5ABZA

Complex of the fimh lectin with a c-linked naphtyl alpha-d-mannoside in soaked trigonal crystals at 2.40 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of C-Mannosylated Anti-Adhesives Bound to the Type 1 Fimbrial Fimh Adhesin
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords FIMH
total genus 35
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5abzA00
4LOVA 2XG4B 1TR7A 4CSSA 4AVJA 1ZE3H 4CA4A 3BFQG 4J3OF 5FX3A 2XG5B 4X5RA 4XOEA 5IQOA 3BFWA 1KIUB 3JWNH 4AV0A 5ABZA 5IQMA 5F3FA 2JTYA 5F2FA 4XO8A 4XODA 4AV4A 5AB1A 4XOBA 4CSTA 1KLFB 4X50A 5FS5A 5FLUA 5IQNA 5AAPA 5JQIB 4J3OH 1UWFA 2JMRA 2VCOA 3ZL1A 4XO9A 4AVKA 5LNGA 4AVIA 4X5QA 2UY6B 2J2ZB 3BWUF 4J3OG 4XOAA 4XOCA 3SQBB 5AALA 1N12A 4AVHA 4AUYA 3JWNE 4AV5A 5CGBA 5FWRA 5LNEA 1PDKB 2W07B 3RFZA 2WMPB 3MCYA 3ZPDA 4ATTA 3ME0B 3ZL2A 3JWNG 4BUQA 2UY7B 4X5PA 1N0LB 4AUUA 4AUJA 1QUNB
chains in the Genus database with same CATH superfamily
2G2RB 1T20A 2D0GA 3TO2B 4U4IA 1OE2A 3IKCB 1V7NH 2NNXA 1J9QA 4PJAB 4X5WA 3P9WB 3WIIL 5IR1A 1WICA 5IKCB 1A65A 1M6OB 4XTRC 5DVPA 4DTGH 5ILTL 4HWZB 3ARXA 1HXYB 1HXYA 1PEWA 1BVZA 2AITA 4G8FB 3LVEA 5KOMC 3DC0A 3P4LA 4NSKA 3GSQB 1JHLL 3BWAB 1DVFD 1KV7A 1XH3A 2ITEA 3KJ6L 2FZ3A 4V1DD 3IKCA 3LZPA 4AV5A 5I71B 2HMIC 1WQVT 4OZGF 4NJ9H 4P2QD 1SY6A 2YUZA 3FOLA 1HU8A 2AEPL 1BBDH 1P1VA 2NCEA 2VAAB 3B5HA 3CC1A 1SHXA 3N1PC 4YL9A 5AYUL 1CN4A 4ACPA 5LGJA 3MC0A 4UTBH 4UV7H 1I9IL 2E8YA 4HG4J 4UCFA 3BT2H 3M46A 5A2JH 1FVDA 2BP8B 3LKOB 4QRPD 3UTPE 3QORC 5C07D 5B1KA 5C0BB 2FBOJ 1J5CA 2ZQKA 5HJDA 3M45A 3MJ7B 3D2UB 2EUVA 4JFEE 4YQXL 2AGJL 4L05A 2UZPA 4EF3A 3Q7JA 4ZS7L 4W93A 4B3VA 1DQQB 3NABH 3W39A 3OKOB 3B9KA 5DK3A 1VKXA 1Z9SB 2F8IA 4M1DL 4QTIH 2O6EA 5KSUB 4LCUA 3I02B 1PSKL 4PVNA 5EBLB 4ONHA 3PNRB 2P8PA 3NGBC 5MI0B 4MNGB 2VJXA 4LSTL 3Q05A 3QGVA 4HV8B 5A2IH 5CAYB 2JKRM 4GMSH 4JHAL 4F8PA 4JM2D 1IEHA 2YKLH 2WYHA 2R0KH 3VFMA 3CHQA 1CDHA 1DQML 3LS5L 4OKVB 3QUGA 4HFWA 2XVBA 4Z95L 5CCGE 1DUZB 2I32A 1AGCB 5DQ9B 1MHCB 1OSYA 2KQMA 4QHMB 2CDEB 5CFAA 3KXFE 2E74C 5IMLA 1MHPH 4HQQH 2FNWA 1JL8A 2FWUA 1KTDA 3NP3A 5B3NA 4JANA 4K07A 3CLFL 3B2VL 2WIIA 5EBGA 1I53A 1MKFA 4J1UB 5F7EL 1TT6A 2IDFA 2E5EA 5CNHA 1ET7A 4JG5A 1QA9B 3GUTB 2P45B 1KG0A 1MFEH 3RWDA 1ORQB 3MNVA 1UM5H 2GSGA 3QNYB 3PWNA 2Y5EA 4ES8A 3MV7E 4TNFA 1H3VA 3K2IA 3FU9A 4BQ8A 2FJHB 3PPEA 4N8CL 3RVTC 3ZQXA 1P84J 4HT1H 4ONFH 4ABVA 2IDCA 3FO9A 2C7UA 2XV6B 5ELIA 3C8HA 4X9IA 3SDCD 1Q9KB 2PNDA 5FGBA 3HBGA 1LK3H 2TRYA 3PY9A 1ZA3B 4K3EH 4XR8C 1BM7A 4LRNH 3BE1H 1AHKA 1ZVSA 3LB6D 4NZTH 3PV7A 3RVVC 1K6QH 2XFXB 5FF6B 5GGSB 4D2NA 2ITDB 1SJMA 1RZ7L 3K8KA 4NKOB 2A2QT 1M9SA 3ME0B 4U6VH 5C08B 1RPUA 3O8XA 1OGAA 1OW0C 4HKZB 2AP2A 2X6BA 4ZNCD 4P5KA 2FYVA 1C5CL 1OARH 3FCTB 4OLVL 4ISVB 5SWZB 2PP9A 2CXKA 5T1KD 4OFVA 3KGRA 2BNRD 3LCYA 3UTSE 3AABA 4EDXA 2DYPD 3KPLB 2WNXA 4YHIA 2ICWA 5C0CB 4KY1H 3BSZA 1J88A 8FABB 3VXMA 3HRZA 2R2CA 2VXSL 4W9HC 5EZOH 1WT5C 3BCDA 2LR4A 4QRBA 3BLBA 1U4FA 2XQBH 4YDMA 1A1MB 4EQ3A 1EFXD 1ZA6A 5CSGA 4CA4A 3HB3C 4N5UA 5KW9L 2FK9A 4PJFA 1FFPA 1KCRL 1YYLL 2ISDA 5D1QD 4GEJA 3VYNA 3SPVB 5DRXA 4I13B 4V2CB 4JM4H 4R4BA 1EDYA 5IB4A 3ESOA 3LEYL 1M7DA 2GIXA 5CGMA 3IJHB 4NO0D 43C9A 1A7RL 2F9BT 3TBBA 4AEEA 4H25B 2W88A 4Z7OF 3APCA 3MCYA 3MLRL 3TCTA 3S5LA 1AP2B 1U2YA 4L9LA 2RFXA 3EJYD 1I9RH 1O7DE 1QRNE 2ZKXA 4NQCB 2B59A 3HNVH 3CVHB 4UQ3B 1AYRA 2YAFA 4A63A 1OPGL 4YSOA 3KLAA 3QQ3A 4FQHB 4WF7A 1IBGH 9PCYA 2QKIB 4PRPB 4BINA 1ZD6A 1RUPL 2WLZA 3OGCA 4JN2B 1F8TL 4DP5X 2Z0BA 1F13A 3QAZC 1J48A 2RGSA 1IBHA 3P69A 4XWGH 1IM3B 2YGPA 3LMJL 4M4PA 4AQ1B 2PTTB 1H0DA 5GGVH 1BPLB 2UWEB 1FIGL 3KDPB 4NPKA 2J1XA 4Z3GA 1UCTA 2GTWB 2WVUA 4DWHA 2ITCA 3GRWL 4XB3A 1S7SB 4D9LH 3WNMA 4JFWA 3UAFA 1NPJA 2DQTH 4NRZA 4IOFC 3L2MA 4JHBA 2PXYD 4IU3A 3ABKB 5L2JB 3DX6B 1UHVA 1G4MA 2AJZB 4N6RA 2B9AA 1T0NA 4UOW0 2WBJC 3OKLA 2VLRE 2PR9A 4XP6H 3P9MA 3NCFB 1H8LA 5TFSL 4ZFZB 1VFOA 4K7PH 2V2TB 3DVGA 1KIQA 3AS0A 3V9EA 4P23D 4IMKC 5AOMA 1HYRC 2N1KA 1B4JL 4L4TA 5TF1L 1JZHA 3VMPA 1XCTB 2K4AA 3R0MA 4WFHE 1HNYA 1U2HA 4U1JA 4X7CC 4CSSA 4OW6A 3FQNA 1UQSA 1KB5L 4JRLA 4O02A 3VWJD 1UB6B 2GBAA 5CO1A 3QUYB 1H3XA 1XGYH 2D03H 1OE1A 2QQKH 1BFSA 1AO7D 3DYOA 5AW0B 2H9GA 4U6HA 4HIQA 1T6VN 1UXWB 4M6MH 1JZ8A 3GSXB 4HKBB 1X5GA 1WIOA 4AJVA 2BIPA 2HRLA 3UCRA 4NYLA 4OVUA 3ARBC 1HZLA 3S8FB 4J28A 1F58H 1G1CA 2CRYA 4EIGB 3K6SA 5TE7H 2NX5E 2QKIC 4RNRB 4WLCA 3E6FA 5A7BA 1UWEL 4A7UA 2DDQL 5IV2A 5KZCD 3PQYD 3TOPA 5JIKA 1GCFA 3CSYA 3BSGA 5F9WB 3ZE2B 5EDXA 4N2DA 4AT6A 4HUNB 2MOGA 1KTLA 1JXDA 3D4GA 3NH7H 3KXFD 1FO0L 5CCJA 4PGBB 5TE6L 1HL4A 1AS7A 1SLWA 4G6KH 5AAWA 4EZLA 1BFVH 1IE4A 4B6ZA 1DJXA 2QELA 1ZV2A 4FFVC 1PZSA 4PGDB 1WITA 2IOIA 4YE4L 3S97C 1DDTA 4TTGA 1GZHC 2X89D 4EZKA 4HIXL 3KXFA 3RZCC 3IXAA 2ZTBA 3OX8A 2RD0A 3LKSA 4YDNA 1UD6A 1MCKA 4MNGE 2VXUL 2BVOB 4FJYA 1HZHL 3GPSA 3SYPA 5D5MA 3HS8A 2JTYA 1TCRB 1T6BX 3GDBA 5CBEB 4HEME 3CCHB 2BS8A 3RFZC 1WAPA 3IJSA 1OM3H 3LRLA 4ZO8A 5GZOC 3KYOA 2EP6A 4XXCA 2HJKA 1KSRA 1DBKL 2BJML 5J1SC 2W60B 1CMOA 3EDFA 1HHJA 4JHUA 4PRHD 4QAWA 4WFGE 4EO5A 3OKMB 1OALA 2L7EA 1T03L 1EXUA 3QPKA 5T3XE 1FZOB 4Q6IC 4OTXH 3DI2B 2KLTA 1ZLWH 2QADB 4C59B 5GS1B 1ZSHA 1H9VA 3D0LA 4LL9A 4QOKE 2A9CA 3RKDD 4R7VA 3BLPX 4CJ0A 1Y18B 3ECWA 2AHIA 3TA4D 2J2ZB 2PW1B 3WD5H 3MLSL 1B2WL 2XYBA 3R4DA 4NHCL 5F6IC 4UNTA 5GRVK 4NX0A 1T4WA 4Z7VF 4OZFG 1KIUA 3F7KA 3L2NA 1BVKA 2GK0A 4EN3B 5KVDE 2J4WH 4NM4H 1CFSB 4OJFH 3B9KD 3MUGB 4GO6B 3RKDC 4OFQA 4AEHL 3W5MA 1SJXA 1CZ8L 1NDMA 3H9ZA 1LO3H 3O4LE 3OLEA 3QCTH 3WTTA 4DJMA 4UQAA 3GLAA 4YVUA 1HT6A 2D7OA 2PCFA 2ZSWA 3QIUD 4HIJA 4HEPG 5EPMA 4FEMA 3N5AA 1YPZE 1TQTA 2GVYA 3TJPA 1NIFA 5ISZD 3W38A 3HAEG 2BW4A 2H0EA 4POYA 2RAMA 5E4OA 3TNNA 3B6SA 3PF2A 3TYGL 1E28B 3B2VH 2F53E 2R4SH 2FBRA 1OK8A 4WK0B 3IU4L 1KIRB 5HI5C 4KUZL 4JGNA 1I4FB 5IESH 3REWA 3T65B 2ENPA 4A6YA 5BRZA 4KKCD 5KYUB 5HDWA 3F62A 2DQGH 3QIBC 2WKOF 3B2XA 4FADA 3CZFA 5D2NA 4MXQD 4Q2ZB 1FG2B 3R18A 5J9PB 3IETA 4WUKL 3CDCA 4I3RL 3V5KA 6TAAA 2ZOLB 4PY7A 1QPPA 2JQZA 2N7AA 3ARDD 2O61B 1NAKH 4U3CA 4I1PA 4RMQA 4XP6L 1WBZB 3M07A 1QSFB 1UWGH 3CVIL 2NY4D 2FWSA 3EG9A 4J4PD 3TT3L 5ANME 2VXQH 2YGOA 4QRPB 5EN3A 1NL0L 3C09B 5KJRH 2X1XR 1JG9A 1IAKA 3QEGL 4L3EB 5F3HA 4BFJA 1BBJA 4BUHA 2UVFA 2XWTA 4TSCH 3BXNB 5JDSB 2V33A 3SEPA 4AGLA 4E41A 5JPNA 3M88A 3HC2A 1LYQA 2EYRB 2WSPA 3GI8H 1INQB 3ILEA 3PAYA 4PWEA 4HGWB 4KKAC 2P80A 4ZX3A 1QX1A 1I1CA 4J8RA 3UO1H 4I0PB 2WXQA 2N0MA 1CR9H 4OQ1A 3MBWA 2AQNA 1FN4A 2DKUA 5MERA 3FC8A 2GTQA 3O8XD 1J7VR 4ZMNA 2BNQA 4BYHA 3QIUC 2X89A 4M43H 3H9YA 5I73B 3RNKA 1INDH 4GT0A 4GP4B 2WXIA 5E6SB 2HWZL 4W9FC 4DGWC 2MCPH 3IGKA 1XX9C 3KVQA 3GMPB 1HS6A 4PRHA 1ML0A 4Z78B 2X10A 5HD8D 1AXTL 4R5XA 2WUBH 3PWPE 3L7EB 3FB6B 4P2OC 4HUUB 4OQTH 5DJYA 3CUPA 2UX7A 5EOCL 5C86A 5HPMB 2GJJA 4PIBA 2WXRA 4XPHL 1RIHH 1VACB 3VRLF 5EUKB 1WA2X 1XCQA 5F2FA 2NYZA 2OX5A 4F8LA 1DLHA 5DJXB 1TPXB 4Y7OC 3TNMB 4LSRL 4M43L 5AG9A 1A7NL 4ZO9A 2EYTB 5EZLA 5CKGA 2HKFL 3TH2T 4M9PA 3VNYA 3WKMH 2GITB 4BZ2H 1DJWA 3Q5TA 3D50A 3ZL2A 1FFQA 1R17A 2YSSB 4NI3A 1KPRB 1K5NA 1VEMA 2IQ9L 3KPPA 5ABAA 3VD2A 1RZFL 3DBXA 4PRNA 2X6AA 4X4YA 4OBSA 2Q6WA 1SN5A 1KWKA 4KQ4H 4XP9L 3TBSB 4OJEH 5D7LE 4YR6A 1TZGL 5KWYC 1MH5B 4F3FA 2I5YL 1I8MA 2NY7H 2VZOA 4OIAA 1KBKA 2VZVA 4NIYE 1JCVA 3D4CA 5AW3B 3MRPA 2AQ1A 4DGVL 1M7IA 5E1IA 1U3YA 5H37G 1L9OA 4YC2C 3FFCA 5D72H 2HPTA 3VXUB 2F8XC 1JNJA 3IJEA 1XIWB 2HT3C 1TJXA 4N90E 4L0YA 2HLEB 3SKNB 3IPBA 4LO9A 4WWKB 3ZDZF 1ZT4A 2X7LA 1T21A 1TYJA 2CK0L 4JDVA 2B5IB 2BVEA 2ICES 4OGXL 1T22A 3MBXL 3EYQC 3HC4L 2FATL 5ITBL 1D6EA 4TQIA 3WFEH 5E5RB 2AV1B 4Z7NF 1MCJA 4JFYA 1UACH 4IBSA 3C8DA 4PV9A 1UH4A 5MEPA 1OWRM 4MD0B 4N2FA 3IFOB 2XRAH 2W1NA 7FABH 2V3DA 3KH3A 4P2OB 5FA4A 3S96B 4IK6A 1CTNA 2YRLA 4CVUA 1A9EA 5IB2A 3V95A 2EDWA 3E1F1 3TYGH 1MOEA 3ZDYB 4IJ3B 1FVCA 2C3XA 2Z4QB 3FUEA 4JZJC 1WAAF 3FK3A 1KN4H 4K5MA 3SGJC 4X98A 2K3HA 1E4KC 4Y2DD 3ZDYE 1YN7B 5I1IL 1I9RL 5F89B 4P2OA 2I69A 4JVPA 1JD7A 4PVBA 1WZ1H 3MRJA 5TF0A 5MEPB 5JIQA 2AW2A 4WWID 2NY2B 4UV4L 4GRMA 1EJOH 1QASA 2HZHA 4Y2OB 3U1SH 4HCRA 1VGEH 1PKQB 5AG8A 4PRIA 1R3LB 3T0ED 2A77H 3QCVL 3Q44A 1KFGA 1G9ML 2X7LB 3TBCA 4OI8A 4KKLD 4QPEA 2PCYA 3O6KL 2WNWA 4JQXA 4MQXD 5EFIB 3U83A 2VDKL 5E2UH 1S7QB 1UD2A 3IJEB 3PLYA 4E41D 3K2MC 1WAEA 2MNWA 2OYMA 2WBJD 3TCXA 5HHOA 4XCYB 4EUPG 3L4CA 4F3FB 5FUZL 2G75B 1KZYA 4X5XA 3X13B 5CIPH 2XQYG 4JRYD 4V33A 4PRNB 3G5YB 3N9GL 1QSFE 3MRCB 3OAZH 4N8PA 4PHZA 1RP8A 4UINL 3PP4L 2DLHA 1FVEB 3CFTA 4JFOB 4RESB 4IDJH 5BXFB 5L2KD 3QDMB 3PDGA 3K2UL 5B3JF 4PJAF 4YXKL 2F5BL 3SE3A 4G6AD 1UURA 5I66B 3CC5B 5BW7C 2FX8H 5I74B 3CV5A 3O3DB 1JE6A 2H47C 4C83A 4O2EB 2QVMA 4W9ZA 5CXPA 1OB0A 4OZIE 1VACA 3EF4A 4OLUH 4GUPA 3VRIB 2XXGA 4A2MA 1LK3L 4WNQB 4NPYA 2DB8A 4MGXA 3OLGA 2L7JA 3GSOA 3HC0A 3FT3A 3QUHA 4JFVA 1F6FB 1DVTA 4JMXA 4ORGB 5LGHH 5BMFL 3BAXA 3WE1A 3D3VE 1NBVH 2EDMA 4AGQA 4XBEH 1RAMA 4LSUL 4HZAA 1TEGA 5L7XL 3U25A 4X6CB 3DVNA 3RNKB 3CHRA 2PWDA 3D69B 1X5KA 3LVTA 3KNBB 1I3GH 3EYVA 2A0LC 3PCYA 5EZJB 3EGSA 2CHZA 3QO0B 5BRZE 1FZMB 2KLRA 1J9SA 1C5CH 1YAIA 1M56B 2B77A 4AMKH 3IDJB 3QJRB 4Y4FD 5I8KH 3MLZH 4QI3A 5B7FA 2DTSA 4JDTL 2QVIA 1HSAB 5DURD 4OSUH 1B0RB 2V9RA 3IN0A 3ZDXB 1X4ZA 4U33A 3NPSB 3NT0A 1PLGH 1RXLA 3SKOA 5KW9H 1IAKB 3GMMB 2G30A 3PPSA 3WNIA 5FWQA 1TPXC 1OCCB 1QMUA 2GUOB 4P9ML 5HHXH 3QRFM 2WYZA 3BWUC 1UADC 1NDGB 1V3LA 3VRJB 2AXWA 2UZYB 2K7PA 4IEFB 5E6UB 4UYQA 3UZQA 3GT6A 1WBZA 5JMRA 1AXSA 3LZFL 3RWEB 4HK3J 4QJ4B 3T0BA 4X7TB 1JZ6A 4IM8A 4OLXH 4QF1B 1QSEA 1HEHC 4G7QB 4X6EA 4DOHE 3JV6B 5FOBA 2IAMB 3EHBD 4XNUH 2H0FA 1OP5K 3OC5A 4CNIA 1UOWA 2Y4SA 4CC1A 3UX9B 2YHGA 4OTXL 4AYDC 3H53A 2LVCA 3ESPA 3B2PA 2BNQE 3KJ4C 2Z65C 2A4ZA 3LN4A 4D8PA 3WXVL 2OPCA 4QTHA 2OP4L 4G1MB 1KJ3H 3WJMB 5CN1A 3B6SB 3AROA 4LKCA 4NKDA 4YHPA 1EANA 2X4OB 4UTAA 1MDTA 5DK2A 3R8QA 1KEGL 3V4VH 3QH3A 1B2WH 3GMRA 3MKKA 3BGMB 1XB3A 5GGVL 1MVYA 3RLSA 3L17A 5B22A 3BEWA 5IJBC 5KVMC 4JY5L 4Q56A 3ULAB 2PCFB 2ZSWB 4L2LA 1EEYB 5C0AB 4TLTA 3QWOA 5DZJA 1DE4A 1YEIL 3ARBB 3QNXA 3IDGA 4R2GD 3SOTA 4MDIB 5GJSH 1Z5LA 4PJEF 2FECI 3CZSA 3OAUH 1IM9A 3ABZA 1WUNT 3D87B 3DPDA 3Q9QA 1BVKB 1KJ3L 2GK0B 1OCZB 3L1GA 4DUXA 1JPSL 1M42A 1RK1B 3A4EA 1DDHB 1CE6A 3FQXA 1EO7A 2I7SA 5KS9F 1BEXA 1I8KA 4XC1H 5B7EA 2VABA 5GZNC 3QUMH 4GKNA 4DGYH 1WWBX 3ARYA 2OK0H 4JL2A 1EGJL 4ZW7A 4APXB 2ZSVB 3NPZB 1AQHA 4BWTA 3U0PB 3HUJA 3NCWA 4G9FB 1CFMA 1R1CA 4QOKB 1AZZC 2E7BA 2FYYA 2X70B 1MFMA 4JBSA 3DRQB 1JRHL 5H2BB 4HLZG 3NESA 4Z7UE 3MRNB 4JRXE 3FU5A 1BQKA 3JV4A 4P5SA 2FT8A 3G6JF 4E9YA 4B0MM 3ECUA 4KNSA 1L6PA 4MZ3A 5IREA 2YKLL 2WWMD 1IILE 2R9HC 2CUHA 4PJ5B 3W0WB 4LMQI 4YE0A 2PTUA 2WANA 3CFMA 5JMOC 2Y3AA 2YK1L 5F7UA 4IMKA 4OF6A 3MREA 4LCYB 3H6JA 3SPJA 1JZFA 4TYUA 3B5GA 3EOYG 2CM6A 2EC9U 2IGFH 5BVJB 1XZWA 1RU9H 4LLWB 4M7LL 3WTWA 2HTKC 3QUXA 1MPAH 4Y4HD 1RZ8B 5IVXB 4BCXA 5I1GH 5T5FL 2XPGA 4X42A 4ENZA 4Y4FC 1VPOL 5J11B 4GXVL 1TZGH 4G8GB 4I8DA 5KVGE 1CC3A 1OTUD 4PGDA 1CT8A 3T77B 1B9KA 3FU3A 5C0JB 1K4DB 5CSZA 5FDWA 4DPRA 4KDWA 2JCCB 1MVUA 3L1FA 5FYJL 4L3ED 3QISA 2D03L 2QQKL 1FFOA 2RR3A 3LNHA 3LNGA 4HT1L 4OM0L 5IV2B 1Q9WA 4AL8L 2EIKB 2FL5A 2GJ6A 4PN6A 4RNRA 4WFHD 4B9YA 2ETWA 4OZHF 1NCDL 2CIKB 4WFFD 1ZV5A 3A5VA 2GFBA 3TO4C 3K6SB 3L4YA 3NAAL 5J89A 3NIGB 3N9GH 5ENWA 1ZSDA 1U3NA 5CJQL 1IGCL 4LPVA 3QEQE 4OF3A 4N8VG 5E5MA 5BS0B 1EBPA 4WCYH 5HSFA 1D2PA 5KBDA 2ZOWA 3I3BA 3X11A 2O6PA 5AVQB 4CADA 4F2ME 4J3OG 2ESVD 3KYKL 3DGGA 4V2BA 3CXHK 4DKFL 1NOLA 2MOVA 3AITA 1E8YA 1ZPUA 4LEOB 1SHSA 3O3AA 3D3VD 4I18A 3U4EB 5A7EA 1UM4H 1C12B 1CVSC 4JKWA 4R4FH 4XMLH 3VGEA 4O02B 3RIKA 2QSQA 3NRQA 3RL1B 4G6FB 2K6WA 3I84A 1QFWI 3X12A 4Z7IA 2WYTA 4JX0A 4MCYA 4Y0GA 1NMBL 4OZFH 4XAWL 4XVOA 2A6KB 3GBEA 3FYIB 2V8LA 3GBDA 3KDMA 5EU6E 3CJJA 3ECQA 3MXVL 4KROD 4ZI8A 2Y7QB 2M83A 4GBXB 2Y7MA 4O4YL 3JXAA 5I82A 1KBPA 4ZFZA 3QULB 4ZUVA 1U3HB 3T4AC 4MZRA 1CGXA 4TVPE 3BC9A 1E4WH 3NA4A 4MQ7A 4XMPH 1KXVC 4BFNA 4AQOA 2AJ3A 2YQ3A 4ZMOA 4PGCA 3BQUD 3WFZA 1RUML 1UD8A 2DTMH 4Y5XB 1DJZA 2EDRA 3LNDA 1E9OA 2WTRA 4RBPH 3MYJB 3WFHA 2BVYA 1CXIA 4GXUM 3POCA 5AYQA 1KIPA 1ZLWK 3S4SB 4WHYG 3T6VA 4OJCA 1MW0A 4RDQF 3T0WA 4C56E 4OZ4A 5KVEE 2ITCB 5I8KL 1V10A 4KRLB 2J7LA 1DUYA 1TTRA 4HUCA 2QVKA 4Y4KD 4W9EC 1F90L 4AQ1A 1MFDL 1RJYB 2XLLA 3NJXA 1JTPA 5D1XE 43CAB 1KBVA 3P0YL 2J8OA 3AREB 1E4XL 1WBYA 4JHVA 4KDTC 1KIPB 4KJQD 3FQRB 1NC4D 5PCYA 2Z31D 1GGBL 4YUEL 4Y5XA 2C9SA 4POZD 2BRRH 4PGCB 2AJ3B 2NY1B 1G9HA 4HLJA 5KEZA 4MQ7B 4KO7A 4PWKA 1WZAA 3LSOA 3MRLA 1AP2A 1I3VA 4P5MA 1R75A 1PG7L 3F58H 1JN6A 4PAZA 4W9DC 2R1XA 4BFIA 4DKDC 3QIBA 3WTYA 3IDXH 4H25A 5EDSA 2B9BA 2KZ1B 4AQAB 1BP3B 5JNYB 2V9TA 1XL6A 4D3CL 5I1HL 5IQ7L 1CLVA 1G9NL 2IF7A 4NKIL 3VJ6A 1UB5A 3IS0X 5DZAA 1IRAY 4QO1A 3ZVVA 2LGNA 3SPVA 2JB6A 4KGJA 4N24A 4P2OD 1C12A 1MREH 1REIA 4MA3A 3SY6A 2YPKB 1G4RA 1NICA 3FN0H 5E9DB 4ZUSB 5AYTA 5IW6A 3GIVA 4N9OB 1I1FB 5E8DH 3DGGB 3LKRA 4IKKA 4AEHH 3H7BB 2KT6A 1J18A 1XTLA 3HRZB 3ULVC 1UXSB 1M53A 3NZSA 4Z18A 3LZOA 3K80A 4E68A 3H9HA 2WB7A 2OMZA 1QOKA 2Y7SA 1R19A 2EDDA 3D85D 3DI3B 3IEAA 4JREC 2EZ0D 4M5YL 4DF9A 3OGOE 1T80A 2GSIB 2WLMA 3NZ8B 2NY2D 3ZLQC 5JIPA 3F64A 1A9BB 1GAFH 4R7XA 1V8HA 1WCBB 1XAUA 2ADIB 5FO9A 5IG7B 4TSAH 4QR7A 1MG2C 12E8H 1MVUB 4RDBA 3G6DH 2JCCA 1NGPH 4I2XB 2BIIA 1PG7X 2EDKA 2P5WA 1T03H 2ZNWA 1EAOA 1U8QA 4APQA 3A4DA 1PD0A 2P5EE 1Q1JH 2ENSA 4CAGA 3APDA 3ESUF 1J5IA 1ZA3A 4XAKD 3BKYH 1JGEB 1NKRA 2DW5A 3BPOB 4PBWD 3VXTB 1LQSR 5C3IA 4MDRA 3BHBB 5HYQA 2HB0A 2IH1A 4FLQA 3K1DA 5B8CA 5K9QI 5ALBL 3AADB 2WXOA 3ZZLA 4G72B 1FH2A 4PY8I 2XZCL 4I9WE 4LIQL 4XXCC 5DJDB 5MENE 2WP3O 3BAJA 3P0VL 1W0VA 4XVSH 4QDGA 4ZPTA 2XT1B 4YGVB 1FI8C 1IGML 1QA9A 4AM0Q 3GUTA 4WHDA 1RURL 2OTPA 3BW9A 4HIEA 3ZRCC 3U30B 2EDHA 5B1AB 4AGNA 1ZY9A 2P5ED 4UTBL 2VSMB 4J1UA 3MODL 5DUMH 2BSDA 4CBPA 3MV7D 4JFXA 4F15C 1T04A 4JANB 3VH8A 4K7FB 2FYYB 3X2QB 5G55A 5GS0H 1F0LA 3T71A 2GG1A 2CK0H 1GC1L 2ILLA 5F8RC 3AY4A 2EDYA 5AAWC 4YDKH 5DQ9A 1XGUB 2UYLB 3GK8H 2HN7A 5C6WH 3TJEH 4HFWB 4JHWH 5I75C 5ES4B 3V5DB 1RK1A 3RDTC 3HZYA 3EJRA 3RZCD 1IM9B 1T6WA 2XRAL 4EIUA 1QNZL 4LLUB 4MDIA 4IJTA 3T3MF 1Q0XL 3W37A 1L7TL 4MNQE 4UNVA 4ONHB 4G6JL 4Y5YB 1TVHA 5LHDA 1EJ8A 3NJKA 3ARBA 4FL4C 2FH6A 4LSPL 1OB1B 3ROLB 5KYWB 1MJ8H 2RB8A 3QWOB 4P9MH 2HRPL 2GTZA 4PREB 5FECA 3W39B 3N42B 1DQQA 3QI9C 3AWGA 1L6ZA 3BEWB 2HRHA 3CPUA 3DNKA 3TBTB 3WL9B 5BVPH 2EE2A 3JT2A 3NRFA 1KELH 3F6LA 3QORB 1XF5B 4ZYKA 4LKCB 4NKDB 2APSA 3PNWA 2HVKB 4FXGA 3FT4B 4KV5F 4Z7QE 5I1CL 3ORJA 2Q3XA 4N0YL 3P4OA 3S9DB 3U2SA 3CVBA 5B1JC 3WYRA 5HYJE 1MI5B 5D72L 4E2OA 4Q0XH 2HX7A 4L4VD 5D96C 1XEUA 5JIHA 2R23A 2HT2D 1N3NB 1XH3B 4KZEL 1B0GB 2BX5A 5CP7B 1LHZA 1JTTA 3MNZB 2CJSA 4Z7UB 2FSEB 5D7SH 4W70A 1GYAA 1AXSB 5F7NC 1Q0YH 3VXPB 3UZQB 4M62H 3UERA 3HFFA 4E5XA 1O75A 4GLRH 4DQOL 5HYEA 2QHLA 1GZPB 3J2PA 1N70A 1TYEB 1B4TA 4F37K 4N2NA 2PPFA 2G3NA 3TCLB 4HUMB 4HG4K 1IARB 2H3KA 4WWKC 2JJVA 5IQLA 3BGFB 3RBSA 3VWJC 4I4WA 1ZS8B 3OMIB 2VLLA 1NAMA 3OWRA 1A1NA 4OQTL 4XNZC 1HDMA 5BJTB 2I9LA 1XCXA 1I7ZB 4FDWA 4L1HA 4PB9H 1B0RA 3ZRSA 1NBZB 4A2DA 4MVBC 1SOXA 4RZKA 1AKJD 1VFAB 2BVUA 1SGKA 4EI5C 4FABH 1KMGA 2DI9A 3DK2A 4PW4A 3QZPA 4AG4H 2XPZA 2VJ0A 4L9LC 4KQ3L 3ZTNL 2WTPA 2CUAA 4GW1A 5CEZH 1GCYA 1NGPL 3KNBA 2IGLA 3D69A 1CO1A 1UENA 5KJRL 4QJ5B 4W4NA 4FXKB 2IGTA 5FXCH 3F7YA 3BAWA 3QZMA 4FS0A 4ZW8A 1AD9B 2YFOA 2WQSA 4DETA 5CU9A 2E6JA 3GI8L 1Y07A 4ORGA 3D85A 2ODIA 4G9FD 1ZIAA 4NKIH 2QVFB 4JY4B 4ZXBA 3O6KH 5L6YL 1BQLH 1JWMA 4JR9H 3WHXB 5C1MB 1M2OA 4GUPB 1K4CA 3TLRA 3VRIA 1UG9A 1RUKL 1NCNA 1SEBA 3AXLA 2X12A 4LHQB 2HFEA 4C83B 2QTVA 5DD1H 5DA4A 1IEBA 4DP8X 3EHBC 4XVSL 1OSZB 1C1EL 5FYKD 2Y5TB 4FQXD 4FQ2L 4LHUG 4UNIA 5DFTA 4WFEE 1FV1A 3A6BH 1OK0A 1TZHB 4ADIA 3BIBX 3OZ9H 3MJWA 3OMAB 3VXRB 3BT0A 1WGOA 1YEDB 1C5BL 3MRCA 4L8SC 5EO1B 1C9SA 1PU0A 5SWQA 4G71B 3AS3A 3HW7A 4H88H 1YC8A 3NCJH 3VFGH 4C56D 5I15H 4HULB 4O58H 3KBEA 1XHHA 3SBWC 2EVJA 4K3HA 4JQIL 2H6PA 2FJGA 5D1ZI 5GGVY 3J07A 3GJEA 1AGEA 1TG8A 3HBQA 1SMAA 4AK2A 1E67A 3VFWB 3TU6A 4J3OD 2WWNA 4R97C 5CMAB 2CMRH 1FLRH 3B7YA 1AGFA 1AAJA 3DXAA 2VLJD 3LKPA 4WU5A 4R4NC 4HWBA 1A4KB 1QLFA 3HCVB 3RE0A 2K8MA 3RX8A 4IIQB 1R3LA 1RZFH 4BKLB 1BLNA 3NFSH 4MMXA 3DOHA 4GRLB 1CLZL 3U7YH 2X9YA 3C9NB 3JV5A 4V11A 3KHOA 1AZBA 2NY3B 3PGCB 1OL0A 1LEGA 1EA9C 5CEXB 1MHEB 3HMXA 4U1HA 3MRJB 4EKXA 2X1PA 2NCMA 2KDYA 2BCKB 5J5EA 1JRHI 2IJ0C 2QV2A 4U1LB 5BV7B 3WEBA 1KPVA 4K9EH 2BFGA 4O2FA 5E2WH 3GHPA 3NP4A 3HPJA 4ZK8A 5HHVH 1J1XH 3BPCA 5DWUH 4MJHA 1JFHA 2ZXGA 2YQGA 4IRSB 1RKRA 3INOA 3LPFA 3HS0C 4JG9A 1I7RA 5IIEB 4R0LC 3MXWL 1A9EB 3UAJA 4ZX6A 5IB2B 3UAJD 2R8SH 4PJXA 2QQQA 3KPRD 3QEQA 2XIDA 3T6XA 5CUSL 3ZTDC 1BIHA 2V5SA 4OLYH 2JI3A 5EUOB 3QJHB 4XNMB 3JWDL 4B96A 3H2WA 4KDTA 1DBMH 2FE0A 1S3RA 3SKMB 1U33A 5AW1B 4YO0A 2AV1A 4QEGA 5E6RB 5JPNC 4IHOA 1W8OA 2YZ8A 5F6IB 3EJZC 4PS7A 1EGJH 5D7LA 3VTTA 5DMKB 5DQJB 1E0OB 1E4JA 3UTSD 1T0PB 1ZT1B 2B3IA 3NCCB 3C5ZA 4DTGL 1FFNA 3OHXC 4XZUA 3HLKA 3JUZA 3FFCB 3IAGC 1SJVA 3HHSB 3TFBA 2VDLL 2J8UF 2NY1C 4G70B 5JHAA 1VAHA 2OMXA 2ZOKA 2W9DL 3MJ9L 1J9RA 2Y06L 1G0DA 4HUWB 2C4FT 4JKPL 3MMEA 4KMLB 4WU7A 3DHUA 5IUSA 2BSBA 4HJJL 5FB8A 5IJKC 3Q2NA 1DFBL 2XXFA 4DKAA 3EGDA 3F12A 3MRHB 4D3CH 1WK0A 3RQ3A 2P24A 3HN3A 3QIWC 2QR0B 1OCWL 5FCUH 5F7DA 3UO1L 2GC4C 3U36B 4MNQB 1EZSA 1S9VB 4X8CA 5JPMB 2NUPB 5FO7A 3PUCA 4FYSA 3LQZB 4GS7B 4PJEE 4Y9BA 5F7AA 3HHMA 5I1GL 3OMNB 4D0DB 2DWDB 5FS5A 4A67A 2OX5B 1ZHLB 3PL6D 1XCQB 5GISL 5HDBE 2XX0A 4M7LH 1FNGA 4H1LG 5DGRA 3QQ9C 4IGBD 3X1GA 1DCLA 3NN8A 1Q1PA 1VZIA 4AOFA 4QKXB 5HD8C 3T1FB 2J72A 2RACA 2IV9A 1QD0A 4WW2A 1AY1L 1OAQH 3QS3A 1W2KT 4U6VL 4YZFF 4X9HA 3ZKQD 3ZKSD 3QA3B 4XXWC 5IFAH 1NFDF 2FGWH 4LVNC 5LN8A 2X4SB 2BH0A 1CLOL 1CDJA 2HJFB 3G6JE 3B2MA 4R7DA 4QXVA 3HC3L 3RX5A 12E8L 1X7QB 3QJZA 4AL8H 1EZVX 5HHME 5B7MA 1A6WL 3JWOL 5T1MB 4Y4FA 4PRHE 4WFGD 3QT2A 3VU1A 3MV01 3WMPA 1Q0XH 2AFNA 4IMLB 1BMZA 3IDUA 5I8CA 1MCQA 1R3KB 2XWTB 4W68A 4GP5B 3PUUA 3QJXA 2UVEA 1NIBA 4YNYB 5K39B 3CFUA 1PLBA 1PY9A 4JE0A 4NNYB 4NKQB 3T2NH 3FU7A 4HJEA 3QJSB 4QRPA 3DO3A 1MF2H 3PGDA 2UX6A 4JRWA 4MMYB 4N87A 1CICD 1RSYA 4L8BB 4OCLC 2EIMB 1S7XB 3EO9L 3N85H 5DD5L 3T2PA 4HK0B 4FQCL 3T6WA 5K9QG 2OR9L 2WXHA 3I75A 3MAWA 5T5FH 4W4OC 4GYBA 5D5MF 4NUJA 2BVQB 3DUUA 5HDRA 4IS6A 2Z35B 4YHZH 1F1DA 3KEDA 3LZRA 2ZOLA 4PY7B 5TDNB 5M94B 1BF5A 2PO6D 1MHHA 1YC7A 3F85A 5DUBB 4Q2ZA 5D2NB 1UWXK 3UCQA 4N8UA 3AC0A 3ARPA 4TVUA 5KBKA 3BE1L 5F72S 2BFVH 4IBWA 1E4WL 5CIPB 3ZMRA 4L3AA 3DJZA 1J0YA 4NBZB 3ZMEA 4A6YB 1QQDB 1CVRA 5J6HB 1ZJBA 4HAGA 1NUFA 1B90A 2OLDA 3C5JA 5GZNA 1TSRA 1KLGB 1YNTA 2F5BH 4LEBA 1HHHB 4FQCH 2XZAL 4ZUWB 3DO7A 2P5EB 3D2TA 4B53A 5JLZA 1PX3A 2VXSH 5D1ZC 1RIVH 4LAJH 3ULVH 4FYQA 3BZ4B 2MMXA 3ULVD 3VD9A 5I18L 3ZHFA 2YIHA 4NM8H 3V0IA 2JE8A 5J06A 1KCRH 4DKFH 1JNLH 2XQYA 3BT2L 5EIIG 3HAEB 2VLKE 1RY7B 3U9UA 4JL1A 5MEOA 3OZLA 5E95B 3BRFA 3SDAB 5AENA 3BVTA 3RIFF 2ZCHL 1L3WA 5ITFA 3T9WA 2E9GA 3E8UL 4LL4A 4NJ9L 3F7LA 3T8MA 5F44A 5KVEH 1D9KC 1CI5A 1CR9L 1XGRA 4Z7UF 1IM9D 3N43F 3MACH 3RNQA 4JB9L 5GSVA 3QXVA 4P2RA 5I1LB 5T1LA 1QP1A 2PW1A 5EULV 1HL9A 1E30A 2J2ZA 2AJSH 3IMUA 1TTCA 1SM3H 5IQ7H 5IY5B 3VI4E 2XN9D 1E9PB 3P1VA 4PW9A 3N55A 2DLGA 2VLKD 2XXMB 5DSCA 1LO2L 4PJBE 1P6FA 4E0RA 4D9RD 3QYNA 4KRPB 3WEAA 3MR9A 2ZCHH 4RGNC 4TULL 2X4QA 3SBWA 4WAFA 1M1XB 3QUZB 3NSXA 3LPPA 3S0PA 2BK8A 2Y5QA 4S0HA 3MV11 4HAFA 3LHPH 1NSNH 3I50H 4PRDA 3SDXF 2MEJB 1HHJB 3TBVA 4E9SA 4OV5B 4KKBD 2K70A 3MOAL 4ODTH 4XPBH 1F58L 2HJKB 5EIQA 3DO7B 3A3YB 4WV1C 1L3NA 3L48A 1KLGA 1QBLL 1BF2A 3D30A 3Q3GA 5FCUL 1TCRA 3LEVL 1I8UA 5F7EH 2P44B 3NIFF 1YEJL 1SJHB 4XO3A 5B39A 1MCPH 3IXAB 2NYYC 3MRFB 1MFEL 4PMEA 1IQWH 3FRPG 5I9QC 5DUBA 3IMWA 1M4KA 1IC7L 4LVOB 3JWNC 4LKXB 2NY5H 3U6XA 1ZHNB 5H4YA 3MRKB 5DHXB 2Z35A 2ENYA 2KZKA 4IRZL 4U2ZA 5FUCC 2WLLB 3B1UA 3I75B 2UXVA 3VE0A 4NZRH 2YA0A 3NJFA 3CH8A 1XGQA 1KTLB 4KK6D 5CSBA 3NZUA 4NN7C 5I5IA 4ZAKD 5SWSD 1CTMA 5HXMA 2CALA 4GY4A 1AY1H 2ESVA 1CICC 1NLBH 3CSYB 3IK2A 1MWOA 5CJOL 1LWRA 2EE0A 4NQDB 4AH2B 3N44F 2C3HA 4JO1L 4F8QA 2WLLA 3ARSA 3PAUA 1I1RA 1U8HA 4KPHH 1R3KA 1DQKA 2WOBA 1DQMH 4OCRH 4GUOA 2AVGA 3TA3A 4LNVA 2YSTA 2JLLA 3WTVA 4NYLB 2A6DA 3QHZH 4GT7A 1N67A 1NCIA 3GS4A 1DANT 1X7QA 1HE7A 1T5XB 2OL3H 1WT5A 4UM9B 4J7RA 2HJFA 4DN3H 3G6JB 4KI1A 3VDCA 4XCFH 2VM9A 1UB6A 1EQWA 1U8CB 4LK4A 4N68A 4PBVC 1TQWA 5EC2A 2XXCB 5IHLB 3UPAA 2NNFA 1QLEL 2ZCKH 5IBUB 2WLYA 4Q52A 1PIGA 1AR1C 1FFRA 3DXAE 2DKMA 3T1FA 4DN4L 3LQAH 1MCWM 4BHUI 3QCUL 1LGVA 1HI6A 3HBPA 3Q2WA 1X9UA 2WCGA 2CDFB 1N6QH 3KYKH 4Y4KA 3BN9D 3OKLB 5F9DC 2ZWLT 2BIOA 4FQXB 2C4XA 1FNFA 1ZHLA 4IU3B 3SE8L 2Z1PA 2VWEC 1SF5A 3QQ4A 1KB5B 2BXYA 4OAWA 1H3WM 4XGZA 5HGDB 5C70A 5DSCB 1NZRA 1F2QA 4XN2A 1U6AH 3HC3H 2XY1A 3ESNA 1R0AH 1S7SA 3WN5B 4NGHL 5TGBA 2BNRE 4KQ0A 1YYMH 3U4AA 3OD3A 5I1LA 1CE1L 5IT2L 1H0DB 3LH8A 4BCYA 2JKIS 4KZDL 3F12B 3HC4H 4LF3A 1TYRA 5F1OB 3MJ6A 4MLIA 3SPHA 2R9HD 4AE1A 4LEXL 1RUQH 5DWPA 3LS4H 2XTJB 2ZX9A 4GSXA 1BVNP 3UZVA 5E4AA 3V4PA 4XT1C 4POZC 1GJIA 1AJ7L 5LWYL 3HAEA 3DYPA 3HVDA 4EZJA 5FW6A 4K8RC 2RFXB 2OSYA 3AG2B 3ZE0E 3NCYS 3PP4H 4XE0A 2VDPB 3C5ZB 1A0QL 4ZFOL 4YHLL 1KJ2B 2EIDA 1YMME 2NY3D 1EHKB 3BI9X 43C9B 5DCCA 4S1DC 4OJFL 1PS3A 4CN6A 2YXFA 2KC0A 1N8OE 4IHOB 4JB9H 1NTDA 1U92B 1I9EA 3C5JB 4NQQA 3LAFA 3P11L 2B3RA 4JKNA 2PR4L 3QJHA 4XNMA 5EEVA 5F7LB 4K7PX 2DJSA 2ZAHA 3WSQL 3N91A 3KBPA 3AS2A 2H32A 5A2AA 2XG4B 1LK2B 2AZUA 2PXYC 4UOJA 1S9YA 2WKOA 3EJUA 1MXDA 5I1DB 5EU7C 4P2YA 4LLVA 2ICWB 4XOEA 4KXZH 4EDXB 4Y5YC 5DHMC 5F1NA 1V3MA 3L9RB 4FQ1H 4P57B 4FLHA 4R2GC 4HOWA 2E4FA 3GSWA 4HK0A 1KEGH 4UDTA 5B21A 3QP3A 2WPGA 3BWUF 7TAAA 1G6RB 2CLRB 3K72B 1SLUA 3CSGA 4AYMC 3MRDA 3MLZL 2OI9C 3GBML 4HKZA 1F4YL 3ZE1E 1INDL 5JW4M 4HXBL 4QTIL 2HLFC 3GXFA 2VXQA 4WDIA 3WG7B 4G5AA 4LGRB 2VM4A 5FF6A 3QIWD 5I8CB 4H7VA 2YUXA 2JQAA 2RH0A 5F6HI 3DSFL 3FFCD 4N2HA 1RUKH 2ZYHA 5T1MA 2A7BA 3VFPA 4APQC 3RY6C 3MO1B 2P3YA 4UT7H 3R7QA 3BX7C 1HHIA 2DV6A 2ZF8A 5L6YH 4NO3B 5DDHA 5FM4A 4I3RH 1EFXA 2R27A 5CMAA 2NQ3A 5F7FA 2YN5A 3G04A 1Q9LB 3O9WB 3TZVA 3V0JA 3WJJC 2C7UB 1AHWB 3S36X 4AC2A 2NY6C 1W9XA 1GOFA 3FO9B 4WJ5A 3RVUC 3U1QA 3MBEB 4LFHD 5F7MC 4FULA 2F6AA 3ZTEA 3UG5A 3V8OA 2IPUG 3QPQD 2FO4B 3L5WB 1KXTA 2QT6A 2HKFH 3PWNB 3VXSD 2DQFA 2BW5A 3O6ML 4G6ML 3SQOH 5T1KA 4KBPA 1K8IA 1MY5A 4QRSB 1WO2A 1ED3A 2QLVB 2BSTA 5JHDD 1W72B 2Z7UA 1PMYA 2VRKA 3QC5X 1HESA 3BKYL 4I3SL 4GKSA 1FV1B 1M6UA 2OMUA 3UYRH 1JWUB 1A5FL 5ANMB 4ZFFA 1OSZA 2ATKA 5K9KB 4OZIB 4D0DA 1G7IB 5AZ2L 1DR9A 4K5NA 2HYMA 2EO7A 4ZMWA 4NP9A 3ARGB 1CLOH 2HFEB 1C7TA 2GT9B 4ODXB 5FYJU 1CL7L 1U36A 2JCCE 3WNPA 1T83C 3FRUA 4M5ZL 1MHCA 3AB0B 4RAUB 4Q9QH 3S3JA 4JY4A 3D25B 3ZZSA 4HEMA 5K5YA 4UZGA 1BQLL 4YHNA 3X1BA 4EQ2A 2GEQA 2IBZX 1BZ8A 3DK0A 5DS1A 1WZMA 2WZ0A 2E4TA 3PJNA 4P5TD 5C0BE 4FXKA 2AV7A 1IFRA 4HUWA 5CHNB 3A67H 4LCUB 2BC4B 4ANXA 3QHFH 1G6RH 1GOHA 3V0EA 3PWVA 5ICXA 5DJ8A 4FQ2H 3RHWF 4Y2DC 5DHYA 3RGVD 4XC3H 4R26L 2PABA 3ABGA 5CLXA 3EBHA 5AFAA 2WK2A 4PJGB 1J1XL 1W91A 4GQZA 4F8TA 2X3CA 1CYGA 1JXJA 5HGBB 1YEEH 4K9EL 5E2WL 1N10A 5F7HA 2MRYA 1I7ZA 3BUQA 3LKOA 3ZSTA 3TYFA 5KVDL 4OF0A 1U8PB 4FZEH 3WAKA 4GG6E 3RZWA 3W57A 3S37X 1ZS8A 3DIFB 4KTEH 5KVFL 5HBBA 4OLYL 2NX5A 3UXFA 5CZXC 3EYUL 3FBQA 3BZEB 4J3TA 1GZPA 3QEQB 3FW6A 1ETB1 4ZNEE 4KITB 1FLRL 4MBOA 3N0AA 5D1ZB 1I7RB 2PPDA 5AVVB 4C58B 5IIEA 3MDJA 4NSKB 3REVA 1H9DA 1QW8A 3MNZA 1WLHA 2Q7AA 4OF5A 1YO4A 2X38A 4IRSA 5ICYA 5IKCA 5IR1B 2R4SL 3EFOA 3SKJL 3HG1D 5C3LD 1MI5A 1QAWA 2ZD0A 4EI0A 1LL1A 3LEXB 2X2IA 4BUQA 1S7UA 1LE5B 3FQTB 1WGVA 3STLA 4LQFH 3U2SB 4P3DA 2FDBP 1D9KB 3TP4A 2Y7LA 5AD0A 2CHDA 1O9VA 1XBDA 25C8L 5GGTA 3SYCA 4XHJC 1OP3H 5JHLH 3HRPA 3SYQA 1TIUA 4DO6A 4MMXB 4QIRA 2Q8BL 3CZNA 5J13B 4IBLT 1QLFB 3AREC 3GBNH 4B97A 1E5ZA 3NJMA 3P4NA 1B0WA 4GRWF 2XVGA 3HR6A 1ZWIB 1Q0YL 3LMJH 1PF3A 2YPLA 3GRWA 3EOTH 4NAQA 4PREA 4HIHA 1S9XA 4U1SB 1KGCD 1CI3M 1G94A 2HH0H 1TVHB 4RIRA 5B8CC 1B88A 2GY7B 3K6DA 4G43B 3BOVA 3DVIA 3QUYC 2HUHA 3CWGA 2Y6TE 1CD9B 3PYCA 3MRGB 4QXWA 3OKNB 5A40E 2I25N 2B20A 2OR8A 3N50A 1ACYL 2AAVA 2VJ8A 4ODUB 5KAQG 3WDJA 3ZHNA 3TPUB 1I9JH 2XN9B 1COBA 2WOYA 1XGUA 2UYLA 3EYSL 4HCGA 3D34A 3HG0A 4QUOA 3IU3B 3EO1A 4K8RD 3QDAA 1BAGA 1MCIA 3CZKA 1E4XI 3QFJD 2GAZA 3I9IA 2M8XA 2BIMA 4PJAE 3DUHA 1BJMA 5JTWA 4OUUB 1JIBA 5FYLL 3JWOH 3CDGB 4ELMF 4HA1A 5HI4C 5TDOA 5BZDA 5CR8A 2JKLA 4NZJA 4TNWF 1J8HE 5E9AA 2CGRH 1MCDA 1JWMB 4MJ5A 1IQWL 4U1NB 3AACA 1YNLL 3U4BH 1JPGA 3GMQB 3LZLA 2OXGA 1RURH 2Y3NA 3D08A 4WO4A 5AVRB 1B9ZA 1A21A 2BOCA 1AD9A 2JLPA 2JQMA 4Y8DC 3V0HA 3LIUA 1U2CA 4BWWA 1L0PA 3HE7D 4KVNH 2OZ4H 1GZQA 1SDDA 5HGHA 4DH2A 3GRGA 3AXIA 3BP7B 5D70L 3N40P 3VXTA 5D2LF 2CBTA 1P6AB 1OXYA 3V0WL 1JYXA 3DURB 1EXGA 4P9HC 2Q3ZA 4NBYB 5C9JA 1E5AA 5ETUA 3M86A 4OCXL 3RPBA 4PCTA 3SJVE 3UDWC 2XV2A 1BQUA 4MMZB 4Y8AA 2V8MA 1QACA 1OZUA 2VE6B 3LH9A 3PXJA 4NQDD 6FABH 2HVBA 5DD6B 3C60A 4FNLL 4ILDA 2DIJA 4YBHA 1PG7H 3F58L 4PRID 2WWKT 3IDMA 3TCLA 3RKPA 1BQRA 2AK4E 3SCMA 1A3LL 3O0RH 5EB9A 2EACA 4ONFL 1BZQK 2B08A 3QQNA 5FA3A 1BPVA 4YXHH 2J88L 5FGSA 2G2NA 4DP4X 4OD1H 4IW4C 3NSDA 3U48A 2OMZB 1L0QA 4I9WD 4HPHA 1C5DA 2Z92A 3FO0H 4K2UH 4P2CG 4IU2A 5C2BL 4MB1A 1SMDA 5AKTA 1KBGH 5K69A 1QHOA 2BWQA 5I19L 2UUDK 1KFAH 3TF4A 3N44B 1L9NA 3FQ2A 1JNLL 4MJ2A 1JGVH 4CVXB 5FO8A 4KVCH 1WHPA 4TUJB 3STBA 5IOPB 2JJWA 3FUDA 1AC6A 3GHBL 4KNTA 4ONGL 4UF7C 3H9SD 1NIAA 4WEBH 3TWCL 1D5BB 1U93A 1NGYA 2I60L 3OAUL 4RQQB 4FXGB 3PNWB 3EYUH 5D71L 3HIZA 2ATPB 4MZIA 1RULL 3QORA 1UUNA 1X7SA 4DEPB 5L4FA 3LRKA 3VDAA 1QG3A 2WWOA 4BSVA 4HK3N 1ZT7A 1WBXB 4XN8A 2XA3A 3HZKA 4QRUB 4X99A 5IFJB 1OB1A 2AK1L 5AWNL 5KYWA 1A6PA 5E23A 3U1SL 2Z93A 3N1MC 1WFIA 4LLUA 5F9OH 3OLDA 1KGXA 2XCMC 3CFEB 5J6GA 3SDDB 4OM1L 1OGAD 4M7LT 4PLJC 1FJ1A 4UT7L 4DSYA 5KG9B 3N6YA 5AAPA 4PS4L 2P28B 2YKKA 4HX1A 1FF5A 1HOCA 1LEKB 4AZUA 1A22B 5LNEA 2DQCL 1EO5A 1KLUB 2H26B 4R6UA 2WXKA 3UPRA 3WLWD 5FW8A 5DJ0A 2VOTA 1UATA 3MRBB 3CQQA 1LVEA 2ARJB 4F1SA 3L13A 1U3JA 4ADJA 2XIBA 5FX3A 3VH8B 3UJIL 3HHRB 1NAMH 1EDQA 3EYFB 3G08A 5F9JA 2ZWNA 1WWAX 3GTTA 3QDGE 3HFMH 4FXKC 4ZOCA 2BLFA 3ULUF 1S5HB 3QULA 4JFPA 3ULSA 4IRJD 2DQUL 5DUPL 1A14H 3MRRA 4BFFA 4PIRF 4KKAD 4K5LA 1HFUA 3OHXB 3GSRA 2NYKA 5C0DB 3V52L 4MS6A 1NINA 1N68A 4XN5A 5HYJB 3IAPA 3RL1A 1FORH 2B2XH 2ZICA 4NOFA 5B8CB 1O0VA 1ZGLM 1P5UC 4YHKH 3GBMH 2PYEA 2VR7A 4EN2A 2EUWA 4OI7A 4LEOA 3ASWA 5DJ2B 5BO1H 2F08A 3BUYA 5C07B 1EZUA 4PG2C 1LO3L 4WO0A 4APQB 2CRMA 1U8QB 4Z76A 4ZZFA 5LXVA 5ENWB 2XFGB 1F42A 4FFYH 3V7MA 4PJ9B 4QY8A 2CIKA 1OTSD 4XP9H 4I2XA 5GS3A 1RFDH 1RQ5A 5M95B 3FAXA 5E00A 2FL5B 2GJ6B 3FCSA 4ZRGA 5GS0D 3AAZB 2EUXA 4JLRB 2BZ7A 2K45A 5ACZB 1JF1A 2IPTL 4ETQB 1RHHB 2JF1A 4OT1L 5ESQB 5B39G 4Q9RH 5I1JH 5DJCB 1FYHB 4JVUA 2IADA 1KB9J 4FLOA 15C8H 3SDYL 3H54A 1TTGA 1QUPA 3VD1A 4UB0L 2DJMA 1TUPA 2GKIA 1OP5H 4J4PA 1DL7H 1EHXA 2YJQA 4GQQA 5B1CA 4PJIB 4QXGH 5AVZB 4WI9A 5JW5B 3MCG1 3Q9PA 2YOCA 5C07A 3ZE2E 4GQRA 4U3HA 2DMBA 1U91B 1YDPB 4NZRL 1LP9B 3SGKA 1I1FA 2HKAA 1WFUA 3GIVB 2V2XA 3J7HA 1ID5I 1S9WA 3FFDB 3VTAA 2PYEB 2JK5B 2YPKA 5LDUA 5IB5A 2NNRA 1ZVHA 2JXMB 2JB6B 4RMVA 3UO8B 4EIZC 1IKOP 3W1ZA 4K94H 4NO2A 1JDAA 4LCYA 3GS0A 2TAAA 3NH7L 3W5NA 4QO1B 1TO4A 3Q43A 2F7RA 4I77H 1TTAA 3VJ6B 4O9HH 2VW4A 5I17A 2D7PA 2V3EA 4PJ5A 3J8F7 4PS8A 5DUJA 4OFYA 4WWPA 4F33B 2XY2A 4IBVA 1OAUH 2E7DA 4HOZA 1GKOA 4G3YH 3FOMB 5AVSB 3JV4B 3LY6A 2V3FA 3AS1A 4JO2L 2J44A 1QPKA 3CSPA 3OXSA 3WS6A 1MELA 1BZOA 1RZJC 2JKNA 4QWWD 4DW2L 2X70A 3P2DA 4UAOB 4OB5L 4AMKL 1WBYB 3BDYL 4F27A 5LWYH 1JGLH 2R1WB 2WXPA 3O2DH 4IIQC 5I2IB 3APMA 4AC4A 1DUYB 3EJZD 3FB5A 4UIKH 1BGXH 4MXWH 1P5UA 2HPOA 2XZZA 1EHAA 1FJ1B 4K3EL 5KG9A 3PL6A 2E6QA 1URIA 2WTRB 3WFHB 2IDTA 2FHFA 4PPTA 2Z93B 3QNXB 4KX8A 3C5SB 3FRPA 5DVMA 5C0FA 2MQCA 5IFJA 1J05A 4AEIH 2IANA 2CXGA 5DJZB 2ZYRA 1DQLH 3HZKB 1FNLA 4IRJA 4PJFE 4U4BA 2DYPB 3SJVB 1ILSA 3T0XA 1BVLA 3FT2B 4YHML 4DFIA 4G8EB 1QBBA 2RMNA 4BSVB 1GS8A 1YJDC 2GI7A 1YQ2A 3AU0A 3QH3B 4XXWA 3BUIA 3WO4B 1TJGH 2HX9A 4YHPB 1HXKA 2ADJA 1X5IA 3ELQA 3O4OC 4AVJA 5C7ZA 1MXGA 4HOMA 4WI7A 3WJMA 2VERA 2FTAA 5I6MA 1P7HL 1NGYB 4JO1H 3AQXA 1ZKAA 2C9RA 2DEYX 2QQLL 2BZCA 4G8IB 4D8PB 3TS8A 3CFKB 3MNWB 5T5NG 3II3A 1X44A 5F1KC 2YXVA 1F11A 5FFLA 4TUJA 5IOPA 3PWLB 4L1LA 1K5WA 4NEHB 5GGTH 2IAMA 4DCQB 1IGFH 4CADB 5AUMA 2YUVA 3MOQA 4PJ8D 1A0QH 2EEFA 4BE5A 1NSNL 5BS0A 4PJDE 4P46A 3T6QC 5KYXB 2JIXA 4L3EE 2R39A 2GFBB 1C5DB 2K9FB 2P9RA 2Z92B 4K5PA 4JCLA 2CPCA 4KHXH 1TQSA 2PWHA 2E7LA 2ORBL 4HISA 3IDIB 2J12B 1AD0B 4XCCL 1DJGA 2CKBA 2G9KA 2VTFA 3MLTB 4F5CA 4K73A 1N64H 2UZXA 3VI3B 2AXJA 4NFDA 3RU8L 3FQUA 2Q0ZX 4FYRA 5I8OH 5IGXH 5FDWB 1IM3D 2R0KL 2YD6A 1CIDA 4W9LC 3SKOB 4LBAA 3OJVC 4MMZA 5AVUB 3T77A 2X42A 5EU6A 3M1OA 1W0WA 3S37H 3ZL4L 1RZGA 5C9JB 3QZOA 2LU4A 4PMFA 4RFNC 4YFEA 4W9JC 3OAYH 2E8ZA 3HR5A 2HJLB 2FX8L 3CXDL 1YY8B 3UYRL 4NENA 1FZMA 2PXYB 5I75B 3MOBL 1ORSA 1J8KA 3WFCH 1HKFA 4OM0H 2ZYSA 1SDDB 1GZQB 2R15A 3U4KA 4N26A 4X7DC 3WO4C 5KN5A 2BOCB 1FNAA 4H0GA 4KY1L 4F9LA 2WUCH 5DQDH 3FO2B 3TZVC 2OA9A 3BH9B 15C8L 2IG2H 3SDYH 4WW2F 3SBRA 3WEMA 2F53A 1A6UL 5HVHC 3FT3B 3HC0B 1LILA 1CJYA 1SDYA 4ZW3A 3QDJD 4PHXA 4R0LA 2OYLA 2HLAA 5D7JB 1I82A 2NZ9C 2A77L 3A47A 2IVFC 1OF2B 4O2EA 5I6XC 2ZJSH 1UT2A 2WBXA 3A6OA 4OD2B 3CC5A 4PJ8C 5I66A 3HUJB 4QOKA 3HI1A 4AI7A 2OMTA 4APXA 1QABA 3ZKMD 3EO1B 3QDGA 1UOLA 1I3GL 4JREB 4OVVA 1VPOH 3U9PL 5E5UB 4XMLL 4NQXB 4JY6A 2CNYA 4O5LH 4BSJA 4DN4H 2XN9A 3K8LA 4UIMA 5AQ0A 1OAZL 3TPUA 4GP8B 1XQ4A 3VUAA 4KO6A 5HY9B 3R1GH 2AJVL 2DQIL 5A2KH 5KZCB 5E0QA 3VI3F 2ZUVA 4ZS6C 3BP6A 2D7NA 3N42F 4X5XB 4F57L 1TQBC 2YLHA 4GG8A 1CBJA 1H5BA 4TL5A 1ND0A 2YUWA 4G43A 4XP1L 4WO4C 1TQVA 3QZLA 2E3VA 2A0LD 2O5ZH 1I8AA 3NACH 5D4JA 3KCWA 1W16A 5KVEL 3QRBA 3U2JA 5D7IE 3UG3A 4AE0A 3VXOA 2E47A 4TL4A 3OPUA 2VITB 3BPOC 2VN3A 4PRIB 4BZ2A 4Z7NE 3CSTA 1KGIA 1OT2A 5AW5B 1D9KA 4KXAA 4IBYA 4AMXA 1N7MH 5AW2B 4FZ8H 2YFNA 1W0YT 1WYJA 2E7CA 1BD2D 3GSNH 1QSEB 4DOHB 4ZT1A 3KYAA 1ID2A 3KWXA 3FUIA 2UY7B 5ICYB 5A16A 4Q6YA 1WAAE 3VQ2C 3KG5A 3REVB 1LWJA 4EN3C 3MKGA 2IDSA 4C57C 2ADYA 3VU2A 3X3GL 5D1ZA 1WS8A 4YQXH 3JVFC 4LSDA 1FFTB 4IEFA 1UD4A 1RHFA 5DRWB 3G5XB 3O6FA 1T1WA 2VZTA 1DP0A 4OIIH 5C0RL 2XN1A 2IPKA 4DW2H 4JG1H 4AYBA 5I16B 3ABLB 1JSYA 4OJYA 3KBFA 1YNKH 4HJJH 1AKPA 1E8XA 1JGUH 4M4RA 3HE7A 3EYSH 1D6EB 1DSFL 4XMKH 1T22B 2IEPA 4WK4B 5A6LA 1HSAA 1O6SA 2H32H 3B8SA 4RH4A 3RWHB 5F97E 4MRCA 2Z91B 4HS3B 1V3KA 2WXFA 5FFGA 2Y6SC 5IZ7A 5IJCC 3LZFH 1RI8A 1UWGL 1T1ZA 3CVIH 4W4OA 4XRCA 3BP5B 1SVCP 5HHOE 2Q7YB 4FJZA 1UA6L 2MNUA 1MEXH 5SV4A 4MX7A 5HDOA 4CDGC 3DVNB 4JJHA 4X6CA 4WTZA 1LEIA 1DVFC 4CC4A 5LGHL 1NCWL 3OR7A 3C6LB 3PDOB 4YR6B 3QFJA 5HDBF 1QO3B 1MWAA 3AFLA 2FH8A 3E1ZA 2CDGB 3FHAA 1NMAH 5DF0A 1TJHL 2YR3A 3RWCA 4PLKC 1IAMA 1SXCA 4I2XE 3SGDH 1OAQL 2JCWA 2GITA 2JKSA 3BUPA 4M3JA 3VQ1C 3ZR5A 4XODA 1M3IA 3FU6A 1OLZA 3T09A 5K9JL 5DJXA 2ZKHH 1G7IA 4OZIA 2AF2A 2IWEA 1JPTH 5ANMA 1JWUA 2ED7A 1AZUA 3QDMA 1CGYA 3X3FL 1FVEA 1L7IH 1ZDSA 3L7FA 2KQNA 5HPMA 1H15A 4P4RB 3G5YA 1K8IB 5C7XL 3MLYL 2CDGA 4N2IA 2Z1KA 3IDNB 1W72H 2JJUA 2EDJA 4PP2A 4AM0B 3LIZA 4L5FL 2L4OA 1WV7T 3OR7B 5D2NC 4XTRD 4DEPC 1XZ0B 1FDLH 4B3EA 3BN9C 3RVUD 2OL3A 2W0FB 1JV5A 4R9HA 5D6DC 4WJ5B 5K9JH 3MLSH 4F7CA 1RZJL 5I1JL 1J86A 3O0RL 5CBAA 2E27L 1BX2A 4P2QA 2EZ0C 2JI1A 1JFQH 2P4AB 2CGRL 4FG2A 4JFUA 4PJ9D 4NO3A 2BCMA 1YEGH 4G2AA 4I0PA 3N1QC 2I7OA 4I0PD 4J8RB 5TE4L 3NIDF 3MLWL 3FU0A 1INQA 3FQWA 3PU7A 4O58L 4PV8B 4YZFE 3HNTL 1PKQA 3MLYH 5F70A 1RZKH 1KY6A 4GRMB 1QPXA 1DVFB 4S0SD 1HILB 4ETYA 2HRPH 4L4VE 3S3CB 2Q5BA 3FUNA 4KHTL 4X6BB 3LN9A 5GS2H 2IPKB 3ARGC 5CD5C 2B0SH 2IO5A 4QLWA 1T1WB 1WSST 3LHPL 3G5XA 3O6FB 3OMZA 5JW3H 5F89A 1C16A 1QSFA 5DFAA 1YN6B 3L9RA 2GCYB 1BVOA 2WLKA 1CFTA 1FVCB 1MRDH 1FPTL 4LVNB 1YJDL 4LU5L 3E9UA 4N0RA 1FG2A 1RUMH 3BIKB 5CCKL 1LK2A 2XG4A 5IBTL 4YVNA 1KY7A 3W56A 1MFNA 4ZMAT 5HHQA 5AVWB 2OCFD 2ZP0T 3IFOA 4PJ7A 1UACL 2I07B 3JWNE 1RZPA 3REWB 1XGPB 2IWKA 3OJDB 4MA7H 1A7QL 3T65A 1KIRA 2IANE 3VFOB 2N56A 2DQ6A 1GJWA 1KDIA 3G7TA 3OAYK 3O2DA 4GSRA 5ALCL 4JDVB 2JELH 4NUGH 4BQ9A 1YSOA 4JDZA 1OP9A 3SKNA 4Z8FH 3JTSB 4AIXA 3VXOB 3HG5A 2QV4A 3KPMB 5GIRA 4XNUL 3L3KB 4NLHA 2NUTA 3SZ6A 2WJ5A 3V9CA 1M7IB 3MRPB 4MFHA 4BE6A 3MV9D 3QJVB 4XPAH 1NDMB 2WXLA 4JO3L 3Q6FB 4QHLA 3UZVB 1GMIA 4BRVA 5GS0C 1H5BB 3ZKXB 4B9ZA 3Q2VA 2OI9B 1BQHA 4G9FE 1A3RL 1I8MB 3C2AL 5C0RH 3GXDA 4M7JL 4PJHA 3TBSA 3A24A 5LUMA 2ZAIA 1IL1B 4FA8A 4XZ4A 1S3KH 3SD5A 4M3KB 4X4YB 1T0MA 2EUZA 3NIGE 1L9MA 5D1XD 3BPNC 4OGZA 1E4HA 1BREA 3WN5A 5EZLB 1K2DA 5E2UL 1CD0A 3QI9D 4WI3A 2OMTB 3HI1B 1J12A 3TNMA 1I31A 3D0LB 4PD4K 4FQLH 3RWFA 4ZAKC 4D0BB 1KB5A 4O02L 1DLHB 3N41F 4ATTA 1OF2A 3VA2C 4FQXA 3QDJE 3Q1EA 5A43C 2HLAB 4R0LB 2JCCF 1E2ZA 1ACYH 5J13C 3ZGIA 1F4XH 3SDCB 4X9YA 5BQ7A 2W8CA 4LDLB 2FWOB 4I0KA 3SYAA 2XX1A 4RGOL 2WLNA 3BH9A 1AZRA 4BCZA 4Y9CA 4B9KC 2E9WA 3GQFA 3L5HA 4XMWA 3KJ4B 5FHBH 3NRPA 3IJSB 2Q76A 5DUML 3B2UD 1M1SA 5E99H 1AYOA 3F04A 4GO8A 5IEKA 5CBEA 3S35L 2DL9A 2BNQB 4FCHA 5LAXB 1CXEA 1T5KA 1WUZA 4H8WC 4J8QA 2F1AA 2WD0A 3US1A 3RUGE 3LKSB 3OX8B 3HR5B 5EOQL 1R3IH 2DQUH 3FF7A 2NLJB 1M05A 1MRCH 1F4XL 2A6DB 1W0WB 4P9HH 3T2OA 4DZ8B 2LFEA 5E4IA 1NEZG 3DRTB 4E41B 1FDLL 1YMHB 4DEUA 1QWNA 3RDJA 1CK0L 1TQUA 1Y6MR 1ESOA 4I7ZC 2CSPA 2R59A 5C0CD 2FWLB 4JQIH 4PJEB 3QUKA 5M7QA 3VFSB 4NQDA 1CGUA 3V7AG 2BXZA 3WOVA 4AT6B 3WFCL 3NCJL 1D7DA 2CO6A 2LQRA 5TF1H 1OM3L 3WBDA 2XI9A 4JPWH 4J3WA 2YPVH 3E6FB 32C2A 3GRBA 1ZDQA 3H1ZA 1R24B 3CK0L 1IAII 2DWTA 5EEUA 1ZHNA 5T5FA 3HZVA 2JIXB 4HWBH 3V5KB 4C4KO 5MHSD 2CMRL 2H2PD 5L2KB 1DQTA 2DMKA 3S6CA 1GGIH 4UOQA 3SQOL 5JOFB 5I6XB 3SPGA 3SE9H 1IGMH 1FL5B 1H6EA 4Z1PA 4JG0L 2H9GB 1F11B 4X7SL 1MG3C 4MD5B 4Y5VA 3ZK0A 1IGYB 1YEKH 3MODH 1C7SA 2IMNA 3L3HA 3Q3GB 4WTWA 4Z9KB 4U1JB 2YD1A 1XCTA 1E28A 2YD3A 5IMMA 5TH2B 3IMRA 3TEYA 1G0YR 4Y19A 4PJIE 3L08A 4NQVB 4MKMA 5IBTH 5AB1A 1BLIA 2APWA 3U46B 5HHVL 1TCMA 1YPZB 3WNOA 2FX9H 4XP5L 3VX0A 5K1NA 4G8EA 1GYWA 4HIJB 4L1SA 4OD3H 4G7YH 4QRRD 2ZUUA 1PQZA 3I6KB 3UGXA 4C8XA 2EXTA 1FHGA 3DX6A 3E38A 2R69H 4MCMA 5L2JA 4NWUL 1MCBA 3UBFA 4R3SA 5B1JA 1NCHA 2X4RB 1GIGL 1E9PA 4LCVA 3D52A 1CFSA 3GC3A 3WENA 1LTXA 3TONA 5TQ0H 4J3OF 5HTSA 1JVOA 1A7QH 5EHFA 2XWXA 4F20A 3PWUA 1ODAA 1A3ZA 3CN4A 4U49A 3ULVF 3F6IA 4CW1B 1DTUA 1NCTA 4DVBB 5CILH 1EBAA 2K3TA 3AG4B 4AYSA 1XFPA 1KXHA 1Y18A 3MUJA 2Z8VC 3P11H 3DHJA 3WLWC 1MQKH 4G80A 4LVHB 1G84A 2VUKA 4PRPA 1IGFL 4WGWB 2XVKA 3ASOB 5GS1A 4UT6L 3WSQH 2B59B 4UQ3A 3OXSB 2XBDA 1FZOA 1DZBA 2A6JB 1AO7B 2BOLA 3HNVL 3DPBA 5D7IF 3GSNL 3WNNA 4W6YB 1CDCA 1MIML 1QNIA 3QRGH 3VX1A 2IAND 3RDTA 1NGXA 4Q0XL 5L0QC 1OTTD 5JLZB 5CCHE 4PP1D 2IAMD 3GRWH 5L4IA 5I71C 2L8AA 3KYOB 1HHHA 4HQQL 3DDFA 4UZUA 1LO2H 1IGIL 2J73A 3OF6D 4HJUA 4PM1A 4UAOC 5K1JA 3CCHA 8PAZA 5D4QA 5FYKU 2GYSA 3WN5C 3JWDC 3S88H 3E9TA 1E9QB 2YGNA 3PQYB 1UOVA 1NUDA 2KZBA 1WFTA 3UTOA 4Q9QL 4M7KH 4DQOH 5TD4A 5IBLD 1BW8A 3TBYB 1DANU 4JHZA 4PV1C 1U91A 1YDPA 1PX8A 1E6OH 1W72L 1FRGL 4A6YH 5A1AA 3KXFB 2ZNXA 3GYRA 3WU1A 3H2PA 3H8NA 5JW5A 2MJWA 3OM3B 4GMTH 1AE6H 2XTJC 3KMDA 2H1PH 2OCCB 4WV1A 3TIDA 1TTFA 3EXJA 1ICTA 1KCSL 2DQDH 4JN1L 4U1IA 2QDVA 2VH5H 2X3BA 5EORH 1ZLEA 4ZS7H 4HSQA 3VFGL 5I15L 4K94L 4N8CH 3UAEA 2H8PA 3VD3A 3H56A 4Y16B 4D0CA 4L8BA 2P47B 3H0TA 3WELA 3PGDB 1RHHA 4MMYA 5D93C 4YMPA 4AGOA 3I6LE 4NNYA 1FNSL 3AAZA 4CUCA 1BMGA 3G5WA 4FQXC 4GQ9L 5FFOA 2HCZX 2MCPL 1BAWA 2X9WA 3UADA 4X0KB 4FL4B 2F8OA 1HIMH 4IMLA 4KK8C 4ZDHB 1XMWA 3MTXA 1WEJL 1X4YA 1YG9A 1ZVSB 4XVUD 3R8BB 5I1EL 2G60H 3ERXA 3CHPA 1AGBB 2QMKA 4HKBA 2L3BA 3NZHL 5FOJA 3SBQA 3SQBB 1K3ZA 4TQPA 1OAYL 3BEVB 2VZUA 4U6HB 3T1WA 1P7KA 3C6LD 3C87A 4M8UA 1T1XA 4G6KL 3GXNA 1S7VB 1AO7E 1E90A 1UQSB 2H0PA 5ADPH 1TLKA 4PJCE 1R3JB 2BSEA 1SZNA 5EUOE 5C0DA 5J6SA 2GSGB 2JKTM 3IJ7A 3QNYA 5AEAA 4DGIH 5C9KA 1GYUA 5MEQB 1UZ8B 1AZVA 1MIEH 1THCA 3NFPA 5TE6H 4K3GA 4S10A 4EI5A 1S5HA 1UKQA 3ULSB 2ITFA 4XCNA 4FKEA 4MASA 1J9CT 2FBJL 4FG0A 4OCRL 1UC6A 4FI8A 4G7VL 2X05A 4J27A 1M7UA 2WZPA 1UJ3C 4WTQA 5AOIA 5LB1A 3QXAB 3OG6B 2DWDA 5D4HA 1EFQA 5FO7B 1DBKH 2RQEA 5I5MA 3PWPA 1S9VA 4I0PC 1C08B 5HJ3A 5J57B 2PP8A 2H26A 3UPRB 2MQ0A 3RVWC 5F7DB 2QR0A 3B83A 3RX9A 1LEKA 3H3PL 4R8WL 4Y1SA 3MRHA 2ADFL 3MLWH 3JSSA 4KJPD 4KUZH 1QRKA 1GGUA 3SDDA 3Q8EA 1EX0A 1XF2B 4MNGA 3KPNB 3KLAB 3QQ3B 3V4UH 2ADGA 1ZHBA 2IOOA 3KGSA 4LB8A 2MPAL 2QZ5A 1T66D 2NRDA 4FOMA 1AQ8A 1BD2A 2BHZA 4KK8D 2AK4D 4K23H 4HU2A 3S5LB 1WBXA 1NMCB 1ECZA 2FB4L 1JHKL 3MJ7A 1RIUL 4ZO7A 3OSVA 5AOLA 2ATPA 3TURA 3R1GL 3CQPA 4PJDF 4NFCA 2MPVA 2K8QA 5IB4B 2ADFH 3ASNB 5EU5A 4RQQA 4YSQA 2WLHA 1LO5B 1IT9H 4KZDH 1CXLA 2AJSL 2XQBL 4PJFB 4U1MB 2R2BA 1SQ2N 2AKRA 2F7QA 3IXTB 4PUBL 4F57H 1ZXQA 2DQJL 3H42H 4PWFA 1MAJA 3ARRA 1AI1H 3AW5A 1ZLSL 3CHXA 4E9VA 3US0A 3TTYA 4YWGL 4M6OH 5FHBL 1UM4L 4S1QL 1IJ9A 3CFIC 3GSQA 3LN5A 1MCOH 2NW2A 3CH1B 3QDJA 3KPLA 1U3HD 4KJWC 4EDWL 3BUDA 2WQWA 4WW2C 4XMXA 5HHMB 4X5WB 1B4JH 3FTVA 2KERA 1WFJA 3KPRE 4O2FB 4LE8A 1MPAL 4ICWA 3GXIA 4NN5B 2VO5A 4X4KA 5DHVB 2CPUA 3BKMH 3NJJA 1GPOH 2D73A 4ANWA 3O8XB 3MJ9A 1LEGB 5ADOH 1HXMA 3OSKA 4GAGL 5DD6A 3POHA 4ZMPA 1EERB 1VZGA 3ME0A 1CDIA 3C9NA 4ELMA 2ITDA 3K7UA 3LDBC 2VE6A 5KBNC 4DGUA 3CVHL 3FUKA 4PB0L 4ZSOA 3WNLA 4ZTPL 3O6MH 3FTWA 4G6MH 4HXAL 4IOSD 4JFHE 4XOAA 1MCPL 1A4KA 5D1QA 4H20H 2DIEA 2YBRA 2ZWKA 1AGFB 3EJQA 1KYUA 1ADQA 1NC4B 4AQ8A 4YDVA 1KENH 2W59A 2EEBA 2ZUXA 2EINB 1UWYA 2F53D 3CHSA 3SPCA 2VDML 4YSDA 1YYCA 3GJEB 5FCSH 1JRHH 2YAPA 4XBMA 5AZ2H 1IE5A 3A4FA 4AENB 4L0PB 1TEYA 1OD9A 1UM6L 3K5RA 2FECL 4G6AC 3IGFA 3CXHJ 3SB3A 3QNFA 2WQAA 1KGCE 1MW2A 5TK4A 3RWDB 1TVDA 1IC0A 3GMQA 3WNJA 4JAMA 5SWQB 4WQOA 3VGFA 4ZBJA 4F8NA 4U1NA 5DVNA 5JHBA 1TETL 4DP7X 4RMUA 3X1NA 3P30H 1CF8H 1M71B 4XBGA 4JFDA 1X6LA 3WY1A 4WEEA 4JRYA 2Y5TA 1NGWA 4BJLA 3DBSA 4WUUD 5CWSA 5EOTA 1IEBB 4L2YA 5SWSE 4EUPA 2A6IB 1UXLA 5E08H 1N18A 2CZNA 2GAZB 1MIEL 3EYQD 1N2RB 2VNCA 1G5GA 3T04D 3ZHKA 5DC2A 3L45A 1SEBB 3SQRA 4XBGB 5JQIB 2QQLH 2CJUL 5DR5L 5CGYD 1AGCA 4P49A 3N43B 5AW8B 2Y9RT 1XIWD 1MFUA 4QRAA 3WY3A 1DJIA 3D85B 3ARVA 2BNQD 4FLSA 1A6WH 5AOZA 1UEMA 1DQJA 2CO1A 3F7YB 5FYJH 1SJEB 1P84K 1L9QA 1D5RA 1JTOA 2P8PB 3Q13A 2JKWA 4JPVH 5KSUA 5LBSA 4GW1B 1FL6A 5C2UB 1BQHG 1NM4A 4W6XB 3ULUC 1QEXA 3EO9H 1NOAA 1NEUA 4YDVB 4EI5D 1EK3A 3QXDB 3L4TA 4LRIC 2YBRB 4Z7VB 2NY5C 5JDJA 3DETD 4F7PA 1CDYA 2WAQA 1NBZA 4FMVA 2BP8A 2NY6D 2I9LB 2A1WH 2I5YH 3SGEI 1A1NB 2XWDA 5BJTA 2CHWA 3QNZA 3FTZA 4AW7A 5AD0B 1HXMB 4NM4L 2YN3A 3QPQC 4MD4A 1LO0H 3FQTA 3STLB 3TC9A 4DGVH 1YEKL 3FOLB 4XVUC 3W3BA 4RISH 1A14L 1RZIA 2JIXD 3WTXA 1LM8V 2FZ3B 3QARA 3EFOB 2QJDA 2DWEA 3SN6N 1WD8A 4H8QA 1CQKA 4HFUL 3VXPA 1OY3B 4R96A 2FSEA 4LEEA 4CGUB 4X2UA 3WLBB 2V5TA 3MOAH 3VSQA 3VG9B 5AKRA 1B0GA 5CN3A 1M6OA 4M7ZC 5HYFA 2BIQA 1N3NA 4JVWA 4E9QA 4B9JA 2A73A 1U3ZA 1X7TA 1DLFH 4G7VH 4H1LB 3E8UH 3TXAA 5C09A 4HLZH 3SE8H 3U1PA 2AKRB 2WZ5A 2DM3A 5IQMA 3LRSA 3P4OB 3DTUB 4X4ME 3DIFA 1FBIH 3VB8A 1USQA 4Z7WA 1WZKA 1ITCA 1U8PA 2X1OA 2HVKA 2ZXDA 3PJSA 3QIUA 1OGSA 1SXAA 1FL3B 4XB7A 1ZLVK 1E40A 4U3SB 3MV7A 4NKMA 3KGUA 3B9EA 2F2HA 2EVGA 1JHTA 1FZJA 2QTEA 4L18A 1X5AA 3PHAA 5CCKH 2W07A 1MQKL 2VISB 3C6SB 3IJ9A 3JTTA 4JFFB 5J11C 4L9DA 4HIIA 3L3OC 4V1DA 3IJYB 3ROLA 3QDMD 2BC4A 4KU1A 1NFDB 4K94C 5D7IA 1JP5A 1J8RA 1GYVA 1YY9D 1OANA 3KYNB 1SBBA 3KPNA 5G2NA 4Y1AE 4DKTA 3OWEA 1WEJH 4UV4H 2BFVL 1FYTD 4WKZA 1BFTA 4QXGL 3BAKA 5E4EC 3QEGH 1R6VA 2NYYD 4BGLA 5AKSA 4MSWA 5E5LA 4FA6A 2H3NB 3WEXB 4X5LA 4Z8FL 4GPVA 4PJDA 3S34L 1OGAE 1OV8A 3FRUB 5AOKA 4LSSH 4XBEL 2XICA 2OR7A 4NN5C 1EGJA 2XA8L 1N5AB 1OHZA 3DHMA 3NSCA 3PWPB 4HH9A 2IC2A 2IGFL 4WNJA 3RTLA 2P8MA 5JXEC 1R3IL 4IRSC 2C5DC 4M7KL 1T04B 4M02A 4PJ7F 4LDCA 4ZFFB 2A9MH 3VFRA 1XGTB 1JZ4A 2W81C 4LP8A 2OMUB 3DX8B 3D2UD 1PIFA 1HQRB 2XWZA 4ZMTA 2DQGL 4BDVA 1Y0LB 5B38A 1FRGH 2BSTB 4XCNB 2OULB 3FFOA 2LW3A 4BEIA 2LE9A 3QO1A 3NFPB 1RUAH 4P3WA 4TM9A 2EE9A 3N1GC 1F45A 1R3JA 4NHUA 1RIHL 1YEHL 2OR9H 4HS8H 4JM2B 3QEHA 3QZNA 1VEOA 3TVMC 1P7KB 4F93B 1AHWA 5DZNA 1LP9E 1PYWB 3X3FH 1JD9A 1Q9LA 2RJMA 3BEVA 2IFGA 3K4ZA 4FNRA 3Q06A 2MNJB 3HZ3A 1X5LA 5C3TA 1OGTB 1AGBA 2ZKMX 3SQBA 5D55A 3MO1A 3IM1A 3VGGA 3P9LB 4Y19D 1S78D 2ZCZA 1QYGL 5I1KL 4RRPG 4U6XB 4AIOA 3UZEA 3VSUA 4Z3FA 1EWHA 2P5WB 2BERA 3QQXA 1TNNA 2G5BB 2N7SA 4ORZC 4NCC1 4X4XB 1MJ8L 1GTNA 4GKLA 1U95A 2BSSA 5EO0A 5EF2A 4JGMA 3EHBB 3RBGA 3FN9A 1RV6X 5I6PA 3VSVA 2O5ZL 1RVFH 3S4SG 4FFWD 1EHLH 4PRBA 1MJ7H 4LVHC 5H35B 3WKYA 2WZ6A 3KH4A 1VJSA 3HVNA 2W65B 4QHUA 4OF7A 4JDTH 1NKGA 4O4YH 1M9WA 4FFVD 4OGXH 3H9HB 1GKEA 3U30C 1X5ZA 1K3IA 2NOYA 5D7JC 1S9YB 5LN4A 5SX4I 5IHHA 3R4RA 1HSBA 4HCIA 5DLLA 4CC4C 1AVAA 3WAJA 3H7BA 1KTCA 2D0HA 3UJTH 1L5GB 1RERA 4MZ2A 4H40A 4RAVB 3AJ7A 4NDMA 3V0VB 1X3DA 3NDYE 4ZUSA 5D2LB 1MJUH 1OWWA 4MA3B 4YXLH 3ZL1A 3AMLA 2IDQA 4JFZL 4NHCH 4AYFB 4RGNE 1DEEB 2ZWSA 3VXRD 5C09D 3SOBL 3V4VB 4LESA 3CLEH 1OPOA 4UOZA 4L1TA 3K6NA 1F4WH 3MUHL 2J88H 4MXVF 3RDTB 3NPSC 5A6IA 3HE7C 2IQ9H 3L5IA 4WI6A 5JR1L 2BVTA 1PKQE