 3DHKH 2BQ7B 1MQ6A 2VH0A 5IYTA 1EZSC 5DJ7A 2XTTB 4CRGA 1GJ7B 1TPOA 1ZOMA 2Q6FA 2J92A 2ZP0H 2HALA 1CE5A 1C1RA 1O33A 1PPEE 1DWCH 1UK3A 1UTPA 3MMGA 1SLXB 4FVDA 4NIYA 2VGCC 5GXPA 1GI8B 1QBNA 2H5DA 1BBRE 3VB4A 3M37A 4AX9H 4A1TA 2SFAA 2WPLS 3ZZCA 1XXDA 4A7IB 2HNTE 1LVBA 1H1BA 4O9VA 1O2UA 1GVLA 2XNIA 2ZPQA 4FU7A 4K69A 1E36B 5CHAC 5FX6A 1O2GH 1FJSA 1C1OA 2RDLA 3ZZBA 1PPBH 2AIQA 3A7VA 1C5RA 2A7HA 3QGJA 1FY3A 1O3KA 4SGBE 2BXTH 1ZSLA 2FOEA 1GBFA 3FZDA 3M7QA 3V7TA 2NU2E 2D26C 3AVZA 1T31A 3A7TA 3ODDA 3KQCA 2RA3A 3TGJE 5DPAA 2AERH 1L1NA 1GBTA 2UUFB 3D65E 1A61H 3MHWU 3PMBB 5DKMA 4X1RU 3TH2H 1GJDB 5EOKA 2ZDLA 1EPTA 1V3XA 3EE0B 2VJ1A 2OBOA 4BANB 2C90B 1TX8A 3QLPH 1BRCE 1SGTA 1G2LA 1D3DB 7LPRA 7KMEH 1P57B 1Z1IA 1GHXH 4WF8A 3NKKA 2KAIB 2ZG0H 5L2YH 1EZXC 2BZAA 2ZWLH 1H9IE 3Q00A 2ZO3H 2HWLB 1DANH 1ANDA 3L33A 1O3DA 3F6UH 5F8TA 1EAWA 3I29A 4TYDA 4ZHAA 3FANA 1C1PA 2A32A 1L1JA 5JB8S 1Q31A 1O2VA 5E0JA 2G00A 1VJ9U 3A7XA 1HJAC 4BXSA 1JMOH 1XM1A 1CHOF 3LJJA 1EKBB 1O2QA 5HYOA 1WQSA 1HIAB 1YCPH 4VGCC 4I7YH 1V2PT 1W10U 1BHXF 1QGFA 2PFEA 3M7TA 4MPXA 2FOAA 1T8LA 4AB9A 1PPCE 3P8FA 1F5KU 1D4PB 2LNCA 2ZHFH 3MNSA 3SU2A 1DSTA 3U98H 4ZKNU 1HXFH 2EI6A 4Y8XA 3ATLA 1SQOA 5E2PA 2VGCB 1LVMA 1GI4A 2WV4A 3GY8A 4CR5A 2FTMA 3PROA 4CRBA 1SGPE 2BDYA 1HAIH 4GCHG 1OSSA 4RKOB 1GBIA 3QK1A 2ZCLP 1MD7A 2FI5E 2RG3A 3T25A 1FIWA 1BUIA 4AZ2B 5ESBA 3BN9A 5CHAB 2HLCA 4K1EA 1K22H 4K1TA 4JK5A 1NU7B 4ZXYH 1ZMNA 3TK5A 1O37A 2EA3A 1HV7A 3OSYA 2G55A 1AZZA 1FDPA 2HNTF 4Y8YA 1OP8A 1ZPZA 1A0HB 5G4BA 1SGRE 3BTDE 5AVDA 1CVWH 1W7GH 3RXVA 4Y0YE 2QF3A 2TPIZ 5A8YA 5E0GA 1TRYA 2BQ6B 2Z9GA 3R3GB 5FBIA 4E06H 1GJ5H 1UTNA 1V2NT 3M7UA 1ZGVA 1LVOA 1SMFE 3TJOA 4XBCA 1SGFA 1DICA 1GHZA 2B0FA 4DG4A 2OUAA 4MVNA 4YT6H 5JB9S 2V6NA 1CGHA 2CF8H 4ISNA 3GDSA 2GGVB 2OBQA 1MTNC 1EJMA 4WMEA 1TAWA 3LU9B 3BF6H 3W94A 4ZMAH 2G8TA 1D6WA 1GHBG 2BD9A 4HTCH 4CHAC 1TGNA 2QCYA 1P05A 4X8TH 2F9NA 3PYHA 1Z8IB 1FV9A 1MH0A 3A81A 1GBDA 2XC0A 1QTFA 2GT8A 4NZQA 4Y0ZE 3SNCA 3QTOH 3UR6A 2ZU1A 1DUEA 1TMUH 4B74A 1SG8B 1A3EH 3B9FH 2A4QA 3ZZ3A 1O3LA 3BG4C 1QFKH 2GX4A 1SBWA 1HJAB 1QR3E 1HDTH 5PTPA 3UFAA 4YM9A 2QYIA 1W7XH 1T8OA 4PROA 4D9RA 1IQKA 1J17T 4YOIA 1O2JA 2BDAA 1MKWH 4VGCB 3MTYA 1BMMH 2DE9A 4IMQA 1CQQA 1Y8TA 5E2OA 4X6MA 3UNQA 3GY6A 3T27A 4K60A 1S0RA 4ZKRU 2Z9KA 2A7CA 1TGBA 1NC6A 2UWPA 4A1XA 1G37A 1OWKA 1ZHRA 2XWBI 3SORA 4U32A 4UFFH 2F9VA 2Z3EA 1K1JA 2B7DH 4K8YA 2GVFA 3U8OH 2EI8A 1C9PA 1TMBH 1XKAC 2OXSA 2G5VA 5EQRA 3ZZ8A 2P8OC 2IN2A 4X2YA 1SQTA 3UWJH 3BTFE 1Z7KA 4ISHH 1PPFE 1RRKA 5A0AE 2ZDAH 1YPJH 2XW9A 1KXEA 1UK4A 2AFQB 4BNRA 1QY6A 3AASA 3RXSA 1UHBA 6GCHF 1OP2A 1TNHA 3UQOA 5DG6A 3RMNH 1TGTA 3MO6A 2W3KA 3CS7A 1TPAE 1EJAA 4YOJA 3LONA 1P04A 1DPOA 1X7AC 1C9TA 4K1SA 3A87A 1J15A 2PKAB 3OY6U 1BTZA 1Z1JA 3TITA 2ALPA 1BRAA 5AF9H 2VWLA 2WPHS 5DGJA 2BY6X 3A8AA 3E0NB 1UCYK 1C1NA 3IITA 1FQ3A 2OQ5A 4ABGA 1SB1H 3ZVGA 4Y7AA 3SJ9A 2NU1E 3PM3A 5A8XA 2BM2A 3RC4A 3T28A 3HPTB 2VIDA 2R9PA 1ELTA 3T29A 2B5TB 3LT3A 1ZPBA 2VH6A 4CRDA 2YNAA 4CHAB 3F9EA 6ESTA 1H8DH 2P3UB 3RU4T 1EOLA 3UNSA 1ELEE 2JH0D 1QHRB 2GV7A 5ETXA 2OINA 1TABE 2FOFA 4Y7BA 4RSPA 1GI7B 5LPRA 2J38A 4X6NA 1MCTA 1C5PA 3BG4B 1GCTC 3SJIA 1O3FA 1K1LA 2R0LA 2Q1JA 5EXNA 5EPYA 1KDQB 5C1YA 1YP9A 1EB2A 3D62A 2ZECA 2AGIX 1T4VH 1S85A 1B0FA 1YGCH 3DFJA 1C1UH 2WPIS 4YZUA 2XBVA 4NFFA 2W7UA 1P2IA 1ZHMA 3GDUA 4FXGH 3MO9A 3OU0A 5C67A 2H9EH 1V6DA 1TBQH 2UWOA 4NWLA 4NG9H 1O3AA 3GCTG 5C1XA 2ZFPH 2G5NA 1P3CA 1EP5A 3GYLB 2J34A 5EW2H 4WH8A 2EC9H 1AN1E 4HI3A 5EQQA 2FOHA 5DK1A 5GCHG 5CMXH 2F3CE 5T6DA 3ZZ4A 1MKXH 1JRTA 2BDHA 1BRBE 1K9OE 1OWHA 4BXWA 1KLJH 2AMPA 4AFQA 4I8HA 2QXGA 1OWEA 2OC1A 1ESTA 7ESTE 3SHAH 1SLWB 4TY6A 4X1NU 4DVAU 1OWIA 2Y7ZA 2FESH 1XMNB 3RXEA 4XBBA 2ZIQH 3S9CA 2BD3A 1K28D 2PUQH 4OGXA 4H6SB 1FZZA 2RA0A 2ZGHA 1C2JA 5AFYH 3S0NA 1ELGA 3BTEE 3P8GA 3OY5U 4ISOA 3QX5H 4B76A 3BG8A 1BITA 1VCPA 3P17H 1YPKH 2Q6DA 3KIDU 1EP6A 5FCRA 3MU1A 1NS3A 1GMHF 4WXVA 3ZVEA 1QRWA 3SGQE 2PW8H 3UUZA 3ZZ5A 3UQVA 1GBMA 4LZ4B 1O3OA 5L2ZH 1G32B 1ID5H 2TRMA 3TNSA 3RXMA 2A5AA 3PV4A 2FYQA 1O5EH 1VJAU 1P0SH 1ZZZA 1C2GA 1YF4A 4NFEA 2ZCKP 1CGJE 2XBWA 1C5OH 1NRRH 2G81E 4LK4A 3M3TA 3QTVH 4Y6DA 4B71A 4DOQA 2HVXA 1DE7H 2Z3DA 2OLGA 1SR5C 5BPEA 4AFUA 1TX7A 2ANYA 1FAXA 3TK9A 3SOSA 1ZTKA 3A80A 1INCA 3P8NA 1RXPA 4HZHA 4IMZA 1P2JA 4A6LA 2FDAA 3OX7U 2ZI2H 2J4IA 3A7YA 4JYVH 3MO3A 4JZEH 5CE1A 4NSYA 3SN8A 1BQYA 3DUXH 3SNBA 3RU4E 1GHAF 5F6MA 1YPHC 2HOBA 4GCHF 1A7SA 4ABEA 4O03A 1Y5AT 3MH7A 3SGBE 4I33A 1UVSH 4AOQA 3UOUA 3SUDA 1ZPCA 1UVOA 3BIVH 2CGAA 3SUGA 2IJOB 1QCPA 4ABIA 3RXBA 1Y3XA 3RXDA 1HJ8A 3QWCH 3RC5A 4ABJA 2ZF0H 3TGKE 1O2MA 4MLFB 1TNGA 4ZUHA 1IQLA 1C4V2 3UPEA 4Z6AH 2WPMS 3E91A 2M5TA 1ETRH 4XBDA 1EAIA 3BV9B 2BLWA 5FAHA 4RKJB 2THFB 1QL7A 1CO7E 4Y8ZA 1NESE 2A4OA 2BMGB 5HM2A 1SOTA 3V0XA 4AYVB 2ZHWH 5E0HA 9LPRA 1GDUA 3Q3YA 1P2NA 1A3BH 2VIOA 3NZIA 1FXYA 1SOZA 3BTWE 4CRCA 3FZZA 4HGCA 2ZPRA 1G3EA 1OYTH 3E90B 1NRPH 1WCZA 4FU8A 3VB5A 2P59A 4JYUH 2WYJA 1GHBF 2A31A 1ACBE 1GHYH 3Q77A 1O34A 8LPRA 1YC0A 2QAAA 1GI5A 3MYWA 1N1LA 7GCHF 3GCHC 3K6ZA 4NSVA 3KL6A 1O3BA 1O3IA 1CHGA 1W3CA 1Z6JH 2XBXA 4UEHH 3LGWA 2VVVA 3SUEA 2WYGA 1MBMA 3PLKA 4XOJA 1LCYA 2GMTB 1W8BH 3KGPA 1T4UH 1C4Y2 2ZFSA 1N6XA 4TPIZ 2VNTA 3QO6A 3K6YA 2Z7FE 3D23A 1KY9A 1C2IA 2TIOA 3MU4A 4XFQA 3D49H 5HMAA 1EZQA 4NA8A 1BZXE 1A46H 1HUTH 4WVPE 2OTVA 4QT8C 3SHCH 3TIUA 4WMFA 1TWXB 4X2VA 2OQUA 2F9OA 4MNVA 4ZXXH 3BTGE 1TB6H 3SBKA 2BDIA 1YKTA 3A8CA 1AFEH 1J16A 5T6FA 4MPUA 4OS5A 3FP8E 5FPYA 1QB6A 2BD2A 3PO1B 2Z9IA 4INHA 3MH4A 3VB3A 2PTNA 2ZU3A 2ANKH 3SNEA 1PPGE 1VR1H 1ARBA 8GCHG 1BBRK 1C1MA 1PPHE 1TBRH 3PMAB 4J1YA 2ZU4A 5C3NA 2XCFA 3UR9A 1BCUH 3EA9A 1S82A 1O3CA 3EQ0H 2D2DA 3ATKA 3SV6A 2QXJA 2V35A 1L0ZA 4ISIH 3VGCC 1MTSA 3ZZDA 3A8BA 3M3SA 5AFZH 5BRRE 3KQEA 1VITF 4ABAA 1L4ZA 1TYNA 2ASUB 1UTMA 4IS5A 4O3UA 4BOHA 3AAVA 4I8GA 3MOCA 4TY7A 2FS9A 5B6OA 1BTXA 2ESTE 1GG6C 2AMQA 2XXLA 4D7GA 2BZ6H 1AFQC 1NFXA 3ATIA 1EZUC 1C2EA 3GICB 1P9UA 1BT7A 1LHCH 2ZTYA 2Y5HA 1IQNA 1K1IA 2H5CA 1C5XB 2A0QB 3E16B 5SGAE 1O5BB 1DXPA 1F92A 3I77A 3RDZA 4UFEH 1S6FA 4I32A 3BTQE 2H2ZA 4JZDH 2QY0B 2FPZA 1AUTC 1ESBA 4BTUB 2AGGX 1BJUA 1FIZA 2PSXA 1SGFG 3GCHB 2H6MA 1IOEA 1MTUA 2ALVA 3Q3XA 4R0IA 2OC0A 2VVCA 1TGCA 1C1WH 3AW1A 1AE8H 1EJNA 1H4WA 2FWWA 1TPSA 5F8ZA 4MNYA 1C2MA 3RXPA 4BAMB 1IQFA 1O3MA 2WUBA 1C2FA 1TA2A 1TA6A 2V3HH 3KCGH 2R3UA 3MH5A 2PR3A 4Z0KA 3UNRA 3RLWH 3UY9A 2O8MA 2IOTA 5E8EH 3QUMP 4Q2KA 2PGBB 4MTBA 1LO6A 4THNH 4A1VA 2R2MB 2LPRA 3URCA 3NPSA 1A0JA 5EGMA 3CP7A 3O8CA 1E38B 5JBBS 1QBVH 1O5AB 1SC8U 3HKJB 5FCKA 1PQ5A 1O31A 1GI0A 1C1SA 2NU3E 4I31A 3ZV8A 1O2XA 1DFPA 1FPCH 2PGQB 2FO9A 1UHBB 2BVRH 2BXUH 2ZA5A 4CRFA 4B2AA 3UWIA 1ORFA 1RS0A 1YPEH 1SLUB 2BLOA 2GV6A 2PKSC 4K8BA 1P06A 2QXIA 2I6QA 2VIWA 3P92A 1UTLM 3VGCB 1QL9A 2O8TA 4AB8A 1QQUA 2J94A 2VIPA 2P93A 1GBKA 3NXPA 1SL3A 3MWIU 1RD3B 4AGKA 1LDTT 4B2BA 1IQHA 4FUGA 1EQ9A 4Q80A 3F68H 1OKXA 1XUIA 4J2YB 1V2ST 2AGEX 3SU6A 2BLQA 1GG6B 1WBGB 3BTKE 1AFQB 4NCYA 3PTBA 5I46H 4DIIH 1MAYA 2W26A 1DDJA 2VB0A 1K1OA 2QC2A 1LHEH 2FYRA 1LMWB 1KLTA 1TLDA 1ZGIA 1O2TA 3S7HB 1HAZB 2BD5A 3S9AA 1C4U2 2GD4B 2A5KA 2QA9E 1O3EA 2ZHEH 1FMGA 2QF0A 1LPZB 2Z9LA 3HGNA 1RGQA 4JZ1A 1GVKB 3GY3A 2O8LA 3RXRA 5LH8A 1TE0A 1GMDF 1MZDA 3P95A 3MNBA 1UK2A 3GOVB 1HRTH 1XUGA 1Y3VA 2GTBA 1AI8H 1DLEA 4AN7A 3HATH 5JYIA 1SGIB 1O2WA 1E34B 1Z71A 3MI4A 3IWMA 2GDEH 2Z94A 4YT7H 5C2ZA 1XVMA 1TNLA 4HFPB 5H4IB 3RXJA 3SV7A 2HNTC 4FUFA 3Q3KA 1ELFA 2SGPE 1GDNA 1N8OC 1SQAA 3WY8A 1B7XB 1GMCG 2FI3E 2J2UA 1TQ7B 2BQWB 1W12U 4M7GA 3S69A 3SU1A 1KXAA 3LKWA 3A88A 3K65B 3LGYA 1HAYB 2BY9X 3HGPA 1THRH 5EQSA 1YLCA 2C8XB 2QXHA 4RN6A 3SJ8A 3L6PA 3ENSB 4ZKSU 3ZZ9A 2F9BH 1GBBA 3VFEA 4ESTE 2W7SA 1KXDA 3ZZAA 1HYLA 1CA0C 1TMTH 4CREA 1V2LT 5TCCA 3QZRA 4ASHA 2O9QA 1OPHB 1YYY1 3T62A 1AD8H 1THSH 4INLA 1AUJA 4UONA 2VWMA 1LKBA 2A2XH 2PUXB 3KEEA 1EAXA 3SI4H 1A5HA 3O8DA 1Z6EA 1CU1A 2C8ZB 1SFQB 3SUFA 2ZFFH 1BIOA 2ZFRH 1K2I1 2R2WU 3MFJA 3LGVA 1ETSH 1AB9C 1TIOA 1E0FD 1CA8B 1IQIA 1MTNB 2FEQH 2A7JA 3SJOA 1RTKA 1T8NA 2W3IA 5L30H 2CHAC 2PSYA 3A84A 3STJA 2HGTH 4Y76A 1J8AA 1AE5A 4NA7A 1WSSH 3HK6B 4FVBA 2STBE 4MNWA 4OS4A 1DS2E 3UIRA 4NZLA 5I25A 1MMJN 1O2IA 1DUAA 1OP0A 4KTCA 1RFNA 2VINA 3ZVFA 2AMDA 1GJCB 2ZCHP 1WTGH 1ZRBA 1P09A 1K1NA 3MH6A 5AHGH 1T8MA 3ZYEA 5LGOA 1O2NA 2BTCE 3TVJB 3TJVA 4NIVA 1F5RA 2FLRH 3FP6E 4ABDA 1DT2A 2ZKSA 3Q76A 1CHOG 4UFDH 4DW2U 1XXFA 1DLKB 3LOXA 1CT2E 5K7RA 1GBAA 4JK6A 1JWTA 3TU7H 3SU0A 1EAUA 1AGJA 5FX5A 3ZVAA 1CSOE 1N8OB 2PV9B 4KP0A 1TONA 1XUKA 1GJAB 1NFUA 2P8OB 2J95A 3RXAA 3SU3A 4YO9A 2UUYA 1C5MD 1ZSJA 1UVTH 1P2MA 2A4GA 2ZU2A 4E05H 2NWNA 1LQEA 1SPJA 4KKDA 4DURA 2XBYA 4KGAA 6CHAC 1ZYOA 1C2KA 1RTLA 3E1XB 4ZROA 1GI9B 6LPRA 3DD2H 3EGKH 1HAXB 1CA0B 4GHQA 3RXOA 1BTHH 2ZGCA 2EI7A 1VZQH 3LH3A 4WMDA 1QA7A 2A2QH 3H7TA 5F8XA 1GBLA 1GJ8B 1AVWA 3MU5A 2AH4X 3RM2H 1S5SA 2BDCA 4X1PU 1MKWK 2FOGA 2WPKS 3T5FH 5JBTA 1TPPA 1VGCC 3QZQA 1D3PB 5LPEA 1TQ0B 2FTLE 3SV2H 1V2RT 1QRZA 1OS8A 1W0YH 1DM4B 4CRAA 1TOCB 5EW1H 1OWDA 3FFGA 3RXQA 1P03A 4XDEA 2G52A 2V0BA 2SGDE 2STAE 3RXCA 1AB9B 5GDSH 2SGEE 1EB1H 1C5UA 1XX9A 8ESTE 3B8JA 1P9SA 1KYNA 1SFIA 2ZGXH 3I78A 3PLBA 1IQEA 1Z8GA 1MD8A 4DJZB 4ABBA 3NWUA 4YOGA 1W2KH 2IPHA 2PWXA 2VU8E 1SVPA 4FUHA 4UDWH 1GI6A 1CT4E 1THPB 1AWFH 4LOYH 4O97A 3U8RH 5K0HA 1U6QA 4Y11E 5A0BA 1HFDA 5GJ4B 1W11U 4GSOA 2JKHA 3A8DA 3LPRA 1GCTB 1KIGH 2BY5X 1Y59T 3M5OA 1QJ7B 1Y3YA 2BLVA 2HPQH 4CBOA 1GBCA 1SSXA 2O8WA 3QN7A 2Z3CA 3K9XB 1HB0B 2FX6A 4AFZA 4JMYA 3LC5A 3ZZ6A 1KXBA 5EXMA 4SGAE 1TNKA 1AU8A 2F91A 1FONA 1HAGE 1K21H 3TJNA 3BEUA 5LPFA 1DY8A 1QRXA 4Q7XA 4YLQH 4A5TS 2DE8A 5DO4H 2BD7A 3SZNA 5JDUB 4GAWA 1GJ4H 1LHFH 5DP8A 2GZ9A 2OD3B 3SQHE 1UMAH 4FUJA 3V12A 3TLOA 1SGQE 1FNIA 1QB1A 3GCNA 3ZVBA 4AORA 1K1MA 3TH4H 3M35A 1AKSA 1CT0E 1C5QA 1ZJDA 3P8OA 3VEQB 5A2MH 3UREA 5ESTE 1G9IE 1O3PB 6CHAB 1BB0B 3RXGA 1V2KT 2JETC 4X2WA 3VXFH 3GCOA 2PHBA 1EXFA 3ATMA 2C8YB 1WU1A 1T7CA 4MG3A 4D9QA 3VB7A 2GKVE 6GCHG 3C27B 4MPVA 3RXFA 1M9UA 4AFSA 2BD8A 4KTSA 1O32A 1AO5A 1SGEE 3SO3A 2CV3A 3RM0H 1VGCB 1GI1A 2ZFTA 1XUHA 2ZDMA 3OTJE 1DXWA 1O2KA 1SGCA 2F9PA 3PWBA 2FLBH 1UTOA 4F49A 3PTNA 3E6PH 1P2OA 1ZSKA 2C93B 1BTPA 4JCNA 1HBTH 1NU9A 1V2QT 2P94A 4OS2A 1MKXK 3T2NA 1G30B 1QIXB 3EA8A 2BY8X 1BTUA 3KNXA 1ABJH 3JZ2B 4H6TA 4JYTA 4GLYA 1H9LB 3LGUA 3RXHA 3TGIE 1C5WB 1O5CB 3TPIZ 2FOCA 1GJ6A 1NROH 1IQJA 1WUNH 2SNVA 2FP7B 1S81A 1GI2A 2SNWA 4OS6A 1CGIE 3HK3B 1J14A 3AW0A 4X8SH 1ELVA 1O2HA 5ABWA 4R8TB 1AZ8A 1NPMA 1DVAH 1BOQA 3SNAA 2A4RA 1MAXA 2YNBA 2UWLA 3E3TA 1GMCF 1QL8A 3EA7A 5IDKA 4ABFA 1PQ7A 4GVUA 1GCDA 1PFXC 2Y81A 1TFXA 3CS0A 1ELDE 3M5MA 3BSQA 3UTUH 3DA9B 1ETTH 1O2PA 4GPGA 1SGYE 4UFGH 1XUFA 4D8NA 3N7OA 4WWYA 1FN8A 1DWDH 1O3GA 2FM2A 4MQAA 3UOPA 1P12E 1HAVB 4BAOB 2BOKA 1PQAA 1C1VH 1Q3XA 3RMLH 2XYAA 2Y5GA 3NCLA 1LPGB 1F0TA 4LXBH 4X2XA 1GI3A 2FODA 3HKIB 3GY7A 2HPPH 3BIUH 2SGFE 5DP6A 2QGRA 2FS8A 4FU9A 5GWZA 2JETB 1PPZA 3T26A 1MCVA 1QJ1B 1W14U
chains in the Genus database with same CATH superfamily
1V2MT 4B73A 2KM0A 4K2YA 1FY5A 2GCHG 3VPKA 3EAJA 2XRCA 1D3QB 1P3EA 4MPWA 4IBLH 1NO9H 1MU6B 1H9HE 1IAUA 2EEKA 4E7NA 2VVUA 1C5NH 2TGTA 1WV7H 1O2OA 3B23B 5T6GA 4K5ZA 1TALA 2ZQ2A 3FKSD 1C5TA 1SGNE 3PLPA 3A85A 1IHTH 4RT1A 1B5GH 3KN2A 1K0HA 1BTYA 1Z8JB 1UO6A 3LIWA 2WPJS 1YPLH 2CF9H 5FPSA 1GMHG 1TNIA 1E1RD 2CN0H 3K2UA 1V2WT 1LQDB 1O36A 5EJZA 2BVSH 3IG6B 3KQBA 2A1DB 4FUDA 4X8VH 4Y71A 1C5VA 1ELBA 3QGNB 4AG1A 1PJPA 1FY1A 1FUJA 4I8LA 4NIXA 4JZIA 4AYYB 2ZNKH 5HKKD 4IC6A 1QJ6B 1C1QA 2H9TH 2ILNA 4ZH8A 3SQEE 1TRNA 3RLYH 1C5LH 3AK5A 1C1TA 2Y6TA 4ZHMU 2WUCA 4OGYA 2JJ1D 1UTQA 3F9FA 1QQ4A 3G01A 3OEED 2XC4A 4E7RG 3F9GA 1O2RA 3DSOA 1C2DA 1YWUA 3GCTF 4XD7D 3VXEH 1UW7A 3TK6A 2I6SA 3JZ1B 1YCPM 2XWAA 3M36A 1H8IH 5GCHF 3SNDA 2KZ4A 1NRQH 1IQGA 5FPTA 1UCYH 4CBNA 4CH8B 1AVGH 1GHWH 2CXVA 3ZYDA 1FX0B 1Y3UA 3F2HA 1ZRKA 4WXIA 2AHME 3BTHE 3H7OA 1MBQA 1O3NA 1ZTJA 1ANCA 1GPZA 5GIBA 5IK2D 3P6ZB 1SGDE 1WAYB 1GHAG 2ZTXA 4DT7B 1O5DH 1DITH 1QB9A 2P16A 5L6NH 2D1JA 2J9NA 2QV1A 3ITIA 2ZTZA 1KXFA 1S83A 3ZVDA 1WOFA 1HAVA 1ZLRA 4ISLA 2TGDA 4TPYA 2BVXH 1JIMA 1RIWC 3E0PB 5EXLA 4GHTA 2OCVB 2C3SA 1VCQA 3M61U 4Q7ZA 1IQMA 3AAUA 1LKAA 4WY3A 3A82A 1ZR0A 4TT3D 4XE4A 3LDXH 1PQ8A 2YOLA 2OC8A 5T3HA 1ANEA 3A89A 1FI8A 1C5SA 2BDGA 4FUBA 5JPMH 1WTHD 3M3VA 4IC5A 4UE7H 1OYQA 1UTKA 3R0FA 2ZDKA 4YLUA 3DT0H 3S9BA 1E35B 1GHVH 1EASA 1C5ZB 1RTFB 1MU8B 1MTWA 1KLIH 1O5GH 1TX6A 4YESB 2ZZUH 1NZQH 3CNRA 3BEIB 2Z6BD 1BDAA 4LZ1H 1GJBB 1HAHH 4WH6A 3VB6A 1F2SE 1GL1A 2GP9B 3MU0A 1G36A 4DGJA 1N6YA 1ZMJA 5GPIB 1HAPH 1T32A 2FOBA 2KAIA 2V3MA 3PMHB 4D76A 2AEIH 5A8ZA 4O3TA 2WINI 4RI0A 1AVXA 5FHTA 1BA8B 1V2OT 1V2JT 4DY7B 7GCHG 1NBME 5FBEA 2GZ8A 1LHDH 3FP7E 4FUIA 1O2LA 2ZC9H 1DOJA 1DWEH 1YLDA 2Z9JA 4NGAH 5DP7A 1K1PA 1GVZA 4ASUD 2B8OH 1GGDC 2PTCE 4B2CA 3U69H 3KF2A 4U01A 3EE7A 4DIHH 1HIAA 1O5FH 3SJKA 1HJ9A 1A5IA 5TJXA 1FPHH 2BY7X 1P2QA 1BMAA 2ULLA 3KHVA 4KTUA 2A45B 1CBWC 3TJUA 3MNXA 2GCTC 3PWCA 4ACAA 1YPHE 1LPKB 4A92A 3V3MA 1GBHA 1NFWA 2BX3A 1GDQA 1O2ZA 1SHYA 1ELAA 1NY22 1BTWA 3BTTE 3RUOA 1NRNH 4X6PA 1AY6H 3E8LA 2F4LA 1KTTB 5F03A 1YLNA 1V2TT 2PKSB 2SGQE 3SV9A 1Q2WA 1EOJA 1HXEH 3UB0A 3RU4D 1FLEE 4D7FA 2K8IA 1YCPK 5J4QA 1XKBC 4OM9A 1YPGH 1RIWB 5HIZA 1QA0A 1O35A 4IN1A 2OC7A 5C20A 1WYKA 1UCYE 4Y10E 4MNXA 1O39A 2V3OH 8KME2 1BMLA 1KSNA 5EPNA 2BHGA 1Y5BT 2G51A 3OYPA 1VITG 4OS7A 2QN5T 2XCNA 4H4FA 1RJXB 4ZHLU 1D3TB 1P01A 1EFRD 2BOHB 4IGDA 4Y79A 1V2UT 5DP5A 2CMYA 1F5LA 3DFLA 1P8VC 2VIQA 1OX1A 3LC3A 5DP3A 1HPGA 2K1QA 3V13A 4X6OA 1NTPA 3A83A 3EDXB 3LH1A 1J9CH 2ZHDA 2KFWA 1MZAA 4KELA 1BHXB 3RXUA 1W13U 3PB1E 5DP4A 1ELCA 2FIRH 2Q6GA 1HCGA 3GY4A 1TRMA 2OP9A 2ZEBA 3SI3H 1G3CA 2C4FH 1FN6A 1HNEE 2J98B 1YM0A 2JH6D 3NUMA 4OS1A 2GDDA 3TNTA 5FXLA 4Q7YA 3CENA 1UJ1A 1BRUP 1F0RA 1O38A 4GUXA 1VITH 9ESTA 1NM6A 3M5NA 4YXWD 1S0QA 1GJ9B 1OXGA 2NU0E 1C2LA 1ESAA 1BJVA 1GGDB 2Y5FA 1QNJA 3RXIA 5JBCS 1F0SA 1YPMH 2DUCA 1UTJA 1LTOA 3U28C 1VCWA 3SU5A 1H8ED 2ZGBH 5KECA 1JIRA 8GCHF 3RC6A 5EG4A 1AKSB 3ELAH 2ODPA 3M5LA 3GYMA 1CBWB 5C5NA 2WHXA 3SV8A 4B1TA 2GCTB 5HM9A 4CR9A 1JBUH 2WZQA 2C8WB 3F9HA 1DWBH 1O2SA 1TBZH 1GBEA 4WJG2 1KXCA 2O8UA 2P3TB 3A86A 2FZZA 4ABHA 3SGAE 2FX4A 1XUJA 2QIQA 5J4SA 1ZTLA 1L2EA 2W6JD 2ZDVH 1QURH 4FUCA 1O3JA 1A0LA 2ANMH 3SW2B 2H1UA 1ABIH 1EPTC 2HRVA 3NK8A 4U2WA 2GCHF 2XC5A 2BB4A 1S6HA 2R3YA 1P11E 1G3DA 4IN2A 1SI5H 4UD9H 1P2KA 2PP6A 4ZAEA 1TOMH 1P10A 4B6FA 4B75A 1EX3A 1TGSZ 3FVFB 4DCDA 1PYTC 1XVOA 3TH3H 3U1IB 2FXRA 1O0DH 1AWHB 2G4TA 1JRSA 2VIVA 3GY5A 5TCAA 2EY4C 1A1RA 3RXTA 3RMMH 2PKAA 2PLXA 2KCOA 3BEFB 2ZFQH 1KTSB 2TGPZ 2WV5A 3H5CB 2CHAB 3ZZ7A 1F0UA 3OFND 4INKA 2GT7A 5HXFA 3W95A 1A2CH 3MU8A 1Y5UT 1W0ZU 5CHBA 2Y7XA 2B9LA 4BAHB 1GBJA 3C1KA 3RMOH 2IPQX 1BBRH 2W5EA 4FOUC 1A5GH 3FAOA 4I8JA 1ARCA 4CH2B 4JZFH 1IHSH 1MUEB 3STIA 2JH5D 1B0EA 5JBAS 1E37B 3ZV9A 1COWD 5B6LA 1A4WH 4BTIB 2CJIA 1NN6A 2VWNA 1S84A 3KQDA 2AIPA 3EYDA 3L3TA 3U8TH 2GMTC 1BMNH 3PMJA 4FUEA 1FY4A 1EATA 4NA9H 1OOKB 1G3BA 1ZJKA 1O3HA 3ATWA 4TWYA 4X0WU 3GISB 1JOUB 1NRSH 1UVPA 4BAQB 1ZMLA 4MDSA 1O30A 2J5UA 3QDZB 1GMDG 4H42U 4XSKU 2G4UA 3U9AH 1AHTH 2GZ7A 2ODYB 4X1SU 3ESTA 1GL0E 2R0KA 1FY8E 2ZPSA 2FI4E 1F7ZA 2AYWA 1FAKH 1L4DA 3H09A 5EODA 1O2YA 3LGTA 1KDQA 4YTAA 2ZQ1A 1EUFA 1TNJA 2D8WA 1WQVH 1VKYA 2BYAX 2FOMB 2ANWA 4F4OC 2ODQA 2KCYA 1OWJA 3F1SB 2A5IA 2BX4A 3PO1C 4IW4E 1D6RA 5DP9A 2BD4A 3LJOA 2V7QD 1C2HA 3A7ZA 1NFYA 2ZDNA 5C1UA 2NU4E 4U30A 1UVUH 2ZGJA 3S7KB 1C5YB 5EU8A 1AMHA 1JXPA 2P3FH 1AQ7A 2AS9A 1ZHPA 1LHGH 2TBSA 3F0PA 4ZKOU 1QBOA 2SGAA 2ZU5A 2FMJA 3MNCA 3O8BA 3ZVCA 1W0KD 5C5OA 1D9IA 1DSUA 1EPTB 2F83A 4NWKA 1P02A 4AGJA 2H9HA 1Y3WA 4NIWA 4BTTB 1MTVA 2W6ID 3RXKA 2BDBA 1DX5M 3URDA 1GWAA 4K3JA 5A0CA 4I8KA 2F9UA 3GDVA 4TWWA 1HGTH 1DY9A 4BAKB 3LGIA 1L1GA 3RP2A 2L74A 1AIXH 3BTME 1HAOH 2UUKB 3DSPA 1SLVB 1NT1A 2RCEA 5A09A 1E79D 3A7WA 1YBWA 3U1JB 2Y82A 2Y80A 4AG2A 3SU4A 2P95A 1HLTH 3P70B 1G2MA 2UUJB 2VWOA 5HGGA 1MQ5A 3ODFA 3RXLA 3O8RA 4X8UH 1LVYA 3N7EA 1ANBA 1V2VT 2TGAA 1SHHB 4X1QU 2ZHQH 1Z8RA 3GY2A 1PYTD 3DHKH 2BQ7B 1MQ6A 3MQKC 2VH0A 5IYTA 1EZSC 5DJ7A 4ZCNA 4ACBA 2XTTB 4CRGA 4TSFD 1GJ7B 1TPOA 1ZOMA 2Q6FA 2J92A 2K0QA 2ZP0H 2HALA 1CE5A 1C1RA 1O33A 2KCPA 1PPEE 1DWCH 1UK3A 1UTPA 3MMGA 1SLXB 4FVDA 4NIYA 2VGCC 5GXPA 1GI8B 1QBNA 2H5DA 1BBRE 3VB4A 3M37A 4AX9H 4A1TA 2SFAA 2WPLS 3ZZCA 1XXDA 5EIYA 4A7IB 2HNTE 1LVBA 3F2GA 1H1BA 4O9VA 1O2UA 1GVLA 2XNIA 2ZPQA 4FU7A 4K69A 1E36B 5CHAC 5FX6A 1O2GH 1FJSA 1C1OA 2RDLA 3ZZBA 1PPBH 1S6LA 2AIQA 3A7VA 1C5RA 2A7HA 3QGJA 1FY3A 1O3KA 4SGBE 2BXTH 1ZSLA 2FOEA 1GBFA 3FZDA 3M7QA 3V7TA 2NU2E 5GNDA 2D26C 3AVZA 1T31A 3A7TA 3ODDA 3KQCA 2RA3A 3TGJE 5DPAA 2AERH 1L1NA 1GBTA 2UUFB 3D65E 1A61H 3MHWU 3PMBB 5DKMA 4X1RU 3TH2H 1GJDB 5EOKA 2ZDLA 1EPTA 1V3XA 2WSSD 3EE0B 2VJ1A 2OBOA 4BANB 2C90B 1TX8A 3QLPH 1BRCE 1SGTA 1G2LA 1D3DB 3OTPA 7LPRA 7KMEH 1P57B 1Z1IA 1GHXH 4WF8A 3NKKA 2KAIB 2ZG0H 5L2YH 1EZXC 2BZAA 2ZWLH 3SYJA 1H9IE 3Q00A 2ZO3H 2HWLB 1DANH 1ANDA 3L33A 1O3DA 3F6UH 5F8TA 1EAWA 3I29A 4TYDA 4ZHAA 3FANA 1C1PA 2KR7A 2A32A 1L1JA 5JB8S 1Q31A 2RDEA 1O2VA 5E0JA 2G00A 1VJ9U 3A7XA 1HJAC 4BXSA 1JMOH 1XM1A 1CHOF 3LJJA 1EKBB 1O2QA 5HYOA 1WQSA 1HIAB 1YCPH 2F43B 4VGCC 4I7YH 1V2PT 1W10U 1BHXF 1QGFA 2PFEA 3M7TA 4MPXA 2FOAA 1T8LA 4AB9A 1PPCE 3N7DA 1F5KU 1D4PB 2LNCA 3P8FA 2ZHFH 3MNSA 3SU2A 1DSTA 3U98H 3PRBA 4ZKNU 1HXFH 2EI6A 2J97A 4Y8XA 3ATLA 1SQOA 5E2PA 2VGCB 1LVMA 1GI4A 2WV4A 3GY8A 4CR5A 2FTMA 3PROA 4CRBA 1SGPE 2BDYA 1HAIH 4GCHG 1OSSA 4RKOB 3W1EA 1GBIA 3QK1A 2ZCLP 4DT4A 1MD7A 2FI5E 2RG3A 3T25A 1FIWA 1BUIA 4AZ2B 5ESBA 1YY3A 3BN9A 5CHAB 2HLCA 4K1EA 1K22H 4K1TA 4JK5A 1NU7B 4ZXYH 1ZMNA 3TK5A 1O37A 2EA3A 1HV7A 3OSYA 2G55A 1AZZA 1FDPA 2HNTF 4Y8YA 1OP8A 1ZPZA 1A0HB 5G4BA 4RT0A 1SGRE 5HIYA 3BTDE 5AVDA 1CVWH 1W7GH 3RXVA 4Y0YE 2WV9A 2EQNA 2QF3A 2TPIZ 5A8YA 5E0GA 1TRYA 2BQ6B 2M2AA 2Z9GA 3R3GB 5FBIA 1WXRA 4E06H 1GJ5H 1UTNA 1V2NT 3M7UA 1ZGVA 1LVOA 1SMFE 2CK3D 3TJOA 4XBCA 1SGFA 1DICA 1GHZA 2B0FA 4DG4A 2OUAA 4MVNA 4YT6H 5JB9S 2V6NA 1CGHA 2CF8H 4ISNA 3GDSA 2GGVB 2OBQA 1MTNC 1EJMA 4WMEA 1TAWA 3LU9B 3BF6H 3W94A 4ZMAH 2G8TA 1D6WA 3KYGA 1GHBG 2BD9A 4HTCH 4CHAC 1TGNA 2QCYA 1P05A 4X8TH 2F9NA 3PYHA 1Z8IB 1FV9A 1MH0A 3A81A 1GBDA 2XC0A 1QTFA 2GT8A 4NZQA 4Y0ZE 3SNCA 3QTOH 2QF4A 3UR6A 2ZU1A 1DUEA 1TMUH 4B74A 1SG8B 1A3EH 3B9FH 2A4QA 3ZZ3A 1O3LA 3BG4C 1QFKH 2GX4A 1SBWA 1HJAB 1QR3E 1HDTH 5PTPA 3UFAA 4YM9A 2QYIA 1W7XH 3WWFA 1T8OA 4PROA 4D9RA 1IQKA 1J17T 3FOAA 4YOIA 1O2JA 2BDAA 1MKWH 4VGCB 3MTYA 1BMMH 2DE9A 4IMQA 1CQQA 1Y8TA 5E2OA 4X6MA 3UNQA 2HLDD 3OE7D 3GY6A 3T27A 4K60A 1S0RA 4ZKRU 2Z9KA 2A7CA 1TGBA 1NC6A 2UWPA 4A1XA 1G37A 1OWKA 1ZHRA 2XWBI 3SORA 4U32A 4UFFH 2F9VA 2Z3EA 1K1JA 2B7DH 4K8YA 2GVFA 3SZEA 2EI8A 1C9PA 1TMBH 1XKAC 2OXSA 2G5VA 5EQRA 3U8OH 3WWBA 3ZZ8A 2P8OC 2IN2A 4X2YA 1SQTA 3UWJH 3BTFE 1Z7KA 4I86A 4ISHH 1PPFE 1RRKA 5A0AE 1SQRA 2ZDAH 1YPJH 2XW9A 1KXEA 1UK4A 1KMHB 2AFQB 4BNRA 1QY6A 3AASA 3RXSA 1UHBA 6GCHF 1OP2A 1TNHA 3FO8D 3UQOA 5DG6A 3RMNH 1TGTA 3MO6A 1SKYE 4Q63A 2W3KA 3CS7A 1TPAE 1EJAA 4YOJA 3LONA 1P04A 1DPOA 4F48B 1X7AC 1C9TA 4K1SA 3A87A 1J15A 2PKAB 3OY6U 1BTZA 1Z1JA 3TITA 2ALPA 1BRAA 5AF9H 2VWLA 2WPHS 5DGJA 2BY6X 3A8AA 3E0NB 1UCYK 1C1NA 3IITA 1FQ3A 2OQ5A 4ABGA 1SB1H 3ZVGA 4Y7AA 3SJ9A 2NU1E 2QF5A 3PM3A 5A8XA 2BM2A 3RC4A 3T28A 3HPTB 2VIDA 2R9PA 1ELTA 3T29A 2B5TB 2KX4A 1E1QD 3LT3A 1ZPBA 2VH6A 4CRDA 2YNAA 4CHAB 1QZ8A 3F9EA 6ESTA 1H8DH 2P3UB 3RU4T 1EOLA 3UNSA 1ELEE 2JH0D 1QHRB 2GV7A 5ETXA 2OINA 1TABE 3F2FA 2FOFA 4Y7BA 4RSPA 1GI7B 5LPRA 2J38A 4X6NA 5C17A 1MCTA 1C5PA 3BG4B 4FETA 1GCTC 3SJIA 1O3FA 1K1LA 2R0LA 2Q1JA 5EXNA 4P02A 2JJ2D 5EPYA 1KDQB 5C1YA 1YP9A 1EB2A 3D62A 2ZECA 2AGIX 1T4VH 1S85A 1B0FA 1YGCH 3DFJA 1C1UH 2WPIS 4YZUA 2XBVA 4NFFA 2W7UA 1P2IA 1ZHMA 3GDUA 4FXGH 3MO9A 3OU0A 5C67A 2H9EH 1V6DA 1TBQH 2UWOA 4NWLA 4NG9H 1O3AA 3GCTG 5C1XA 2ZFPH 2G5NA 1P3CA 1EP5A 3GYLB 2J34A 5EW2H 4WH8A 2EC9H 1AN1E 4HI3A 5EQQA 2FOHA 5DK1A 5GCHG 5CMXH 2F3CE 5T6DA 3ZZ4A 1MKXH 1JRTA 2BDHA 1BRBE 1K9OE 1OWHA 2YMSC 4BXWA 1KLJH 2AMPA 4AFQA 4I8HA 2QXGA 1OWEA 2OC1A 1ESTA 7ESTE 3SHAH 1SLWB 4TY6A 4X1NU 4DVAU 1OWIA 2Y7ZA 2FESH 1XMNB 3RXEA 4XBBA 2ZIQH 3S9CA 2BD3A 1K28D 2PUQH 4OGXA 4H6SB 1FZZA 2RA0A 2ZGHA 1C2JA 5AFYH 3S0NA 1ELGA 3BTEE 3P8GA 3OY5U 4ISOA 3QX5H 4B76A 3BG8A 1BITA 1VCPA 3P17H 1YPKH 5KEDA 2Q6DA 3KIDU 1EP6A 5FCRA 3MU1A 1NS3A 1GMHF 4WXVA 3ZVEA 1QRWA 3SGQE 2PW8H 3UUZA 3ZZ5A 3UQVA 1GBMA 4LZ4B 1O3OA 5L2ZH 2KCAA 1G32B 1ID5H 2TRMA 3TNSA 3RXMA 2A5AA 3PV4A 2FYQA 1O5EH 1VJAU 1P0SH 1ZZZA 1C2GA 1YF4A 4NFEA 2ZCKP 1CGJE 2XBWA 1C5OH 1NRRH 2G81E 4LK4A 3M3TA 3QTVH 4Y6DA 4B71A 4DOQA 2HVXA 1DE7H 2Z3DA 2OLGA 1SR5C 5BPEA 4AFUA 1TX7A 2ANYA 1FAXA 3TK9A 3SOSA 1ZTKA 2HVYB 3A80A 1INCA 3P8NA 1RXPA 3PRDA 4HZHA 4IMZA 1P2JA 4A6LA 2FDAA 3OX7U 2ZI2H 2J4IA 3A7YA 4JYVH 3MO3A 4JZEH 5CE1A 4NSYA 3SN8A 1BQYA 3DUXH 3SNBA 3RU4E 1GHAF 5F6MA 1YPHC 2HOBA 3FN8A 4GCHF 1A7SA 4ABEA 4O03A 1Y5AT 3MH7A 3SGBE 4I33A 1UVSH 5CDFE 4AOQA 3UOUA 3F3BA 3SUDA 1ZPCA 1UVOA 3BIVH 2CGAA 3SUGA 2IJOB 1QCPA 4ABIA 2QE7D 3RXBA 1Y3XA 3RXDA 1HJ8A 3QWCH 3RC5A 4ABJA 2ZF0H 3TGKE 1O2MA 4MLFB 1TNGA 4ZUHA 1IQLA 1C4V2 3KYFA 3UPEA 4Z6AH 1MABB 2WPMS 3E91A 2M5TA 1ETRH 4XBDA 1EAIA 3BV9B 2BLWA 5FAHA 4RKJB 2THFB 1QL7A 1CO7E 4Y8ZA 1NESE 2A4OA 2BMGB 5HM2A 1SOTA 3V0XA 4AYVB 2ZHWH 5E0HA 9LPRA 1GDUA 2YMSD 1P2NA 1A3BH 2VIOA 3NZIA 3Q3YA 1FXYA 1SOZA 3BTWE 4CRCA 3FZZA 4HGCA 2ZPRA 1G3EA 1OYTH 3E90B 1NRPH 1WCZA 4FU8A 3VB5A 2P59A 4JYUH 3ZIAD 2WYJA 1GHBF 2A31A 1ACBE 1GHYH 3Q77A 1O34A 8LPRA 1YC0A 2QAAA 1GI5A 3MYWA 1N1LA 7GCHF 3GCHC 3K6ZA 4NSVA 3KL6A 1O3BA 1O3IA 1CHGA 1W3CA 1Z6JH 2XBXA 4UEHH 3LGWA 2VVVA 3SUEA 2WYGA 1MBMA 3PLKA 4XOJA 1LCYA 2GMTB 2L6OA 1W8BH 3KGPA 1T4UH 1C4Y2 2ZFSA 1N6XA 4TPIZ 3GS9A 2VNTA 3QO6A 3K6YA 2Z7FE 3D23A 1KY9A 1C2IA 2TIOA 3MU4A 4XFQA 3D49H 5HMAA 1EZQA 4NA8A 1BZXE 1A46H 1HUTH 4WVPE 2OTVA 4QT8C 3SHCH 3TIUA 4WMFA 1TWXB 4X2VA 2WPDD 2OQUA 2F9OA 4MNVA 4ZXXH 3BTGE 1TB6H 3SBKA 4B6EA 2BDIA 1YKTA 1NBMD 3A8CA 1AFEH 1J16A 5T6FA 4MPUA 4OS5A 3FP8E 5FPYA 1QB6A 2BD2A 3PO1B 2Z9IA 4INHA 3MH4A 3VB3A 5C0TA 2PTNA 2ZU3A 2ANKH 3SNEA 1PPGE 5C94A 1VR1H 1ARBA 8GCHG 1BBRK 1C1MA 1PPHE 1TBRH 3PMAB 4J1YA 2ZU4A 5C3NA 2XCFA 3UR9A 1BCUH 3EA9A 1S82A 1O3CA 3EQ0H 2D2DA 3ATKA 3SV6A 2QXJA 2V35A 1L0ZA 4ISIH 3VGCC 1MTSA 3ZZDA 3A8BA 3M3SA 5AFZH 5BRRE 3KQEA 1VITF 4ABAA 1L4ZA 1TYNA 2ASUB 1UTMA 4IS5A 4O3UA 4BOHA 3AAVA 4I8GA 3MOCA 4TY7A 2FS9A 5B6OA 1BTXA 2ESTE 1GG6C 2AMQA 2XXLA 4D7GA 2BZ6H 1AFQC 1NFXA 3ATIA 1EZUC 1C2EA 2RFKC 3GICB 1P9UA 1BT7A 1LHCH 2ZTYA 2Y5HA 1IQNA 1K1IA 2H5CA 1C5XB 2A0QB 3E16B 5SGAE 1O5BB 1DXPA 1F92A 3I77A 3RDZA 4AC9A 4UFEH 4Z1MD 1S6FA 4I32A 3BTQE 2H2ZA 4JZDH 2QY0B 2FPZA 1AUTC 1ESBA 4BTUB 2AGGX 2XNDD 1BJUA 1FIZA 2PSXA 1SGFG 3GCHB 2H6MA 1IOEA 1MTUA 2ALVA 3Q3XA 4R0IA 2LP6A 2OC0A 2VVCA 1TGCA 1C1WH 3AW1A 1AE8H 1EJNA 1H4WA 2FWWA 1TPSA 5F8ZA 4MNYA 1C2MA 3RXPA 4BAMB 1IQFA 1O3MA 2WUBA 1C2FA 1TA2A 1W0JD 1TA6A 2V3HH 3KCGH 2R3UA 3MH5A 2PR3A 4Z0KA 2JDID 3UNRA 3RLWH 3UY9A 2O8MA 2IOTA 5E8EH 3QUMP 4Q2KA 2PGBB 4MTBA 1LO6A 4THNH 4A1VA 2R2MB 2LPRA 3URCA 3NPSA 1A0JA 5EGMA 3CP7A 3O8CA 1E38B 5JBBS 1QBVH 1O5AB 1SC8U 3HKJB 5FCKA 1PQ5A 1O31A 1GI0A 1C1SA 2NU3E 4I31A 3ZV8A 1O2XA 1DFPA 1FPCH 2PGQB 2FO9A 1UHBB 2BVRH 2BXUH 2ZA5A 4CRFA 4B2AA 3UWIA 1ORFA 1RS0A 1YPEH 1SLUB 2BLOA 2GV6A 2PKSC 4K8BA 1P06A 2QXIA 2I6QA 2VIWA 3PV5A 3P92A 1UTLM 3VGCB 1QL9A 2O8TA 4AB8A 1QQUA 2J94A 2VIPA 4HG6A 2P93A 1GBKA 3NXPA 1SL3A 3MWIU 1RD3B 4AGKA 1LDTT 4B2BA 1IQHA 4FUGA 1EQ9A 4Q80A 3F68H 1OKXA 1XUIA 4J2YB 1V2ST 2AGEX 3SU6A 2BLQA 1GG6B 1WBGB 2OK5A 3BTKE 1AFQB 4NCYA 3PTBA 5I46H 4DIIH 1MAYA 2W26A 1DDJA 2VB0A 1K1OA 2QC2A 1LHEH 2FYRA 1LMWB 1KLTA 1TLDA 1ZGIA 1O2TA 3S7HB 1HAZB 2BD5A 3S9AA 1C4U2 2GD4B 2A5KA 2QA9E 1O3EA 2ZHEH 4F55A 1FMGA 2QF0A 1LPZB 2Z9LA 3HGNA 1RGQA 3OEHD 1GVKB 3GY3A 4JZ1A 2O8LA 3RXRA 5LH8A 1TE0A 1GMDF 1MZDA 3P95A 3MNBA 1UK2A 3GOVB 1HRTH 1XUGA 1Y3VA 2GTBA 2JIZD 1AI8H 1DLEA 4AN7A 3HATH 5JYIA 1SGIB 1O2WA 1E34B 1Z71A 3MI4A 3IWMA 2GDEH 2Z94A 4YT7H 5C2ZA 1XVMA 3OAAD 1TNLA 4HFPB 5H4IB 3KQ5A 3RXJA 3SV7A 2HNTC 4FUFA 3Q3KA 1ELFA 2SGPE 1GDNA 1N8OC 1SQAA 1OHHD 3WY8A 1B7XB 1GMCG 2FI3E 2J2UA 2IJD1 1TQ7B 2BQWB 1W12U 4M7GA 3S69A 3SU1A 1KXAA 3LKWA 3A88A 3K65B 3LGYA 1HAYB 2BY9X 3HGPA 1THRH 5EQSA 1YLCA 2C8XB 2QXHA 4RN6A 3SJ8A 3L6PA 3ENSB 4ZKSU 3ZZ9A 2F9BH 2LELA 1GBBA 3VFEA 4ESTE 2W7SA 1KXDA 3ZZAA 1HYLA 1CA0C 1TMTH 4CREA 1V2LT 5TCCA 3QZRA 4ASHA 1WDIA 2O9QA 1OPHB 1YYY1 3T62A 1AD8H 1THSH 4INLA 1AUJA 4UONA 2VWMA 1LKBA 2A2XH 2PUXB 3KEEA 1EAXA 3SI4H 1A5HA 3O8DA 1Z6EA 1CU1A 2C8ZB 1SFQB 5DN6D 3SUFA 2ZFFH 1BIOA 2ZFRH 1K2I1 2R2WU 3MFJA 3LGVA 1ETSH 1AB9C 1TIOA 1E0FD 1CA8B 1IQIA 1MTNB 2FEQH 2A7JA 3SJOA 1RTKA 4M9FA 1T8NA 2W3IA 5L30H 2CHAC 2PSYA 3A84A 3STJA 2HGTH 4Y76A 1J8AA 1AE5A 4NA7A 1WSSH 3HK6B 4FVBA 2STBE 4MNWA 4OS4A 1DS2E 3UIRA 4NZLA 5I25A 1MMJN 1O2IA 1DUAA 1OP0A 4KTCA 1RFNA 2VINA 3ZVFA 2AMDA 1GJCB 2ZCHP 1WTGH 1ZRBA 1P09A 1K1NA 3MH6A 5AHGH 1T8MA 3ZYEA 5LGOA 1O2NA 2BTCE 3TVJB 3VG8A 3TJVA 4NIVA 1F5RA 2FLRH 3FP6E 4ABDA 1DT2A 2ZKSA 3Q76A 1CHOG 4UFDH 4DW2U 1XXFA 1DLKB 3LOXA 1CT2E 5K7RA 1GBAA 4JK6A 1JWTA 3TU7H 3SU0A 1EAUA 1AGJA 4P00A 3N99A 5FX5A 1BMFD 3ZVAA 1CSOE 1N8OB 2PV9B 4KP0A 1TONA 1XUKA 1GJAB 1NFUA 2P8OB 2J95A 3RXAA 3SU3A 4YO9A 2UUYA 1C5MD 1ZSJA 1UVTH 1P2MA 2GJGA 2A4GA 2ZU2A 4E05H 5F53A 2NWNA 1LQEA 1SPJA 4KKDA 4DURA 2XBYA 4KGAA 6CHAC 1ZYOA 1C2KA 1RTLA 3E1XB 4ZROA 1GI9B 6LPRA 3DD2H 3EGKH 1HAXB 1CA0B 4GHQA 3RXOA 3PV2A 1BTHH 2ZGCA 2EI7A 1VZQH 3LH3A 4WMDA 1QA7A 2A2QH 3H7TA 5F8XA 1GBLA 1GJ8B 1AVWA 3MU5A 2AH4X 3RM2H 1S5SA 2BDCA 4X1PU 1MKWK 2FOGA 2WPKS 3T5FH 5JBTA 1TPPA 1VGCC 4XRNA 3QZQA 1D3PB 5LPEA 1TQ0B 2FTLE 3SV2H 1V2RT 1QRZA 1OS8A 1W0YH 1DM4B 4CRAA 1TOCB 5EW1H 1OWDA 3FFGA 2VBCA 3RXQA 1P03A 4XDEA 2G52A 2V0BA 2SGDE 2STAE 3RXCA 1AB9B 5GDSH 2SGEE 1EB1H 1C5UA 1XX9A 8ESTE 3B8JA 1P9SA 1KYNA 3WW7A 1SFIA 2ZGXH 3I78A 3PLBA 1IQEA 1Z8GA 1MD8A 4DJZB 4ABBA 3NWUA 4YOGA 1W2KH 2IPHA 2PWXA 2VU8E 1SVPA 4FUHA 4UDWH 1GI6A 1CT4E 1THPB 1AWFH 4LOYH 4O97A 3U8RH 3UAIC 5K0HA 1U6QA 4Y11E 5A0BA 1HFDA 5GJ4B 1W11U 4GSOA 2JKHA 3A8DA 3LPRA 1GCTB 1KIGH 2BY5X 1Y59T 3M5OA 1QJ7B 1Y3YA 2BLVA 2J98A 2HPQH 4CBOA 1GBCA 1SSXA 2O8WA 3QN7A 2Z3CA 3DCLA 3K9XB 1HB0B 2FX6A 4AFZA 4JMYA 3LC5A 1H8HD 3ZZ6A 1KXBA 5EXMA 4SGAE 1TNKA 1AU8A 2F91A 1FONA 1HAGE 1K21H 3TJNA 3BEUA 5LPFA 1DY8A 1QRXA 4Q7XA 4YLQH 4A5TS 2DE8A 5DO4H 2BD7A 3SZNA 5JDUB 4GAWA 1GJ4H 1LHFH 5DP8A 2GZ9A 2OD3B 3SQHE 1UMAH 4FUJA 3V12A 5C0UA 3TLOA 1SGQE 1FNIA 1QB1A 3GCNA 3ZVBA 2YMSB 4AORA 1K1MA 5DSFA 3M35A 3TH4H 1AKSA 1CT0E 1C5QA 1ZJDA 3P8OA 3VEQB 5A2MH 3UREA 5ESTE 1G9IE 1O3PB 6CHAB 1BB0B 3RXGA 1V2KT 2JETC 4X2WA 3VXFH 3GCOA 2PHBA 1EXFA 3ATMA 2XOKD 2C8YB 1WU1A 1T7CA 4MG3A 4D9QA 3VB7A 2GKVE 6GCHG 3C27B 4MPVA 3RXFA 1M9UA 4AFSA 2BD8A 4KTSA 1O32A 1AO5A 1SGEE 3SO3A 2CV3A 3RM0H 1VGCB 1GI1A 2ZFTA 1XUHA 2ZDMA 3OTJE 5FL7D 1DXWA 1O2KA 1SGCA 2F9PA 3PWBA 2FLBH 1UTOA 4F49A 3PTNA 3E6PH 1P2OA 1ZSKA 2C93B 1BTPA 4JCNA 1HBTH 1NU9A 1V2QT 2P94A 4OS2A 1MKXK 3T2NA 1G30B 1QIXB 3EA8A 2BY8X 1BTUA 3KNXA 1ABJH 3JZ2B 4H6TA 4JYTA 4GLYA 1H9LB 3LGUA 3RXHA 5EJ1A 3TGIE 1C5WB 1O5CB 3TPIZ 2FOCA 1GJ6A 1NROH 1IQJA 1WUNH 2SNVA 2FP7B 1S81A 1GI2A 2SNWA 4OS6A 5KGOA 1CGIE 3HK3B 1J14A 3AW0A 4X8SH 1ELVA 1O2HA 5ABWA 4R8TB 1AZ8A 1NPMA 1DVAH 1BOQA 3SNAA 2A4RA 1MAXA 2YNBA 2UWLA 3E3TA 1GMCF 1QL8A 3EA7A 5IDKA 4ABFA 1PQ7A 4GVUA 1GCDA 1PFXC 2Y81A 1TFXA 3F0OA 3CS0A 1ELDE 3M5MA 3BSQA 3UTUH 3DA9B 1ETTH 1O2PA 4GPGA 1SGYE 4UFGH 1XUFA 4D8NA 3N7OA 4WWYA 1FN8A 1DWDH 1O3GA 2FM2A 4MQAA 3DSGA 3UOPA 1P12E 3NRLA 1HAVB 4BAOB 2BOKA 1PQAA 1C1VH 1Q3XA 4Q4LA 2XYAA 2Y5GA 3RMLH 3NCLA 1LPGB 1F0TA 4LXBH 4X2XA 1GI3A 2FODA 3HKIB 3GY7A 2HPPH 3BIUH 2SGFE 5DP6A 2QGRA 5EJLA 2FS8A 4FU9A 5GWZA 2JETB 1PPZA 3T26A 1MCVA 5T1VA 1QJ1B 1W14U
chains in the Genus database with same CATH topology
1V2MT 4B73A 4K2YA 1FY5A 2GCHG 3VPKA 3EAJA 2XRCA 1D3QB 1P3EA 4MPWA 4IBLH 1NO9H 1MU6B 1H9HE 1IAUA 2EEKA 4E7NA 2VVUA 1C5NH 2TGTA 1WV7H 1O2OA 3B23B 5T6GA 4K5ZA 1TALA 2ZQ2A 1C5TA 1SGNE 3PLPA 3A85A 1IHTH 1B5GH 3KN2A 1BTYA 1Z8JB 1UO6A 3LIWA 2WPJS 1YPLH 2CF9H 5FPSA 1GMHG 1TNIA 2CN0H 3K2UA 1V2WT 1LQDB 1O36A 2BVSH 3IG6B 3KQBA 2A1DB 4FUDA 4X8VH 4Y71A 1C5VA 1ELBA 3QGNB 4AG1A 1PJPA 1FY1A 1FUJA 4I8LA 4NIXA 4JZIA 4AYYB 2ZNKH 4IC6A 1QJ6B 1C1QA 2H9TH 2ILNA 4ZH8A 3SQEE 1TRNA 3RLYH 1C5LH 1C1TA 2Y6TA 4ZHMU 2WUCA 4OGYA 1UTQA 3F9FA 1QQ4A 3G01A 2XC4A 4E7RG 3F9GA 1O2RA 1C2DA 3GCTF 3VXEH 3TK6A 2I6SA 3JZ1B 1YCPM 2XWAA 3M36A 1H8IH 5GCHF 3SNDA 1NRQH 1IQGA 5FPTA 1UCYH 4CBNA 4CH8B 1AVGH 1GHWH 2CXVA 3ZYDA 1Y3UA 1ZRKA 4WXIA 3BTHE 3H7OA 1MBQA 1O3NA 1ZTJA 1ANCA 1GPZA 5GIBA 3P6ZB 1SGDE 1WAYB 1GHAG 2ZTXA 4DT7B 1O5DH 1DITH 1QB9A 2P16A 5L6NH 2D1JA 2J9NA 2QV1A 3ITIA 2ZTZA 1KXFA 1S83A 3ZVDA 1WOFA 1HAVA 1ZLRA 4ISLA 2TGDA 4TPYA 2BVXH 1JIMA 1RIWC 3E0PB 5EXLA 4GHTA 2OCVB 2C3SA 1VCQA 3M61U 4Q7ZA 1IQMA 3AAUA 1LKAA 4WY3A 3A82A 1ZR0A 4XE4A 3LDXH 1PQ8A 2YOLA 2OC8A 5T3HA 1ANEA 3A89A 1FI8A 1C5SA 2BDGA 4FUBA 5JPMH 1WTHD 3M3VA 4IC5A 4UE7H 1OYQA 1UTKA 3R0FA 2ZDKA 4YLUA 3DT0H 3S9BA 1E35B 1GHVH 1EASA 1C5ZB 1RTFB 1MU8B 1MTWA 1KLIH 1O5GH 1TX6A 4YESB 2ZZUH 1NZQH 3BEIB 2Z6BD 1BDAA 4LZ1H 1GJBB 1HAHH 4WH6A 3VB6A 1F2SE 1GL1A 2GP9B 3MU0A 1G36A 4DGJA 1N6YA 1ZMJA 5GPIB 1HAPH 1T32A 2FOBA 2KAIA 3PMHB 4D76A 2AEIH 5A8ZA 4O3TA 2WINI 1AVXA 5FHTA 1BA8B 1V2OT 1V2JT 4DY7B 7GCHG 5FBEA 2GZ8A 1LHDH 3FP7E 4FUIA 1O2LA 2ZC9H 1DOJA 1DWEH 1YLDA 2Z9JA 4NGAH 5DP7A 1K1PA 1GVZA 2B8OH 1GGDC 2PTCE 4B2CA 3U69H 3KF2A 4U01A 4DIHH 1HIAA 1O5FH 3SJKA 1HJ9A 1A5IA 5TJXA 1FPHH 2BY7X 1P2QA 1BMAA 2ULLA 3KHVA 4KTUA 2A45B 1CBWC 3TJUA 3MNXA 2GCTC 3PWCA 1YPHE 1LPKB 4A92A 3V3MA 1GBHA 1NFWA 2BX3A 1GDQA 1O2ZA 1SHYA 1ELAA 1NY22 1BTWA 3BTTE 3RUOA 1NRNH 4X6PA 1AY6H 3E8LA 1KTTB 5F03A 3SV9A 1V2TT 2PKSB 2SGQE 1Q2WA 1EOJA 1HXEH 3RU4D 1FLEE 4D7FA 1YCPK 5J4QA 1XKBC 1YPGH 1RIWB 1QA0A 1O35A 4IN1A 2OC7A 5C20A 1WYKA 1UCYE 4Y10E 4MNXA 1O39A 2V3OH 8KME2 1BMLA 1KSNA 5EPNA 2BHGA 1Y5BT 2G51A 3OYPA 1VITG 4OS7A 2QN5T 2XCNA 4H4FA 1RJXB 4ZHLU 1D3TB 1P01A 2BOHB 4IGDA 4Y79A 1V2UT 5DP5A 2CMYA 1F5LA 3DFLA 1P8VC 2VIQA 1OX1A 3LC3A 5DP3A 1HPGA 2K1QA 3V13A 4X6OA 1NTPA 3A83A 3EDXB 3LH1A 1J9CH 2ZHDA 1MZAA 4KELA 1BHXB 3RXUA 1W13U 3PB1E 5DP4A 1ELCA 2FIRH 2Q6GA 1HCGA 3GY4A 1TRMA 2OP9A 2ZEBA 3SI3H 1G3CA 2C4FH 1FN6A 1HNEE 1YM0A 2JH6D 3NUMA 4OS1A 2GDDA 3TNTA 5FXLA 4Q7YA 3CENA 1UJ1A 1BRUP 1F0RA 1O38A 4GUXA 1VITH 9ESTA 1NM6A 3M5NA 1S0QA 1GJ9B 1OXGA 2NU0E 1C2LA 1ESAA 1BJVA 1GGDB 2Y5FA 1QNJA 3RXIA 5JBCS 1F0SA 1YPMH 2DUCA 1UTJA 1LTOA 1VCWA 3SU5A 2ZGBH 1JIRA 8GCHF 3RC6A 5EG4A 1AKSB 3ELAH 2ODPA 3M5LA 3GYMA 1CBWB 5C5NA 3SV8A 4B1TA 2GCTB 5HM9A 4CR9A 1JBUH 2C8WB 3F9HA 1DWBH 1O2SA 1TBZH 1GBEA 4WJG2 1KXCA 2O8UA 2P3TB 3A86A 2FZZA 4ABHA 3SGAE 2FX4A 1XUJA 2QIQA 5J4SA 1ZTLA 1L2EA 2ZDVH 1QURH 4FUCA 1O3JA 1A0LA 2ANMH 3SW2B 2H1UA 1ABIH 1EPTC 2HRVA 3NK8A 4U2WA 2GCHF 2XC5A 2BB4A 1S6HA 2R3YA 1P11E 1G3DA 4IN2A 1SI5H 4UD9H 1P2KA 4ZAEA 1TOMH 1P10A 4B75A 1EX3A 1TGSZ 3FVFB 4DCDA 1PYTC 1XVOA 3TH3H 3U1IB 2FXRA 1O0DH 1AWHB 2G4TA 1JRSA 2VIVA 3GY5A 5TCAA 1A1RA 3RXTA 3RMMH 2PKAA 2PLXA 3BEFB 2ZFQH 1KTSB 2TGPZ 2WV5A 3H5CB 2CHAB 3ZZ7A 1F0UA 4INKA 2GT7A 5HXFA 3W95A 1A2CH 3MU8A 1Y5UT 1W0ZU 2Y7XA 2B9LA 4BAHB 1GBJA 3C1KA 3RMOH 1BBRH 2W5EA 1A5GH 3FAOA 4I8JA 1ARCA 4CH2B 4JZFH 1IHSH 1MUEB 3STIA 2JH5D 1B0EA 5JBAS 1E37B 3ZV9A 1A4WH 4BTIB 2CJIA 1NN6A 2VWNA 1S84A 3KQDA 2AIPA 3EYDA 3L3TA 3U8TH 2GMTC 1BMNH 3PMJA 4FUEA 1FY4A 1EATA 4NA9H 1OOKB 1G3BA 1ZJKA 1O3HA 3ATWA 4TWYA 4X0WU 3GISB 1JOUB 1NRSH 1UVPA 4BAQB 1ZMLA 4MDSA 1O30A 3QDZB 4H42U 1GMDG 4XSKU 2G4UA 3U9AH 1AHTH 2GZ7A 2ODYB 4X1SU 3ESTA 1GL0E 2R0KA 1FY8E 2ZPSA 2FI4E 1F7ZA 2AYWA 1FAKH 1L4DA 5EODA 1O2YA 3LGTA 1KDQA 4YTAA 2ZQ1A 1EUFA 1TNJA 2D8WA 1WQVH 2BYAX 2FOMB 2ANWA 4F4OC 2ODQA 1OWJA 3F1SB 2A5IA 2BX4A 3PO1C 4IW4E 1D6RA 5DP9A 2BD4A 3LJOA 1C2HA 3A7ZA 1NFYA 2ZDNA 5C1UA 2NU4E 4U30A 1UVUH 2ZGJA 3S7KB 1C5YB 5EU8A 1AMHA 1JXPA 2P3FH 1AQ7A 2AS9A 1ZHPA 1LHGH 2TBSA 4ZKOU 1QBOA 2SGAA 2ZU5A 2FMJA 3MNCA 3O8BA 3ZVCA 5C5OA 1D9IA 1DSUA 1EPTB 2F83A 4NWKA 1P02A 4AGJA 2H9HA 1Y3WA 4NIWA 4BTTB 1MTVA 3RXKA 2BDBA 1DX5M 3URDA 1GWAA 4K3JA 5A0CA 4I8KA 2F9UA 3GDVA 4TWWA 1HGTH 1DY9A 4BAKB 3LGIA 1L1GA 3RP2A 1HAOH 1AIXH 3BTME 2UUKB 1SLVB 1NT1A 2RCEA 5A09A 3A7WA 1YBWA 3U1JB 2Y82A 2Y80A 4AG2A 3SU4A 2P95A 1HLTH 3P70B 1G2MA 2UUJB 2VWOA 5HGGA 1MQ5A 3ODFA 3RXLA 3O8RA 4X8UH 1LVYA 1ANBA 1V2VT 2TGAA 1SHHB 4X1QU 2ZHQH 1Z8RA 3GY2A 1PYTD 3DHKH 2BQ7B 1MQ6A 2VH0A 5IYTA 1EZSC 5DJ7A 2XTTB 4CRGA 1GJ7B 1TPOA 1ZOMA 2Q6FA 2J92A 2ZP0H 2HALA 1CE5A 1C1RA 1O33A 1PPEE 1DWCH 1UK3A 1UTPA 3MMGA 1SLXB 4FVDA 4NIYA 2VGCC 5GXPA 1GI8B 1QBNA 2H5DA 1BBRE 3VB4A 3M37A 4AX9H 4A1TA 2SFAA 2WPLS 3ZZCA 1XXDA 4A7IB 2HNTE 1LVBA 1H1BA 4O9VA 1O2UA 1GVLA 2XNIA 2ZPQA 4FU7A 4K69A 1E36B 5CHAC 5FX6A 1O2GH 1FJSA 1C1OA 2RDLA 3ZZBA 1PPBH 2AIQA 3A7VA 1C5RA 2A7HA 3QGJA 1FY3A 1O3KA 4SGBE 2BXTH 1ZSLA 2FOEA 1GBFA 3FZDA 3M7QA 3V7TA 2NU2E 2D26C 3AVZA 1T31A 3A7TA 3ODDA 3KQCA 2RA3A 3TGJE 5DPAA 2AERH 1L1NA 1GBTA 2UUFB 3D65E 1A61H 3MHWU 3PMBB 5DKMA 4X1RU 3TH2H 1GJDB 5EOKA 2ZDLA 1EPTA 1V3XA 3EE0B 2VJ1A 2OBOA 4BANB 2C90B 1TX8A 3QLPH 1BRCE 1SGTA 1G2LA 1D3DB 7LPRA 7KMEH 1P57B 1Z1IA 1GHXH 4WF8A 3NKKA 2KAIB 2ZG0H 5L2YH 1EZXC 2BZAA 2ZWLH 1H9IE 3Q00A 2ZO3H 2HWLB 1DANH 1ANDA 3L33A 1O3DA 3F6UH 5F8TA 1EAWA 3I29A 4TYDA 4ZHAA 3FANA 1C1PA 2A32A 1L1JA 5JB8S 1Q31A 1O2VA 5E0JA 2G00A 1VJ9U 3A7XA 1HJAC 4BXSA 1JMOH 1XM1A 1CHOF 3LJJA 1EKBB 1O2QA 5HYOA 1WQSA 1HIAB 1YCPH 4VGCC 4I7YH 1V2PT 1W10U 1BHXF 1QGFA 2PFEA 3M7TA 4MPXA 2FOAA 1T8LA 4AB9A 1PPCE 3P8FA 1F5KU 1D4PB 2LNCA 2ZHFH 3MNSA 3SU2A 1DSTA 3U98H 4ZKNU 1HXFH 2EI6A 4Y8XA 3ATLA 1SQOA 5E2PA 2VGCB 1LVMA 1GI4A 2WV4A 3GY8A 4CR5A 2FTMA 3PROA 4CRBA 1SGPE 2BDYA 1HAIH 4GCHG 1OSSA 4RKOB 1GBIA 3QK1A 2ZCLP 1MD7A 2FI5E 2RG3A 3T25A 1FIWA 1BUIA 4AZ2B 5ESBA 3BN9A 5CHAB 2HLCA 4K1EA 1K22H 4K1TA 4JK5A 1NU7B 4ZXYH 1ZMNA 3TK5A 1O37A 2EA3A 1HV7A 3OSYA 2G55A 1AZZA 1FDPA 2HNTF 4Y8YA 1OP8A 1ZPZA 1A0HB 5G4BA 1SGRE 3BTDE 5AVDA 1CVWH 1W7GH 3RXVA 4Y0YE 2QF3A 2TPIZ 5A8YA 5E0GA 1TRYA 2BQ6B 2Z9GA 3R3GB 5FBIA 4E06H 1GJ5H 1UTNA 1V2NT 3M7UA 1ZGVA 1LVOA 1SMFE 3TJOA 4XBCA 1SGFA 1DICA 1GHZA 2B0FA 4DG4A 2OUAA 4MVNA 4YT6H 5JB9S 2V6NA 1CGHA 2CF8H 4ISNA 3GDSA 2GGVB 2OBQA 1MTNC 1EJMA 4WMEA 1TAWA 3LU9B 3BF6H 3W94A 4ZMAH 2G8TA 1D6WA 1GHBG 2BD9A 4HTCH 4CHAC 1TGNA 2QCYA 1P05A 4X8TH 2F9NA 3PYHA 1Z8IB 1FV9A 1MH0A 3A81A 1GBDA 2XC0A 1QTFA 2GT8A 4NZQA 4Y0ZE 3SNCA 3QTOH 3UR6A 2ZU1A 1DUEA 1TMUH 4B74A 1SG8B 1A3EH 3B9FH 2A4QA 3ZZ3A 1O3LA 3BG4C 1QFKH 2GX4A 1SBWA 1HJAB 1QR3E 1HDTH 5PTPA 3UFAA 4YM9A 2QYIA 1W7XH 1T8OA 4PROA 4D9RA 1IQKA 1J17T 4YOIA 1O2JA 2BDAA 1MKWH 4VGCB 3MTYA 1BMMH 2DE9A 4IMQA 1CQQA 1Y8TA 5E2OA 4X6MA 3UNQA 3GY6A 3T27A 4K60A 1S0RA 4ZKRU 2Z9KA 2A7CA 1TGBA 1NC6A 2UWPA 4A1XA 1G37A 1OWKA 1ZHRA 2XWBI 3SORA 4U32A 4UFFH 2F9VA 2Z3EA 1K1JA 2B7DH 4K8YA 2GVFA 3U8OH 2EI8A 1C9PA 1TMBH 1XKAC 2OXSA 2G5VA 5EQRA 3ZZ8A 2P8OC 2IN2A 4X2YA 1SQTA 3UWJH 3BTFE 1Z7KA 4ISHH 1PPFE 1RRKA 5A0AE 2ZDAH 1YPJH 2XW9A 1KXEA 1UK4A 2AFQB 4BNRA 1QY6A 3AASA 3RXSA 1UHBA 6GCHF 1OP2A 1TNHA 3UQOA 5DG6A 3RMNH 1TGTA 3MO6A 2W3KA 3CS7A 1TPAE 1EJAA 4YOJA 3LONA 1P04A 1DPOA 1X7AC 1C9TA 4K1SA 3A87A 1J15A 2PKAB 3OY6U 1BTZA 1Z1JA 3TITA 2ALPA 1BRAA 5AF9H 2VWLA 2WPHS 5DGJA 2BY6X 3A8AA 3E0NB 1UCYK 1C1NA 3IITA 1FQ3A 2OQ5A 4ABGA 1SB1H 3ZVGA 4Y7AA 3SJ9A 2NU1E 3PM3A 5A8XA 2BM2A 3RC4A 3T28A 3HPTB 2VIDA 2R9PA 1ELTA 3T29A 2B5TB 3LT3A 1ZPBA 2VH6A 4CRDA 2YNAA 4CHAB 3F9EA 6ESTA 1H8DH 2P3UB 3RU4T 1EOLA 3UNSA 1ELEE 2JH0D 1QHRB 2GV7A 5ETXA 2OINA 1TABE 2FOFA 4Y7BA 4RSPA 1GI7B 5LPRA 2J38A 4X6NA 1MCTA 1C5PA 3BG4B 1GCTC 3SJIA 1O3FA 1K1LA 2R0LA 2Q1JA 5EXNA 5EPYA 1KDQB 5C1YA 1YP9A 1EB2A 3D62A 2ZECA 2AGIX 1T4VH 1S85A 1B0FA 1YGCH 3DFJA 1C1UH 2WPIS 4YZUA 2XBVA 4NFFA 2W7UA 1P2IA 1ZHMA