5ABZA

Complex of the fimh lectin with a c-linked naphtyl alpha-d-mannoside in soaked trigonal crystals at 2.40 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of C-Mannosylated Anti-Adhesives Bound to the Type 1 Fimbrial Fimh Adhesin
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords FIMH
total genus 35
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5abzA00
1PDKB 2WMPB 4XOCA 2VCOA 3MCYA 4J3OG 4XOAA 4AUYA 2JMRA 3ME0B 4AV4A 3RFZA 1KLFB 3BFQG 4J3OF 4X5QA 4CSSA 3SQBB 4XO8A 4XODA 4XO9A 5F2FA 5FLUA 4AVHA 4AV0A 3JWNH 4X5RA 3ZL1A 4XOEA 1ZE3H 4AUJA 5LNGA 5F3FA 4XOBA 5FX3A 3ZL2A 5AAPA 4AUUA 3JWNE 5IQMA 2UY6B 4AV5A 5FS5A 4X50A 2XG5B 2J2ZB 4LOVA 4BUQA 4AVIA 1TR7A 2UY7B 1QUNB 4J3OH 5AB1A 4AVJA 2JTYA 1UWFA 4ATTA 5IQOA 3BFWA 5JQIB 2XG4B 4X5PA 5ABZA 1KIUB 4CA4A 1N12A 1N0LB 5IQNA 4AVKA 4CSTA 2W07B 5FWRA 3JWNG 3ZPDA 5LNEA 5CGBA 3BWUF 5AALA
chains in the Genus database with same CATH superfamily
1MLBB 3APFA 3TV3H 4YSAA 4LK4A 1F90H 5D7LA 4PLKD 3ZTCC 1AGEB 3AAZA 3S8GB 5C0FA 5CCKL 4OVVA 2NX5B 1T6VN 2QQLL 4AW4A 2VMDA 4KY1H 3C6LC 1C5CH 2EZ0D 1RZFL 1BF2A 1SXSA 1A3QA 2A9BA 3GMOA 4WNSA 2FB4L 4XPFL 1BOGB 5F7LB 5F1OB 4YVUA 3SKNA 3VD4A 3GRBA 5HD8C 3DRQA 5IJKA 3IMRA 5FYLD 1K2DB 1LEKB 3W82A 4X4YB 4ZMWA 4BQ9A 3GSQB 1OTSC 2MEJB 5I5IA 5IEHA 4GI9A 5MENE 2UXGA 4L5FL 4ZD3H 1KENL 3HPJB 5GZOA 3FN0H 4Y5XC 3T6WA 3VD2A 4HGKC 3ZKND 1K8IB 3CFMA 1NUDA 4KK5C 5CIPH 3P1VA 3N9GH 4AUJA 3QO0A 4R90L 2H8PB 1NC4D 3NJFA 2MNJB 5AYUH 1O9ZA 5D1ZC 2VKWA 4HLEA 1KCKA 1N64H 4LLDB 1KCWA 4KOCA 3IGAB 1DJHA 1TVBB 3FB7A 4PRHA 2A0LC 4J8RB 1XSKA 4F7PB 4M8VA 4UT7L 4XMLL 4YX2L 1KGYE 4JN1H 4LHQB 1TJHL 4HJJH 4HSAC 4FZEH 1OSYA 5AAWA 2XQBH 3FFCD 3QXUA 1V27A 2H3KA 4UZUA 4IRJC 1QSED 3T8VA 1PD1A 4X0KB 1TCMA 2G4GA 5TJWK 1UEMA 2ADIB 1UT1A 1LMKA 1WZKA 4ALAH 4HC1A 3T4AB 3CDGA 5JHDA 1FL3A 2OL3A 1FZKA 3ZX1A 1Z9PA 4P4RB 2MCMA 2NW2B 4HD9A 2IQAA 3AU1A 2UVEA 2KLRA 1ETB1 4KK6C 5DYOA 2NXYD 2HN7B 5MP6H 3QXTA 3RVVC 3MUZ1 1OWWA 1SJEB 5E6ID 2XN9A 1EJ8A 3CZJA 4U33A 4ZO8A 4NP9A 2ZUQC 2AJ3A 1SYVB 5CIPA 2EIDA 5I5JA 5MERB 1VRSA 4ZPVA 3UGXA 5T3ZD 2NSQA 4YQXL 1IT9H 3JUYA 5FEBA 2P49B 3QCVH 3GNMH 4GT7A 4ALAC 3POHA 4RGND 4R2GB 4R83A 2NX5A 2V9TA 2C9UA 1QZNA 5B1JC 4E9YA 4TNFA 1E7UA 1O7DC 3QFGA 4OKVB 4WNQB 5HHMB 5JIQA 1DQQA 1UUNA 3NJMA 1P5VB 2QGCA 4S1DD 1JK8A 4CNIB 1U8PA 1SJHB 3U7AA 1A3LL 4QHKJ 3UZQB 4MNHB 1MZYA 4PREA 4OD3L 2QMKA 4PGZA 3E6HA 1TVDA 4XCYB 5EBGA 3QIUA 4MNQE 5AW5B 3TBVB 2CJUL 5D7HA 2DBLH 1UM6L 3FRUB 1WSST 4DCQB 4XT1C 1N0LA 2F1EA 3BDBA 5JHLL 1R3LA 4BFOA 1A3RH 3UAJD 3Q6FA 2YPKA 3V5HA 4U6XB 3W9DB 1UASA 2FWOA 3IF1B 3E80A 2V7NB 3K5SA 3RGHA 1N4XL 3EJYD 1V3LA 4QI3A 3KM2A 3WJMA 4XNDA 4NN6C 4JFZL 2O5XL 1I1AC 5JW5B 1HILB 2Z91B 3IETB 3IWUA 3LCYA 4NHCH 4PJXA 4TSBH 5DMYA 1BZ9A 2JJSA 5DVNA 4JM2D 1JPST 3FT2A 3VGHA 3VU1A 3A6CL 2WLIA 4WUUB 3IDJB 1WDAA 5EO1A 2HJKA 3BUBA 3L9YA 4MHHG 2XIIA 1WJ3A 1DJGA 4GKZB 4GSRA 3BQUC 3RNKB 3N41F 1LJMA 2DM4A 4Y89A 2JMRA 1PG7H 3KW7A 4TLTA 2IFGA 1RXLA 3GLEA 4W4OA 3FU7A 1HL8A 2HT2D 3K4DA 4I87A 4Y8DC 6PAZA 8FABA 3E8UL 2W60A 3HZYB 1YDPA 1HJCA 3OAWA 2VXSL 1ZE3H 4D8OA 1WTLA 3MFFA 3D06A 1OHZA 4RMTA 1LGVA 1KYDA 3EAKA 4U3SA 1E7VA 3WFDL 4JB9L 4AZ8B 4M5YL 2WP3T 1ZCRA 4F37F 1MUJB 4QTFA 2IADA 1QKZH 2YAPA 3G3LA 4ES8A 2EO7A 4U2YA 5FV1L 1RULL 2ZP9A 3TPKA 2ARWA 2PPEA 3BDYL 5ESVA 5F7MC 5K39B 1OSZB 3UOAB 4BJLA 4XNZC 4OLUL 1UZ6F 3AY4C 4WKZB 3AS3A 5ACLA 3TPUB 5GS2D 2IWGA 4M8QA 4QHMB 2X44D 1VGKB 1TJXA 4PIBA 1OB0A 3D8MA 2ICEC 1R0AL 1G7QB 4ZW5A 2C4FT 1QFWM 3CVIL 1JD9A 3TCLA 1RVFH 2TRHA 3WFEH 1ZLVH 4Q6IC 4F20A 3KMDA 3NCXA 2UUDH 4DERA 5C08A 2VN7A 3L4TA 4MMXB 5LVEA 2ZX5A 3QCUH 4ANKA 1TQBC 5ESAA 4NNXA 1TQBB 4QRTA 2AQRA 5EOCL 4MNGE 2OMXA 3HAEA 4I48B 3EYSL 4DKFL 3ETSA 3M7OA 3WS6A 2LAAA 4O9HL 5FYJU 1DBKH 3OGCA 2AEQH 2X7LB 2Z31A 1W72L 3NDYE 3VXNA 4M61B 3S36H 3ZHDA 2BK8A 4CGTA 4U1SB 4J4PC 2FK9A 4WU7A 4EE2A 3D52A 4FQIH 3CU7A 1KWKA 3MO1A 5DXWA 4PGCA 4MXVE 5JPMC 2D7TL 1L9QA 4BSWA 4LF3A 1EMTL 3BSGA 1GCFA 5H4YA 4QJ3B 4PTTB 2MKLC 4W6YB 1GCYA 3N42B 4KI5E 2E8ZA 3F65A 1AHWB 3BH8A 3AS1A 3PGFH 3V7AG 4W6XB 4DK3A 3LDBC 1DBJL 1H15A 3N1MC 2VR8A 4HQQH 4JPWL 1YEWA 1QPPA 2YD7A 3HS0B 5DVOA 3LH2H 3FMGH 4L8SB 5EDSA 2FSEA 2A83B 5BZXA 1VFBB 3RL2B 3TO4B 3PQYA 1DBBH 1DQDH 4NBXB 5F6HJ 5DRWA 4NSKB 4HV8B 1AR2A 5T1JA 1KOAA 4KI5F 2EDDA 2F7QA 2VLKB 5DURD 3CN3A 2MH4A 2PXYB 1A22B 3DVGA 2WQXA 4YAQB 1BJ1H 5IW1B 2JELL 3UFIA 5JQIB 3QUXD 1WFNA 1QYGH 1N59B 4FFTA 3FCTA 1XCQB 1K8IA 1JS4A 3V0GA 4AYFA 5KJ7E 3OMZA 1MUJA 1OCWL 2IDCA 2WUBL 3QO0B 4NX0A 4ZOBA 3LPFA 4LL4A 4LSTH 4ZK8A 4A6YH 5HVHB 5D9SB 3CZNA 1S7RB 5I8OL 2DQFB 2WIIA 2OM5A 3UACA 1D5MA 4TS6A 5BVJA 3RI5K 5BS0B 1UQSB 4AG4L 5EUKB 3LZLA 1QPKA 4H8QA 1J5CA 1JZJA 3I3DA 2Y2WA 4BFIB 2EEFA 5IMOA 5AOZA 1GR7A 4PW4A 3KLHD 3MV8D 1Q9WB 2HVKB 4UINH 1UURA 1KLUB 4G9FE 3QJZA 5T1DH 1BOYA 3HB3D 2Z1PA 1MWAA 4P9HL 1OAUH 1OCOB 3VXTA 2D7PA 3Q2CA 4KHTL 3SEPA 4MS8C 1JPGA 2V17H 3A6OA 2ZOLA 4FNLL 4KHXH 4AQ8A 4ZQKB 4X5WB 3GXUB 1HH6A 2YLHA 2XUWA 2Q76B 2IXQA 5E94B 4YH6A 1IGTB 1OO2A 4NXSA 3U2IA 4EDWL 1T89A 3HBZA 3LQAH 2JQMA 1FLTX 1HAUA 3NIGB 2ZKHL 4X6DE 5F7DA 3VWJA 4KDVA 4OGAC 3BJ91 1S7UB 2GPZA 4PJHF 4IOSD 4G8FA 1EPFA 3RWJB 2VDLB 4LP5A 3EJZD 2H6PB 2ZUYA 4WFGE 1WEJL 2AXHA 3VCLA 4LKCA 3BVVA 3QIBC 5IROD 3DV6B 1B4TA 2OSXA 3MQIA 4YS4A 1H9DA 1PZ5B 1S7XA 3ZQXA 1F2QA 3DO4A 4ADJA 1H0DA 4LQFL 2R8SL 4F37K 1J48A 4M6OH 2WNXA 1Y6MR 2XBDA 3P4LA 5E24E 3LRMA 1GH7A 2O6DA 3V5DB 2QZ5A 2R7EA 4XVSL 1HQRB 4P5SA 1DVYA 1U8HA 5ANMB 5BXFA 1KCLA 4K4KA 5JQ6L 1P9MA 1SZNA 2P8MA 2LU5A 3O45A 1OCWH 5D72H 5I15L 2BVTA 1JV2B 1KACB 4I0PC 3U4KA 1MREH 4WWKB 4DEPB 3V5HB 3TEWA 1D6VL 3SYQA 1NWOA 4N90D 4DFHA 1SMAA 3VNZA 1GVIA 2YEVB 2PO6C 5F97E 1BX2A 3HI1A 1PZUB 5DMGD 1G6RA 3NJLA 1C7TA 4KKCC 5I8EA 1GA2A 5C1MB 3QK0A 3B7TA 4F7TA 1SF3A 3GS7A 5LG6A 2CHWA 1TPXB 3MRRB 3U83A 1XH3B 3GS4A 4NKDA 1KZQA 4GI8A 3UPRB 2J55A 4G1EB 2ZSWB 3S3CB 2JKTM 4KJYB 3AG2B 3BE1H 3BQUD 3LNDA 4PJBF 3MRJA 4RDQG 1YPZE 2NX5D 1U8QA 2E5EA 4JFXB 1SFHA 1R5IA 4K3JH 3SDCA 1KPRA 2EDLA 3ZTJG 1TZGL 3TBYB 3P3TA 4ZODA 4DOHE 4ZXBB 2CDFA 2JJUA 3FUDA 2HTKD 3KE0A 4LPVA 4PIRF 2DI8A 4F57L 1L7TL 2WLHA 1YECL 3OPZL 2JJWA 4L8CB 5JHLH 2HX8A 4JFDB 5HDWA 1YY9C 4PJAA 5D55A 1K8DB 5DJ2B 5GSRA 3ZO0A 2ZP8A 4Z7QB 2VN6A 3T1FB 4FYSA 1TJMA 4H1LB 3VXOB 2XWJB 4N4YB 3BVXA 1XZ0A 1Z3GH 3FUMA 3I6LE 3MHZA 1AHWC 2JI2A 3EYUH 4UDUA 2HUHA 5GISH 3SOBL 4U7SA 4LIQE 3O2DH 1FA4A 4FA8A 3G5YA 1KT2B 4L3EB 5D71L 1YSOA 4HBQA 4WY7L 5CSZB 3WN5B 3T0VA 3VI4E 1WHOA 5DFTA 1FLRH 2R0KL 5GGSY 4GFTB 4Z77A 1RVFL 4BKLA 5HPOA 1OAUL 2R69L 2BZ7A 5E7BA 4M7LT 3B2DC 4YQXH 1PNDA 3G6JB 5E9DE 3ETBF 5E2WH 3EYFB 3BWAA 5C08B 1FFNA 1R46A 3UJTL 4KZDH 2ZXAA 3QEQD 4PFEA 5I1CL 4P05A 3PDOB 3O6LL 1BAGA 1YEIH 3GPEA 5DMJB 1Y7VA 3TFKC 5CMAA 3NJVA 2VL5A 3PJSB 3VQLA 4QTIL 4TSBL 4QAMB 5G4NA 4GSXA 5DJ0A 1ZGLM 3FSVA 3IE9A 4ZW7A 4PRHE 2R4RL 2CGYA 1DDHA 3HEIB 3SJVE 1U42A 4HS3B 4XOCA 5JOFA 1T83C 4U1MA 3S4SG 1DE4A 2H26B 2MPVA 2PWHA 1ZA6B 1F8TL 3GB7A 4B5ZA 5K9QG 3ZTJH 5JIKA 2EVIA 2F54B 5DO2C 3V0EA 3H9SD 2H3NB 5HGAB 1FGNH 1EAOA 1OAZH 5H35B 4DFIA 3KPNA 1GYWA 1IC5L 4YXKL 1GIGL 4W6WB 3HBPA 4ACPA 1NC2A 4X4ME 3UL4A 3IDNB 1UZ8A 3KPMA 4FA7B 4R2GD 4WI7A 2W80C 3BZEB 3KWXA 5B8CC 4NHCL 4Y5XA 1VZIA 3QPXH 5KSAA 5JXAL 4NZFA 2FVNA 1JPFA 2ORBL 4XX1G 1JP5A 2C3GA 2WLLB 4TRPL 1KUMA 4ETYA 4ABQA 3FL7A 5JPNC 1RJLA 5E8PA 5D6DA 4PRBA 2LLGA 5DEJA 1BZQK 5DEFA 2ATKA 2DJMA 2DQEH 4TVPL 3SPGA 4DO5A 2DH3A 1KYAA 2DB8A 1NFAA 1F3RB 1XZ0B 3UROR 4Q9RH 1R75A 1CQKA 4NZJA 4U1KA 2PUQT 2FECL 3DVNA 5EU6A 4KJWC 3ESPA 3WHE0 5EZOH 2P5PA 3OLGA 3CFJA 2HX7A 4G72B 4AE1A 1MJ7L 5IFHH 4UI2A 4MXQC 2QLYA 4XTRC 4MFHA 4FNSA 4OJAA 4Z77B 2F53E 2EH8H 4L4TB 2R39A 1KXQA 1RSYA 1TEFA 5C6WH 2GEEA 1OQXA 1AGCA 3A6BH 3NZHH 3V52L 1YO4A 1JCKA 4KNUA 2R56H 4UAOC 2HVKA 3Q44A 3RNQA 3UTSD 2I9TB 1I8UA 3UZQA 3FYEB 1YN6B 5D4QA 3W57A 4CDGC 1FFTB 1KY7A 4PJBA 1BAFH 4G6KL 1A14H 3OPUA 4RRPG 1LP9F 3K5RA 1FNGB 2ZKWA 1T7XA 3O9WA 1F45A 4NT6B 1B0WA 1BM3L 1FI8C 4FLRA 3MNDA 2R4SH 4A2EA 4JDEB 3D6GA 1FGVH 1U3NA 4QHLB 3WKPA 3QR0A 1KCSH 1QSEE 4X5RA 1I9JH 3LNFA 2FQDA 2Y3NA 2LR4A 1S9YB 1YMME 4IS6A 1CU4H 4PJAF 5A2LH 4HOWA 2AK1H 4Z3GA 5DUPH 1XHHA 3B8SA 4IBWA 4RAUB 1FPTH 3ETTA 3S35X 4HD5A 1R47A 2FZ3B 4HUWB 2JFCA 4XMPH 1UEYA 4LAQL 2V2XB 1TLKA 4U6VL 3GMOB 3TA3D 1XCTB 4U2ZA 1MCEA 1PVHA 4YHLL 2Q9OA 4NENA 3K6IA 3ALPA 1HHGA 5HD8D 4XODA 3I02B 4OFDA 2IDQA 1G0DA 3TEUA 4MCYA 3UC2A 3SQRA 2VZUA 4BFKA 2LQRA 2R29A 4OF0A 4OUUB 4UV4H 4RGNE 1NL0L 4LO9A 5DT1H 4X99A 1PSKL 4JJ5B 2JCCB 4N1HB 4CSZA 1DR9A 1WAAF 5LBSH 2WMPB 2J8UF 5E99L 5FUOH 4NM8H 3RGVD 4OZIE 1YZZA 3I3EA 4WWKA 2PPAA 5EZIL 1KV3A 2GBVA 5A2JH 4WO4B 3EBGA 2H2SC 1BFVL 2VUOA 5FYJL 4S2SB 3LVTA 4MLIA 3VUAA 5T5FL 5IJDC 2DWSA 6FABL 2FJGB 1EEYB 4NFCA 4PGDA 1GC1H 2G3MA 2Q7YB 2D31A 1MVYA 4P49A 2X4OB 4IJ3B 4UILH 4G1MB 4W9HC 1FO0A 1CD1A 5GS1A 5AWNL 2AXJA 1T66D 3HPJA 4P23D 4UWQB 3VFRA 1BQHB 1VENA 4ZO7A 3WIFB 4JL1A 3JQOB 5ADPL 2FQEA 2AJSL 2ZUXA 4NZRH 2WY3B 5JUEL 4OF7A 5E6SB 1WCQA 2P5WB 5A2IH 1YEHL 3HFMH 4IOIA 2ZTBA 1BQRA 2ZWSA 3OQRA 1SHSA 4GKNA 3CC5B 3TBYA 2P24B 3DSNA 2N01B 3VMNA 8FABB 5L4FA 4QDGA 1IKOP 4P57B 4KO6A 4AL8C 1FGVL 3OJDB 1VZHA 2GBUA 3FO2A 1U8KB 3WY3A 4P48A 1H3VA 1KJ2B 4JCLA 1CWVA 4HHWA 4YWGL 5D7IF 2Y72A 3FQXB 1RFDH 3Q8AA 5DVKA 4IBYA 1RZJC 5MHSD 3PRZA 3SDDB 3V0VB 1QASA 5ESVB 2RCSL 2ICEA 4K9JA 3TNNB 1AZCA 1K4DA 3U1QA 3LTVA 4ZRGA 3BVWA 1BQKA 1E5CA 3PWUB 3V4PH 1E27A 1WF5A 2Y2TA 2QPEB 4Y5VA 4Z7OB 1A6TB 2ADGA 2Y7QA 2IOIA 2YGVA 3K8MA 5GGTL 3RX5A 2CKBH 4XO5A 5FS5A 1ZSDA 1HKFA 4HISA 2YS4A 3BFOA 2NY3C 4EZJA 2FTAA 4X42A 5J13B 5IQOA 4KKPA 4BA0A 3IK2A 4N3UA 5I23A 2XY2A 4PVBA 3N1FC 4PWHA 5T1KB 4OLXH 1Z3RA 2Z4TA 1TDQA 1DVUA 1OALA 3F00A 4AYDC 1BA9A 4PJDB 5F3BB 1W72B 2NY4D 5I1DA 5D7EA 4I1PA 3F7YA 5D1ZB 3H9SE 2DYSB 1IGML 3AW5A 3H2PA 4J4PA 5CUSL 1INEH 5DC9B 1MHHA 3BVUA 4Y16B 4YHMH 1LM8V 4C4KO 4DH2A 2B9BA 1Z9SA 3S96B 5LQBL 2C1OA 4JR9L 5JPMB 5TE7H 2G60L 2EDWA 4WW2B 3TOPA 4TUJA 1F86A 4HYTB 2XG4B 1IEAB 5CILL 4FXKB 3WY4A 3VFMA 3PAVA 1KB5H 2QFPA 3II2A 5CEZL 3WSQH 2X4OA 2R4SL 1QMUA 3O8XD 4K55A 3ARYA 1KBPA 1TZIB 4PCKA 4IGBB 4DQOH 3FQRA 1Y0LA 2UZIL 4RRPA 2O30A 3V4PA 4H8WC 2GHZA 3H2QA 3F2LA 1GSMA 3JWNC 4JG1H 4X8CA 4AC2A 5K5YA 4KKAC 1XGYL 3BPLB 4LOEA 1G6VK 3WL9A 3DXAD 1BAWA 2EACA 2J6EH 2PCPB 4Y9GA 4K3EH 4U1HA 4R4FL 3U0PB 1KLUA 2EDKA 3IDMB 1OAXH 2PTTA 1JHTA 1DJWA 1LD9B 4MA8H 4MCMA 1JGLL 5LGHL 3ARED 3S3DB 5DD6B 5LNDA 1N5AB 2BHZA 2YKLL 5AD0A 3GBLA 5DC0A 4PB0H 5F21B 5B8CB 3QYCA 3WD5L 1OT1A 2F19H 1TQVA 4ZOAA 2ZOUA 2ENYA 1OTTD 4Z7NF 1PQZB 4IRZH 5C0BA 4B9ZA 3UC0L 3LIZA 1T2XA 4YHKL 5D4IA 4G7RB 3BX7C 3VGBA 1N8OE 3TT3H 3QNYB 4U0QB 4H88H 1NEUA 1PZ3A 5BVJB 1P6FA 1XGTB 4RDQF 3P9LB 5F7KC 5ADOH 3LHPL 4AVKA 5I66B 1NUNB 1OTUC 3IPFA 4DP6X 2APBA 2XTJC 4Z0XA 4Z7VA 3MCYA 1DP0A 2YSSA 4JRLA 5E5MA 5BRPA 4FTVE 4RAHA 2LVCA 3F5WA 4AQ8C 4UF7C 4H0LC 5F9DC 1SJVA 2PW1A 5DQ9B 3BKYL 3BN9D 4P5KA 1DSWA 5MENB 4X9YA 5DD1L 4N2DA 1YQVL 1G7PB 4JKLA 1CF8L 2BOLA 4U1IA 3ZHNA 3GSQA 1QLEL 1RZPA 3D0VA 2LV4A 3KXFA 4MNQA 4FS0A 3UCRA 1YECH 4L3FA 4Y9CA 3B34A 4ZTOL 1MWAL 3FB6A 3S37X 5AW6B 3DECA 4AEFA 5FA4A 3VGGA 3ARXA 2WINB 2XNAB 5EZIH 1EMTH 3AACA 1UOKA 5H37H 3CDFA 1CVRA 1B4JL 4I0PB 2CBTA 5LBSL 4WWKC 4LKXB 1BX2B 5TTRA 4LDCA 3B56A 4EBQL 4JDTL 5I6XC 1BZOA 4XE5B 4Y9FA 4M3JA 2ZPKL 3MV9D 3K3QA 4KV5E 4IRSA 1UWEL 3IVKA 5DJ8A 3OWRA 1YPZA 1KCUH 4EO5A 5C07E 4O02L 4AQ1C 4DK5A 3FC8A 5ACZA 3D12B 1U8CB 4NC2B 4K9EL 2CR6A 5JHAA 3RVTC 5KVDE 1FCCA 2IAMB 4EIGB 4JZJA 5IROA 4KROC 2YEZB 4UM9A 3S5LB 4JFVA 4DPAX 4NRXB 4PJCB 4QY8B 5PCYA 1M6UA 1VFAB 4L29A 4PRAB 1DQLH 3VSVA 5IK3B 3HZKB 1XL6A 4R5XA 1QUNB 3LZRA 2X6MA 4PS4H 2V7HB 5EUOE 3ZDYB 1N67A 1SJEA 4MA7H 4GAGH 3LEXA 5E0QA 3MV7E 4Y19D 1AGFA 2XBTA 1BD2D 2LAGB 5DUMH 4N0FA 1NGYB 2ETWA 1PDKB 1R3JA 3L4WA 3OAUH 1TPXC 3TYGH 1D5XA 4AGOA 2ZF8A 1REIA 3GRWL 2CBMA 3FOMA 1TQCC 4Z7IA 2A4CA 4KRPC 4FXGA 1JWSB 4OLWL 3KGRA 1OM3H 3VXSE 1T66C 1LDPL 1BAFL 1BFOA 4G6KH 4HK0A 3AQDA 1OWRM 5IB1B 4JO1H 5E5MB 1VZGA 3VWKA 2R2EB 5C71A 3X13B 5ICXA 4PRPE 1BVLB 4BSVA 3IXTA 3NT0A 4H8UA 1JTPA 3IFNL 1JXKA 4ZJ9A 3N85L 4HWBA 3DX7B 1HH6B 1SLXA 1B0IA 4FG6C 4L1BA 2H6OA 1MVFA 1AZUA 1ACXA 4J6RL 4YHKH 1W8EA 1J0HA 4XN7A 1GW0A 1N8ZB 2Q8BH 3WE6A 2PPCA 4Y4KA 43C9A 3SYAA 4UOZA 3D2UD 2YPLE 3RAJL 2EVJA 1PJ9A 1I1YB 4IRSC 3GSRA 3K1DA 4M03A 1SUHA 1F18A 3L9RB 3CHSA 1PEZA 1A1MB 5K1VA 3ZKXC 1SHXA 1RJYA 5E2TH 1JF1A 3NCFB 4GUCA 4KNSA 3RGVA 5FM8A 5KVEH 2X2YA 2E74C 4UT9A 1D9KC 4M6MH 4PN6A 4XB7A 2XV0A 2PCFA 3W56A 2X6BA 3BXNB 1AIZA 2QPFA 3FCSA 3DRTA 2PXYC 1LQSR 2R2BB 1R6VA 4FQLH 4LCCC 4ATWA 3RPIA 1ASQA 2APFA 3WIIL 1MHEB 2X5PA 4PY7A 3SDYL 1E65A 3UP6A 2FQGA 1TZOA 4JKKA 1YJDC 4JBSA 4XCNA 3VI4F 5ID1B 2FYYA 4H8VA 1XDTT 3QPQC 2D9QB 1IC4L 4NRXA 1JIBA 4PJ8D 5E8OA 1ACCA 1ZK9A 2LFEA 5JO5B 3WSQL 3SE4A 3RKPA 2NY0C 4HWBH 1U8NA 1CE1L 3C12A 2W92A 4XMZA 4PCSA 3NZSA 3EH4B 4LLDA 4PMFA 5ICUA 3MNZA 3STZA 5LN8A 3BFQG 1HNFA 5FO9A 5JOPE 4LEOA 2EIKB 4HSCX 1JNHA 5IOKA 3QHFH 4MJ6B 4KXZH 5IVXB 2CWRA 2HFTA 1EGJA 4JFDD 3STBA 4PGBA 3CZEA 2I5YH 4PHXA 4LCIL 5CHNA 3LS4H 5IJBC 4GRWF 3B9EA 4CJ0A 3ZY7A 1USQA 4PBWD 4Q9QH 5TDOB 3OF6D 4LE8A 1CFTB 4FJZA 4OZGB 3JWDC 5D2LA 4AYMC 2PF6A 1FVDB 5F88A 4Q9QL 3H9HA 4JFDA 1RD6A 3APNA 3V4VL 3GJEB 4PRIE 5SWSA 4TNWF 5EPMB 1PTZA 3RWCB 2AZUA 4BK8A 5J56B 1V3JA 4W9DC 2XDHA 1MNNA 1CD8A 4LLYB 3HZVB 1BBDL 1C5BH 4JFOA 5HHVL 4GKOA 1HYRC 1MLCA 3EDKA 1JJUA 1OM3L 4YNYA 5K39A 1A6VL 1I9RH 5HYSG 1J10A 2BSDA 4IS6B 4Q4IA 1M56B 2EO9A 1KBBA 5D1XE 2BOBB 1P69B 2BSEA 3SIKA 1DEEB 2F58L 5CN3A 3VG9B 4QRPE 2WO2B 4FCAA 3SPCA 3WNJA 1GZHA 3NEOA 4JLRA 4N5ED 4K3DH 2V3EA 5I6OA 5I1AB 3GK8L 5EU4B 4U1LB 3O6MH 3QIUB 2EJ1A 1XR8B 3RNQB 3TZVB 3IPBA 5H2BA 4DVRL 1G1CA 5J1AB 5DFAA 5L0QC 2FX9H 1NPNA 4MGXA 3KS0J 3O3EA 4HIHA 1PPIA 2BFGA 1M7IA 1XBDA 3HE7C 4ZMLA 2DIBA 3BP5A 3KJ4C 4Z78B 4AMXA 1ED3A 2LVEA 4O02H 3QJFA 3W81A 3UYPB 4GKSA 3GFUA 1QSFB 3QEQE 5AVSB 4MRCA 1A6AB 1VADA 3D51A 4FQIL 4PLKC 4FNPA 3AREA 2J88L 4M4RB 3VYOA 1MREL 1WAEA 2AMGA 2R0ZL 3FHEA 4HWEH 4P4KC 2FWUA 3HG5A 5FO2A 2DDQH 1GYUA 4BXSV 4HPYH 4OFKA 3PY9A 1IKNA 4WI8A 1UZ8B 3KPMB 2B1HH 4BQBA 1CZ8H 3V4UH 4WFFE 2X53A 2CLRB 4NIYE 4RZCA 1ORQB 2VXVH 4UZSA 2R8SH 5HJ3A 5IM7B 2EIEA 5FDWA 2VLMD 5EN2A 4CC4C 3EOBB 1BQHA 1FH5H 2F8XC 1EO7A 3Q6FB 2AI0L 4DUXA 5DJCA 5EIIB 2EYSB 2ZX7A 4U1NA 5CGYD 4JO2H 43CAB 3RWCA 3CLEH 3VXUD 1XGQA 1ZHLB 1N59A 4ODXA 4FLOA 1XF5B 2VMCA 2Z8SA 4CUCA 2ZOLB 2G5UA 2MMXA 5ETUB 1G9NC 3GHEL 3SDAD 2OW6A 4XO9A 1A6VH 4F8QA 1ZGLP 3WIHL 3MUHL 1EFQA 3MLSH 1HXKA 3PNWB 3F58H 3K4ZA 5D7LE 5T3XE 4S2SA 4G2AA 3M1OA 4DEUA 4QCIB 3KWWB 3GBDA 5BS0A 2YQ2A 4FZ8L 1OW0A 3UZVB 4MJ5B 2E59A 2NUPB 4KHTH 2GQHA 2F19L 2CHXA 4G1MA 1HHJB 4Y4KD 5ERWB 3T0BA 5AB2A 1GOGA 4QRTB 3DVFA 3GLDA 1X44A 3C5SA 4F24A 3BVNA 3CK0H 5DVMA 2ZWNA 5AZEL 5J1AA 1A7OL 1OVZA 4H0IA 3OGCB 4WSJA 5EF0A 4TM9A 3SQOH 3L48A 1CFQB 2VQUA 1UOLA 1U6AH 1XB6A 2SODB 1IMHC 3JVFC 5L8JB 2CLZA 1M9SA 3VGFA 2E6JA 4N0YH 3DOHA 4OD2B 3MV8B 1IKNC 1K5WA 3PL6B 2XXCB 1FHGA 2LLLA 5CSGA 2AQPA 3C6LD 5TQ0H 3WEBA 2XXFA 3OVUB 2YO3A 5B3JF 5AVVB 5FM5M 2NXYB 3AB0B 1KN2L 5C0AD 3F6JA 4M5SA 1MWAH 4FJ6A 4R7DA 4HF5H 5IB3B 1THAA 4Z0BH 2BXZA 5CINH 1Q38A 2A9CA 2XN0A 4KUCD 4MMXA 1YUKB 1ZLWK 1LO0H 5FO8B 3MOAL 2Z92B 3A67L 2R2BA 4C47A 2F6AA 1FUNA 2AEWA 1YVLA 1CLYL 2EE3A 2YXVA 2ZG3A 3KNBB 1KCRL 1KB3A 4PJDA 4X99B 3LX9A 3ZGIA 2MOQA 4AIOA 1K6QL 1XD1A 2EE6A 1QACA 3QUZB 3NCBB 3BIBX 3NEEA 2X3AA 2ZXCA 4HFWA 4ODSL 3LDBB 4F8OA 5KSBE 4OLZL 3Q2WA 2J12B 3DGGB 1T3FA 2AJVH 3VG0L 5HHQA 4UQ2A 3EJJX 4G8GA 4CKQA 4ZG1A 1JHTB 4PR5A 1A6ZA 3FT9A 3I6GA 5E2TL 4EIZC 2DQHL 2DIEA 3UC0H 1DVSA 3CSBA 5DA0B 1WCBB 4QMEA 5JIDA 1LDPH 2QSVA 2VM3A 5I2IB 4M5TA 2LE9A 4Z8FL 3GBMH 4I9WE 1UQSA 3RIFK 4FXKA 2X4TB 2VN3A 1CICD 3SQBA 2QEJA 2ZICA 3ZDZE 1INQB 3CFTA 3WO4C 2FHBA 1KN4L 2B2XL 3K2KA 4G6MH 1DQMH 3T0WA 3D05A 5IFJB 4B3VA 1HAWA 2K7PA 2R51A 5HYJA 3HLKA 2BNRB 5I0XA 3PYCA 2DTSA 1S2EA 3NABL 4M1GH 5F3HB 1TEYA 3ESUF 3QUYB 4YFDB 2F5BH 4O2EA 3SDCC 1LK2A 1U2CA 4Y2DB 2DDQL 1G7LA 3U46A 1UD2A 1NFIB 4Q4EA 1WYJA 2DLGA 3VTMA 3SBRA 4HWBL 5BV7H 4WWNA 4ZXBC 2DIJA 5FCUL 3ZQWA 3SHSA 3Q9PA 3MCLL 4Q74A 5CEZH 4QRPD 1FYTE 1UACL 2HKHL 3MNWA 1Z6JT 3B2UD 3ZQ9A 3VXOA 3UBXG 3ARTA 3THMH 1EBAA 5F1IA 4OQ1A 2Z7UA 4WUKH 3U30B 3CQPA 5FA3A 3KYOB 1YYMH 3QI9D 1GYVA 3LNHA 3BPCB 2AK4E 4NC0B 3O9WD 3TIDA 3GB7B 1NJ9B 2Z35B 1Q9WA 4GS7B 1H5BC 2BOBA 1IE4A 1Q1PA 3E6FB 1QNIA 3HI5L 4MB4A 4RFEA 4ZMNA 3IXAB 3WO3B 4I3GA 4JQIL 2CAKA 4P4KA 3UAJA 4KVNH 2HT2C 2ZXBA 1K4CB 3ILDA 3QWQB 1AE6L 1AZNA 3VXTB 3DHJA 4K9EH 5JPNB 3P0GB 5C0IB 1FSKC 4HU8A 5F3FA 1S3RA 3D5OF 4MQSB 3OAYK 4NQCB 4X6BB 3WAJA 3H9ZA 4XRCB 5DQJA 4LL1A 1XEUA 2OPCA 4HPYL 4OIAA 4F9PC 4QRAA 3VXME 4YBLB 4HU2A 2P5EA 3P77B 4KTEH 4QHNB 1ES0B 4ZMZA 2VITA 1JRHI 1ZWIB 2CO4A 3CFEB 4GP8B 3MCKA 1U8IB 5IVXF 2W59A 2WSDA 2ED7A 1BHGA 4WFHD 5F7HA 4S0HA 2QGDA 1QUPA 1ZLDA 2ZONA 3ISWA 4LLQB 2BX5A 2NXZC 4O51A 1D7DA 2UY6B 4XMPL 5JQ6H 2DYPB 2VNCA 4ELMB 3HC2A 2R29H 4YPGA 1B4RA 5CLWA 4IK6A 2HKAA 1RJZA 1S9WA 3MRQA 4AK2A 1UWXK 3POCA 4E42A 2EEDA 3F7YB 5A43C 1YNTB 1LEGA 2DM2A 5AVTB 5I0DA 3DOIA 4OD3H 1O7VA 3UTOA 3TYFA 1OGSA 2CJTA 4LLVB 3O4OC 5CGYC 3X1GA 2VDQH 4A7QA 4JZJB 1G7HB 3H3PH 3DLQR 2J4WH 5B38B 4OIFA 3T08A 4KRMB 3T1FA 1FV1A 2FT6A 5GS1C 1YY8B 5E1AA 1PG7L 3L4ZA 2HVJA 1Z5YD 3KPOB 4H13C 1P7BA 1OTTC 3FQNA 3TA3C 4DESA 1GAFL 2CUMA 4V2BA 4H40A 2P43B 1CTOA 1H3XA 2IWKA 4KDWA 4DJMA 1M7XA 5E99H 5FUOL 1QAWA 2A6IB 3A6BL 3GM8A 4IKKA 4GQRA 2DQCH 1QBLL 3GINA 3OKNA 3UMTA 3VTAA 4ZFOL 3PDGA 5EFIA 3K2UH 1M3JA 5EEWA 3ULUD 1K4CA 3WIIH 5AAMC 3QO1A 2OMVB 5INCA 5FLVA 5HI5C 4MDJB 4XHJD 1OB1B 2N3JA 2CRYA 1NLDL 1JGDA 3VDAA 3TO2B 1U4FA 4KH2A 4OT1L 5ICXB 3RDTD 3BD5A 1WIUA 2LU3A 4Y19E 1BVNT 5CR1A 1A3RL 1BSIA 4FNTA 3RIFF 3OMIB 4BCYA 1HKLL 1P5UB 3FB8B 1FFOA 4YIQB 1A66A 4DAGL 5DUBB 4HIJB 4V1DE 3D0LA 5LG1A 2I25N 2DL2A 3ULVF 5BMFL 1JZDC 4RNRA 1HEHC 2OZ4A 4LSTL 1UKQA 4N3TA 3MVSA 3FQTA 4L3CB 2DQGH 5DJDB 4EUPH 4HVBA 5JA9A 2F54A 2XWBB 1VEOA 3MRFA 1AIFB 1M57B 4LU5H 3WXWL 2H3NA 3INUH 1GIGH 1MCWM 2OR9L 2VE6B 4HF5L 2YAEA 3CH1B 4HWZA 4K94L 2V9UA 1S9XA 4R9HA 2VQ1B 3VQ1C 1SRDA 2ARJA 4N9GA 4WSKA 3UBGA 2GTZA 2NYZA 1O75A 4FTVB 1XGUB 2BDNL 1I3RB 4QRUB 5DD5H 4GFXA 4IHOB 3DYOA 3MLZH 3IDXL 4R0LC 3IDJA 3MJGX 4TL4A 5EO1B 4Y5XB 3SBWA 3AWEA 3VFVB 3KPRE 3NJNA 1FO0B 1UXSB 4N0CC 3TLRA 4L8BA 1F8TH 2V3DA 2VSMB 2H2PD 2HG5A 3N43B 5C7XL 2XA8L 1U6AL 3TA4D 4X7EC 5IBUB 3ML8A 4P5RA 3L5WB 1KJ3H 2XRAL 3L3HA 2VSKB 4KKLC 1U8OA 5DHYB 4S1RL 1JAEA 2YPKB 2A77L 3NIFB 4BFGA 1BW8A 1XXDC 1HK6A 2FSDA 1BGXH 1RP8A 1I3GH 1P0SE 2D73A 2NYYC 2WGNB 4WI4A 4X7SH 1KXHA 5KOMC 4G6JH 5F70A 1KJ2A 5KVEE 3ISYA 3ZSSA 2WO3B 1JGVH 3MODH 4UILL 1FJ1A 2MPAL 5AVWB 2ZOWA 3LZOA 3HN3A 5IBUG 5D71H 3CFBA 2FX7H 4V2CB 2K6YA 2E7DA 1WA2X 1NCTA 1HXYA 2UXVA 4FFZA 4JQVC 2R9HD 3OX8A 4KROB 3UTTB 2XQYA 5JOEA 2NZ1A 2WQ8A 3MLSL 3CUPB 3X13A 4PJFE 1Z3GL 5EN3A 3QG7L 1X9RA 1H5BA 3JV5A 3WIFA 1CFTA 3NOIA 3TGXA 1KEGL 3BP4B 4D3CL 4FD0A 4G83A 4KGLA 4I9XA 1O0VA 4K9EC 4G6AD 4CU8A 5FHAH 1NANH 4A67A 2GG1A 1NAMH 4KKBD 1HXMA 1Q0EA 4GRMA 5EF3A 2BFVH 4K7FA 4DAGH 1DQJA 3S88L 1PBYA 3D0LB 1HCFX 4A38A 3BWZA 2IWFA 3HE6D 4BK5C 3BQUB 1ECYA 4MA7L 2RB8A 3NCEB 5IB5A 3SE8H 1YCSA 4C83B 1A1MA 2BZDA 1ZANL 3X3FH 2R2HA 1QVOA 1UA3A 5BOPA 1Q9KB 2Y7MA 1BQ5A 4EF3A 3C60C 4BD4A 3VI3E 3N06B 2HPTA 3CIAA 4QNPE 1A02N 2B59B 2ADIA 1XQ4A 1U8MA 4RISH 4PRDA 1WZAA 1UT9A 1VCBC 3ALWA 2P5ED 4P46B 3WUWA 4DKAA 2YPLD 1ZLUH 5L6YH 4LVOB 4RX4D 3T5WA 1KJ2H 2Q87A 1I9JL 2R83A 3AU1B 5F0MB 3ZUNC 3SPHA 2XV2A 2JIXA 3P9MA 1M42A 3GMPA 3L4YA 3UJIL 2OMXB 3HAEB 1E28A 4QHLA 5FCUH 5GQBA 5JLZB 2A4EA 2NY2D 2QSCH 1JHKH 5J7CC 5GRVK 5KS9A 2RBLA 1ECZA 1U8OB 2UXFA 4UBDD 1J8HD 2A73B 2KZKA 5DJCB 3HS0C 4U1HB 1ITCA 3VGAB 3VXNB 4JAMA 4GEIA 4WCYH 2OYPA 4RAUA 1UTDA 1EEZA 3LXCA 2J2ZB 3RBSA 5F1NA 4OJFH 2EXYD 1I1RA 2PTUA 1MHCA 3U48A 2QVTA 1U8IA 4YGAB 1UOVA 4ICWA 1S7VA 3UCQA 4PJXF 2X2UA 5AW9B 4DT2A 4CU6A 2XG4A 4LT7A 1JBJA 1EEYA 2IV9A 2RMNA 4H20H 4LARL 4PGDB 1T20B 4TSAL 2WGXA 3C5ZB 3GUFA 5GRYA 4YSSA 5IESH 5H8DA 3QORD 3U82B 5J12B 2NY6D 3G5VB 2WZ6A 5I74B 4QO1B 3BN9C 4K23H 3WHXA 3RZCB 4PJ6A 2HPOA 2NLJA 4P5TA 1YHPA 1ZV9A 4B0MB 4IRJA 1KEGH 1TEGA 3R18A 3U0TA 1OIOA 3C8HA 4K5MA 1DTUA 5T1LA 4EDWH 4B97A 3QG7H 4AQEA 3VXRE 2P8PA 3APDA 4L3ED 1J8SA 4LCYB 2VGLM 4EAEA 3D3VB 1EDQA 1HXMB 3SPJA 3N44B 2ZSVB 1ODUA 3F7QA 2GB2A 5TF1L 4KV5F 3TT3L 4K5NA 4OZ4B 4XBEH 1X4ZA 2EDEA 4NPJA 1F11A 1W2KT 1W6WA 1IQWL 1C5DA 4N2NA 1AKJB 1FIGL 2CGZA 2ICEB 4FABH 2CRZA 2WLIB 4WUUA 5FKAB 2X05A 5A2CA 2Y23A 1QHOA 4QGYA 5JIHA 1YG9A 1UB5B 1MLBA 3JWDL 3TH2T 2CUHA 3EADA 4O4YL 4JFFA 3WIHA 2CPUA 3CU1A 2EDOA 2YJLA 4HX1B 3KWVA 1ADQA 2IBZY 4MRBA 3DPBA 1M6OB 4ZOCA 3RILA 1K72A 1H8SA 3EFFA 4GKNB 4RVBA 2WUBH 4P57A 2IC2A 3HRZA 3V55A 5JXAH 2GYSA 4PJIA 1W72A 5TE6L 4UIMA 1T80A 1JPGB 1IBGH 4NQCE 2Y6TE 4LHUB 4JFOB 1JGUL 3I50H 4XI5C 4FQXB 1ZGLA 1XSOA 4W9IC 3KYNB 3CK0L 4E9SA 4NNYB 3ARFB 5F1NB 1LDSA 4NN7C 1AHKA 1E5BA 3Q3GA 5HDBE 4IBVA 1ZVSA 5D1ZI 2CJ3A 3PWUA 3KBHE 3HG3A 2JSFA 1DLHB 3HKZA 3MLWL 2H45A 2NY5L 3FU5A 4UB0L 3GXNA 4M6ML 4HP5A 4Y1AD 5HHXH 3W38A 5DJXA 2W9EH 3GRWA 3QDGA 5GGUA 2CIIB 3NSXA 4AQ1B 4GXFA 32C2B 1DBJH 2G3XA 4OZGF 5I75C 1CLOL 3AS2A 2BSSA 3CBRA 2WJ7A 3CZUB 3PWPA 4M93C 1U93A 3LV3A 3QUHA 1QBBA 1DJIA 4DO6A 1YPZB 3JBG7 1C08A 5H2BB 2O4EA 4BZ2L 3UPRA 3U7WL 1NLDH 1IIIA 3NN8A 3RWIB 3ZE1E 3MACL 4G6FD 5D7JD 2X3BA 5FHBL 4XVUD 3UBHA 3PDDA 5E95B 4AYEC 4Z76B 4HZLB 1FL3B 1OAJA 1TF4A 1TZ8A 1OE2A 1QEWB 4R7NB 3MYJA 4XNYH 3T0XA 1S8DA 4AUUA 3QCUL 4OCYH 3R7QA 2YSTA 1KCRH 5DYOB 3SDAC 4G8GB 1XVSA 2ERJC 4X5PA 4HUMB 1OP5K 2DKUA 1WWCA 1NGXA 1SEBB 3DARA 1LO2H 4WJKB 4KXBA 1T1ZB 15C8L 1RMFH 1WWWX 3ZKNC 1JERA 4FFVD 1MDAA 1VFBA 4MAYC 1I4FB 4YDMA 3ULVD 3SKJL 4B41A 1ETJA 4HLJA 4N2EA 3CFBB 2VRKA 1YJDH 2OCFD 4S10A 3IE4A 4XCFL 2RD0A 5DUJA 1BPLB 4G1EA 2PCPA 4OF3A 3CC1A 3ZGHA 2VXUL 3OKOA 4P99A 1E8WA 1EO5A 2FJUB 4PJ8C 3N40P 4M6NL 4TQEL 3JV6A 3O2VH 5DU7A 4P2QA 4TTGA 2QVIA 4HUUB 3TL5A 5EBLB 5HHOA 4P9ML 4UNUA 3PNRB 1JVKA 3A22A 4OFPA 3WFBH 3T09A 1NEZB 5D7SH 4URKA 4Z7QE 1SOKA 3OMAB 4QTIH 5F7FA 2IOOA 5TDPB 1MCNA 5C0IA 4L5FE 4JY5H 1FPTL 3T4YA 3ZR5A 3BZ4A 3HMXH 5D7SL 1NDMB 5GS0C 3KWUA 3UJIH 2H1PH 4FKEA 2VLJA 4PLOB 3QQ9D 3D4YA 1H3GA 5AOMA 2N4IA 3HG1D 3BMVA 2VW4A 3CX5K 1DLHA 3RVVD 4WHTB 4AGLA 3UZVA 5AL0A 5IQ7H 2OAAA 5JZ7D 4FEMA 3AM8A 2J1YA 4LVOC 4P23C 5DZOA 4Z7VB 4Z0XB 1X5ZA 4RISL 4JFWA 4GS7C 3CSGA 2WQSA 3SDDC 4J3BA 1WS8A 2IPUK 1S3KH 2XACC 1RZ8B 3MRIB 3E6FA 1RUPL 4AM0A 1PZBA 4FHJA 2AC0A 2KPNA 4N2HA 4LRIA 4KPHH 3X12A 3NFPA 3BEWA 5EOCH 5GISL 4KO5A 3SOBH 4MNGA 3JZ7A 1P2CA 2V3FA 4CJ1A 3SDAA 1DJZA 3QH3A 7TAAA 3DBSA 4S1DC 4JQIH 4LDLB 4YHLH 5KSAB 4X7TA 1H6EA 4JFEA 5CJXC 4G43B 4JNXA 2WWOA 4HUVA 2YRPA 3QUMB 4G8FB 5MEND 3IJHB 1MI5B 3GT6A 5AVZB 3I9GL 2RJMA 5J4MA 2X89D 3NPZB 4K5PA 1NBZB 2BRRH 2WXQA 5TE4H 4OZHE 1IGIL 1IRAY 4I2XA 3D08A 2XU9A 1TSRA 1K3IA 3JSSA 2VH5L 4ZMVA 4ILDA 3CFDA 4IOFD 1M7DA 1IM3D 2NY3D 1B3JA 4DO4A 4QHPA 3UTSB 5ACZB 3OMNB 5GJTH 2UVFA 1EXHA 5HGDB 1JFQH 3CPLB 3LKOB 2R0ZH 4HWEL 4GG6B 4GEJA 2O93L 4NQVB 1P9MC 3ET9F 4UUJB 1AGCB 1KBGH 1WBXB 3WV0A 3AITA 5EEXA 3QZBA 2GTQA 2VR5A 1L3NA 1D6VH 3HR5A 3ASOB 1FGNL 1CTNA 3B7YA 1D3CA 1S7WB 4NC1E 5IHUL 1L9NA 1O9VA 4APQB 3PWNA 3QIWC 3ARBC 2WVUA 3IFPA 5EV7A 1T1WB 1J05B 3PIQB 4GUPB 5J57B 3CH8A 2DRUA 3BFWA 3TEYA 1NUGA 4AENB 2VB5A 2I26N 4IRZA 3T8MA 1KSRA 4U31A 3QAZB 2HVJB 2F53A 1NIFA 1SFDA 3VH8G 4FXTA 3MUGA 2QVKA 4K2UH 2UYLB 1QO3A 1YYCA 3IMWA 2XQBL 4K5LA 4EVNA 5K69A 4JHVA 3O9WC 1QFOA 3NJGA 5FR3A 1CQYA 1CGYA 1CGXA 3EJSA 1ZT4B 3SY0A 4JKPL 2XTJD 3G04B 4L4VE 4J28A 1FZKB 2QPDB 1G9MC 1WVZA 2ISDA 3QPXL 3U2SA 1NC4A 1D5IH 4XE0A 4MDJA 1U3ZA 5EIQA 4YSEA 3T6QC 4CRPA 1VJSA 3GI9L 3G5XB 1M3IA 1U58A 5C0DA 5JW3H 1T83A 1PLGL 3TO2A 4L8SA 4IDJL 5KW9L 3BWUF 4X4YA 4OM0H 1MQKH 4Z7UF 1CK0H 3VRIB 2W9DH 4NRYA 1LK3L 1EZSA 1P5UC 3L7EB 4ENED 1S9VA 2ZWKA 2M2DA 4E68A 4H1LH 2YA1A 2Z31B 4U1NB 1X4XA 3FTXA 1VEMA 1JCVA 1NM4A 4XP5L 1IT9L 5D96B 4FCHA 1FFRA 3MLRH 3MO1B 4KWUA 1TTUA 2Z35A 3QEGL 1CFVL 1OK8A 3CZSA 3SGJA 4OIBA 2BS71 3FZUC 3QISA 4GBXB 4Q89A 4J4PD 1MW1A 1I1FB 1TVHB 2NNXA 3LSOA 4LVHB 5JNYA 3PNWA 4LCIH 1FRGH 3GF8A 1VF5C 1KZYA 2BSTA 2WIIB 3KDPB 2RTTA 4J2QA 3EBHA 3HUJF 1WFOA 3HB3C 3HVNA 1KGWA 4OI8A 2YZ8A 4JPSA 5HGDA 2R59A 4HK3J 4MJJA 4FMVA 3KWWA 4XNAA 2RFXB 1AY1H 4D9QD 3LAFA 3TM6A 3WMSA 3QDMB 5I74C 3H7LA 4ALAL 3QT2A 1LO3L 3LD8C 4IEFA 3RWIA 2H3XC 3EOBA 3VGDA 1LWHA 1QWUA 1ZWIA 3NJJA 2V5RA 1IM3B 4QXGH 2DKSA 4GINA 4HKBB 1IQDA 1MAKA 2DTMH 4XPGH 3VDCA 1XBRA 1P7QA 4K7FB 3OJVC 3ZHFA 2J8UE 2D0GA 2GAZB 4LSRL 4YHOH 3WN6A 4WJG3 4V1DA 4F8PA 1W9XA 1A4CA 4PU2A 1ZIAA 3JWNE 4ODWB 5F7DB 3V0AC 3IFOA 3NRPA 1U0QA 1S7UA 2K9FB 2F54E 4O2FA 2GSIB 4FP8L 4U3XA 4KRLB 4PJDF 5J11C 4LASH 2XWXA 1KEMH 2XCMC 3QUGA 1U2YA 3WFDH 3RNKA 1HYSD 4M00A 3VFTB 3K6FA 5E6IA 1BZEA 1OB1A 5GXBB 4JO3H 1I1CA 5DZJA 1H3WM 5JHDE 1Q0XL 3ATDA 3DUHA 4CNIA 5D1XD 2HB0A 2F74B 2ZWLT 2IDUA 2NUTB 4NP4L 2Y1ZA 4N0UB 5FAAA 3S8WA 1CUOA 2P24A 3DSNB 3L1FA 4FFZH 5FXCH 3NQKA 5HGGS 5BVPL 2G9HB 1I9RL 5CJ5A 4CVZB 1EJFA 3TZVC 3GHPA 3BZ4B 5D7IB 4FQJH 4IRSD 2DQTL 4HW6A 5IOPB 2BHUA 2OI9B 2PWEA 4NWUH 2QV2A 2ALWA 4B9PA 2EC9T 4JMNA 1DEEA 4TUOB 3DGGA 1HSAA 1X7TA 2WUCL 3OR6A 4LCWE 1YYLL 3CXHJ 3RJQB 2N59A 2Y1AA 5I26A 2VZ1A 3NSFA 4MNQD 4XMKH 1I8LA 2DOCA 2AQ3A 3II3A 1AH1A 3DI3B 3NCYS 4PRPA 1ZS8A 3CVHL 3GJFH 5F9OH 4G59C 1RZ8A 2IQ9L 3MRIA 2G5BB 1MRDH 2A0LD 4L8DB 4QKXB 4PJCF 1N68A 5ESQA 3T6ZA 3I6LD 4GQ9H 5MP6L 5DUBA 3MRJB 1BXAA 1WT5C 4LCCB 1N18A 4HUXA 4IKJA 3L3GB 3WE1A 3ULVL 4RNRB 3QJHB 1DFXA 3GMQB 5MEOB 5C70A 3L6FB 3RX9A 3QORA 3AU0A 3V5KA 4UDTA 2G5RA 3FT3A 4HFWB 4PRHB 3NZ8A 4PB9L 1HZHH 2H7WA 3CSTA 4O58L 1EEZB 1JZ6A 3ARBA 2EXWD 1A6ZB 2ESVA 4YO0B 3HE7B 2ZKHH 1O6VA 2AAAA 1P4BL 3MRMA 2OJZL 4OZHB 2KLSA 4NENB 5E0FA 3WJJA 4PH8A 1F13A 1PFOA 2B2XH 3ARFD 1CXEA 1MJJA 2BP8A 2C26A 2FHFA 2PPDA 2BP3A 2ROYA 2XJLA 3MLYL 3MI6A 3O11A 4A2HA 3QJOA 1KBWA 5LAPA 3NJKA 2GUYA 2ZKMX 3FB5B 3A6CH 3RZCC 1ANUA 2G0LA 3G08B 2X70B 3FTWA 4XXDB 1C8QA 1R3HA 3DIFA 3QS2A 5T1DL 2OL3B 1I75A 5DS8B 1XB3A 4F92B 3EHBC 3WTUA 5LWYH 2DQGL 2BVPA 1U8QB 1P1ZB 4KOBA 4BZ2H 3LXAA 1DVFD 2EE2A 1ZIBA 3NAAH 2QKIA 3QVAA 1AO7D 3HG1B 5DD0H 4GOSA 1QSFD 3L95B 5J89A 1E2ZA 1VGEH 3QXWA 2HP4A 2ZX6A 3GMMB 4Y5VC 1HHHB 5ISZD 3UTQB 1IFRA 1O5PA 3GBEA 4NWUL 5E1QA 1S6NA 3A24A 3GTVA 1CMOA 2NXZD 4H1LA 2XN2A 1BCIA 2DH2A 4OQTH 3UJJH 2R0LH 3WFHA 4NZUH 4X9HA 3LPPA 3MUGB 4S1QH 1WFMA 4XBEL 1AKPA 1QO3B 4LF3B 1FE8H 1UXLA 1DSYA 1AJ7L 5ERWA 4UNVA 4M8RA 1PAMA 5TQ2H 2DWEA 3GXDA 4ZZKA 5IY5B 1BWMA 2V5MA 2WXFA 1S5IL 1TTBA 5E6IC 4B9CA 2WNKA 4Y2OB 3CJJA 2WB1A 5DO8A 32C2A 3CHRA 4UQCA 2HRGA 4IRZL 1TXKA 3IAGC 2YBRB 1I7RB 5BV7B 3RLSA 1I8KA 4RWHA 4JM2C 4BZ1L 1ILSA 4AIEA 3D9AL 5F7EL 5D1QA 2ATPB 3EGXB 4OAWA 4J7RA 3NCMA 5I18H 1URLA 3TA3B 4OLUH 2JKRM 4OCRL 3J8F7 3JWDH 4PR5B 5IMLA 1J0KA 3I6GB 3HFML 4P2AA 4R4FH 3DK2A 1YMMB 3PQYD 3VX0A 2F5AH 5ADPH 2IG2L 5ABAA 5SWZB 1OT4A 4HOZA 1X6LA 4HKXB 4X9IA 3E38A 3FZUD 4YHNA 5DQDL 5CFHA 4F9LA 3G9VA 3TONA 3PXHA 4JG0L 3T65A 3OQ3B 5C07A 2QPSA 1IGYA 5LAXB 1T04B 5E4EC 1MCWW 4G9DA 4YZFF 4DETA 1U3YA 3GDCA 4BFNA 1P4LB 1RUMH 3B43A 4GPVA 2VT0A 3DYMA 1BZ8A 3TV8A 3IDNA 1E28B 3RVWC 3WHE1 2RH0A 1QI3A 4WHCA 3J2PA 4D0BB 4AE0A 1MHPL 3MLXL 1LK2B 5AOJA 3V8OA 2ZPKH 1UM4L 1VIWA 2FWOB 5TE7L 4IBUA 4N6RA 3Q48A 1L0XA 4MMZA 4LLVA 3O81A 4GSQA 2DYPD 1TQWA 3DX7A 1IAOB 5GZNA 1EK3A 2EDTA 1H8NA 4MJ2A 1NCDH 5GRWA 5L2KD 4XHJC 2OK0L 2E27H 5KSAD 1AD9A 1T0NA 1UT2A 4P59H 4B6ZA 1BJ8A 1MY7A 2GJ6A 4NUJA 4ZO6A 1KFAL 4KK5D 5JHDD 5LNEA 1QKZL 2R1WA 5F7WC 2VLJB 3T4AC 3UIYA 2Z1KA 3MV8E 3K2MC 3MRPA 3PABB 5GGRA 4FXLA 1F2XK 2Z8WC 5CR8A 1CTMA 1Q9LB 4AYSA 1FYTD 3FQWB 1OSEA 2IOMA 1QR1B 4CGUB 4IRJB 1ET5A 5E2JA 3U0TB 2NR6C 3GXMA 9PCYA 4Y4KC 1A0QL 4N22A 1F90L 4XVTL 1MCDA 4KITB 3VWJD 3HUJE 1FL5A 3EDDA 3VD0A 3V2AR 1UJ3C 4KJWD 1DANT 1I3RA 4UCFA 3THML 3T6VA 2PP7A 1MNUH 3QP3A 3LMJH 3Q7JA 2W07B 3O8XA 4MD4B 2HKHH 5BV7C 4OJDH 1JMZA 3NFPB 5DR5L 3LKRB 5HHMD 3L13A 4XPGL 2IF7A 3CFCL 4FRWA 3EF4A 3O3UN 3BUPA 4YPJA 5CNHA 5LN4A 4UTCA 3LJ3A 5E8OB 1SN0A 2HZHA 1IIKA 3LQMA 4G7QB 3ZIMA 2HLFC 5C6TL 1CGUA 4IU2A 5KTEL 3GSRB 2AKRB 2R9HC 4QRPB 3MMEA 3KDMA 3BT2H 3RX8A 3KL0A 5I0ZA 2J44A 1G6RB 2IPTL 2KI6A 4MTMA 1TQSA 4KXZI 5SX4H 1JD7A 2EYRB 2BWDA 1KWGA 4PD4K 1WUNT 5C0BD 4BZ1H 4ZYKA 1I3UA 1MKFA 1YNTA 3D07A 1Q94B 4AM0B 3PXLA 3NSJA 4QOKE 3F7VB 2ITEA 4YSRA 3NDZE 4FI8A 5D96C 1H6TA 9CGTA 1IGFH 1ZV2A 3VXRB 4ANWA 4Y1AE 4ISVA 4LESA 4WUUD 2NY3B 5AAMA 1AHMA 2HUEA 5CD3B 3UDWA 3T4AA 3D34A 3O4LA 1TYEB 4NCDA 2PR4L 5EG6C 4D0DA 1WZ1H 2VR3A 3W0WB 1T0NB 1PU0A 1SBBA 1N64L 3AT9A 1JGVL 1DQJB 1UCBL 2A2QT 3BWUC 3IBEA 3MNZB 5EU7E 5H94B 3QW9A 1QTSA 4O51B 4DP7X 2VIRB 2VLJE 2H32B 2NTFA 3KPLB 5D2LF 4JO5A 2JI1A 3TYGL 3C2SA 4U4BA 1J8KA 3QEQA 3JWOH 4P8QA 3UBXB 4Z0BL 3TBSB 5KANG 4F8LA 1H9VA 3BHBB 4NIKB 5KYUA 4LIQH 5GHWH 4RH4A 2A5UA 4S0TD 4IIQB 1JV5B 4G8EA 4LBEA 3OKOB 3UBXA 1KTBA 5I8OH 4JRYE 3UTTA 1GY2A 1FG2A 5L88H 2F53D 2MQGA 2E76C 5BUAA 2FX8L 2XY1A 4URTB 1BJ1J 4N20A 5EBMA 4KY1L 2YQGA 5I19H 1LP9B 3O0RL 4XPTH 2UZIH 2CA4A 4LMQE 4X6DF 1AZZC 2BERA 3LPOA 1UKTA 5T1KA 2FIKA 4JPKL 2OCCB 2LTQC 3CSFA 2NXYC 3FSWA 3FO2B 3VJ6A 4QHKI 3CXDL 2NZIA 5LDSA 1WAAE 4XAWL 4DVBB 4QRQA 3IU4L 4LCUB 5C08D 4A7GF 3EGDB 2JKXA 1HS6A 3DTUB 2ZF9A 2GITA 1S46A 3ZTNL 1M1SA 1FDLH 4XC3L 3KGSA 5JZ7C 2Y06L 4RGNC 4RZKA 4BV1A 2B5IC 3LS5H 1Z9LA 4N9GB 2R2EA 4HSQA 1KF9B 1D9KD 2G3ZA 1UXWA 4R97B 4POZC 1G1KA 4XNMA 5JW4R 2VRQA 5KVEL 2QADB 1K3ZA 5IG7B 2NR6A 4E0RB 3VFVA 1S4IA 2AZAA 5HGBB 3LRKA 3N55A 3MLVL 1KPVA 5G2NA 2A74C 3O6KL 3QHTC 4HGWA 4DNLA 3AXLB 3EOYG 3AREC 4PRHD 4JFYB 1UYWH 4TSCH 3FB8A 4MMYB 3CVHH 4AYGA 1L9OA 2R29L 3DTDA 4MYPA 3N1PC 2P42B 2WLLA 3VRIA 3ZOAA 3QIBD 5IROC 1F42A 3RL1B 5JW4Q 3F7RA 2I9LB 2TSAA 2BSBA 3EFOB 3KLDA 3NUKA 5D70L 4PRBB 3TV3L 2CO6B 2AV1B 4J3SA 1NCCH 4P2OD 4PV9A 4NZ8A 3OG6B 2D2CC 2O5YH 1FZMA 4PM1A 2IH3A 3QQDB 4O02A 4OTXL 2EP6A 3KYMB 3P69A 2KQMA 4JPIA 4UOQA 2EDJA 5B8CA 1IAMA 4UV4L 2CMRH 2VDKH 3BW9B 4LLUA 4ZXBD 5F7UA 5TFSH 3HUJB 5EOQH 1I7TA 4TSAH 2AJZA 3GBNL 1SXZA 4G8IB 2CDEA 3SD5A 1I3GL 1J12A 3MTRA 4QNPF 1QA9A 1UA6H 3S98A 3B1UA 2NNFA 3K2IA 2JB6A 2VLRD 4GW4B 4U1GB 1QQDB 2RAMA 1FC2D 2W1NA 4PJ9C 4UM8A 5I18L 3N42F 3KLAA 3MRCA 1B3IA 3IGAA 2WYIA 1N9PA 2O72A 4X8XA 1J5HA 2CXGA 4CDHA 1FNGA 1Z9OA 3VM7A 2A9NL 4P0DA 4JKNA 1TZAA 1DL7H 2DN7A 3MRHB 1TLMA 6PCYA 1BMZA 3IU4H 4YBQC 3QRLA 4ZO9A 3S6CA 4F58H 5HHOD 1F6LL 5LXGH 2EUWA 5CHNB 1WH0A 4ZFOB 1Y18A 1BM3H 2EKSB 5B38G 1U8MB 1AR1C 3FFOA 3PABA 5FHAL 2DQJL 5GGRB 5LCVA 5FM5O 2WZPD 2JVUA 3ROOA 5TE6H 3C8KB 5IVZB 5FB8A 3FQWA 1QR1A 3A3YB 2E7LA 1ZLWH 1CDCA 1FORL 4D9LH 1B9ZA 4FNRA 4HMDA 2XXMB 2J43A 2O6FA 3QPKA 4PRPB 3B9KD 1WBYB 4GRMB 5CAYB 5DSCA 3RA7H 5DI8B 1T03L 1YMMD 3PQYB 1CVSC 2OS7A 1FNEA 4PV8A 5FGBC 2Y1VA 1CYGA 3L5IA 1BQLH 4GSDH 1N19A 4ZUUB 2VDRL 5DO2D 2CSPA 2VR6A 3D85B 3ME0A 3DUSB 3PPSA 2X9YA 3MRGB 2J2ZA 4R2GC 1MFDH 1CICB 2CCWA 2AV1A 1KLFA 3WEMA 1Z5LA 2DWXA 3RWDA 1OF0A 3NTCH 1CFSA 1CLOH 1WIOA 4MASA 4GQQA 1FNSH 4KROD 3UTTD 4B9FA 4M93B 4RGOL 1CXHA 4ZZFA 2FJHA 4WUUE 4S11A 2XPGB 5J1TC 4HCRH 3GKWL 4BH8B 3GMLA 4HS6B 2W9EL 1JXGA 3D48R 4NQDB 4XP9L 3IVKB 2G5BA 2F5BL 4UYPA 2IH1B 2NY1B 3IMVA 1EAQA 1Q72L 3VH8B 4HJEA 1SQ2N 3NK4A 2FIRT 5JXED 3BP5B 4CVWA 2X4RB 4PTUB 3QS3A 4X98A 1PG7W 4F5CA 3D39B 3O6FB 4ISVB 4IOIB 4POYA 3VFWB 1W8NA 2JV6A 4HZAA 5FYKH 3FFDB 1AACA 1JZEA 2Z8VC 1J0JA 4TV3A 4P23A 1HDMA 2R23A 1MQ8A 1UWGL 3QXDA 1O5DT 2JKIS 4XXWA 2C9AA 4AITA 4ORGB 1KPUA 3TPUA 1B90A 4JHWL 4TVSa 1BG9A 2PABA 2J1XA 4H5SB 5H94A 4C56D 3Q8CA 4O2FB 4WJ5A 4M6OL 2MHAB 4LRIC 2FYVA 4QO1A 3JWOL 7FABH 1NCWL 3QG6A 4P3WA 1EO8H 3HN5A 4TLKA 2Y3AA 1LWRA 2CA3A 2RFXA 2WOYA 3TCXA 5LGKA 1ADWA 1I4FA 3QGVA 4NJ9L 4XPBH 1WICA 1F1DA 3P11H 4TUKH 3PWPE 5KYUB 2H1LM 5HDQH 3VCLB 5ICZB 1RUAL 3LEVL 5E1HB 5TK4A 1EDHA 1SXBA 3HZYA 4QT5B 2LU4A 1JN6B 3DGDA 4F1ZA 4G6AC 1QZ1A 1BMGA 1BYNA 4U1JB 1J88A 4YMPA 4I9WD 4LVNB 5IQ9B 1LO0L 2WHVA 4QR7A 4PGEB 4XN9A 5E6YA 2XC8A 3MJ9H 3ATBA 4ONHB 5ENWB 1OP5H 4F58L 1L6ZA 2C34A 3AADB 4WI0B 1DDTA 1GZQA 1KTDA 4I89A 1E50A 4JFDE 5EDXA 5FOBA 1D2PA 2VXQA 4OCLC 5CJOH 2CXKA 3BGFC 1LE5B 2D03H 2V9RA 3ZLQC 5DLML 1U4EA 3JWOC 5C2UB 2QBWA 4JCMA 1UWFA 3NCWA 4R26H 3RHWF 1X9LA 3R1GH 3VX1A 1J5OL 3STZB 1XL4A 2Z93A 1A2YB 2UX6A 3LB6C 3B8YA 3GXIA 2HRHA 3AM8C 5HHPB 2VLRA 4ERSH 5EZLA 2QTEA 1UM4H 2Z9TA 1QRNB 4AI7A 3JV4A 3KBEA 4I48A 5K9OA 5ISZE 1JTTA 7PCYA 1NOAA 1KJMA 1S7QB 1TZIA 2AAVA 4U1IB 2NY1C 4N86A 1W6LA 4KPHL 3FTGB 3WJLC 4KJYA 2KHAA 4LSSH 1NSNL 4A7TA 3GO1H 3KYNA 1DQLL 3VDBA 1M2OA 4N8CL 1S7TA 2DM3A 4U05A 1BF5A 3V79C 2GSMB 4FG6D 4M43L 4PTTA 4Y0GA 4L8CA 3T8XA 1I8MA 2AQ2A 2DL9A 1YNKL 3S7GA 1SLVA 1T1WA 2L8AA 2FO4B 3QDGB 5AW3B 2FJFA 2VDKB 1CFBA 4BWUA 4MJ6A 5L9DH 2AERT 2WQVA 2BSSB 1NCAH 4ONGH 5IFHL 2XQYK 2FSEB 2B15A 4EEEA 3QNYA 4HV8A 5B3NA 4HUKB 4ZPTA 2DICA 5BZDB 1BD2E 1SF5A 4WK4B 1I8IB 2JXMB 3EHBD 3IDXH 1EANA 1N2RA 1F6FB 5A2AA 2VLLA 4PVMA 1VFAA 4IBZA 1KC5H 1QA9B 1CBVL 2NCMA 2ZXQA 4NKMA 2YD0A 4F1SA 3SPVA 4KC3B 4ONHA 1KXTB 1I7ZA 1ZJBA 5IQMA 4LGSB 4LSVL 4DKDC 3SKJH 4OGXH 2GFBB 3EUUA 3N1GC 1OPGH 5IHZB 4D8PA 3BIAX 3EH2A 3MLPA 1NCGA 2K6ZA 2G2RB 3LN4A 2OJEB 3HW7A 4FOMA 2WANA 2YLKA 1ADQH 4DKTA 2QT6A 3AT8A 3QJVB 1JGEA 3APMA 4M3HA 4MJIB 1VA9A 4OM1L 5E2UH 3RURA 4RBPK 5DD3L 5DEZA 1UGNA 2H41A 1AO7E 1KNOB 2YPVA 3HC0B 5JOFB 3NP3A 1B4LA 3UTZA 4TOYL 1AIFA 2DQUL 3JWNH 4Q0XL 4BSJA 2EEBA 4N1CA 3SY6A 2EDXA 2P5WA 2FX7L 1WAPA 2MSPA 2NY2C 4XO3A 5AYTA 4YHZH 4AGQA 2CBPA 3Q1EA 1JZ2A 3U46B 1MPAL 4JHWH 3R0MA 2DD8H 3FFCA 5T5FA 3WELA 2BSCA 4YHYC 3ULUH 2Q0ZX 5ANME 2WJ5A 3US1A 4HJSA 3HJEA 2IBZX 2P26A 3HMXA 3VFGL 5C7XH 3WUWG 2Y7SA 3M45A 3S96A 4BGDA 1HC1A 2GSGA 2OKMA 1KJ3L 1BVZA 2VXSH 3JVGA 4P2QD 3VGAC 4GUQA 3BPCA 4L29B 4OZIA 3QR2A 4KKAD 4ABVA 1V3MA 4J3OH 1Q72H 5EZPA 3EH5B 2R69H 1OM9A 4AYBA 4ZMPA 2KDYA 3LQAL 3ASWA 1N26A 4UM9D 4X6EB 4KQ4L 4L48A 2Q6WB 2A6KB 5DTFA 3MV01 5T33L 1ITBB 5AVUB 1JDAA 2F8OA 3W0WD 5BZDA 4QRUA 4JG5A 4DZ8B 3IEAA 3MYZA 3QI9A 1GS7A 3TBSA 2X88A 2FYYB 5HVHC 1N2RB 3U6RA 2MQ3A 4FYTA 3K7UA 4OFIA 5ICYB 5KUMA 3U9UB 1CYXA 1RUAH 3LEVH 4X0KA 4KQ3H 5CJQL 2F7PA 1MH5B 3QDMA 5C0ND 1ZT1B 2BNQE 3ECQA 3CZGA 2Q86B 3DOSB 4Z5RB 1B9KA 4ZFFA 1DVTA 5HVWA 1MI5A 5SWSE 1VERA 1JZFA 4GSDL 1J11A 1JL8A 2BOCA 2EIJB 4PJ7B 4EUPB 1ZHLA 2WK2A 1MSPA 2DLFL 2IGTA 4G6FB 3OHXB 5D7JB 1CIDA 4HJGB 4OFYA 2DJUA 4I8DA 4RMUA 3D09A 4Z7AA 2CRMA 3U1PA 1NGPL 2BHFA 2ZCHL 3DWTA 4JDEA 1MEXL 2KERA 2Z0BA 3WXVH 5E8DL 1ADQL 5DURB 3RWGB 3KYKL 4Z7UA 5MERA 1P84K 1YEFL 2VIRA 2F1BA 2Q8BL 4P2CG 4PG2C 4NAQA 2YBGA 3MRQB 3QQ4A 1AO7A 5I66A 4Z7VE 5EHFA 2OSLA 3FQUB 1IC5H 5CM1A 1KCVL 5AKRA 1BV8A 1FYHB 3Q13A 4QXTA 4WTWA 4OKVA 1I7UB 4IW4C 4PRDB 3OR7A 3BWAB 5K33A 5AVRB 4JY6B 4JO3L 2VWEC 4I5BB 1IGCL 3SDYH 5LGJB 4Q52A 5FW6A 4JY4B 1MCPH 3WLWD 3VYPA 1G4RA 4YSOA 1MJ8H 3B2VH 4L4VD 5FF6B 2IQAB 4WRLA 2JIXB 3OKYA 5AW2B 2GSGB 2GJ6B 5BNXD 3FQNB 1MWOA 4N8VG 1PQZA 5C0BB 3ZKXB 4RGOH 1JK9A 3NRQA 3PP4H 1CLZH 4WI0A 4N2LA 1ZKAA 5L4MA 1U8NB 4XBMA 1J1OH 4KKBC 2A1WL 3ZMRA 1RIHL 3ULVC 2AV7B 3FT3B 3EFOA 3HR6A 4IHBA 3MBXL 3H54A 3KL3A 2CO2A 4F27A 1CE6B 2JLPA 2WKLA 2EYRA 5DHVH 1E3FA 4JLRB 3VI4B 5AUMA 2IH3B 3QQDA 4O02B 4ZUVA 5A3IC 2I60L 1DBKL 2G2PA 1MRCH 1SEQL 4NZDA 3V4LA 3WKNA 3GMRA 5J12C 3HOGA 3F5WB 1DZ0A 3QIBA 3G5XA 4YZFE 2Q8AL 1ZHKA 3BZEA 3AQYA 3QWOB 4JRYA 1OZUA 2BWIA 4XGZA 5D2NE 3BW9A 4LLUB 4NB7A 4OGAD 3Q6GH 2ZCLL 3BKJL 1RPKA 4FNUA 2KKQA 2CO7B 4AX3A 2EUXA 3S3PA 1NANI 3QRBA 3KLHC 4Z5RA 1TQUA 1AC6A 1T2JA 2WXJA 1OV8A 5FC9A 4FNLH 5ABDE 1DBAH 1XGPA 5AYUL 1HH9B 4KTEL 2F0CA 3MGOA 3CV5A 2XG5A 1DE4B 3AMKA 1ZEAL 2Y5EA 2FJSA 3PU7A 1KC5L 1M9WA 1TVBA 3FB7B 3V7AE 2FUTA 5D7LB 3MN8A 3V6ZA 3F84A 1TETH 4XHQA 5GSVB 4P04A 5IVNA 4ZBJA 2D03L 2VQ1A 4JPVL 1F11B 1U21A 1DANU 3KLSA 2Z31D 2UWEB 4H25A 4P9HC 4NQXB 3VXSA 2OCJA 4IKLA 5ES4B 2FUQA 1CZ8L 4JB9H 4MMZC 4JJOA 4XP1H 3LKQA 3MV7A 5F72S 1D5ZB 4ZOEA 2QFRA 4LPUA 3DO3A 3VWKB 1HZKA 3MJWA 4PS7A 2R1XA 4GBXC 3JT2A 4K73A 4PRNB 3RZCA 3CN1A 3T3PB 1HEJC 4K3DL 4NFBA 3MCLH 4APXB 4RFEB 1N70A 1TSHA 2DTML 4P07A 1X7QB 5JA8B 5BV7L 5I1AA 3S3SA 1T5XB 3F7PC 1E42A 3AQXA 4M4PA 4HKBA 2OMUA 3C60A 1AOZA 3R7RA 5DVLA 1CGWA 1RP9A 3VM5A 3H2WA 2FX9L 4DVBA 2QR0B 1YA5A 3UJJL 2NTFB 3QFJA 4I2XE 5TQ0L 4OI7A 1RSFA 2HWZH 5HYQB 2WBXA 4OAWB 4FYQA 3E1F1 1F4YL 3FAXA 4WU5A 5J06A 3AJ7A 4R8WL 3DJSA 3L3DB 2E8YA 3T2NH 4PGCB 4GKSB 3X1EA 2V2XA 4HFUH 2V2WB 2PP8A 2DW5A 4XCEA 3OKKA 3MLUH 4I4WB 5LCVL 4H7VA 4Z8FH 3DRTB 2XRAH 3ROOB 3R8BB 4J1UA 2NTSP 1BIIA 3FSZA 5HGBA 4WI5A 1MJ7H 3TVMD 1MI5D 1MJUH 1Q0YH 2Y25A 5C0AE 2CJUH 4XP5H 3H9YA 4ZI8A 5ACMA 5FLUA 1F4XL 2Y7LA 3LOWA 3TFBA 5GZNC 3O6KH 3QHZL 1RHFA 1EERB 3DJZA 4JRXA 5T3ZH 1WP6A 1P7KA 3LKPA 3PWLB 3QWRD 5HHOE 2CLZB 3D33A 3WTVA 4PVNA 4JM2A 3ZZQA 5HY9B 4C83A 2WLNA 1W8OA 4KY2A 4LPWA 3UAAA 3MROB 1T2QH 4J5VA 3ELAT 5BS0D 1KTJA 4JFPB 2WWKO 1HL5A 2FZ3A 2NT0A 2CDGA 3ABZA 4F8NA 1U91A 3QDGE 1EFXB 2O61A 3U0WL 3L4UA 1EZVY 4WI9A 3KYAA 5EU3B 1VFOA 3B2UC 4JKPH 1GGTA 3IGFA 5AAPA 3O11B 4PGBB 3KZ8A 4JGMA 2Z92A 2Z4QB 4BCZA 2R1WB 3KR3L 3I02A 2CIIA 3IDYC 1UGKA 2JTYA 4AQ1A 4AEIH 2IPTH 3VFOB 4JKWA 4MCYB 3QG6B 3JTSA 2Y69B 2D7QA 3OKMB 4XCNB 2BY0A 3RL2A 3VRLF 4M9PA 1OAQL 3FU7B 2QSTA 2BIMA 1G43A 4A2FA 1M2VB 2PTVA 4QT5A 2H0EA 3L95A 1WC7A 2V8LA 3NESA 2BIQA 5DD3H 2Z0UA 2JCCE 1S8DB 4WO4A 5IQ9A 1ZHNB 3KYMA 5D1QE 1OP9A 1PMYA 3EO1B 3F05A 1BECA 2ITDB 1FIGH 3AG4B 5D1QC 4CSTA 3D87B 5EH1A 1KCUL 1R24A 1UCBH 2GUOA 1MAML 1J8RA 1J1PL 1U95B 3QQXA 1Z9NA 2HAZA 3BUIA 5FUZL 5E4AA 2X2HA 4JPWH 2GABA 4JANB 5HDOA 3GKWH 3N9GL 4ZMYA 2CDEB 2ICWJ 3V10A 4YC2C 1BJMA 2WXHA 2BNRE 4RRPM 4Z7WA 2LOEA 2YRZA 5ECJE 2A9ML 2R0WH 4ODBD 4YLBA 1TG8A 5IHWA 1LILA 3HG4A 4XP6L 1SBSL 1YEHH 4TNVK 5D70H 3P4OA 5ESAB 1UOWA 1KELH 2QKIB 3ZKSD 2MOVA 4X4XA 2GTZB 5A1AA 1SLUA 1ZTXE 2P5WE 1F4XH 4BUHA 1YJDL 1FFQA 3MRNB 4Z3TA 5AWNH 5IBLD 3E8VA 3LZFL 3BVTA 4CMMB 5IESL 2FR4B 5DJYB 4MQ7A 4XBPB 4K7PX 3P4MB 2NOYA 4B9YA 2X6CA 3D1MC 1CD9B 4GRWH 4Q56A 4WFGD 2RIKA 5JPMA 1VGKA 5KSVA 1B2YA 4FQHA 4FF9A 5AOKA 4AL8L 2LABA 3WTSA 3QUKA 1QBAA 1XTLA 4G3YL 4JFHE 1C1EL 4NOFA 5HYJD 2XVKA 4NS0A 3V9EA 4M6AA 3QUXB 3PUUA 8PAZA 4P3CL 3WEXA 5SV3A 3EFFB 4ACTA 4JKMA 3QC5X 3K0WA 1AC0A 4P2RE 1NGYA 5DMIH 2N7AA 3SQBB 1KYOK 5KBNC 2LU7A 3H8NA 4NKIH 4N85A 1JG9A 1L3WA 3BH4A 1PZCA 4PV8B 2H1PL 1G7JB 2IG2H 4XZUB 4A2GA 1NMAL 4QHUA 3ARGA 4NHUA 5HXMA 3OL2A 2HT3C 4LAJH 3RQ3A 3FPXA 3T9WA 2NNCA 5C08E 4S1RH 4RMSA 4MXVF 2W8CA 2HRPH 1JWMB 3QJFB 2WB7A 5HYIA 3OLIA 1AG6A 4ZXBA 5K9KA 3VFUA 1HYSC 2XWEA 3C2AL 2K1MA 3FW6A 1ZA3B 2WLKA 3DSFL 1IGJA 3QPQD 2Q2LA 1KDJA 2EXWC 4F7CA 1EZVX 5C0EB 2WXIA 3ZZSA 2AK1L 4JQIA 3MGTB 4N0CD 4NPKA 3ZDZB 1NFDF 2V0AA 1VPOL 3EOAA 3GI8H 4OZFA 3GK8H 4YFLI 3I50L 4DKEL 1JGEB 4HLZH 1CF8H 4H25B 4MAYD 4MXQD 2AFNA 1QSVA 1Q9KA 1EHKB 1PLGH 3FO0H 3DDGA 4D0BA 4PBXA 1XIWB 1MEXH 3TYFB 5JYLA 4X7DC 4OGYH 2X4RA 4PTUA 4XC1L 2CH8A 1J8HE 3GGWB 1ZY9A 3U30C 2ODIA 1NWPA 2Q3ZA 3VB9A 3BKJH 1A6WH 2UUDK 4HCFA 5MENA 3DTXA 1FQ9C 5ALCH 2G3NA 1Y6KR 2OTWA 3ZIYA 1L5GB 4MX7B 2WYZA 3D0VB 1LP9A 4NUGL 4UNTA 2Q8AH 1CR9H 1HSBB 2EH8L 4AEIL 2WZAA 5E1IA 5JIPA 3HC3L 4R4BA 4HHGA 1V55B 2V17L 4KHXL 3NG5A 2CPCA 4E9RA 5FOBB 5GS0D 4WKXA 2E7LC 4YHPA 2WVSA 1MCKA 3QUXC 4P9HH 3LVEA 1X5AA 1WWAX 3GBML 4QRFA 2J8UB 5DEGB 5EZOL 4BDVB 2YKLH 1E43A 2VC2H 3LN5B 3QUYC 2KYIA 5AVXB 1GSKA 1OQOA 2XICA 1AXTL 5GS0H 1F5WA 5E8NB 3AAZB 2R2HB 3L1EA 3PAUA 1GKOA 2OR8A 3SKUD 5EZLB 5AVYB 2OA9A 1BWWA 1L9MA 2KS0A 5I28A 4J3OC 3BH9B 1YUHA 3AZUA 3F01A 3TVMC 1ROCA 3Q9QA 5A7EA 4YUEL 1WUZA 2Z3FA 4PWEA 5SX5H 1XF3A 1KTLA 2VN4A 4R0LB 5D2LE 5T3XL 2OSYA 1HQRA 4TYUA 1TU2A 1URIA 3W2DH 3MTXA 3ZDXF 4J27A 2NY5C 1QSEA 3H42H 4NQSA 3WS3A 3LKSA 5L2JA 1I1AA 2FWLB 1IC4H 2PN5A 4WW1B 4LOUC 1HQ4B 4HMEA 4X2UA 4CADB 3VVVA 2NY0B 2BW4A 5M94B 1KB5L 4E5XA 2M8XA 3CFUA 1DN0B 3LRSB 4JDZA 4F2FA 3TH3T 4ZFFB 3ULUL 1RCYA 5F9AC 4J8RA 3N5AA 4P5TD 5K9JL 5MI0C 1BYOA 1OGAE 3HPLB 5KYWA 2BO0A 1SVZA 1I1AD 1A4AA 3SJVB 4BKSC 1GMEA 4N2FA 4NZTL 3TT1H 1OSZA 4OB5L 5EUOA 4FXGB 4XXCC 4XMKL 5I1HL 2HRLA 1YEGL 4QHMA 3CHOA 4KXDA 3P73B 4GLRI 2P45B 1IU1A 1MCJA 2VDRB 1DLFL 3GSVB 4AMWA 4TL5A 1E30A 3DPBB 4N9OB 4XX1E 5CP3A 5DMGC 4XVJH 4PP1C 1XB8A 2Q5BA 1JPTH 3EXJA 5LDUA 2ZWZA 5IQNA 1GS6X 5CCGE 5DRZA 1G9HA 1ZT1A 1T2QL 2DQCL 3W0WA 1CB4A 2WXKA 5E8PB 4BFJA 4BINA 3OAZK 1XGRA 5AZUA 2IDFA 3HI1B 1T1XB 3CX5J 3VGEA 3Q8EA 4OZ4A 1RU9L 2D4DA 3SO3C 1AGFB 1W16A 5T3ZL 3UPCA 4KMTH 5DJ6A 5I5MA 4ETQA 3PGDB 1RH8A 4XWOD 3BPNB 4E9XA 2WXOA 2X42A 2B0SL 5D5MB 5FKAA 1MJUL 1Q0YL 2IALA 2PYEE 2XWTB 5C97A 2DQDL 4O2CA 4IIQA 1NGWA 2EXSA 4JG0H 4HJUA 3SO5A 1QLFA 4ABUA 1NAML 3DROA 3RVWD 3UTPE 1CDGA 2MCPL 4LZKA 5BO0D 4U3CA 5CBAA 5HSFA 4OV5A 1GYAA 4GAGL 3CDGB 5GJSL 5JHDB 1V7NH 4WGKA 1A1NB 3AXIA 1MCCA 3ES6B 4WDIA 5E6IB 1KELL 3OAUL 1KPVB 3HR5B 2X87A 3ZU8A