5ABZA

Complex of the fimh lectin with a c-linked naphtyl alpha-d-mannoside in soaked trigonal crystals at 2.40 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH
publication title Structures of C-Mannosylated Anti-Adhesives Bound to the Type 1 Fimbrial Fimh Adhesin
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 35
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5abzA00
1KIUB 1TR7A 3ZPDA 1UWFA 2W07B 2UY6B 5AB1A 3JWNH 4LOVA 4CA4A 4J3OG 5F3FA 4X5QA 4XO8A 4X5PA 3BFWA 3JWNG 4AVIA 2J2ZB 4AUJA 5JQIB 4BUQA 5FWRA 4J3OH 5F2FA 2UY7B 1N0LB 5LNGA 4XODA 4AVHA 5FLUA 1KLFB 4X5RA 4XOCA 5IQNA 3ZL2A 2VCOA 2JMRA 4AUYA 2XG4B 5CGBA 4AVJA 3MCYA 1ZE3H 4AUUA 2XG5B 4CSTA 4AVKA 4AV4A 4X50A 4ATTA 4CSSA 4XOAA 4AV5A 4XO9A 5AAPA 3SQBB 3BWUF 3ZL1A 4AV0A 2JTYA 3RFZA 4XOEA 1PDKB 2WMPB 3BFQG 5IQMA 3ME0B 4J3OF 5LNEA 5IQOA 5FX3A 5FS5A 1QUNB 5ABZA 1N12A 4XOBA 5AALA 3JWNE
chains in the Genus database with same CATH superfamily
2W5PA 2XVLA 4JAMB 2WZ5A 4TNVF 4YDLC 1L0XA 1RJYA 1BOYA 3EJPA 4FQJL 2D03H 4ZX6A 1MAML 4ZFQA 4HKBA 5HBBA 4B0MM 4JJOA 4XMWA 4ZUUA 3CN2A 3LQZA 3VGDA 2Z0BA 2WKOF 3VVWA 1UQSB 3WHE0 4OR1A 4LEEA 1CN4A 1U8KA 4LL9A 4Y1SA 4HU2A 3KXFA 4IRSB 4J2QA 2IGLA 2OX5A 1ES0A 1C7TA 5FYKE 3N41B 5G4OA 3AU1B 4QYOA 4J7RA 3PHOA 1D6EA 4YFDB 3ZYIA 5CR1A 5C0JA 5IY5B 4KTGA 1YY8B 5HYJA 5L4JA 2J6EH 4UT9A 1KCBA 2I9TA 4DVBA 3Q44A 1INQA 2IH8A 1Y18A 4XMKL 1F4XH 1ZSHA 2AJVH 2I7OA 3AB0C 3I75A 5IB2A 1OPGH 2XA8H 3WIFA 1XO8A 3PNWA 5FAAA 4QGTA 3C8HA 2QFPA 4Y1AE 2XJLA 5J9PA 1YNLL 2Q3AA 5IEHA 1PG7H 5JTWA 3MMEA 4NPJA 3HE6D 4L4TB 2O61A 2VLLB 1GXEA 3FQUB 4CN1A 2BERA 3TF4A 5SWQA 2NNCA 3RY5A 1A4KB 2YKLL 1J8RA 2DV6A 3SOBL 1B4JH 3G04B 5F9OH 5KJRL 4C4BA 4NYLA 4K9EH 3D39A 4ZQKB 3H2WA 3FO9B 4OBRA 4NO2B 4E5XA 1ZSDA 2KLTA 4FYSA 3S4SG 3UTOA 3US9A 1Q0YH 3D07A 3O4LA 1MJJB 4OAWB 2AKRA 1D9KA 1WGOA 4Z77A 4NQEE 3LPFA 2VL4A 2VISB 5IQLA 1OM3H 4AGOA 3ARDC 5LXVA 3EJYD 3HAEB 3MV9B 4M62L 4F3FB 1B2YA 4HV8B 3LV3B 4J8QA 4E9SA 4E9RA 4G70B 3HB3B 2WB1A 3FXIC 5EWIL 5CAYB 3EXLA 3A6CH 3N41F 2FQEA 5AVWB 1HL5A 3KPNA 3L1OH 3CVCA 4HHGA 2WTRA 4EN3B 1A7NL 4Q8BA 4F33A 2QHLA 1J9QA 3UJIH 2DQUL 3SGJC 3DV6A 3IN0A 3GB7B 4KUZH 1GGCH 4GY4A 5T1DH 2FNWA 2XDHA 4KJPD 4BCYA 2FR4B 3LVTA 3IWUA 1YEIL 4GG8B 2R0KH 1MHCA 5CJQL 4WCYL 1E3FA 4L05A 3U30B 1BVOA 5IIEB 3ZU8A 4BKTC 2FQGA 4XAWL 3ARED 4N87A 3FMGL 5I71C 4QHNB 3GMPB 5KVDH 2FSDA 3QDAA 1F00I 4MMZB 4X6DA 1S7UB 4LLYA 2F5AL 5C0BD 3RTQB 1RP8A 3U6RA 3NA4A 5DHVH 1MZYA 1TYJA 2VLKB 3L4TA 1RZIA 2NYYD 1DUYA 4MJ5A 5DTFA 3NAAH 3HPJA 5D7SL 3B2DC 2J8HA 3EOTH 2A74B 3WE1A 2AITA 1OAKL 4IRJB 2B0SL 1TDQA 1SLWA 3JTTA 3D5OF 1IZJA 4JFDA 5GGVY 5LAPA 1CICC 4UNVA 3WBDA 1JPGB 1M6OB 3VH8A 2CO1A 3VACA 4B9FA 3MV7B 4FFZH 4HK3J 4TVSa 5F1KC 4GXFA 1ZS8A 3QIBD 1HXYA 4N1CA 1P6WA 4R0LB 1SOSA 3NZSA 3BX7C 1SBSL 1SYVA 3ARFC 1UVQB 1OP4A 1LEIB 3VI3A 2ZKWA 3MDJA 4H8WL 4JPKH 3LN4A 1OTUC 3RVXD 1QKZH 3PUUA 2NT0A 3QRGH 4HKXA 5J6GA 5AOZA 4PJ7A 4LU5L 3HG1D 3RVVC 3LIZL 4TQEH 3P2BA 1G9EA 4XN9A 5IMLA 4X6BB 1A21A 1D7DA 1DDHB 4PAZA 2Q86B 2C9XA 2DQFB 1AHWC 1JZDC 1R5WB 2G60H 3L2NA 3MBEA 4P48A 2Q7NA 5F7LB 3MRFA 2DWTA 4KROC 5F9WC 1C8QA 4W9GC 5A2FA 3QG6B 4OFIA 3VD2A 2ZOWA 3EG9A 4GW1A 4PMFA 4A2HA 3IF1B 3IGAB 4DIXA 5G55A 1A22B 2BVYA 3M8OH 5I0DA 4YH6A 1XF2A 5FGSA 4FX5A 1WISA 3TBYB 4MASA 1M56B 1ZDSA 2CHXA 5DJAA 1I8AA 4HIXL 1OCZB 4JZOB 1P4IL 2AEQL 4X9HA 1T20A 2F1AA 3MA9H 4JRYD 1NLBH 1FA4A 3IJSB 3SGDI 2YK1L 3JWOH 3RTLA 4N0RA 3E8UL 3NCJH 1CFMA 1KBWA 2JKNA 1A6PA 1UD2A 1Z9MA 2F54B 2G9KA 1AMYA 3H55A 2VOTA 1IFGA 4WFGE 3BC9A 5JZ7C 1OSPL 5I18L 1BFOA 1XF3B 5IFJB 3OHXA 3ET9F 1O9VA 2HXAA 3NP4A 3G6DH 4PJEB 5EUOE 3SQRA 1V27A 2HSIA 1WC7B 2X2JA 1MAJA 2F5BH 3ATBA 2YUVA 1E5YA 5D7JD 3S2CA 2OFQA 5LN8A 1I3RB 4R8WL 3VFWA 3C6SA 4FE9A 3C5JA 3TJEL 2DWYA 3I3DA 2FLMA 3L3GA 4GKSB 5I82A 5CFHA 3KJ4B 5ISZB 4PJFB 1UH2A 1MHHA 5LBSL 4L5FL 1OANA 3S37H 4DN4H 1DBJL 1R5IB 3FTUA 4G7SB 1JGEA 3IJHA 3BP6B 3LEXB 5CSZA 3O41A 4CNIA 5JR1H 3H1ZA 2IWKA 3TL5A 2VTFA 2OJZH 1X5HA 4PBWD 1WAAE 4P5KB 4ZD3L 1D5BA 2PR4H 5K5YA 1UYWL 4K7PX 2EIKB 4HKZA 1OP5H 5D70H 5GSRB 3U4EA 4EIBA 4MDJA 5FDYA 2JTDA 3ULUF 3CU1A 2W91A 3BN9C 2HRPH 1J1PL 2Y9RT 3TFKC 4DO6A 4XNQA 2HRLA 4LLWB 1U8HB 1SJXA 3VXQB 2YSTA 3TEWA 2Q76B 1NFKA 2VE6A 1OTSD 1G7IB 3ALWA 5ICXA 5I1AB 2JI1A 3MZGB 5LHDA 3VXTA 1YQ2A 4NLHA 3DIDA 3SGDH 1Q0XH 4JM0A 4BIKA 5JOPD 4PJEF 2MKWA 3SYAA 3BRDA 1ZEAH 3J2PA 3HBGA 3MUY1 2J25A 4OM1L 5L2KD 2FO8A 2A38A 4S1RH 2DQTH 1GC1H 2VDPL 1WO2A 4O4YH 4MJIB 4PTUB 3P9MA 5JXEC 4NDMA 2LOEA 1CFVL 1LO3H 3M07A 3P11H 3EOAA 1E65A 1S7QB 1E8ZA 1X3DA 5F7HA 3ATEA 4G82A 1BVLA 3QDMD 4D8PB 1AXTL 3HZKB 2E6QA 3OKLA 5AAMC 2JI3A 3EJZC 4DHLA 5B38B 1TEGA 1EDHA 1RZGB 1FH5H 1VEMA 2G5BB 4GQQA 4ICXA 4XVTH 3TWCL 2XN9E 1V3KA 2YPLD 3AXIA 3NFSL 3FAXA 1NIBA 1DVFB 4QLWA 4I77L 2VM3A 3QULA 4ZSOB 2XIDA 3HHSA 3WIHH 2DBLH 2BSRB 5BMFL 3CGTA 3Q01A 1EQWA 1XTLA 2A9CA 3MCYA 3MJGX 4JO2L 3CFDA 4N0CD 4JFPA 1SYSB 4O02A 2D31A 4YSDA 3HLKA 5I76B 5IFHL 2K3TA 2OTWA 2VGLM 5C86A 2PW1A 4OGXH 3K5RA 3UTSA 3NH7H 1MW2A 4KO5A 3FQXB 4Q7DA 1Z0MA 5HHXL 3H9SE 3VE0B 1BM3L 3V0VB 4PW9A 5AG9A 3N1PC 5IBLC 3KL5A 4D7BA 1SLUA 3BT2L 3PL6A 4IJTA 4UV4H 4X0KB 3MKGA 4KI1A 3QIWC 3WS6A 4B53A 3S36H 3CLFL 4KX9A 4YHZH 5EA0L 1EAJA 2ATPB 3HZYB 2HG5A 1SUJA 2WLIB 4ZBJA 2Z1PA 4WWKC 1QHPA 3LY6A 3I6LD 2EDKA 1PDKB 3BFQG 1HVXA 4NZDA 1WGVA 2OXGA 1CQKA 3GD1C 3KLAB 5DDHB 2GK2A 2FNBA 4PIBA 1F56A 4YL9A 1CPUA 3G5ZA 1XGUA 3F12A 2CHWA 3MNWA 5D6CA 3GS7A 1HS6A 3U7WL 5JXAH 5K1NA 2R29A 1SXBA 4GKOA 2G4GA 2CO2A 1QLRB 3PFUA 4FP8H 4ZUVB 1AGCA 3K4DA 5ACZA 3RFZC 4MJ2A 4DUWA 3QEGL 5E51A 3QWQB 3BEWB 4WI5A 1KIUA 1L9TA 3HI6H 2WYZA 1YMMA 5B1JC 3T1FB 4B95C 5HYIA 5I6XB 1TENA 3QYNA 2OMNA 1FZJA 2EJ1A 4KKZA 3F85A 1RMFL 2BY3A 3RWHA 3CZSA 1FAIH 1XGQB 4M93B 3TBTA 3CZJA 5GGVH 2DWXA 4HUUB 5BS0E 5I1LB 2J4WL 4LKCB 1HEHC 2DD8L 3BD5A 3MPCA 4HT1L 3MLRH 1FNGA 3HRZA 3BDBA 2I85A 3ZZ1A 3JWDL 4PPTA 1XF5B 2C1OA 4KJQC 2ZSVA 1EZSA 3MGOB 1MIML 5E08L 1AR1C 4PWJA 1GYUA 5HHNA 1VFBB 2QQLL 3KWXA 1QFWM 4FG6D 3QORC 1JNJA 3NA9L 2YS4A 4F8OA 4NJAL 3N40F 4HC1A 3U1QA 4F7PB 2XOTA 3DX7B 4GXUM 2C9SA 4Z7VA 3T0AA 1U33A 1HZHH 4PWFA 2N0MA 5DS8B 1G43A 2PCPB 1LQSR 4GSDL 4XGZB 4YHIB 5FO8B 2F7QA 1X6NA 4F7TB 1F58H 3SJVD 1K2DB 4A63A 2DZEA 2VQ1A 3VG9B 4BRVA 4XPAH 3L5JA 3R06B 4Z23A 5FFLA 3CDFA 1A4BA 5HHPA 4X7CC 1N3NA 5D71H 4PS7A 3KPMB 5D2NB 1MI5B 2X5PA 5C92A 4WO0A 2XG4B 1QLFA 4ZOEA 5JDSB 2LLNA 4N2OA 4JFED 5AW2B 3QXVA 1URZA 2QMJA 3T0WA 3C2SA 2WKOA 3MGTB 4OZFG 4JG9A 1RPKA 1FFOB 3EJCA 3FT2B 4N8VA 3KWWA 3C5SB 3O45B 5F97E 2J7LA 1QNZH 1LYQA 3GEWB 3W5MA 3TBVB 1FFQA 1RUMH 2OW6A 3FONA 3ABLB 4KNUA 4LSRH 2EXYD 3IJ9A 3KLSA 1HE8A 3QJVB 3WEOA 4KAQH 3FN3A 3SQBA 1SOQA 5JHLA 2A0LC 2APBA 3IDYC 5DD6B 5JPNA 3US0A 2K4WA 1HHKB 1HOCB 2WBXA 3UADA 2DLFH 2E7MA 5HYSG 2MCG1 2DM3A 2WK2A 4QJ3B 5DC9B 3EYFA 5TF1L 2QSCH 4JFQA 2R0WL 4JPWL 4I3SL 4QJ5B 3BQVA 1OAZH 5DHMC 3HZVB 4O02L 4XOBA 1ZHKA 3O3UN 3PQYA 4JG5A 1MVUA 1S78C 2ZUUA 4J23A 4ERSL 2Q2LA 5DJ6B 4DETA 3W11C 4JAMA 3NZHH 4E41A 3PV7A 4BEIA 2XTJD 1S9WB 3NESA 2XN2A 4CN4A 4JGMA 3LS4L 5FW6A 1KDJA 2F19L 2AI0H 1IIKA 1R17A 4KBPA 3PNRB 4HXBH 4LLVB 5BRPA 1BMZA 2AJSH 3JWNH 1UQSA 2H26A 1OGAD 5IB4A 3GMNA 3KH3A 4LGSB 1XGZA 5F9JB 3VFTB 4IRSA 4HPHA 4PIRF 1UGKA 1DP0A 1BF8A 1MRCL 3SDXB 4JHWL 6FABH 1WFNA 3AU1A 4HXAL 3GO1L 2GJ6D 4KO6A 1YY8A 3VFOA 1H19A 4IBVA 2VMEA 3FOLB 3GNML 4K3DL 3KPRD 3JT0A 3LZLA 1NCHA 4PJXE 4HLEA 3PU7A 4WWNA 1B9ZA 2R29L 2E7DA 7CGTA 1E28A 3SO3B 3UPRB 4IGBB 4U2ZA 4KRPD 2B15A 4H8WC 1JNHB 1MREL 4L4TA 2Z93B 2CJUL 1HJCA 5I1JH 5KYXB 3MRHB 1A4KA 4NN5C 4PJIE 3T4AB 4Y9GA 2J1ZA 3G04A 2QFRA 3BUIA 3CIQA 3B83A 4MJ6A 4ZQKA 3FO9A 1VPOL 4NO2A 2BS8A 1ORQA 2X9XA 5TE6L 3PHQB 1OAXH 4UOQA 1FZMB 1MJJA 3QI9B 4OAWA 1UA6H 2B59B 3PJNA 4WO4A 1DVZA 4JHAH 2VISA 3ZIYA 2Z91B 2XKUA 3BIAX 5AL0A 3HAEA 3MV9A 1CDYA 4HV8A 4W4NA 3E1F1 2OKMA 5AENA 5C0AB 1FZKB 3AQDA 3SDXF 2RFXB 1EJOH 5IB5B 3RDTB 1Y1DA 2FX8L 1QACA 3UP6A 1Z7JA 2GI7A 2UX6A 5HHOE 1S5IL 4XC1L 4LARL 1PLGL 4XBMA 3DUSB 3GB7A 2XFXB 5K9JH 1IGJB 2FR4A 4GSQA 3L3OB 4D8OA 1UM6H 2R27A 4GG8A 4GRLD 2IFFL 1ZLUK 2EVFA 3I9PA 4RDBA 2MNWA 1COBA 5IIEA 4L8SB 1KCSH 2XQYG 4C59B 3FYEB 4QHNA 3Q2WA 3GMPA 3IBEA 3MRCB 1O0VA 3QO0B 4GBXD 4L3AA 4MMZA 2DQEH 1S7UA 3RTQA 3FAWA 3D3VE 4MA3B 4QTIH 4KMTH 4C47A 4GG6E 4AEEA 1HCFX 3OWEA 4RMSA 4HJGB 2FWOB 4U31A 2ZUTA 1B88A 2WWMC 4NQQA 3PGFH 2C9UA 2A74A 2WPGA 2D0HA 3RA7H 4WDIB 3QQ9C 4FXGB 3P3SA 2X6AA 3QYCA 1ZV9A 2E4FA 2YPKB 4XNXH 1JPGA 5CINL 3T65B 1M6OA 1DZBA 1BD2E 1XWVA 4OIIH 3HS8A 4RDQG 3MV7A 1YN7B 4U1KB 5GGRY 5C0GB 3MROB 4KHXL 4XBEH 1BM7A 2B20A 1FNHA 2QZ5A 5TE7H 4U1GC 1QBML 3GMLB 2F9BT 1YY9C 1RCYA 2A99A 3RB5A 4R0LA 2IGFL 3DHJA 1RIVH 4QNPF 1UVQA 3LH9A 1LEIA 5CXPA 1USQA 3VD1A 2DWSA 3QQXA 4UT6H 4TUKL 5C6PB 1XR9A 4HZLB 1E0OB 2DI9A 5ECGA 2HVKB 3X17A 3BE1H 4X6BA 4XB3A 1DDHA 1MCOH 4LASL 2Q86A 1NC2A 5FYJU 2DQFA 1R5WA 4ABVA 1MG2C 3RAJL 5IBTH 4O2CB 3WNIA 4QXUL 1ODUA 3QG6A 3GKWL 1OOAA 5GGSB 3IF1A 3AT9A 3HMWH 3IGAA 2DDQH 2LT9A 4QY8B 4XRCB 4ZMLA 3TBYA 1UASA 2EZ0D 2YR3A 2X28A 4NBYB 4JJHA 2X87A 1UOVA 2DMCA 3IJSA 3W0WE 4X50A 5CMAB 4FQQB 5ABAA 4NQCA 3KLHD 2HKAA 1XF3A 5IFJA 4YHMH 4IYKA 5EB9A 4PJEA 1JWUB 2VITB 5FB8B 2J1YA 1U2CA 2LVCA 1WC7A 5JOEA 3MREB 4RX4D 2AMGA 1H5BB 3QAZB 1AOHA 3ZUNC 4P05A 2BSBA 1NPUA 3NUKA 5KVFE 1I3RA 4PWIA 4DQAA 5BO0D 3K46A 1A7PH 4XNZB 3IMTA 3VX0A 3MBEC 3V6OE 1CL7L 1UCTA 1AZUA 2BIIA 2ATKB 2PABA 4GKSA 1XD0A 5AYTA 3QEHB 4H20H 5ISZA 2DQJL 2APTA 4TQ8A 1EXHA 3O2DA 1ZVSB 2FIKB 1SHSA 4WHYG 5D8JL 4MNGE 3WFDH 1OAUL 1RK0B 4PGDB 1R5IA 2GTZB 5C0CD 3BP6A 4H0IA 3LEXA 2ZXAA 1KIPB 3PGCB 4RFOL 4ZRGA 5EO1B 2NYZA 1RZFL 4P5KA 4MNQD 1LWJA 2YD0A 3US1A 3AROA 5FYJE 4ZAKD 2BNRD 3WDHA 4OF3A 3FTXA 2XY1A 5ELIA 5GSRA 2NLJB 4OF0A 2YPVH 3TEYA 1X5MA 3RQ3A 1HINL 2F7OA 1RU9H 2I25N 3AITA 1A7OL 4LLWA 1U8HA 1A9BB 3VXQA 2IQ9H 2Y5TB 2Q76A 2BXZA 5CZKA 1G7IA 3MVSA 12E8H 2XACC 3VM7A 3QUMB 3LEYL 4D0CB 4KXBA 2XQBH 4ACPA 2M8XA 3MLZL 1U36A 1FPTH 3B8SA 3VRLF 4F9PA 3PABB 2C3VA 3QCVH 2WLMA 4MJIA 4N90E 4PTUA 5I74B 1L7IH 1AKJD 3MJWA 5IEKB 4IDJL 1S7QA 1RVFL 5D1ZC 4L8BB 4Z95L 4ZW3A 1MFDL 4UTAA 4XODA 1WBZA 4ZG1A 3ARYA 4IW4C 4K7PY 4D8PA 3HZKA 5B3SB 4HPYH 3H3KA 4DNLA 3KS0J 1GGIH 1HU8A 3RWDA 3S0PA 5B38A 1A4JB 1RZGA 4OSUL 3SIKA 2EIZB 3HNVL 3NJVA 3H2QA 4QOKA 1OW0C 2AK4E 4OCNC 1E5AA 2Y23A 4OZIB 2C4FU 2X2YA 2AP2A 4K73A 1DVFA 4YXLH 4NKOB 2UZYB 3NFPA 2GYSA 2QV2A 4ZSOA 1DQJB 1Q1JL 4WV1B 3WI9A 2BSRA 1UKQA 2FE0A 3BPLB 3ZR6A 5CP3H 3QXAB 4KGLA 1SYSA 2BVEA 5I76A 5EZIL 1H8SA 1RUKL 2AZAA 1GOGA 3STZB 1V3LA 3A6OA 4S1SH 3DBXB 1WA2X 2XLLA 3GUTB 4GOSA 3FQXA 3T3MB 3EZJB 3H85A 2H6UA 3V0VA 3VE0A 5BW7A 1HQ4B 4OCRH 4Z3EA 4X0KA 2O5NA 2NXYC 1G0XA 1BAFL 2J21A 3CCHB 3MTXA 3LDBC 4WFHE 5I8KL 4Q9CA 2VDOB 1GYVA 1WA1X 1CT8B 2ATPA 2EDNA 2E7BA 3HZYA 2WLIA 1IVTA 4EZMA 3TFBA 4PRHE 2BMKB 3SEPA 3D18B 1PDKA 2R2EB 2YAPA 3LNDA 3O2WL 5D1QC 1F13A 1YMHB 2WZ0A 5LNEA 4Q0XL 5GQBA 3KLAA 4ZXBC 5DDHA 4XVUD 1H3GA 1PY0A 4D0BB 4N5ED 1CGVA 2WQ8A 4TVPH 5E1QA 1L5GB 3UIZA 5KW9L 2WWOA 5KSBE 5KTEH 3L9EA 1IQWL 3HMXL 5ILTH 3GZPA 2VT0A 4OZIF 4OH2A 1QLRA 1ZXQA 4FZ8L 4HYTB 4ZUVA 3QHZH 3UAEA 4JFUA 3BEWA 3AGVA 1JZGA 2F8VA 3T1FA 4MXVE 1PJ9A 1KEGH 1BXXA 2WIIB 2H32B 1S9KC 1U3NA 2IDUA 4Q6KA 1XGQA 2NSMA 4WU7B 4PJGE 3GSXB 3CHQA 4HUUA 1X5GA 1M1SA 3W3BA 4G7YL 4LKCA 2GHWB 3AXHA 1HJBC 3PL6C 1LJMA 3DVIA 1XB8A 3WS6C 1AJ7H 4LO9A 2NX5B 1O6VA 3HFML 4JMNA 1REIA 3BSZL 5FGBA 1CGYA 4BCXA 4GUQA 3ARGC 3OL2A 3AQXA 4WJG3 1XF5A 3MGOA 4L9LB 3RWJB 3DJZA 1VFBA 2E9GA 4NP4L 4TNWK 2XN0A 5FLVA 2DY2A 1YLBB 3L54A 1QSZA 4F7PA 3DX7A 5DJZA 4K5NA 2HAZA 5CSBA 2IPUG 3W38A 3QYMA 5DS8A 3G6JE 1JMXA 3LZOA 2PCPA 4XGZA 4YHIA 3P77B 5FO8A 2XYBA 3DXAD 5CJXA 4NNYB 1YEHL 1K2DA 4HF5H 5CWSB 4E5XG 3N85L 3V4PL 3AJ7A 3O9WC 3QH3A 2VM4A 9CGTA 4M9OA 1PX8A 3EHBD 4GB9A 2G2PA 2PXYC 3FUFA 3VXSB 3KPMA 4NS0A 1P5UB 3AQYA 1IEAA 3BLBA 5D2NA 1MI5A 4NB7A 3FO2B 4FULA 4Z7WB 5MI0C 1A9VA 5JDSA 3IPFA 4JZJB 3ML8A 2GUOB 5A2LH 2WB7A 4YZWA 3BIKB 2HX8A 3N9GH 3MGTA 2HLFC 4CRPA 5LGHL 3FT2A 4UQEA 4TLTA 5BRZB 3WFHA 4JY5L 4FOMA 4A7GF 4G9FB 1N9PA 3C5SA 3O45A 3OPZL 1INEH 3MLSH 3QUKB 3RP1A 4UTAL 1RP9A 2HH0L 5DZLA 3TBVA 4LDLB 4QXVA 2DTSA 3KYNB 2LV4A 4LFHD 2VC2B 3QUZB 3GIZH 3UABA 3EJTA 4JANA 3U1SH 4B9IA 1HHKA 2P8PB 1IE5A 5SWZA 1HOCA 3ARSA 4PJ5D 2OS7A 5KBDA 4TVPD 4MQSB 2IV8A 3AG3B 4EOWH 2WCGA 5DHYB 3HI5L 3MU3A 4G8GB 4AIZB 4M3HA 2IPKB 5JUEH 4U0RC 1CF8L 2ERJC 5KOVC 2ZXEB 5GRUH 3GXDA 2Q8BH 2ZOTA 1VFOA 3HZVA 1GGBL 2WN2A 3RKDC 3KS0H 4K0OA 3VFMB 3U2SB 4BE6A 5DJ6A 3LEVL 3LN5A 3WKPA 4Q4EA 1S9WA 5A7EA 4Z7WF 4P2RD 3ZDYE 4MZIA 2QADB 3LKNB 3RGVC 4GUCA 2LAAA 4ANKA 1VLXA 4PU2A 4LLVA 4WUKH 3SDAB 1TMCB 3T2PA 2MCPH 3VSVA 4H8HA 2A9AA 3ZE1E 3B2VH 4WJ5B 4KVCH 2E27H 4BRJA 5F9JA 1V5JA 3CSTA 3ILQC 1FDLL 3RKPA 5CGYC 3VFTA 4FLSA 1MJ7H 1F1DA 3SDXA 2IH9A 3WTSA 2P26A 1RD6A 4KRMB 1FNSL 4Y2OB 3KW7A 1JPTL 1WIUA 4JY4A 2OSWA 1NEZB 3DVNB 4I88A 1GHFL 4PB9H 1A65A 4B9PA 3L4YA 4H8PA 4HCRL 3DX8B 5DVLA 4BYHA 4XNMB 1WYJA 3GI8H 1QLEH 4IGBA 4YUEH 1E43A 1JNHA 3OKEA 3BAKA 2Y7OA 2Z93A 4X80H 3A4DA 2L3BA 2AQRA 3CN4A 4L37B 4PRID 3T4AA 2EO7A 1I9IH 4YPGA 5JIDA 4UOW0 4MB3A 5FYLD 3TNMA 4K7PH 5T8IA 3L4ZA 4O51B 3EZ8A 4RLDA 3BWUC 1L3NA 2PW2B 3PHQA 4X42A 5IVXB 2BFVH 5DUPH 4P5TC 2YEQA 3D85B 3QI9A 1RIHH 4KQ4H 1L7TH 2B59A 3U9UB 5H35B 4CVZB 3VMNA 2VW6A 2Z91A 3UDWA 4IRSC 4XAKD 4HD5A 3FZUD 5AVSB 1SVBA 4AMWA 3HKZA 3QXDB 3LNHA 3WN5B 3G9AB 5C0AA 3CV5A 3EYQC 2P5WB 1FZKA 3EGXB 2FD6L 3CZLA 5IB5A 4ZMOA 1E5UI 1FO0B 4KZEL 5E2WL 4YIQB 4GP8B 5B4MC 3DLQR 3DO4A 3MYZA 4ZOCA 3UYRL 2DEYX 4DAGH 4LNRB 2UVEA 3IPEA 4HEME 2XFXA 5TK4A 1IGJA 3L3OA 2OMXB 2XVGA 3G3LA 3K3QA 1PMYA 4L8SA 2YRBA 5AB9A 4LL1A 2ESVD 3MRCA 4WUUB 3QO0A 3CH8A 3VFUB 4Y2DB 4NENB 4NBXB 43CAB 4PVBA 5IVXF 1BXUA 1OLLA 4YE4L 1F02I 4BINA 1K8DA 4HJGA 3EGDB 2FWOA 5CUSH 5EEXA 1IEHA 4L2LA 3DPDA 4K71B 3WKMH 3T6QC 2J5LB 1KFAH 1KCWA 4N8CL 3OB0H 4FXGA 1F3RB 5JOFA 1BEYH 2YPKA 2HLAB 2Z9TA 3HB3C 1AG0A 3T65A 1HIMH 1NPNA 2O6PA 2XPGB 4BSVB 2YOAA 1YN7A 2XY2A 5CU9A 3HC3L 3CLEH 4BFBD 5C0GA 2BRRL 3MROA 5I6PA 3SY0B 3U2IA 3IU3B 5EUOB 4EN3C 5C0FB 3O6LH 4LCUB 3EYUH 4DGVL 3GMLA 3H8NA 3P9WB 4NFDA 1VGEL 4TSAL 3N1FC 4Y16D 5AKSA 3E3QE 5H4YA 4RWYL 4W9LC 4TOYL 1TVHB 3IS0X 4U7SA 4KX8A 4A2MA 3GSNH 5I1IH 3S97C 5MP6L 2OP4L 2IANE 2QPDB 3CUPB 3QIUC 4NHCL 2W88A 4HZLA 4JGNA 4M43H 4BWUA 4UILH 2HVKA 3ORJA 4YC2B 1RK7A 4MMZC 1H3TA 3RTQC 3TNNB 2ZXWB 3ZZSA 2COQA 3WGVB 2D0GA 3VXUE 3QCUH 4PRNB 2VXTL 4M8QB 4O2CA 5AB0A 3LCYA 1J9CT 4B50A 5D2LB 3QUYC 4IRJC 1KELH 5GGSA 3K2MC 3AUWB 2BDNH 2VN6A 4OZFH 2R69H 5BVPL 4LSVL 2DM7A 4JR9L 4QY8A 1ZANH 1I7ZB 4XRCA 2O1AA 4AJWA 3D0AA 3SODB 2K3HA 2VSDA 3FUIA 4MWFA 1F18A 2VDQL 5FPIA 1LO0L 3NSDA 3MRKB 1SPDA 5EUOF 5BO1L 5CMAA 1IGCL 2M1KA 4KJWD 2XWCA 1J0HA 1CLOL 2DAVA 4M6NL 5DMIH 3CMOH 4KKQA 3FUJA 3FQWB 1FVEB 3V0AC 1P7KB 2J3SA 3QZOA 4ODHL 2VITA 5FB8A 2FECL 4NCDA 1RUPL 4FTDA 1I9RH 1E30A 5PCYA 1H5BA 3ZT5A 3GTTA 3BDYH 3FTGB 3LXBA 3D69B 1L9PA 2A2QT 4HX1B 1H3WM 1SXCA 3LNEA 3V10A 5TE4L 1A5FH 4N9GB 2Y22A 2FBJH 4JPVL 5IROC 2ATKA 3TVMC 3B2XA 3KCWA 4N3UA 4WGKA 3QEHA 1WAAF 2CHDA 1N12A 2NT1A 3NFNB 3I6GB 3EBAA 1B6DA 1ZVSA 2FIKA 1MNUL 4J6RL 4PGDA 5D2LF 1JPSL 1JNLH 2GTZA 5AZEL 5D7LE 1KIPA 3PGCA 5EO1A 4AEHL 3BH9A 3ZQWA 1YEKL 1JTPA 1PZDA 4KVNL 3PDOB 1TTGA 1FFRA 2H6OA 2YBRB 3P4OB 2EDRA 1TVBA 2NLJA 4JDTL 4LOVA 5IV2B 3S3SA 2FJHA 2Y36H 2ZX5A 3IJ8A 2UVFA 3DETC 1CU4H 4WFEE 3T0XA 1XL6A 2H4EA 3BFWA 1A9BA 3HG1B 4F80A 1KMGA 1KC5H 1YAIA 2Y5TA 3BHBB 2A77H 3QUMA 1G0YR 4BM7A 4XWGL 5F0JB 4D0CA 1V7NL 5A2CA 4FHBD 2QSVA 4LHUG 1THAA 1VZGA 4QDGA 2MPAL 2NR6D 3BWAB 2O93L 4UM9D 5DUMH 2IALB 3PABA 4JE0A 4LQFL 4DTGH 5IEKA 3AY4C 4YDVB 4R96B 5AYUH 4YSRA 4W6WB 1KXVC 4L8BA 5MENA 2OTUB 1RURL 4NO0D 2QVKA 2PTVA 1RULH 1NSNH 2JB5H 3FRPB 2WQXA 2NY2D 2V17H 2EEBA 4YHPB 2YAMA 3W5NA 3E9UA 1R47A 2EIZA 3BUDA 2FSEB 3K2UL 4OLEA 1DSFL 4OCXL 4OZIA 4XPFH 3IDNB 4NKOA 2N56A 2UZYA 1JPFB 2Z65C 5KSAA 4JO4L 5I1DB 1DQJA 2E8ZA 2X40A 5L9DH 3BJLA 4WV1A 4R90H 1F6LL 3S3PA 2WUCL 1DVQA 3RFRA 1F4HA 4FLHA 3TV3H 3QXAA 2NDGA 4OLXL 1QSEE 3I9GL 3MYJB 4HDIB 3FHAA 5AOMA 3QDJD 5D7JB 3DBXA 3CXDL 4C56E 4DZBB 3GUTA 1RZ8B 1I85A 5DHVB 3QPQD 5EOCJ 4DUVA 4U1IB 3TZVD 4EVNB 1HQ4A 2VDKH 2HRGA 1OF0A 4FADA 3CCHA 3MCG1 2YQ2A 3POCA 4TUOB 2DPKA 1MEXH 3B7RL 1KJ3H 1CT8A 3MJ9A 3MOBH 3NK4A 2DKSA 4WK4B 2A7BA 3GXUB 4W9HC 5DYFA 2K6WA 2BMKA 3D18A 2R2EA 1NBQA 1YMHA 2VDNH 3HC0A 3CHOA 4E9VA 3WE6B 4PR5B 3MBXH 4OZGB 2O6EA 1MHPL 4D0BA 5A1AA 1A3LL 2Y1YA 5SX4I 1L5GA 1D7FA 3ZTNL 1YEDB 4XXDB 1XXDC 4S2SB 3DYOA 3BYYA 3S3JA 1JNNL 3SKNB 4X7TB 4XCYB 3S5ZA 3IRCA 4R4FL 3NJHA 3QG7H 2GI0A 3GHEH 1ROWA 2ZXGA 3KPSE 1YDPB 2WIIA 2H32A 2CDFB 1QEWA 1KLUA 3OV6A 1BGXH 4XMXA 4WU7A 2F1BA 2E75C 3EH1A 5IVZB 1NGPL 3GSXA 2CKBA 4OLWH 3HLAB 3TYFB 1ZT4B 5DO2D 2HVJB 2AAVA 4A7GA 3RGBA 2WM0A 2J2ZB 2CK0L 3VXRB 4I1NB 1MFBH 4F57L 1J1XH 4I4WB 5FUZL 1OL0A 4WHCA 2EIBA 3V6OC 4P99A 1ZLDA 2KLSA 4L9LA 3RWJA 3UX9B 1T66D 3AXLB 4B5EA 4EUPG 5BCAA 5E56A 4WKZB 4XXCC 4LCIH 2P52A 3CVDA 5T33L 5HHMB 1XIWA 3X1GA 1MFVA 1NL0L 3FL7A 3K4AA 3VU1A 4HK3N 4OZGF 3P77A 2NPLX 4BXVA 2A6IB 2VLMD 3QCTH 4KK5D 2WZ6A 2ICEC 3UAFA 5KS9B 2I69A 3DK0A 5CWSA 1JF5A 1NGZB 3H53A 3IS1X 3PWLB 3QFGA 1EERB 2CLRA 2P80D 3K6DA 4AM0B 4AWJC 2Y1ZA 4U6TA 3QQ4B 5SX4H 3VXSA 3WIIH 1P5UA 4EE2A 1EANA 1JGDB 1JZHA 2IXQB 2WNGA 3FO2A 3II2A 3LD8C 3QUML 4JZJA 3N0PB 4M93C 4Z7WA 4ZUTB 4ENZA 2GUOA 2Z31D 4D3CL 5F71A 2UY7A 3HAEG 1UWYA 4A55A 4GT7A 3BIKA 2IAMB 4OGAD 3SE8H 2DQIL 3ECWA 2B5IB 1IGIH 4YFEA 1SEQH 1BQ5A 5BRZA 4IOSA 3D30A 4G9FA 1SMOA 3QUXC 3QUKA 3T1WA 1N26A 3I50H 2ZJSH 1UWGL 4PUBL 3KYNA 3RJOA 5B3NA 3QUZA 5GJSL 1NIDA 4JZNB 4XPBH 4YHKL 2BSEA 2P8PA 1YEGL 4HWBL 1R0AH 4LP4A 4OJCA 4WHYH 3KPOB 4LSUL 1ZAGA 4OJFL 5DHYA 4G8GA 1GZHC 3VG9C 4AIZA 9PCYA 2IPKA 1MRFL 1Q38A 3EYSH 5KS9F 4PREB 2RTTA 3IJYB 4K23H 5DFWH 5GS1C 3RGHA 4AC2A 3QJHB 4DJMA 2XZQH 4NQEA 3DC0A 5CJ8A 2RGSA 4GSRA 1U3HC 4I0PD 2WXQA 3VFMA 4KWUA 4LCWE 3IAGC 5GGQL 3VFGL 1U42A 4AL8L 5DT1H 5F70A 3WTWA 3AY2A 2AJUH 5JW4R 3LKNA 4G7RB 1J1OH 4HCFA 3MKKA 4G43B 2JWYA 2G3NA 5LG1A 2FJUB 3WJLC 3ETBF 5M7QA 4XCCH 5DR5H 3SE9H 3BW9B 5IHWA 3HG2A 4ODTH 5F3HB 4BK5C 1OV8A 4WJ5A 5HHOB 1OGTA 1QFWL 3FU7B 3L3IB 4P2AA 2QQQA 4OLVH 4PJXF 1L9MA 2ENSA 1FRGL 2OI9B 3L5IA 1WLHA 4HULB 4Y2OA 3VFVB 3KHQA 3SJVB 2F58L 1NEZA 1IV8A 1VIWA 3DVNA 1S7RB 1TQBC 3KBFA 4JFXB 4HVBA 2GBUA 1E3XA 2XQYK 3DX8A 3MRMB 3OXRB 5EOCH 4PJIF 5F2FA 3GK8L 4PRAB 4XNMA 4LB8A 5KBLA 5IT2H 3CVHH 1U8QB 5CZXD 4KFZC 3IVKB 2F7RA 1OF2B 1OT1A 1ZA3B 3KCPA 4L37A 3MNMA 3TF7C 2V9TA 3KPQB 3V5HB 1UXMA 5DJ2B 3KWTA 4O51A 5A2BA 1BWMA 5J57B 2ORBH 5F44A 1NANI 2HTKD 4L3ED 4XP4H 4LF3B 4XO5A 4LAQL 2IWEA 3DHPA 3Q1SH 5IVXA 1S9VB 2VLRD 4DO4A 1JIBA 1IC0A 2CWRA 3ABMB 5D7IE 3U9UA 2MOVA 2Y2YA 4RMUA 3MRQB 1AR2A 2WIMA 5H35A 4CVZA 2I9LB 2NZIA 3FHQA 1OAKH 4XP1L 3FTWA 2DJMA 1TPXC 2A6KB 1VZHA 1SRDA 5GRVK 3AG4B 3QXDA 1FE8L 5C0NC 2QQNH 3WN5A 2D2OA 1FN4B 4P0DA 4U1HB 4PSRA 3PS6A 3EGXA 1UWEL 4MQXD 4K3EL 1FO0A 2UWEE 4UQIM 1ITCA 1FQ9C 4YIQA 1WTGT 5EIIG 5B7EA 1JI2A 1CI5A 1UM4L 2RBLA 5J7CC 2K8QA 1ZWIA 2C4FT 4LNRA 3BKYH 5KG9B 3SO3C 1IBGH 2CR6A 4NEHB 4IGBC 1J8HD 4F8QA 1BLIA 3RPBA 5E1AB 1K6QL 2PR9A 2VXQA 1AGBA 2DWEB 2WC7A 2ROYA 3ZKSD 5JHDB 4PJ6A 2OMXA 2A4ZA 4WTQA 3ZHNA 1U8LB 2UZPA 2WXNA 1CE6B 2XTJB 4TUJB 5H2BB 4DGIH 1LP9B 1PZ5B 3DURB 2HUEA 3ARQA 5CGTA 4G6KL 4WUUA 5ABZA 3V0JA 3V7AE 3FT3B 3VI4E 1A64A 4JCWA 4Y2DA 3VFUA 1ZLVK 1NKOA 1OGAB 4Z76A 2OMWA 43CAA 3HW7A 2WVUA 4QJ4B 1TXKA 2FJGB 2YQGA 3EGDA 3G08B 3INUL 2GJ6B 4KK8D 1J48A 3W0WB 4DKFH 2JF1A 2AJXH 3CTTA 3D51A 3KPRB 5EF0A 4BSVA 2WNWA 2JV6A 2XPGA 4XPTH 1PLBA 1FVDA 4Y9FA 4UT9H 3MRNA 1T1XA 3RDTC 2IG2L 1R24B 2RALA 2VC2L 4M7ZC 2RJMA 3SY0A 1DVYA 3IU3A 5EUOA 5C0FA 5EF1A 4D0DA 1MPAL 2WNKA 4ETQB 2ZG2A 2IFGA 2AS5M 1YAZA 3L3OC 5GRYA 1TJGL 1TVHA 3MODL 4HUXB 4RRPA 4ZTPL 3A4AA 5A3IC 3OLGA 3SGEI 2RIKA 5J3HD 1B3IA 5IK3B 3V6FB 4HOXA 3CUPA 4L8SC 3W57A 4Z9KB 4WTWA 3QP3A 2ZOKB 4NGHH 2ZZUT 1LP9F 3TNNA 4MNGB 2WINB 2Y06H 5I6KA 3DI3B 4MBRA 3M46A 2VKWA 1NBYB 5LWYH 4XR8C 1WAAA 1MFEH 4PVLA 3DO3A 4OFYA 5T3XL 5K59E 4M8QA 1G84A 2AEPL 1UACL 5C2BL 3V4UH 5I17A 5E6ID 3GBNL 5FUCE 4OW6A 5D2LA 4FXGC 1EVUA 3MLWL 1EEUA 4F93B 1OB1B 1S7WB 4FI7A 4XN8A 1N6QH 1I7ZA 3JTSA 3RI5F 4FQCH 2HT4D 2CGYA 3WEBA 3WKQA 3OSVA 4WWOA 1EJFA 1MIEL 4RWHA 2Z8VC 3ULVF 1BZ9B 2AABL 3L3HB 4JGJA 3VA6A 1QABA 1X5XA 2I26N 5I0XA 2OTPA 3MRKA 3S96B 2DYPD 4GRLB 1XSOA 3P0YL 1N8ZB 1IRAY 2Z4QB 4U49A 2DQGL 4M7LT 1QRKA 4FJZA 3VXMD 1I3GL 3FQWA 2YAOA 1FVEA 4PYHA 1P7KA 5C0RL 4IDLA 2CM5A 4GBXB 4GEJA 4IU2B 1ZVYA 3CK0L 4P8QA 2KLRA 2O30A 5AWNL 4MMXC 3C60C 3SY6A 1NA8A 5E9DE 1HI6B 4W4OA 1P4BH 1ZE3C 3ZTDC 3ME0B 3V5KB 5F7DA 4ZMPA 1C8PA 4DQOH 5JPMC 2UXVA 2X4UB 4Q52A 2YD4A 1GOHA 3D69A 4HX1A 1KPRB 4TRPL 4ZMWA 4N9GA 4X7FC 2Y7NA 5F9AC 2NCEA 1JTOA 3GPSA 3HS9A 1D2OA 4MLSA 1PG7W 4OIFA 2WVVB 4ZNEA 3NFNA 3I6GA 4LOUC 3KXFD 1VACB 2J6EA 5F0PB 2DB8A 1NDTA 5I73C 1SN0A 5HYJD 2YZ1A 1H3PL 3PDOA 2Y4SA 5EPMA 2ADYA 1CTOA 2YBRA 5A2KH 1AO7E 4L1BA 5IV2A 1EUUA 2AV7B 5KYWA 1XZ0B 3TA3B 4KKCC 1KEML 1W6WA 2UUDK 4OM0H 4J6IA 5E2JA 3HG1A 1TNMA 3ZQXA 3PXJA 5DWUL 4AG4H 1U8PB 5D1ZI 3FB5B 4JCMA 5AW5B 4LP8A 4NZTH 4TTDD 3X3FH 4M4RB 1R3IH 5J6HB 2Y1AA 4KTDL 3T4YB 1O7SA 1PNDA 3QAZC 3D39D 4WEBH 5BOJA 3WY2A 3VTAA 3BWAA 3QDME 3QDGE 4YNYA 2TAAA 4FFYA 4Y19B 1UCBL 2HJKB 4JN1L 3O4LD 2P24B 2PUQT 4JKPH 2E7HA 4YDVA 3OKMB 4R96A 5FV1L 2X6VA 1D9KD 2CUHA 1KYAA 3WXWH 4ES8A 3ZDZE 4AGPA 1VADB 4L2YA 1ASQA 1NC4A 1XGYH 2MQCA 5C9JB 5KSBB 5CFAA 3FRPA 2DMHA 3H3PL 1R1CA 4BSWB 3MRDB 5J13B 4PBDA 4YHPA 1D5IH 4F20A 2EADA 2PYEE 1PCXA 3B9EA 3WJJA 1E2WA 2EUWA 2FSEA 4JB9H 2P49B 3FFCD 1D5XB 3CFTA 2VDML 3O8XA 4I9XA 4L4JA 3IDNA 4H0LC 4NFCA 4BELD 1JPFA 5A7BA 8PAZA 1J87A 1LO4H 5HI3C 5I1DA 4MX7B 4BFJA 4BQCA 1SDYA 2GJJA 2GJRA 2OA9A 3RIAF 2WUBL 1YVLA 1H6TA 2VUYA 3HR5A 3VCLB 2E9BA 3MYJA 4FA8A 3PIQB 3WD5L 1NAKL 5D7JA 3VB8A 4EKXA 3G5XB 3ILEA 5JHBA 5KVGH 4U33A 2HLEB 4DZBA 1A66A 3GJEB 5DHVA 3BZFB 4IBUA 3TIDB 3L5XL 1K4CB 4FQ2L 3U1PA 1KYUA 2HWZL 3SKOB 4EVNA 3GXIA 3HG5A 2R8SL 1V55B 1K9TA 2P8LB 5I74C 3FFDB 2IPUK 3DX4A 3EFDL 1WHPA 1THCA 4ZODA 4IIQC 2VDRH 5F0MB 3ZKMC 3TCTA 1I9EA 1PU0A 1MCPL 5C0CB 1XR8B 1NEUA 3H42L 1OTTD 1P2CA 3TP4A 4FFWD 4JLRB 2FBOJ 1GYAA 3C2AH 5KSBF 4JFDD 1EHAA 3WE6A 4ZAKB 5AB2A 4PR5A 2JB6B 1WWAX 4OZGA 2Z1KA 1X5AA 4NJ9H 5ICUA 3KPPB 1N2RB 3GYRA 5KVEH 1HYSC 2O6DA 5D1XD 1YEDA 4XXDA 4S2SA 4XN1A 4ZX3A 4MXVF 5IZ7A 3SKNA 3OF6A 3HUJE 1JN6B 2OL3B 1CIDA 4X7TA 4AYBA 3LHPL 4XCYA 2QT6A 3SDCA 1MN4A 3BPLC 3MV8B 2FAUA 5DJDB 1SDDB 4IRZA 4ALAH 1YDPA 4PBXA 5I5JA 2V4LA 3NJIA 4EBQL 2H1XA 2CDFA 3KPLB 4MCZB 4AL8C 4W6YB 2HMIC 4R97B 3U2JA 2D03L 2ZKHH 3EFOB 1WFUA 1XFPA 3FQ2A 3TYFA 1BZ8A 3JVGC 4XB8A 2HVJA 4KRNA 3PP3H 1OKEA 4YSTA 2G30A 4KITB 2J2ZA 4LIQE 2GIXA 2RD0A 5TFSH 3VXRA 5KYYB 4HOMA 4I4WA 3RIFF 2IBGA 3ARWA 2NUTB 4GH7B 1CIUA 2XRAH 1M7IB 3AXLA 3L95B 4DGWC 2J6EL 4WKZA 2X42A 4P4RB 2VH5H 4D2NA 1F4XL 2FGWH 2AJVL 4F27A 1IARB 1OPGL 1YPZB 2XA8L 4KNTA 2ITDB 3M1BB 2FLRT 2A6IA 4F24A 5JYLA 3WGUB 5KS9A 3NGBB 1PG7L 3OR6B 3UAJC 3F7PC 4R2GB 3LKOB 3PWLA 2ADIB 2ZCLH 4FMKA 1PEWA 2VJXA 1T1YB 3G7TA 2WOBA 4I1RA 4JFEE 4NOFA 4RGNB 4AM0A 4CKQA 1U8OB 1J86A 3DX3A 5DLMH 5CLYA 1B4JL 1M2VA 1JWMB 2MHAB 4J3OC 5F9OL 3QQ4A 2CRIA 4K9EL 1UB5B 4L3CB 1JGDA 2IXQA 4LSSH 1GIGH 4X2UA 4XMVA 4ZUTA 5BJTB 5AL8A 1W91A 3FBKA 1Q0YL 4YLQT 5IVNA 1TOXA 3ZN6A 2IAMA 1RSYA 3C6LB 2WXMA 1MLBB 1OM3L 2H45A 1OAYH 2B3IA 2PLTA 5MEPB 3CFBB 4YWGH 4QPEA 1JZ4A 3QPXH 1KG0B 4GJTB 4RH4A 3GSOB 2P9RA 4WHTB 3A6CL 3M1OA 4JZNA 3U0TB 1AGDB 5HPOA 3CBRA 3Q5OA 4PJIA 3L1OL 4MNHB 3O3EB 2XWEA 3OVUB 3APFA 3SCMC 2DLHA 1JZEA 3WMPA 2H0JA 3UJIL 4LBEB 3FU6A 4U1NB 3KPOA 4FYQA 1ECYA 1YPZF 1NBCA 1GGCL 4KUZL 5T1DL 2V0AA 3BGFB 3T2QA 4WSKA 4BZ1A 4EIGB 4N9OB 2R0KL 3IJYA 4PREA 5IFAH 4YS4A 3Q43A 4XO3A 3FH7A 3GSRA 1P5UC 4RBPH 4ATWA 1QYGH 1JZ2A 4JZJC 4M5YH 4G7QB 5KVDL 4YJZL 3DUHA 3KBPA 1CYXA 1DJWA 2EQDA 3LMJH 1WZ1H 3A47A 3ZE1F 2WBKA 4Y4KB 3CFCH 4TMPA 3EOYG 4AYID 4G43A 3WELA 2IBZX 2N1KA 5EH1A 4N2FA 4AEIH 1G6VK 3NAAL 4PLJC 3D0LB 5F3HA 3EOTL 1Y7VA 5HHOA 2YRLA 3QZWB 1TCMA 1TUPA 3FU7A 4QWWD 3L3IA 2G2NA 4KI5D 3SSGA 2L7QA 4MVBD 1TYEB 1AQDB 4HC1H 4U1MB 1KY6A 4FFZL 1HZLA 3DXAB 2GEQA 2X6UA 2R0ZH 1CDUA 1C5CH 1S7RA 3RG1C 1KZYA 4JFXA 3MRMA 3OXRA 3WIHA 2OK0H 5D93B 3L7EB 4PRAA 1Z1WA 5F72S 2ZWKA 3WKNA 4I0KA 3IVKA 4PBVC 2UX7A 1ZA3A 2VR5A 4JPKL 1YUKB 1IQDB 1IBDA 1QKZL 2AQ1A 2LFEA 3QRGL 3KPQA 3V5HA 1EXGA 2WLNA 2CXKA 5CNHA 5DJ2A 1L0PA 2WTPA 4GINA 4TQEL 3UTSD 4X9FA 5FR3A 1BIIB 1NCNA 1QO3B 2R1YB 4KXZI 4LF3A 3BH8B 1S9VA 2DEWX 4CMMA 3H7LA 2J44A 2G60L 3SDAC 1CMOA 4R4NC 3NCMA 1W6LA 5BOPA 2I9LA 5DFVC 2YWYA 3OLDA 4WI7A 4AE1A 5C0IB 1MG3C 4ODVH 3M8OL 1FN4A 4U1HA 4H13C 4PJ5B 1E50A 2QDVA 5JHLH 3K1DA 2PKDA 3MA9L 2NW3B 1NLBL 1JK9B 4HIHB 4HIIA 1X5JA 4DSYA 3JWOL 2DOCA 2OULB 5KG9A 3BZ4B 3NCJL 4EI6A 2LU4A 5I8EB 1OP9A 2DWEA 3RL1B 5JHDA 1KIRB 2BSSB 1CL7I 3ILPB 3G6DL 4Y5XC 1U8LA 2Y25A 3VDCA 4BKSC 1CE6A 4TUJA 5H2BA 1LP9A 1PZ5A 1UJTA 2F5BL 3DURA 3BJ91 4F2FA 4EI5B 2H9GB 2OSLB 4JRWA 4FQ1H 5IVOA 3JWNE 5GGRB 2YLKA 3FT3A 3MOQA 4DESA 1FH2A 4LASH 1OGAA 3M1CA 3NSJA 4H7VA 2Y2WA 2AXJA 3PCYA 5ALCH 2BVPB 3IGUA 2E46A 2YEZB 4QXUH 3G08A 1CFTB 4WTXA 2GJ6A 2DQMA 3PHAA 3P40A 3W0WA 2EIEA 5A2JH 3S37L 4DN4L 3ZW3A 3KPRA 5JR1L 4LDEB 2OJZL 2ITFA 3JT2A 4KH9A 4Z7NE 1YUHB 1R33A 2PR4L 1ZT1B 4TLKA 2F8IA 3D1MC 5D70L 4ABUA 1KJMB 2X4SB 2EYSB 3B43A 2K8MA 2V7NB 2WN3A 5M94B 4MA8H 5EOTB 2HRPL 1P4UA 2GBTA 1JTTA 3AC0A 1XGTA 4ETQA 1NBZA 4NLAA 1YEWA 1MHEB 1OCWH 4UCFA 2AEIT 2JK5B 3N5AA 3SE3C 4HUXA 4QRRD 4H44C 3OAZH 1EV2E 3CFEB 5K39B 3WYRA 1J0KA 1PX4A 3RPKA 1J5OH 5IK3A 1RLBA 4XZUA 1Q0XL 4MRCA 4WI6A 1A3ZA 5D96B 5ANMB 1ZEAL 2ZOKA 3BKJH 4MKTA 4NQVB 4XXWC 4AI7A 1TTBA 4S1RL 2DQTL 1GC1L 4MNGA 4O4YL 2WINA 2NY4D 2ZUWA 1KCRH 4LSQH 5D7LB 1LO3L 3RNQB 5GHWH 1EMTH 3P11L 2GABA 1NBYA 3FN9A 4GI9A 1W9XA 1N64H 2JCCB 2WO4A 2A3TA 4K71C 5E8DH 2J5LC 1RY7B 1AS6A 4P23D 2OBGA 1E7VA 1ZMYA 1OB1A 1S7WA 1FH5L 3LYRA 2DMKA 2XG5B 1S4IA 2PPCA 4R7XA 4XVTL 1OK0A 3MCLH 1ZHLA 1MELA 1Z9LA 4Y7OC 4OD2B 2EVGA 4QT5B 2NSXA 2DM4A 3D4GA 4Z0BH 2BWIA 4X9IA 1BZ9A 2WBWB 3L3HA 1JHKH 2CA3A 2CMRH 1EDQA 3CN1A 3S96A 3L08A 3WNNA 5AOKA 3WIHL 2DBLL 4GRLA 1JZIA 1N8ZA 2L8AA 2Z4QA 4KHTH 3ZQ9A 3U46B 1A8JH 2EDQA 5LBVA 2ESVB 2BCKB 4HWUA 4GBXA 4IU2A 4OGXL 2PYFB 3NH7L 3CDCA 5AZ2H 5A40E 3QARA 2G2RB 3HBZA 1HI6A 2D8KA 1A47A 4PJCB 3ME0A 3V5KA 3MJ8B 2ZX7A 4KMQA 4E41D 2LHAA 3IFOB 2X4UA 4UV4L 1AD9B 2C4XA 1AZZC 1UUSA 3S36L 4AE0A 3P9LB 3EJYC 4YX2H 1O7DE 1G1YA 1K3IA 2K9UA 4YHZL 1OB0A 4I18C 2Y5QA 5TDPB 4TNVK 2WVVA 2BNRE 1DHKA 4WVRA 2JCCF 3QJSB 5JW3H 1VACA 5EEZA 3M6DA 4J39A 5I8CA 1OARH 4ES9A 4KKNA 7FABH 1XMEB 4BSJA 5JXAL 3J27A 3LH2H 4XP5H 3EO9H 4KJPC 2FQFA 4CA4A 1QLEB 2EACA 4OZ4A 4A37A 4J3OG 2L0DA 1N5AB 4FP8L 4ZFFB 1ZK9A 3NK3A 3OXSA 3K2KA 2XCMC 4MAUH 5M95B 4HLZG 2AV7A 5TJWK 3TA3A 3HI6L 4OUOA 5EN2B 4O5LH 4BDVB 4PP1D 2VLJB 4J3UA 5CJOH 3AREC 1UKTA 4L4TD 5DQJA 2F18A 2Q6WB 1NKGA 1CR9H 1XVSA 1AFVH 1UHVA 3FB5A 1JGIA 1FAIL 5GGVL 5J6HA 2R59A 3T4YA 4PRHA 3ZKXB 1BBDH 1KGJA 2NYYC 4LEXH 2VMCA 4OD3H 3MLRL 3VDAA 1HILB 4Y19A 2HJKA 3L9BA 1E4WH 1O5PA 4PV1C 1RZJH 1OP3H 4Y0GA 2P24A 5E0FA 4Z8FH 3OKMA 4WO4D 2QKIC 1VADA 2WQRA 5KSBA 5C9JA 3MA7B 4MSWB 1N70A 1HC1A 1VCBC 2QSTA 3K71A 1TQCB 1OALA 3MRDA 4BSWA 4LMQE 4NZJA 5L8KB 3TX4A 3WTTA 3QIBC 4FFVD 3NJFA 1HZHL 1D5XA 2AEOA 3E80A 1CFQB 1DEDA 5HGHA 5CD5D 3ULUH 1F58L 1WWCA 2EVJA 4NQXA 4WNSA 2B14A 1VDGA 4MX7A 1WA0X 1SOXA 1G5GA 1T2JA 4G8FB 4XPAL 3RVXC 3TV8A 3TLRA 1ZLWH 3LVEA 5KJ4A 3VCLA 4AGMA 1ZHNB 2AJYH 3C09C 5D71L 1FJ1A 1VGKB 3BP7B 2QLYA 3FJTA 4J4PA 4K9EC 4JFFE 1MJ8H 5E7BA 3S8WA 4OFQA 1ETA1 3EXJA 2YD3A 2PO6B 3GLZA 3ZBMA 5KBKA 1RHHB 2VW4A 1MCCA 2WXOA 1S3RA 1DEEB 1PY9A 2FH6A 3GJEA 2G5RA 5FM4A 5HGBA 1KN2H 3TIDA 1YYMH 3SKOA 2FEDD 1PD1A 2GTQA 4YHNB 1NZRA 1XCQA 3C5ZB 2P8LA 2YN3A 4J8RA 4G83A 3RHWF 3OAZK 1JDCA 1QNZL 1BX2B 5C0CA 2EECA 1XR8A 1KXHA 4K3JH 4F9LA 1RUML 3O2DH 4LSRL 4WW2B 4JLRA 4XO4A 3S5LB 5FUCC 1G7HB 4KAQL 2IH3B 1W0VB 4ZAKA 2JB6A 4X4XB 1ET5A 3D7PA 3QHFH 1JMZA 4UMGA 3QZBA 3WV0A 1U3ZA 1CTMA 2GG1A 3KPPA 1N2RA 3MV7D 3TN0D 2DLFL 2RCSH 3TEZA 3Q6FB 4QHUB 1Q72H 2FWUA 1HAUA 2E9JA 1ZTXE 1CXIA 1JN6A 2OL3A 1IBHA 2QSCL 3MV8A 2W9LA 2YC1B 1YN6B 2XSKA 5BNXD 5DJDA 4POZD 1OAZL 1SDDA 1RAMA 2P7TB 5D7JC 3NABH 4PV8B 3KPLA 4MCZA 2AXFA 5IJVB 3NZHL 4GKZB 5F96H 5EIVA 1LVEA 2AI0L 3MLXH 2AQ2A 4HXBL 1N68A 3EIFA 2XU9A 2AJSL 1E4KA 1TCRB 4PGBB 1NC2D 2AANA 2H3KA 5KYYA 1GRWA 1Z5HA 2ZWLT 5DEZA 1NEZG 2IDCA 3HHRB 2NUTA 1MCJA 6FABL 1U30A 1M7IA 3L95A 3OR7B 1EAQA 3QRFM 4P4RA 4WW2F 5F3BB 1FVCB 5D9SB 2YAFA 3CBJB 5C08B 1YPZA 2VM9A 3QFJD 4ONOA 2DJ4A 2ITDA 3M1BA 5TGBB 3X13B 1OWRM 3TJHD 4L0YA 3ULUD 3PJLA 3HN5A 3P69A 4R83A 3SDDB 4GKNB 1F1AA 4S1QH 3AM8A 2MWCA 1OTSC 1IAII 1IC4H 3LKOA 2ADIA 2OMUB 1CJYA 1IGMH 1T1YA 4FGMA 1F90H 5I1JL 4NQCD 5IOKA 3W2DH 1IB5A 4OCLC 1X9QA 4QF1B 2W0PA 5EO9B 2MHAA 1JWMA 5D4JA 2EIDA 3TZVB 4NQSB 3ASOB 1UB5A 4L3CA 3D08A 4XCEB 5FXCH 4JKLA 3ZTJH 2H1PH 1OAXL 1U8CB 4FTVE 1WBXB 2QL1A 3OAYH 4OZHE 4AOFA 3VXPB 3UBXA 1UA6L 4JQVA 1LGVA 3C6LA 4JHAL 1EH9A 1MLBA 3DO7A 4HALA 1ZJAA 2PP8A 5MEPA 1NBVH 1UT1A 3D34A 3OMZA 1KG0A 4TQIA 3EYVB 4E36A 5ISZD 1DBBH 3PXLA 2OJ1A 4TVPE 2OYPA 3GSOA 1FYTE 4WHTA 5D6DC 1R3LB 1EJOL 1ICTA 2WCSA 3U0TA 1CBJA 1AGDA 3HG4A 2GIMA 4MNHA 2BHZA 1IGTB 2V2XA 2WLJA 3O3EA 2YPVA 3O6FB 4LBEA 4U1NA 4N0CC 3UBFA 4LL4A 5K9JL 1T04B 3L13A 5EU5B 5E6RB 3N1MC 5I19H 4LCVA 1UM6L 2K70A 2X1OA 3UJTH 4LHJB 3T6ZA 4P2RE 4UNTA 3CU7A 1O7VA 4MCMA 2E47A 1RFDH 1KCSL 2FT6A 2FO4B 3GXTA 5ID0B 1T2XA 3FO1B 2JQAA 3K72B 2DQEL 4IKNA 4MD0B 2H2SD 1UGNA 1IAIH 3OPUA 4QTIL 5KYUA 3T0EB 4KMTL 1PEZA 5KOMC 3T0VA 5I1GH 3ARRA 3NJNA 4Y4KA 1T22A 3SD2A 2BW4A 4WRLA 5B3JE 4MJID 5BV7H 3LZFH 1R34A 4ANVA 4YSUA 4FZEH 3PGFL 4AVIA 1T89A 3C87A 3P0GB 3RA7L 3REVB 3UZQB 1AZBA 5AW4B 1BXAA 3DOIA 1KYOK 5AW0B 2RHEA 2O6FA 4P2QD 1AQDA 4U1MA 4OIIL 1GCFA 1YEEH 1KV3A 4PS3A 4X8XA 4LPVA 4NWUH 3DXAA 5IP4A 4WI8A 4XBEL 3GUFA 4QOKD 3H3BC 3CDGB 5TE7L 2GIYA 3LN9A 3S98A 4PRIE 1DVFD 4R9HA 3MRBB 1XSKA 3LKSB 5FYLE 5CP3A 1RIVL 5D5MB 5GGSY 1U6AH 5T5NF 2D7OA 4JREB 1IQDA 4PRPB 2IBZY 3NEXA 4UT6L 2P43B 4LPXA 3G5WA 3B3IB 5FO9B 1GC1C 5GZOD 3BE1L 1BIIA 1QO3A 3BH8A 3F7KA 4WSGA 5JIMA 1IE4A 1MCOL 4FEIA 4H5SA 3L1FA 4L1LA 5K33A 4V1DE 3T8VA 4ENED 4JM2F 1JP5A 5IBTL 4FG6C 5AOJA 4AVKA 4NKIH 5C0IA 3HMWL 4OVUA 2DDQL 2GAZB 1R19A 1NPJA 2OI9C 3O4OC 3F8UB 5FGCB 3C8DA 3HC3H 4X98B 4EZLA 4KKAD 1JK9A 4HIHA 2Z8WC 1WCBB 4HIPA 2BK8A 2IANA 2Y07H 1WAEA 4ETYA 3BZ4A 2WMPB 3CQQA 3RWCB 3VM5A 5I8EA 3VD4A 3ZVVA 1BJMA 1M71B 3RL1A 1KIRA 1SMAA 1SY6A 2BSSA 3GFUA 4NRYB 4BFKA 5D5MF 2G4EA 2FCBA 3R7QA 3ILPA 3KNBB 4YHML 3VI4F 5EBGA 1O6SB 4P2OD 4M56A 1PKOA 2NNXA 4PMEA 4EI5A 2OSLA 1E4XI 5GGRA 2OJEB 3RL2B 1A7PL 3WN6A 2HT3D 4V2CB 5KSUB 1JYXA 2BVPA 2YMTA 3P30H 3J8F7 1XH1A 1B9KA 2EXYC 3WTUA 1CFTA 4H20L 4M29A 3N3EA 4A04A 4HPOH 3WFDL 2COVD 2I60H 3CC5B 1JVOA 4GT0A 2OR9H 1BPVA 3UG5A 5KSVA 1FIGH 4RZKA 1YUHA 1ZT1A 3DARA 2BC4B 5I1HH 1AE6H 4FKEA 4LAJH 2ZT9C 4U4BA 3K5SA 1KJMA 2X4SA 1ZPUA 2OMTB 2YPVL 3L7FB 4JBSA 5DEFB 2V7NA 5LBGA 1SN5A 5EOTA 1RU9L 4I13B 4AKOA 4ZI8A 2ADJB 2YD1A 4U2YA 3D6GA 4JHZA 2IQ9L 3CFEA 3NT0A 5K39A 3I6KB 12E8L 2Q20A 3F3HA 1V54B 2XTJC 2JJSC 4L3EB 5E4AA 4LZKA 2XQBL 2VLRB 4J3TA 5IGXH 3F6LA 5J0BA 4E9QA 1FPTL 4NQVA 5K59F 1G4RA 2BINA 3UTPD 4OBSA 3QCVL 2AQTA 3SPHA 2UXTA 2JKJA 5CP7B 1KTDB 1L7IL 5D7LA 3SBWC 1IAMA 2OMZB 1YNKH 4BFIB 1ULVA 5INDB 3EBGA 4AXWB 2F2HA 1SQMA 2JCCA 3QJFB 4ZW5A 4X6CB 2YAHA 4HPYL 1E4XH 1AO7B 2WO2B 1GGIL 4PFEA 1QSFB 1GH7A 2EDOA 4NQDE 5CN1A 4U3CA 5E1IA 5C8JB 2WY3B 1CGTA 1T5KA 3IDGB 2JSFA 2YEVB 5DD3H 5IHHA 1SHXA 5JIQA 2FUQA 4Z3FA 3FUHA 4F5CE 2HKHH 1CLCA 4QT5A 4YXLL 4KRPC 1J8HB 1JK8B 5SWZD 1KXQE 3BWSA 5C7ZA 4LPTA 1A6ZB 4Z1PA 5FHAH 2PWDA 3F7QA 2IBBA 1USZA 3C08H 3HKFA 2Z4TA 3U46A 4F58H 2BCKA 3GPEA 2Z3FA 4K8RH 4DEPC 4S1SL 4HW6A 2PYFA 1HESA 1XT5A 1YC7A 1ZIBA 2G2RA 4MLIA 5C09E 5TTRA 5D7KD 1WPCA 4PJCA 3BAEH 4OCRL 4JRXD 3MJ8A 4K3HA 3QNXA 3IFOA 1MDTA 4OV6F 1MCSA 3RWFB 1AD9A 1OQXA 1SZNA 2YHGA 3SD5A 2PYEB 4IBYA 1PSKH 3V0FA 1TYRA 3VMPA 2W9EH 3BDXA 3CN3A 3VWJD 1KPVB 1E9PB 5EF2A 5DURB 5TDPA 1FLRH 3GDBA 3KLQA 5C6TH 1O75A 3Q8EA 4BQ6A 3ARBB 3QGVA 1RERA 5IMKB 4Q14A 4TS6A 5J56B 4Z7QE 1J05A 1NFAA 2H3XC 3DIVA 4D9LL 1H9DA 1GA2A 4IBZA 4TVPL 5C07E 4PD4J 3RX7A 4N0FB 3MCKB 5ILTL 2QSQA 4LCCC 5KTEL 3UH8A 1T83C 3CVHB 1NGYB 1M6UA 5LLIC 1A25A 1N5AA 4ZFFA 4GRLC 3QHZL 4RSVA 5EG6C 1EA9C 3F2LA 5EN2A 4BDVA 2EABA 2VLJA 2YN5A 1EGJA 1KEGL 1TZIB 1T4KB 4GBXC 2Q6WA 3L6FB 1DLFH 4DUXA 4YBHA 1WWBX 1KWGA 2DL2A 4L4VE 2WQVA 1ACXA 3WG7B 3BMWA 2V6HA 3ULAB 1HILA 3JWNC 1AJ7L 3R0NA 4D7PA 3PY9A 4YBQD 5E6IB 4B96A 5JW5B 3QI9D 1NAMB 1KY7A 2V3DA 2MKLC 4OFVA 3V4VB 2TSBA 1VB9A 1A6AB 2Y7SA 4LVOB 5A43C 4OY9A 3T3PB 3D4YA 2X4PB 4N85A 2VIRA 3MA7A 4GRWE 4XTRD 4MSWA 1AQ8A 2KL6A 4EIUA 1WJ3A 3FOMB 1DZ0A 2Z8SA 4DPCX 1AQKH 1F3DJ 3U25A 5K93A 4Z7IA 2DYPB 2TRHA 3HI1B 4ELMB 1AACA 5CEZE 1JL8A 1S7XB 4H1LB 2Y7QB 1E42A 1P7QB 4MS8D 5LGYA 3QDJE 2J71A 4HF5L 3VXMB 4QLRA 5DJYB 4APXB 4E42B 2C3WA 4POUB 4TUUA 1QMUA 4G8FA 2EDFA 4ZTEA 1C16B 4X4KA 1ZHNA 3TPUB 5E4EB 1VGKA 1JF1B 3BP7A 4N0UE 1I8LC 1EEYA 2PO6A 4K8RD 4M6MH 1EEZB 2W92A 1RHHA 1UJ3A 3R4DA 1DEEA 1XX9C 4HKBB 4M7JH 3R1GH 1IBZA 2YBGA 4KO7A 2JNZA 3N9GL 4YHNA 4JFYB 3C5ZA 2X4RA 2YGPA 4X9YA 5FECB 3KXFB 2H5UA 3ARUA 1INEL 1BX2A 3MLSL 4UQDA 3PHOB 1IC7H 4OCSH 4HBQA 2J8OA 5B8CC 2EZ0C 4WW2A 1H6UA 4HS6B 1G7HA 3NIDB 5L4IA 1QW9A 1W0VA 3GIZL 4X4XA 3VD5A 5DJXB 5EOQH 3DJSA 3U1SL 3WSQH 3D48R 1PS3A 4LOEA 1TR7A 3II3A 2YXFA 3NSXA 4EOWL 3Q6FA 4NBZB 4QHUA 4UAOC 3TA4D 5DA4A 3KLHC 3BGAA 5K1JA 5JUEL 1NTDA 4YHYC 2VR3A 3Q9QA 1KLGB 1KB5B 5KANG 3EO1B 2YC1A 1YN6A 5GRUL 2Q8BL 3CG8A 3QUGA 4GQ9H 3WMSA 4F15B 3ZO9A 2P7TA 4PCYA 5IESH 5HDOA 1BREA 1QFWI 3GLEA 1ZSDB 4PV8A 3MLPA 5IJVA 3GRWA 5EBLB 2XKNA 1UD3A 1AVAA 2L7JA 4OF6A 1Q94B 2UXGA 2D2CC 2Z7YA 2JJUA 2KUTA 4TL5A 3CQFA 1T03H 2EXWD 2XC8A 3V52H 4WUKL 2AV1B 1YYLH 2MCPL 2ARJA 4PGBA 1SXZA 2V5SA 5KYNA 3B2VL 4KVCL 2E27L 1YNTB 1O7DC 3MLTA 2FDBP 4R3SA 1MJ7L 1B2WH 4F9LC 2R69A 4FKHA 3OJ2C 3FFCB 4X4YB 1XB6A 3T0DA 3OR7A 4K07A 4ZAKC 1DYZA 1IBBA 1BQKA 5CM1A 4JVWA 3UO1H 1F4YH 3FH5A 5F3BA 2WTRB 1FVCA 4PB9L 5D9SA 2EINB 2GC7C 2VZTA 4YSSA 2XWXA 5C08A 3VSTA 3WFEH 3X13A 3K6OA 4AQ8A 5TGBA 4PCTA 3Q6GH 3TC9A 3K2IA 1EZVX 3GI8L 1QLEL 3ML9A 1UZ8B 4MXQD 2GSMB 4NO5B 4MZ2A 4YUEL 3SDDA 3O0RH 3EDEA 4X80L 4D9RE 1UM5H 4L8CB 4GIPD 3X14B 4QF1A 4WWID 1I9IL 5EO9A 2HG0A 2XKSA 5EN3A 4K7PL 4DK5A 1CFNB 1BA9A 3TZVA 4NQSA 4Q9RH 1A3RH 4UINH 4JPQA 4XCEA 5GRWA 3U6RB 5AEAA 3VUAA 2BFVL 5DUPL 4KK9D 1U8CA 1WBXA 3AS0A 1RIHL 2A5UA 2EDLA 2GB2A 4KQ4L 1L7TL 3GI9H 5DTFB 1QRNB 5INCB 5T1JA 3B7YA 3WNJA 3WDIA 1Z3GH 2VDOH 5HGGS 3UGXA 3MJ9H 2QVIA 3JTTB 1SXNA 3RURA 3ESVF 5I1EH 5IB3B 1DSYA 1Q4NX 2DQCH 2APWA 1QPKA 3EYVA 1YNTF 4N2KA 5FFGA 3QB7C 1BJ1J 1PFOA 6PCYA 5D72H 3VD9A 1R3LA 2Y6TE 4PGJA 2JKXA 5D1XB 5DC0A 3MOAH 1DBKH 1IGTA 3WUWA 3NCYP 4DAGL 2CCLA 3O6FA 2X6BA 5E95B 1T7ZA 2V7HB 2HFEA 4ZS6D 3VI3B 5EU5A 1XTMA 2HTLD 3LNIA 2PCXA 4B27A 2CR0A 3ZE2E 3BOVA 3ZE0B 2X7LB 3RY6C 3VRJB 4ZPVB 2WCPA 1Q1PA 4KZDH 2H32H 1DE4B 2FO4A 4XMLH 5ID0A 4N0YH 5IMLB 2APXA 1KGWA 3FO1A 3QEQD 1JZ7A 4MD0A 1F3DH 1NUNB 2CKBH 3CHPA 3T0EA 4BFOA 2V37A 3C6LC 4KNSA 3DMMB 2X89A 4ZFGH 4PN6A 1SN2A 3AMLA 1S9YB 1TQWA 5CUSL 1A1OA 1ZOXA 1Z9OA 3LNFA 2DYRB 2P8MB 3MUHL 3WKML 5MEND 1MQKH 1KFAL 1HKFA 4X7SH 4XVUC 1A7QH 3UZQA 5DFAA 1BEYL 4DVRH 4N5EC 1E5BA 1HIML 2LGNA 1B0IA 4G6MH 1R3KB 1P4LB 2ICCA 2R4RH 3CLEL 4C57C 4JFOB 3FTSA 3O6LL 3EYUL 3CDGA 4KQ3H 5FLUA 4CGUB 3CDYA 3LKSA 5KSAD 1HKLH 1U92B 4CU7A 4LSPH 5D5MA 1BFOB 2FBRA 3VI4A 4DP2X 5IHBA 3SZ6A 2YD2A 2IDTA 5I1IL 3GSNL 1NOAA 4PRPA 1X5LA 3ZE0F 4M43L 4UILL 2KS0A 1MXDA 3B3IA 5FO9A 4RNRB 3H7BB 4NIYE 1NQBA 2R2CA 3VFWB 2AGJH 5FYKH 2JCWA 2KZKA 2AQQA 5GS3A 5GS2H 3BFOA 1GY1A 4ZMVA 3GBMH 3BAWA 4KDVA 3L3GB 4L1HA 4PJAB 4HMCA 3QCUL 3T2LA 5JIIA 1X7QA 1D6VH 4UYQA 3AU0A 4LVHC 1T89C 1H3VA 4OF7A 2BX5A 4XH2B 3GGWB 1KELL 4XP9H 1JGEB 1MCIA 2E6JA 3GSVB 5CSZB 4C4KO 2BDNL 1GZQB 2GAZA 2R69L 4PWHA 3VD0A 4RA3A 1QW8A 1ZANL 1WICA 3QNFA 1P9MA 4X98A 1CQYA 1SXAA 3LJ3A 5HJ3A 3N1QC 5MHSD 4MDJB 4NO3B 1WCBA 4MXWH 5D93C 1YG9A 4UZUA 4UOW1 4IS6B 1E2VA 3EHBC 3L3KB 2WMPA 4XNQB 1IKNA 5FA3B 1NLDH 3L81A 5DMIL 3VYOA 3SBPA 3CXHK 4TTGA 3CMOL 4JHUA 2VE6B 2K7QA 3AG2B 1GCYA 4NRYA 1KJ2B 3KNBA 3VXTB 2K0RA 4NFBA 3S3DB 5I30H 1JYWA 1IUZA 3UTTB 3MNVB 1U95B 1I9RL 3QZMA 4MAYB 3UPCA 1LTXA 2NRDA 3BDYL 5AVVB 2OJEA 3RL2A 1ZV5A 2XBZA 4IBLT 1FCCA 2NQCA 4KU1A 5GSVB 1A5FL 4R4BB 5KSUA 3BVNB 2KDYA 3TEXA 2FBJL 4PJDB 1R3JB 2EE6A 2WQUA 1U2HA 1H6EA 3CC5A 1MQ8A 1QUPA 2H0EA 1JNLL 1XQ4A 1G7PB 4H88H 2B1AH 2NY3D 2D3LA 1VHPA 3IDIA 3BLKA 3FUEA 3WL9B 4QD2E 2IOMA 2BC4A 3GQFA 2A9MH 4N2CA 3TU6A 4S0HA 2IDQA 4Z7OB 1XIWD 2XX1A 1PKQB 1BBJB 2FT8A 4Q74A 4M5TA 4HHWA 5DEFA 3E0GA 3GHBH 2Y36L 3DJRA 4ADGA 3VFRB 3CFDB 1UH4A 4JFPB 2ADJA 5J11B 1CU4L 1UWXH 5DZJA 3FUMA 1KC5L 2CDGA 2PW1B 1PZAA 3H0TB 2A77L 3I6KA 2DLGA 3DVGB 3OKKA 4L3EA 2ARJQ 3MXWH 1A0QH 2RB8A 2VLRA 1BJ1H 3BQUD 4YVNA 1UH3A 3JV6B 3EJJX 2ROXA 5FM5O 3MGAA 3F64A 5DUML 1LE5B 5DZAA 4UANA 5FYKD 5CP7A 4HUMB 1KTDA 4DF9A 4DTGL 1U4EA 3RVTD 2OMZA 2HG5B 4KV5E 5AYUL 4GMTH 4KOCA 5INDA 3IN2A 4AXWA 5CN2A 3QJFA 5BRZD 1RULL 2EH7H 5DVOA 1NSNL 2JB5L 4X6CA 4IOSD 4G9FD 4PJDF 1RUAH 2H1LM 2V17L 1AO7A 2J12B 5CBAB 4PG2C 1QSFA 4YL4A 2AQSA 1L9OA 1MSPA 4M1CD 4Y1AD 5HI5D 5C8JA 2KT6A 1WIPA 2EH8H 3BVXA 2WW8A 2GBVA 3ROLB 3QUZD 1FO0H 5CF3A 3KBHE 2NOYA 4RGMC 4XPFL 3W82A 5J12B 1J8HA 2ENJA 4DKDC 3ZHLA 1AGCB 4XOAA 4GQPH 3MLUH 1G9NH 1EAOA 5L9DL 4YXKH 4JW3A 4R90L 1A6ZA 3QW9A 4G8GD 2VXQH 4OTXH 3TV3L 1U93B 4JE4B 4AZUA 4JKWA 4JQXA 1D3CA 3AGWA 2HN7B 2CR3A 2V33A 2C9AA 5HJDA 3DGCR 3TBTB 1UXLA 4NQED 5D96C 3DOSB 1FYHB 5EZLA 3AW5A 1BVNP 2AQ3A 2VDKL 2JKRM 4BWTA 4KKLD 1T3FB 4ESKA 1D7BA 4LVEA 2QADD 2PYEA 3VGFA 4P46B 1MEXL 3FZUC 4X5WB 1KJ3L 1KPVA 1E9PA 2EIJB 3MOBL 2LLGA 3S7GA 3INOA 3PGDA 5HYJE 1XGPB 3P2TA 4RAVA 2B9AA 1DVTA 3ARBA 2VDNL 2WGXA 2EE0A 4OT1H 3NMEA 3MBXL 4WGVB 2YAQA 3DV4B 3Q8AA 4J1UA 4PRBB 3I84A 3VTMA 2AK1H 4UZSA 5HDBE 2A9DA 1S7SA 1I53A 3MCKA 1T1ZB 2VQ1B 4KZCA 4UT7H 4F2ME 3CVHA 4GEIA 1NGYA 5CLTA 4POYA 4QRRB 4HIJB 4I48A 3IMUA 5IWLC 3QG7L 2ZSWA 3D39E 5ICZB 3GHEL 1MCWW 3VGEA 4AZ8B 1WD9A 1OWWA 1M7UA 1T4KA 1VJSA 2IO5A 4CL7A 2ED7A 3LNGA 1BGXL 2D9CA 2JXMB 2BY0A 4UYPA 4N28A 4OLWL 3IU4H 2BZCA 2EXSA 2EKSB 2MTPA 2PTUA 3P4MB 1IAIM 4HETA 4L5FE 4HBCH 3WAJA 3D2UA 5E6IA 5AVYB 5HGDB 5JW5A 1MFBL 1J1XL 1NAMA 2CGRH 2HZHA 2TSAA 4P23B 2E76C 3N0AA 3V4VA 1BYOA 3QK0A 1A6AA 2X4PA 4IKLA 4A6YB 2QZQA 3L9YA 4E9WA 2HRHA 2AAAA 2DBJA 1DBMH 1DBAH 3EBHA 3FOMA 1DN2A 3BUQA 4LCIL 5EFIB 5IUCA 1EHLH 4W9DC 5F6IC 3ATFA 4U6VH 5J1AB 4FCHA 4Y16C 4TNWF 4X5LA 1SJMA 5LXGH 1S7XA 3QCTL 3GXNA 4H1LA 4ZQTA 2Y7QA 5JA8B 1P7QA 4OCWH 3MHZA 5SX5K 3VXMA 5DJYA 1JFHA 1W8EA 3QXTA 1KF9B 4APXA 3AABA 2DTMH 1A6VH 4E42A 2D7QA 4EMZA 1XCTB 1LK3H 2J1WA 2XN1A 3D4CA 1W8NA 3SQOH 1C16A 3T2NH 2Q1EA 1MVUB 3OKNB 1JSYA 4X6DE 1JF1A 3WIIL 3MRRB 4E41B 5JW4N 3MR9B 4GFTB 1EEZA 1AC6A 1NFDE 4QXGH 4XNUH 1JHTB 1QVOB 4WUUD 5JIPA 2NY0D 3SE8L 4HH8A 1T0OA 4XMTA 4JFYA 1IGIL 4Y2DD 2H26B 1DJZA 1EEQA 5PAZA 3GMNB 5IB4B 4JFDE 1SEQL 1NMAH 5FECA 1NCBH 3CZFB 4TSCH 2UZXB 2WWKO 3I50L 2ZJSL 4HWZB 3RLSA 3CZEA 2NY1D 3MJ6A 1JDAA 1TQCC 4OV5B 4Y1TA 3B34A 3FQYA 4HS6A 3VFOB 4HJUA 1I1AB 4ANUA 2ZUQB 4HJ0D 4XPBL 1VCAA 5F7YC 5K9QG 2A6DB 1YQVH 4GMSH 4UMSA 5DJXA 3ETBJ 5GISH 5CEYB 3EGSB 4CW1A 2EE3A 4WFGD 2C9PA 3FO0H 5KUMA 4KRLB 1E28B 4KJWC 1R0AL 1J5IA 5DVMA 4FG0A 4M48H 5E5MB 4CDGC 1T0PB 4S1DD 3RRQA 4N1EA 1BQLH 2IDFA 5EULV 2JQZA 3EYSL 4W9KC 2DN7A 1KLGA 5F8QC 1KB5A 2EC9T 4K23L 2F53B 3EO1A 3QNYB 4LLQB 4PJ7E 4LSDA 4M3KB 4XNYH 2XZQL 5DRWB 3S2AA 5L88H 4MJ6B 1ORQB 5KBNC 5EBLA 2FEJA 3LRLA 5DT1L 1Q94A 3N42B 3QZWG 4G5AA 2AJUL 4AUJA 2G0LA 5JQIB 5H94B 1J1OL 4WO4B 3C5ZC 2DIAA 2QEJA 4FFYH 4O58H 3PWJB 2CO6B 2AV1A 4XCCL 5DR5L 3SE9L 4Z3JA 3IJEB 2ZUXA 4ODTL 3DKHA 1KNOB 2BOBB 1V7MH 1YNTA 4HS8H 2BIHA 4OFYD 1OT2A 4OLVL 4OI9A 5T1KB 2GQHA 3D06A 1WT5A 3FFCA 4X4YA 1DANU 5I2IB 4PJHE 1DJGA 4P4KB 3P73B 2X70B 1IAOB 3MUGB 1ND0A 1ZLEA 3DUUB 1MVYA 4HG4J 4L48A 5EOCL 2WOYA 1C5BH 3K4ZA 4A68A 4E68A 5E23A 3OLIA 1WH0A 5IT2L 4NO5A 1UZ8A 3CVHL 4OCYH 3A4FA 4ONFH 1HL8A 3LX9A 2OW7A 4L8CA 3X14A 1ZGLM 3EH3B 4OZHF 1CFNA 2NR6C 5FK9B 5EHFA 3NTCH 3KAAA 4U05A 2ZONA 2ORBL 2KHAA 4XP4L 4PH8A 2O5YH 3PPEA 4M7KH 4RMWA 4LFHG 3Q1SL 3WTXA 3ZTCC 5I1CH 3KGUA 4XCFH 5JQ6H 4WFFE 1L9QA 3N42F 1QFUH 1QRNA 5INCA 5E6YA 2NY2C 4G8EB 2XWDA 1UOKA 2ZWSA 2NMSA 2XN9D 3TASA 4ZMNA 5IB3A 3QC6X 2QQNL 1EZVY 2X1WL 4NM8H 3TN0B 2PF6A 5D1XA 4R7VA 1IC5H 1CD1B 1E6JH 1SHMA 4J3BA 2FLBT 3RBSA 4EBQH 3OJVC 3KYMB 5CZVH 3ZYJA 3BKYL 3AWEA 1IBGL 2ZWNA 5E2VH 2V7HA 2X3AA 1VEPA 4HUWA 2OZ4H 3TTSA 1J88A 2X7LA 4IRZH 1XR9B 4ZPVA 3VRJA 4DOHE 1DL7H 3BZDA