5ABZA

Complex of the fimh lectin with a c-linked naphtyl alpha-d-mannoside in soaked trigonal crystals at 2.40 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
158
structure length
158
Chain Sequence
b'FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH
molecule tags Cell adhesion
source organism Escherichia coli
publication title Structures of C-Mannosylated Anti-Adhesives Bound to the Type 1 Fimbrial Fimh Adhesin
pubmed doi rcsb
total genus 35
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5abzA00
3MCYA 4LOVA 4AUYA 3RFZA 4CSTA 2J2ZB 4XO8A 4X5RA 1N0LB 4X5QA 4XOAA 5IQOA 1PDKB 3BFWA 4X50A 2JMRA 5FS5A 3JWNH 5IQMA 4J3OH 4AV0A 5JQIB 4XOBA 5F2FA 1KLFB 1N12A 4J3OF 3BWUF 1QUNB 5FX3A 4AVHA 2XG4B 3ZL1A 4AV5A 2WMPB 5F3FA 3ZL2A 4CA4A 3BFQG 3SQBB 5FWRA 4AUJA 4CSSA 2W07B 5ABZA 5AAPA 5FLUA 5AALA 5IQNA 5LNGA 1UWFA 5AB1A 4XOCA 4AVJA 4AVKA 3ZPDA 5CGBA 4AV4A 2JTYA 3JWNE 3JWNG 2XG5B 5LNEA 1KIUB 4J3OG 3ME0B 4AUUA 1ZE3H 2UY7B 1TR7A 4AVIA 4BUQA 2VCOA 4XO9A 4ATTA 4XODA 2UY6B 4XOEA 4X5PA
chains in the Genus database with same CATH superfamily
3C8KB 1HZHL 1F2XK 5AYUH 3PNRB 4MD4A 1NOAA 3BVWA 4NO2A 1FN4A 2VTFA 4QHUA 1VJSA 2J43A 1GZHA 1N67A 3UBXA 4A68A 2P49B 1OCWL 2MQ3A 2WMPA 3CDFA 5EOTB 5HYJB 2H6OA 2K9FB 2ZCLH 5HVHC 4GUQA 1MDAA 2AJ3B 3JTSA 3W9DA 2AEQL 4PJCF 2M83A 4FTVE 3SGEI 1M2VA 1LE5A 4YC2B 1QLEB 3AMLA 2GKIA 1G9NH 3GNMH 2IAMA 2Q76B 3F7KA 4NHCH 4PV9B 4UQIM 3OV6A 5HJ3B 2A6KB 1Q1JH 3EH4B 4MZRA 5FYJD 2O5YL 2KPWA 2Z65C 2V2XA 2OI9B 3GSVA 3N5AA 4H5SA 3DROB 3V5KA 1JWSB 2YAFA 1MELA 1ND0B 2IH3B 2BHFA 1F00I 1A7NL 1MEXH 2Y2YA 4J3UA 4UIKH 1AE6H 5G4MA 1MAJA 4DKEL 1A7PH 2YA2A 4YGAB 3AAZB 2X9WA 5FYKH 1WWAX 3AS2A 3CZKA 1NL0L 3A6BL 1NEUA 5L4IA 3MRCA 5LVEA 5F7UA 3KJ6L 3OC8A 1FNEB 5HHOA 2AVGA 2B4CC 1LO3H 2RQ8A 2MKWA 3EFOB 1QNZL 1R24B 2WLHA 1DQML 1QW9A 4DETA 3D87B 2PXYA 1G6RH 3PQYD 5KSBF 5C3TA 4PCSA 1NKRA 3U46B 1R0AL 1QPKA 3GSRA 3QDMA 1JYWA 3OGOE 1RUPH 3HOGA 4Z0BH 2HRLA 3KCPA 3MJ8B 4GRMB 4DGIL 4EXKA 5CKAA 5IMOB 5D9SB 1LGVA 4D8OA 1OAJA 2JKSA 4HLZG 2NY4B 4N87A 1YZZA 5DJCA 3RWCB 1MNUH 1OTSD 3QFJA 4KMTL 4X80L 4U05A 1HDMB 2D4FA 2Z7YA 5E9DD 5TE7H 1CICA 3CWGA 3L3OC 4FKHA 3W0WA 3J07A 2FJUB 2VDMH 5I1AB 3IJ7A 4F8OA 4LEOB 1QTPA 1JGLL 3BAKA 2GITA 1LK2B 2MCPL 3TA3D 3P2TA 3U1SL 4OIIH 3C60D 2H3XC 3RHWK 1I1YB 4HGKC 2J6EA 5BZZA 3WFBL 4RFEB 5FLUA 1JWSA 1S7UA 5HYFA 1FFTB 3QQDA 3T9WA 1E9QB 4NPYA 5CMAB 4NI3A 1KXQA 4BFNA 2CD0A 5DSCB 5F3BA 3G3LA 4Y1TA 5FYLE 3ZDWA 4AENA 1LO4L 4XP6L 5TE4H 3HE7D 2FL5B 2ITEA 3QIUC 3AREC 4ZOEA 2CJUL 1G7QB 3SE3A 5AD0B 3HUJB 4HVBA 4JMXA 3LKQA 3FTXA 1TYJA 3QZOA 2CGRH 3KCWA 3UGXA 4I0KA 5T1DH 1SUHA 2YXWA 4QXTB 2H6UA 2JWYA 4OZIE 2APFA 1WWBX 4MMZC 3FB6A 3IVKB 3ZE0F 1BX2A 4WEEA 2OCJA 4IBUA 2ADFH 1FVEA 3QRBA 2IPKA 1FL6A 4MKMA 4F2ME 2PPCA 1HEZA 2VABB 35C8H 2GW5A 3OGCA 1UOKA 2PTTA 4GMTL 3SKNA 3T0VA 2H47C 1SEQH 4Z7WB 4TLUA 2WQSA 4OCYH 2NUPA 5T1KA 5HXMA 4XPAH 4E41A 1A7PL 4FQ2H 2EDYA 4XAKD 3KCPB 5IMOA 4L1TA 3MLZH 3S5YA 4LVHC 1MY5A 4I5BB 4LLAA 4OQTA 4PRAA 5TE7L 4NGHL 5INDB 2DQJL 3ARDD 2DLFL 5CXPA 5EEYA 1IIIA 1NCAL 1XAKA 4NHCL 4N9GA 4X5XB 4UINH 5GGRY 4X5RA 1J8HB 5BMFH 5T1JA 5CCHE 2FIKA 5DRWB 4LMQE 1QTYT 3OC5A 1F1AA 1T0NA 3SGDI 1HJBC 2VB5A 2EDTA 3TJEH 3F7LA 1E42A 5CP7B 2VIRA 4B5EA 2DIEA 3VGBA 1NWOA 1CGSL 1IBGL 1E5BA 5CS7A 1IKNC 2ENSA 1WYJA 1AHWB 2IQ9H 2CGZA 4A7TA 4N85A 2MCAA 1CL7H 3PFQA 3T2NL 5HYSG 2A6IA 4L3CB 3GXPA 5KBLA 2BVPA 1H3UA 4YK4C 4L8BA 3APNA 1IBHA 5I1DB 4AYEC 1QLRB 4IMLA 1MCDA 5DUPL 1FNSH 4XC1H 4WI6A 3FMGL 5AVYB 1JMZA 1KY7A 5DHYA 3LQZA 4OCXL 2EE9A 1B4JL 4JQVA 5HYJE 2APTA 4AMKL 3CN4A 2VDNL 3P3TA 5CZXC 3O9WA 4LAQH 3SDYH 3LKQB 5KVGL 3TPUB 4NZRL 1A8ZA 4UILH 4IOSA 4HSQA 1IAII 4LNRB 5DLMH 2E56A 4UT7L 1OCRB 3ZDYE 2VRKA 3PNWB 2AQNA 2QR0A 2UY6A 3U82B 1FFPB 5IEHB 2O30A 4XMPH 3TCLA 1NGPL 2C3WA 1WC7A 4LSPH 4C47A 4Y1AE 1P2CB 3ES6A 4KVNH 2MPAH 1INQA 2NRDA 3GSXA 4P5TB 4QGTA 3RBGA 4BXVA 3H9HB 2V8LA 3KPNA 1ZT7B 2HZHA 2I32A 2JKNA 3SYOA 2K1MA 3SPIA 1HL8A 1EGJH 5HHXH 3FT4B 5BZDA 2ZOLA 1C8QA 1V10A 5CFAA 3U7YH 5GXBB 5LGJA 2C3XA 4E9SA 4L8BB 5I1DA 4P59L 4Y7MA 5LCVL 1J9SA 3TU6A 3J7HA 4UYQA 1JCKA 3NZHL 5DVNA 3VXSE 3OHXC 4RETB 1IL1A 1ZWIA 4ODSH 4KO6A 4PB9H 5KAQF 2XZAL 4KZDL 4TVPH 4I2XB 2EYTA 1XDTT 3KPSB 4LAQL 3IDNA 1ZXKA 1SOKA 4NN7B 4P46C 3II1A 2FGWH 1YECL 4QT5A 5HP5A 3ALPA 4BH8B 3RWGA 3TYGH 1NJ9B 4OLYL 2BNRE 4IRSC 1LO2L 1ORSB 2VW4A 3IFPA 3MUGB 4NJ9L 1F90H 3QDJE 3WNLA 4MRCA 4LU5L 4OAWA 5CEZE 3QIUB 4Y5YA 1CL7L 4EI0A 3IFLH 4QY8B 5EBLA 1V7NH 2H8PB 2NY4D 2W9LA 2OMWB 1WK0A 2QSTA 2XRAL 5CLXA 5EFIA 2MOQA 1QFWM 4JX0A 3CSYA 4YOKA 1EJOL 3P9WB 5EF0A 3L5XL 1KELH 2GBTA 4HIXH 4KOCA 1E5YA 1KTRL 2DYSB 5IB5A 4F7MA 1GJWA 5MP6L 2JJSA 1NQBA 3IETA 5IB4B 3V6OE 4PJFE 3MJ9H 3S4SG 4Z78B 4LASL 3ARPA 1BZ9B 3QUXA 4ZUUA 1EXUA 5ILTL 4BSVB 5H94B 3L54A 4ANXA 4HS3A 5AOZA 3RY6A 5DRNA 3QRLA 3TEXA 2VLJE 4KXDA 4A37A 1FFNB 3ARGA 4FQIH 4LCUA 1UKSA 2DQUL 4BZ2L 4IIZA 1SLVA 5B1BB 4AKPA 3SJVB 3FRPB 4K0OA 4KK6D 4QOKE 4KGJA 3H6AA 3OKNB 2AERT 2G2NA 4YDZA 2HVJA 3JVGA 2F1BA 2FO4A 5LB1A 4PIBA 1AQDB 1AGCA 1MKFA 2H2PD 1ZA3B 3T8VA 3D0LA 3QUML 4IRZA 4M8RA 2ADFL 3ATBA 4DZ8B 1P6FA 4F5CA 2BX5A 2BNQE 2WWKT 5FDWB 1Q9OA 3NZSA 3IJ9A 1HAWA 1N12A 4J3WA 1C08B 2XRAH 5JUEH 4HWBH 4M3JA 2F54D 1I1YA 4JPSA 1KIPA 1F86A 3BYYA 3DOIA 2CDGA 5DWPA 4N0FA 3WY2A 2A9NH 1TTGA 5L4MA 2CIKA 3CFCL 3EYSH 3HE7A 2Y7QB 3HRZA 5HHMD 4OM1L 4PJ5E 4ZMTA 4O2FA 3QI9A 2FNWA 4RIRA 5DUMH 3UBGA 5IR1A 3CDZB 3PGDA 3QNZB 1OOAA 3LRLA 4I0CC 1O75A 4PB9L 4GSUA 5I30L 3BQUA 3OAZH 4HIHB 1EO5A 2EXWC 1S7RB 3WS3B 2EE6A 2MCPH 3SQOL 4D0DB 3TO2B 3UTQB 4XP9L 3ZUCA 1H8NA 3P9LA 2X4OB 3I3EA 3SGDH 3V7AG 2C1PA 3FB7B 1BZOA 3QEUB 4U7MA 1W91A 2DQDL 3EJSA 4XO5A 3D1MC 2NZIA 5HHPB 2YAEA 3BH9A 4Y4HA 2C9RA 1PEWA 1YNKH 1FL6B 2ZKXA 3CFEA 1WT5A 1ZLVK 3TF4A 3L95A 1SDDA 3MRDB 2RQEA 1PLGL 2WUCH 3WXVL 4B9GA 2ZCKL 3JWDH 3QCVL 2Q5BA 2BCKB 4S0TD 2AC0A 3SDDC 2QSQA 1NFDA 3H2WA 4R2GD 4RRPM 3AXHA 4WAFA 4LSPL 3LHPH 3V5HA 1SHMA 4RQQA 2B1AH 2FZ3A 2QGDA 1MLBA 4JDEA 2EIZB 4M1DH 4ODXB 1ZEAH 4PD4K 4YHKH 1FL3B 1AY1H 2R0WL 3FSZA 3TBCA 4QRRB 3SDDB 2NXYD 1JGUL 5JW3L 2QDWA 3QNYA 1P5UC 4XBEH 3QEUA 4JREB 1RH8A 4U4BA 1LO3L 4G6KH 2WCSA 4QOKD 5JHLA 3UX9B 4KXZI 4F58L 2VC2L 5DZLA 4LKXB 4Q7DA 2IMNA 5F1IB 1L4IA 4M8VA 1WFIA 4H0GA 2ORBL 3CFJB 5HYIA 3NPSC 3L5WA 2WZ0A 5GGVL 2AXGB 4K3JL 4C56E 3WS6A 3ESPA 2AJSL 3GK8H 4LVNB 3QZWB 1SVCP 2XFGB 3S8GB 3INUH 4WU7B 1PLCA 2H9GA 4MQTB 4RRPA 1MJ8L 2P43B 1XAUA 2A7BA 2IQ9L 4TLTA 2E9GA 3TJHD 1N0XL 1KCRL 4KNSA 4GQPH 2MTAA 5I9QC 1J0YA 1DUYB 1EO8H 4RA3A 4NOFA 4BQ6A 2VLJA 3ECBA 2CO7B 2PWFA 3P77B 5FXCH 2VR3A 3U30B 4R3SA 1TKWB 4PRBA 1PX8A 2AGJL 1SEBB 4XMKH 4IOSD 2VDOL 1MCKA 1TZOA 1Q9LB 5CEZD 1I9JL 3FCSA 4XWOD 1G7PA 2Y1YA 3ULUF 3IDJA 1KDIA 1BXXA 1GZHC 5I1GH 1R46A 3D51A 2XIIA 3B7SA 4GQQA 2JJTC 4Z9KB 2AJ3A 4YFLF 1G87A 5B39A 1RUMH 2H0PA 5ESAB 1WTGT 1GPOH 5D1XC 5IGXL 3VFTA 4AH2A 3ULVF 5JQ6H 3HC3H 5L7XL 3GXUB 2FAUA 1E4WH 1A6ZB 3Q48A 1SEQL 1OGAD 4H2CA 1PGRB 4MD4B 3GEFA 3R7RA 1RU9H 2VZVA 2B9AA 2BCKA 2B5IB 1WZ1H 1TJGH 3HAEH 3N41F 1HWHB 1LEGA 5K1JA 4CMMB 1PAZA 1DDTA 2PR4H 1R3LA 1H9DA 1MVUB 3EGSB 5L6YL 3KLAB 1P6WA 5HGDA 2QPFA 4F7TA 1U8HA 2WOYA 3MLTA 3NG5A 3QNXB 4OW6A 1QSFD 5D70H 1AMXA 4GBXA 5F71A 3RDTC 3W0WD 4W68A 4JN1H 4BFEA 1CXKA 1FZJA 1KJ2A 5LQBH 1M7IB 2A6DB 3IU3A 1TYRA 4TKWA 4DW2L 3VB9A 2GBVA 4DKTA 3VD0A 4ZOAA 1UFGA 3V4PA 1G7MA 2EDOA 1UHVA 1JZ6A 5CHNA 1DJIA 2CR3A 4N1HB 3LRHA 2K45A 1SGKA 2DOCA 4XVOA 4Y88A 1NBYB 5EDXA 3FT2A 4YUEH 4P9ML 4IKLA 3CMOL 5FK9A 1QSVA 4JZOB 3ZT7A 4JCLA 4A6YA 4NHUB 3F65A 1CXFA 4K7PL 2DQCH 5ETUB 3IFPB 3QZWA 2IFGA 5I82A 3VWJD 1OTUC 2ZX9A 4JRYB 5L9DL 1KBWA 4FA6A 4CW1A 1YMMD 1I7ZA 4UQ2A 5BZWB 3C8HA 3SDAB 4MWFB 4Y2LA 3VRIA 1P6AB 1INEL 2C4XA 3UTSB 3HMWL 2XFXA 3CC1A 2H2SD 4RDBA 4UV7L 3TPKA 1U8OA 1PVHA 3VJ6A 4R0LA 3O3UN 4AUJA 5ES4B 3ESVF 1P69B 3I85A 4Z7OB 2GITB 2P5ED 5D7KD 2YHGA 3PQYB 4LLDA 3H7BB 5HYSA 5JA9A 2GTWB 3R8QA 1O6SA 1YN7A 3CFCH 2HP4A 3IETB 5IB4A 3VXRB 5AW3B 4XO9A 2XVKA 1KGCD 1KPVA 5IP4A 3ARGD 1VFBB 5EMYA 3US9A 4YDVB 4CU6A 3VFGL 3HBZA 4R8WL 1ZK5A 4LSQL 2WV3A 4YDKH 1B2WH 2IANA 4MA1B 5EPMB 4NN5C 1G43A 1UD2A 2BOBB 3FU7A 1YCSA 3LZFH 4EDXB 4QRAA 3LAFA 1TETH 1RJLB 2O72A 2G3ZA 1P1ZB 1Z0MA 1JYNA 5KTEL 3PHOA 2DIBA 3PXLA 4LLWA 2RIKA 4ALAH 5E2TH 2X4SA 2HTLD 4K2UH 1SQ2N 4YXHH 4PLJC 3QQDB 1I3RA 3KYNB 3DDGA 1DBKH 5TE6H 3NCMA 3AT9A 2MWCA 3GTVA 5EOCL 3S35L 5FDWA 2YBRB 3GBDA 3B6SB 4HGWA 4QD2E 1FZOA 2VNCA 2ZX6A 1FYHB 3HZKB 5D4HA 5EUOE 3QIBC 1A1NB 1UGNA 4DSYA 5DMYA 4NYLA 4LEOA 3FK3A 4AGQA 4OZHA 2P80D 2WCGA 4PJHB 4IBQA 2V2XB 2VLRE 3ABZA 3BP4A 4PB0H 1NIDA 3S3CB 2HA1A 4XZUB 4GG6B 4PLNC 2LVEA 4WI0A 3U0WH 4FLQA 5KUMA 2NT0A 4TYUA 1F4YH 4GUOA 1JNJA 4MAYB 1W72A 1ZPLA 5CR8A 4YK4B 1CD0A 3LS5H 4YBQC 5GS1A 1TLMA 1WZLA 3RU8L 5IW6A 1HWGB 5FKAB 1DEEB 1V5JA 2G75B 4O2CB 1ZLDA 4XX1E 1XGRA 3QJSB 1G7LA 1V7NL 2UYLB 2VLRD 2XBDA 2B2XH 2OXHB 4MNQA 3OPZH 3V0WL 4NEHB 1T03L 5I23A 1C16B 1EAQA 2R2HB 4FHBD 3V6FA 1IT9L 1SXCA 4P49A 5ACZB 2B20A 4QRTA 4PJHA 3BZEA 3MBEA 3TYGL 4HIJA 1C8PA 4N9OB 5HYEA 3ZKXC 3RWDB 1RQ5A 5HVGB 1JWMB 4DGVH 2PW1B 3K6SB 4JKWA 4WI2A 4AWJC 5F89A 1NMCB 3E6FB 3CTTA 1JRHH 2J4WL 4GMSL 1IZKA 5BVPL 1UACL 2WQAA 2R51A 2GPZA 4FXLA 4H25A 4DHLA 4ES8A 5B1JA 1J1PH 2A1WL 3PWPD 4LPXA 4P5SA 2VXQA 2HWZH 3BZFB 5KZCB 2VABA 2G9HB 1RZGB 1F4XH 3BH4A 4ZTOL 1D6VH 2HKFL 4ZS6D 2I7OA 1FWXA 2Z93A 3BT2L 3RLSA 1NCDH 4NNYB 3TJHC 3KBHE 3QP3A 2YD3A 3IYLW 1B9KA 4ZUUB 2NY7H 3V79C 5IKCB 2XTJC 2PYEA 2WLKA 4MB1A 1HXYA 4Z7VE 1RJLA 4GSDL 4K5PA 1RZFL 2NT1A 1M9SA 4PJFB 4IMKC 2TRHA 3LV3B 1FV1B 4XI5D 2C9SA 5BXFA 4J3OH 1XIWA 4XWOC 3GHPA 1Q9WB 2IIJA 1UCBH 3APMA 3ARTA 4G9FE 4QTHB 1MH5A 4UQ9A 2IPTH 5HDRA 4HA1A 3W0WE 1LD9A 1HIML 4BV1A 1DJYA 2XWZA 3IEAA 4XP5L 1FNGA 1RP9A 4FNQA 5CN1A 1EX0A 4RA0C 3EHBC 2XN9A 2OTWA 3ETBJ 1T21A 4OF5A 3DLQR 2H32B 3ETTA 3DGDA 4NUJB 1G9HA 3F6IA 1BJ8A 4ODVH 5DD6A 4DP1X 1CLOH 1OTTC 1U21A 3OB0H 4HZAA 2AAVA 3DGGA 3PRZA 4KI5C 2F5BH 5TDNB 2NXZD 2ZUQC 5DJCB 3RWCA 3KYAA 1EJ6A 4DFHA 2LGNA 4NFCA 5IEKB 4N8VG 2ICEB 2OZ4L 2VC2H 3D0VA 4MBRA 2F08A 1VCAA 1RUQH 5HD8C 2P5WE 3P73B 1SDAB 2J44A 3MJGX 2VDNB 4RAHA 4I1PA 4N6RA 4NIYE 3MO1B 1JGVH 4MMYB 1NSNH 1GGUA 4AM0B 1FNLA 1W2KT 1XH3B 1ZEAL 4LFHD 5F70A 5A2LH 1Z5HA 5JW4Q 3ABMB 4ZQKB 1MPAL 5C08A 7PCYA 1R3IL 1DANU 1XIWB 3EDJA 3M7FB 5EC2A 4ZAKB 1BM3L 2YSTA 2HTKC 1MVFA 1FHGA 1MCCA 3HFML 3LZNA 3QHZL 3PQYE 4G8FB 4JRLA 5I15H 4N8PA 2JIXD 4P23D 4GKLA 4JN2B 3FFCB 3QUZC 1OTUD 1R5WA 1AGEB 4JPWH 1PG7L 5LNEA 2C7FA 4FXKB 4TVUA 3CC5A 4XAWL 3HN8A 2NQCA 3KJ4C 3WIHL 3MOAH 4ZD3L 2XZQH 3MLZL 4WKZA 2MKLC 5BO1H 1SNRA 1M1XB 2AXJA 1UUSA 3CV5A 3MRLA 5ISZA 3U7AA 3NMEA 3ISRA 1KGIA 3Q8BA 3FAXA 4K7FA 4JBSA 3EOYG 1RLBA 3L7EB 1MSPA 2F54A 5I8OH 3KL5A 1GS8A 2CA4A 4OZGE 5LGHL 3QORB 5D1QD 4DO4A 4RRPG 3SE8H 3V6ZB 3TT3H 4Q97A 2IOIA 1ILSA 3MRGB 3IF1B 3U9WA 4OSUL 2W0PA 4FXTA 5HDQL 1I75A 1QYGH 1I3VA 3DHMA 4N2CA 4JFZL 4PI2A 5F9JA 5SWZE 3UZVA 3ZYOA 4CUCA 2V9QA 5I0DA 4U4IA 3W9EB 4HKJA 3KPLA 3N85H 1T0NB 3UZQA 4FTVA 4OJAA 4FNSA 4ZYKB 1SBSH 5DQ9A 5F7DB 1U3JA 3FQRA 1DBAL 4PJHE 5KYYA 1IIKA 1Q0XH 4QRBA 3UP1A 4PJ8D 4GP4B 3DIDA 3F8UB 1VDGA 4OSUH 2ZUSA 4MNHA 4H1LH 4L5FH 1O6SB 1U0QA 5EU4B 1SYVA 2XQBL 4PJHF 1HNGA 1X7QA 1N6QH 2CDGB 2ZCHL 2OMNA 1AC6A 1I1AD 2WXKA 2FHCA 4FFWC 2P4AB 2C3VA 3N04A 3G5VB 5JTWA 2VQ1B 4OIIL 2BC4B 5K9JL 2RR3A 4KC3B 5AB2A 2HLFC 3NN8A 4TNGA 5E2WH 1C1EH 2UUDH 3SDAD 2X10A 4NKIL 5E00A 4DZ8A 1DFXA 2X2JA 1EEZA 4H40A 4UOW0 5ALCH 1ADQH 1IGYA 2BNQA 2W1NA 2XPZA 3GRBA 1TO5A 5C0AA 3LKRA 4YIQA 3DMMD 1H0DB 5SWSD 3WSQH 1NANI 4I0PA 4F27A 3X17A 4WU5B 2A74B 2ZOKB 4GI8A 2TSAA 4TL4A 2XXMB 5ABAA 1XBRA 1GJUA 1WD8A 3FT4A 3SYCA 1X6LA 1T04A 4PWHA 1EJOH 1OSZA 2XG4B 1MIEH 4S1SH 2Q86B 2BC4A 4G8EA 1X4XA 4XO3A 3V0FA 4KROD 4RGMC 3K0WA 1T7XA 2YD9A 3Q5YA 2UX7A 2VXSL 2HRHA 1KLGA 1DE4A 2KYIA 4JM2A 5CU9A 4JFXB 1CT8B 3CQFA 1VENA 3V4LA 7CGTA 1GGBL 1A21A 4JFFD 1JWUA 3CLEH 4X98A 1JE6A 2IANE 4DVRH 5CINH 2Q7YA 1T6VN 5E6ZA 1JN6A 1E4XH 3HE6B 4XN7A 4UIKL 2MRYA 4HWEH 4FMKA 3WY3A 3C6LC 2Z31A 1BLNA 3E0GA 3PWJB 2VLJD 1IGFH 3OXSB 2IALB 4KJYA 4XBGB 1OXYA 2V9UA 4Z7UE 4RGOL 4YH6A 5IOPA 4GRLB 1K3ZA 1NOLA 3HUJA 1XTMA 1AGDA 2R27A 2BSRA 4ELMA 5K9OA 4U1IB 4RMBA 4MJ5A 1H3VA 2E46A 4P2RE 1WJ3A 4JR9L 3K80A 1ZLUH 2FEDC 3MLYH 3VGEA 3C5ZB 4AUYA 3THML 1Z1WA 4Y5XA 3ALWA 4L8SB 2JXMA 1NOFA 2VDKL 3K6IA 4BWWA 3WKYA 2VAAA 2BH0A 4OKVB 3FYEB 4U6XA 3IPBA 3H85A 4X6EB 2C3VB 5FYJL 1MQKH 4OKDA 5GSVB 3UO1H 3NSCA 2Z31B 1WE5A 1BD2B 2X3CA 1BIIA 1ZANH 1TZIA 2GJ6D 4NOBA 2CALA 2GJJA 5AVVB 5IQOA 5F88B 4OZFA 4PI0A 4PGDA 1U42A 4XMPL 2QMJA 1GXEA 5DK0A 4PGCB 4HXBL 5FCSH 4FN0A 1U8CA 4MDRA 5I5RA 1XWVA 1IAMA 1LK3L 1QSFA 1HU8A 1QBMH 4FLHA 2BJMH 4M1CD 2EICA 3G7TA 2VSKB 1M7UA 1VADB 5FW7A 4CVZA 1K2DB 3DX6A 2BIOA 5MHSD 4I87A 2NZ9D 4X7DC 2R69H 3QG6A 4XTRD 4ZMZA 3EO9L 2SEBB 4U6HA 2YBGA 1ET7A 1YY9D 4O02B 1LP9A 1OCOB 4GB9A 3CHQA 4XC1L 3AGVA 4U1LA 5MI0C 4HXBH 3MRFB 4CC4A 4NLAA 3KWWA 1LE5B 4E0RA 3QDJA 1ZJBA 2JQMA 4FG6D 4XBGA 3QH3B 4P2RA 4PG2C 5AL0A 4X5PA 4EI5C 4DOHB 4CL7A 1AGFB 4P23C 4UM8A 1YMMA 5BQ7A 3D34A 4EE2A 2PR9A 5TH2A 4Y4KD 4B9KC 2NY3C 1KWKA 4PS4L 2Q7YB 1MIEL 3MV9B 4S1SL 4U6XB 2G60L 3WY1A 5JOPD 3JWOL 4BSJA 1MAKA 4KRPD 4BWUA 3ULUE 1J5IA 4GSQA 4UINL 4Y9GA 2X4TB 2APBA 1BXVA 3OLIA 2YJLA 4LHUB 3QWNA 2H6PB 3QHTC 4ZUSB 3UBFA 1QWNA 2QSCH 1MY7A 2YJQA 3D09A 1CFNB 2ZG3A 1KBGH 4HS8L 5ITFB 2AJVH 1S7RA 1BGXL 1SMAA 5EDSA 1U3YA 1F1DA 5DGRA 4KAQL 1WFMA 4MCYA 4H8PA 2Z35B 3BMVA 4JQIA 3S88L 2UWEB 2ZAGA 3KVDD 2XWBA 3DO3A 1F45A 4OR1A 4RESB 3T8XA 3ZE2F 2V2TB 2Z91A 4AIXA 4GQZA 3RDTB 5KJ4A 4PGDB 2RCSH 4C57C 4LHUA 3LZFL 2GK0B 3WFEH 2JH2A 4IBZA 3AUWB 4TVPE 4HJ1A 3BGFB 2BVQA 4TRPL 1P7KB 3HC2A 5GGSA 4KK8D 1AGBB 4LCWA 1ORQA 3X12B 3MV9A 1YYLL 4LL1A 5DZOA 1RZQA 3KM2A 4PTUA 1DVZA 4DTGH 2BZ7A 2VLKE 4L3AA 3TH2T 1A3QA 4CW1B 5IEHA 1IGJA 3LRGA 3Q6FB 4G82A 1D5IH 3A6CH 2ATKB 5ALCL 2DQTL 3N91A 3GXTA 4I13B 3STZA 1S5IL 3KWWB 1W6WA 2HLFD 3VDAA 4S0HA 1RSFA 3GKZA 1T1ZB 4HCRH 4N86A 4XPTL 4Z7VB 1YDPA 3SDAC 3L5WB 5A1AA 5IBLD 1KB5B 4MYPA 3E3QC 4NQVB 4PRHD 5E5UB 5DK3A 4PJEB 5D7KE 3SODB 4FTDA 5C3IA 3VRLF 3MPCA 3ZKND 3U0TA 5BUAA 3WMSA 1JHKH 1JGDA 2VMJA 1XQ4A 1XH2A 1HCYA 4N8CH 3N41B 4ZFOA 4NZFA 2YXFA 3IKKA 3NEXA 3CFDB 4PD4J 5MEOA 5BZXA 2ID5A 3P4MB 5DDHB 1MFUA 4HAGA 3ZDZE 4LE8A 2WP3O 2QQLL 4UAOB 1YEIH 4NQXA 2UZPA 1BFSA 2BSEA 1BJ1H 1S9WB 3FQNA 1PG7H 3T3PE 2DMBA 1SJEB 5EIIB 4F33A 1EVUA 4I4WB 4MA1C 3DUHA 3T0EE 2BFVL 4NN5B 3O4OB 4DK3A 3SY0B 1BM3H 1YNTA 4ZS7L 3ILQD 2WIMA 3L48A 4WFEE 5JXED 1QSEB 2NR6D 3GPSA 5LBVA 1W80A 3QZBA 4L1HA 5LLIC 1J5OH 1KGCE 4R4FL 3C6LD 3RE0A 1AKJA 1NAML 1QI4A 2CHDA 3EJYC 3I2CH 4TUUA 4YHZL 1U8NA 2V5MA 3PDDA 4FFZL 4E9QA 4QRSB 2H3KA 3MJ6A 2YWZA 1F3DH 3D85A 1IV8A 1JZDC 2IFFL 4BDVA 1XIWD 3QQ4A 5K5YA 2CE6A 3IJ8A 4JY4B 3RFZB 5F7NC 2LAAA 5FUZL 3SDXE 3S36L 3HG1A 3KH4A 3POCA 5IJVB 1HHJA 3UDWA 1XX9C 4GQ9H 2AITA 2HT4C 4JHAH 1BQHB 1JPST 1HYSC 5E94B 2GCYA 2HH0L 4K9EL 3Q9PA 4PFEA 4AL8C 2TRYA 4XP5H 4LQ1A 2AEQH 1G7HB 3L3IB 5H4YA 5ANMA 5EC1B 2Z31D 1TJMA 1YN6B 4XCNA 2FR4A 1RUAH 1E4XI 3DPBB 2EE0A 3HHSA 3SE6A 2BNRB 4PJIF 1JF6A 3GSNL 1BEYL 4KMQA 4WNQB 3MRMB 5D2NB 2Q3AA 2N7BA 1FVEB 4B9FA 3EJZD 5GSRA 4YHMH 5DSCA 5F3BB 3MGOA 2Z93B 1NLDH 3T65A 3OAWA 1NBZB 1XF4A 4BQ9A 1DQJB 3DSNB 4G7YL 3QDMD 3WKQA 4XN4A 1ONQB 2BHUA 1Q94B 2DM2A 1FV1A 4PJBB 4NO2B 4TMPA 3VD1A 1MHEB 1BV8A 1TQTA 2QKIB 2QQKH 3ARRA 4ZMQA 3PWUB 1KJ3H 1SDDB 3NFSH 1F97A 3Q05A 3PWNA 4XBEL 4CDHA 1CLCA 1FC1A 4LAJH 4KDWA 2NY4C 2QPSA 5E9DA 2E86A 5EO0B 1JZJA 3VFRA 1Y18A 2WNWA 3HG1B 2QKIC 3WIIL 1NCGA 2FHFA 2CO6B 3V0IA 3KLLA 5AWNH 1MW0A 3VFVB 4ZUWB 1KENL 4YDLB 5I0WA 4HIIA 2I07A 1A4BA 4FABH 4BM7A 1TVBB 1TVHB 2PCPA 4JLRB 1J8KA 2CLZA 2R1YB 4HJ0C 4B9CA 1UD8A 1Y0LB 3T6QC 3DIFA 2FBJH 4KHXL 3CU7A 3CLFH 3LH2H 3IAGC 3LN4A 2AZAA 4FHJA 4PV8B 3QQ3A 4EOWL 5AENA 2UY7A 3QQNA 1G7IB 1R3KA 5EOCJ 1BAGA 1Y6KR 3FO9A 3VU1A 3T3ME 1F4XL 5DJZB 2HWZL 4LCIH 2CLVB 2B8OT 2DMHA 2DWYA 4IOIA 4JPVH 5IW6B 1AG0A 2DTSA 4HKBB 2X4PA 2P5WA 3BMWA 4E9WA 4NRXA 4N4YB 5J12B 5IVZA 3TN0D 4FCHA 2OA9A 3BAIA 4DGVL 4YSRA 1ODAA 3LKNB 2KBGA 3SHSA 4F15C 5C2BH 5CD5C 2ICWI 4YXHL 3MYJA 4AYFA 2CRZA 1D5IL 1MZZA 3RKDD 3ROLA 1OB1B 1C9SA 1WEJH 1XCWA 2GI7A 3CX5K 3O8XC 1AANA 2WBJC 1E3ZA 1CVRA 3A22A 1NM4A 3NCBB 3MBEC 1ZE3C 2WC7A 2X0VA 3B6SA 1J9CT 1ZHKA 3DJTA 4X9HA 2F8OA 2F7QA 3QXUA 3Q2WA 4HMDA 4XXCC 4M7JL 4LFHG 3H9HA 1DEEA 2G75A 1H8LA 4KRLB 5T1KD 2R1YA 4JANA 3CZLA 4ZUTB 3BCDA 3ZDZB 4PVLA 2WUBL 1XB3A 3WHE1 3AJ7A 3KPLB 5D7EA 3TX4A 4KDTC 3CU1A 4R8WH 5AKRA 2Z4QA 3LEXB 4FXKC 3SOBH 5IOKA 4GBXC 1AACA 2J88L 1U2HA 2X70A 1CR9L 2BNQD 5BRZE 1ITCA 3TP4A 2C7UB 1NZRA 2M2DA 3V6ZA 1TCMA 2HG5B 2K3HA 1KMGA 1RD6A 3GS0A 1A4KA 1SEBA 2KC0A 2E9WA 2C8NA 3EIFA 3TWCL 3PWPB 4IHBA 5HDBE 1ANUA 4ZO9A 4NCC1 4Y1AB 3O81A 2JLPA 1JXKA 3UTTA 1GW0A 2EH7H 3HI6L 1XR9B 4F8NA 1TJIH 4Z7IA 3OKYA 1REIA 4GW4B 1LO0H 1KXVA 4QRPD 4JM2D 3REVB 1HH6B 2YD4A 3FZUD 2OXGB 3ARFD 3DX2A 4FNUA 4OCMC 1KYAA 5FM4A 4AT6B 3GLEA 1HQ4A 1YMHA 1D2OA 1KPRA 2OJ1A 4FQJH 4PJAA 1GZPA 3IDGB 4R2GC 1P9MC 3SSGA 1FBIH 5GJTH 3T1FA 2X6BA 3I6LD 4ICWA 1P4LB 2YK1H 2YC1A 1Z9SB 3WJMB 5HVWA 2XCMC 4XP1L 4B9YA 1CE6A 4KO7A 5DQJB 4C56B 1CFQA 2NR6C 2LAGB 2F0CA 2WZ6A 1QX1A 3ALXA 4OLWH 2EACA 4LSRL 1JP5A 4FLRA 3MUHL 4OFYA 3SGKC 3D3VB 4M62L 3C6LB 3V7AE 1CI5A 1NICA 3RX9A 4JN1L 4C83A 5IUCA 2L04A 3ET9F 3W38A 5EHFA 1CO1A 2QGEA 4GW4A 1F6AA 3QK0A 3DX4A 3PAVA 5D7HA 2ZYSA 3LEYH 1RMFL 4XP4L 12E8L 5CHNB 4N0UB 3CXDH 4X9GA 5C92A 5E56A 3ROOA 1AHWC 1OT1A 3C12A 3WAJA 4HIEA 2HFEA 2YIHA 3E8UL 1P4UA 2E47A 4HPOH 5DUJA 4YFDB 3VI3B 2FVNA 5JIMA 2C26A 1A4KB 4HETA 3UDWC 1KFAH 2J73A 5I73B 1N10A 4HUUB 2ESVA 1KLFA 3CVCA 3ARYA 4HJIA 1P7BA 5JPNC 4YVNA 3GBML 3LZQA 2NYZA 4XXWA 4DN3H 5IK3B 4FI8A 1U3ZA 4NO0B 3KEHA 4IGBB 4L8CA 2OKMA 1IX2A 4YBLB 4W9LC 5D7LE 5I1GL 3ML8A 5GRJH 1G1YA 3GSNA 1YEWA 5HHXL 1QD0A 1UKQA 4EDXA 1PD6A 4R96B 3IJHB 2BHYA 3R4DA 4QAWA 5DT1L 4Q4IA 1EZSA 3ZKXB 4A66A 5B4MD 1WA0X 3HBQA 2JKJA 3T4AA 2ZOUA 4R5VA 4UQDA 4PUBH 4P2YA 1DDHB 3VMNA 2K7QA 4KTEH 4QOKB 5E5RB 1P5UB 5B21A 4EI6A 3A4FA 4P57B 3ZR5A 3PXHA 3V5DA 4YO0A 3R0MA 3RBSA 1E9OB 1UB6B 4U1GC 1YNLH 1BIIB 3QDJD 4WTWA 1CFSB 1G9ML 4GYBA 1XSIA 1R3JB 3CFUA 4WUUB 2J5LB 1Z3RA 3SBRA 1AJ7H 4OZHB 3BH8A 2CUIA 5I1CL 1OCCB 1EDHA 1YN6A 3DVFA 1AXSA 3GS7A 3LMJL 4L8SA 1J9RA 5E99L 1DVSA 3DUUA 4HSCX 5IQLA 1BVKB 3KGUA 2E9IA 2V9RA 4JFUA 5DUPH 2H0EA 1CLOL 1A6AB 4L9LB 5EU4A 1BA9A 1H15B 4JRYE 4B9JA 4ZX5A 2NCEA 4PSPA 1SJHA 3TBTA 1FO0L 3ZZSA 4XXDB 5TJWK 3VWKC 3B7TA 4OF3A 2N4IA 4PRPA 2VM3A 1NJ9A 3I84A 4GLRI 4JFEE 2ZE0A 4M61A 1KN2L 3A0OA 1MWOA 4G6FB 3X2QB 3O8XA 2MHAB 3SO3C 1TPXB 3VSQA 2APVA 1NPNA 2AXWA 2CJ3A 1W0WB 4F37F 1SPDA 4LGPB 3VXSB 1MOEA 1F4WH 2XYBA 3C5ZA 3QCVH 3K4DA 2WYHA 3DX0A 4KKLD 4PJEE 1JZ3A 1S9XB 5JPMA 1JV2A 1AFVL 4YSTA 1CGYA 1JF1A 3BH9B 3II3A 4K5OA 3ZTJH 4GXUM 1I8LA 5DS8B 4ANUA 3GSWA 1DQLH 4YX2L 4LB8A 5FUZH 4FG4A 4GI9A 3I6GB 4HU2A 3Q13A 3KLDA 2X05A 2UXTA 5F88A 4A67A 3VAEA 4O9HH 3SBWC 3TLRA 4ZTEA 4D9LH 1HSBA 5CN2A 3S5ZA 5I16B 1Q90A 2XV2A 4YE4L 3RKDC 1DVFA 1U3NA 4PW3A 3FB8A 3TVMC 3BH8B 1AQ8A 3RUGE 5JORA 1KUMA 4TTDD 1HS6A 1U8MB 1HSAB 3MBWA 1SN5A 2X6MA 3LQMA 5F9WB 4E68A 1ZV2A 2J72A 5GHWL 3U83A 3ZO9A 4YHKL 3STBA 3MHZA 4WY7L 4F8QA 2DTMH 3UYPB 3FDWA 2FH6A 3S8FB 3QI9D 4PAZA 2Q86A 1AMYA 5T1DL 4OY9A 1JHTA 4Q9CA 4AV0A 5KANI 3OXSA 2WN2A 2EIEA 3RJDA 4UAHA 1IFHL 4JEGB 1KTDB 4ZSOE 3UBXG 4CNIB 4LSSL 3B2PA 2Q7NA 2PPEA 5KOVC 1YMMB 5BQ7B 1ZS8B 4L4TA 5H8DA 4PJBF 3CHPA 3LPWA 1JERA 3WJJC 1EAPA 4OGAC 2FEEL 5IHBA 1I8KA 2UXGA 1EEYA 4MZ3A 2MMXA 1XGQB 4QAMB 4BZ1H 4GG8B 3KXFE 4UDTB 1JHKL 1BBDH 2HVJB 2NY1B 3EW3B 1NCTA 1KXTA 2OJZH 4HOXA 1AR1B 3BLPX 4XN2A 4R7NA 4W93A 3OQRA 1MQ8A 5E6RB 3DJRA 2IXQB 3P1VA 5JXAH 2YAOA 3KNBA 1TJHL 4PS3A 4DERA 4AK2A 1YEEH 4AJVA 5K9OB 4M7KL 2P46B 4LARL 5E2TL 2W88A 4H1LB 4ONHA 4Z7AA 1K5NA 3MKGA 1MFBL 1VPOH 5DMGD 2VL4A 2BIMA 2Y9RT 4A7VA 3WNPA 5JO5A 5T33H 3VX0A 1X5ZA 4XN9A 5CIPH 2HYMA 4RGNB 3VGDA 3OAUL 2YBRA 4PJ7E 4PJCB 1KXTB 3FQNB 4HYTB 5C6TH 1H6UA 1MFEL 5IWLC 1T1YB 1TTRA 3T8MA 1Y6NR 2HKAA 2OP4H 3TASA 1OP3H 1U9KA 4G80A 4TUOA 4APQC 1EAPB 1SN2A 2OXGA 3PV7A 4AJ0A 2YFNA 3KLAA 1AHWA 4H26B 5DD3H 3EGDB 1KTCA 5C2BL 4ZMVA 4UUJA 3QXWA 2HMIC 4OFPA 3CK0L 1DO6A 4ODBD 1L0YA 1A1MB 4IK7A 2P47B 4IQHA 5FO8A 3MLPA 3M6DA 3TIDA 2LE9A 3IM1A 3X1EA 1CWVA 1EHNA 3LIUA 5SWZA 5DEGA 5H35B 1JZHA 4D9RE 2J8OA 3U9UA 2EIKB 3FCGA 2WLLB 3WO3B 3HAEA 3A67H 5A2JH 5AZ2L 4Z18A 3LNGA 5JOFA 1CFMA 3E6HA 4YZFE 5IIEA 2IPUK 3RUGA 1DUZB 5HGBA 3PGCB 1EDYA 3M1CA 3CMOH 5B3SB 1QVOB 1KCBA 3F7RA 5DFAA 2DYPD 3ILPA 3JWNH 5I5JA 1JK9A 5LN8A 1URIA 1NGWA 1EIBA 1OARL 1AR1D 4D3CH 1GGYA 2HFEB 4AYID 5AOKA 4KKAD 5JYMA 4H25B 5B3JF 1A1MA 4DW2H 1BYOA 3KHOA 3UTZA 1HEZB 3OWRA 4AVJA 1NFKA 2X4UA 1L6PA 4UZGA 1TG8A 3ARZA 2E8ZA 4OFDA 1U91A 1NAMB 4PY7A 5EWIL 3NJXA 5D1ZC 2R4RH 3MUGA 2WPGA 3CZEA 3HNSL 3JWOC 2XJKA 2DQEL 3HI1B 1H3PL 1DZBA 2Y72A 3ZVVA 5DJYB 4Z0XB 2YRPA 5D2NC 1HESA 5EN2A 1XGPA 3HE6D 2FSDA 2VDLL 4N2EA 4NPKA 1G0YR 1AS7A 1TNNA 2CQVA 1KCVH 3VXNB 1X9RA 3IDMB 3ILDA 4WWPA 1UXMA 3ZDXF 3MRHB 1DBMH 4GG6A 3AM8A 3UACA 1ZIAA 2QVFB 4TTGA 4HFUH 1IEAB 5DHVB 4ZG1A 2Y0SA 3IS0X 4KKLC 1BVLA 4X5WA 3QPQC 2VXVH 2ESVE 3KG5A 3HZKA 1DSWA 4A04A 3HS9A 2R0LH 4MZIA 4LL4A 3MCLH 4R4NC 4UWQB 5ADOL 2Y3AA 1JK9B 1JWUB 4X98B 4XNUL 2ZQKA 3D4GA 1XF3A 2H2PC 4AZ8A 4NQXB 2GJRA 2NY0D 1HHKA 3SDCB 1BBJA 1I7UA 1A9VA 3CGTA 2FWOB 5B3JE 4Q89A 5DLML 1MZYA 3E6HB 1FZMB 3PUCA 5GS3A 1QBAA 4TNWF 5CP7A 4M93B 4M7ZB 2YOAA 4NCC2 4ZJ9A 1K8DB 2WD0A 5EOCH 4HFWA 3O8XB 2J57A 2KS0A 3FCTA 4XPGL 3KEDA 1L5GB 3AS1A 1YEFL 3ELQA 4PJXE 4MDIA 2YXVA 4LDLB 3OKMA 1L7TH 3QFGA 3L4TA 3ULVD 3AS3A 1QTSA 1G7QA 4F92B 3TO4B 5AVTB 5FUOH 2JKWA 4KH9A 3K71B 1H3XA 3FT2B 1HXYB 3VG9B 3GO1H 5I9QB 1BD2A 4LLDB 2AQ2A 1V8HA 3V0EA 4JDZB 4Q6YA 3C6SA 3EBAA 3LS4H 4P5TD 4RFEA 1ROWA 2EXWD 2QTEA 4WUKH 4ONOA 4YC2C 2OMBA 4YDKL 5IQ7H 5IZ7A 1GGCH 4XMUA 1H8SA 4B53A 4HKBA 5F1SA 3EYUH 1IZJA 3FUJA 2NTFB 1FG9C 1PLGH 4O00A 2MQ0A 3L3OB 1UZGA 1I7ZB 3TCLB 2KI6A 4YXKH 3M17B 4I3SL 2PO6D 4A2FA 3RPBA 3FQ1A 4QRPA 2PCFB 4RISL 3RNKA 1JXDA 5JXAL 5KSUB 2B08A 3QQ3B 4OIFA 5AUMB 4K3HA 3ZL4L 1PDKB 3DPBA 4MXVF 4N8CL 3Q3GB 3Q5TA 4X6DE 3HS0A 2YZ8A 4HFWB 5IEKA 4LT7A 4LEXL 2AEIT 2JCWA 2FQGA 4NSKA 1V3JA 4LMQI 3RWHB 5J6HA 1TZHA 3L9BA 3KYKL 3WEAA 4NWTH 2WB1A 4AUUA 2VDML 3D2TA 5JHDB 1WAAF 4QJ4B 3RVVC 4WJ5A 1ZTXE 1UT1A 4URTB 1BQSA 4QRQA 4U1KA 1B3IA 3H4FA 3WFDH 3FH5A 7FABH 4Q4EA 1IJ9A 4JAMB 4DTGL 1BG1A 5E4EC 2CZNA 4W9HC 4XVUC 4JK0D 1B3JA 5F3HB 1D6EB 2Q9OA 1HINH 3FUFA 3EBIA 4H44C 3PWPE 4FULA 3W82A 4Y2DA 4P2RB 1G5AA 1NBZA 3UZEA 3RVTC 1XGTB 4YQXL 3V7MA 2J3SA 4ACTA 4O58L 5C0AB 5I24A 1I1FA 4WHYG 5D1QE 4YXLL 2HT2D 4M03A 3DA0A 4Q9QH 4J27A 4JQVC 1QACA 2G5BA 4K5LA 1RULL 4XOAA 2XJLA 3PP4H 3LNEA 1QRNE 5HGGS 3MFFB 4QF1A 3RZCA 3U2SA 1JFQL 5D1ZA 5D9SA 3U4BL 3CAFA 3Q43A 3U1SH 1I8LC 3GZQA 4KI5E 1GPOL 4UNTA 4Z7WF 4FZEL 4TSCH 1DSFL 4CSPA 3QDHA 2OMYA 3OPUA 4PJAB 2X2HA 3QEQE 1QKZL 1D9KD 3ZE2B 2A9DA 2XN0A 3MRJB 4S1QL 5F72S 3EOAA 4B3VA 4B0MB 4K8RD 1AFVH 3UCRA 5BOJA 4ZFFB 1CK0H 4OZFG 5IFAL 5EV7A 1CTOA 1FIGH 4M5SA 4XMWA 3BUIA 1A6TA 5DTFA 4PBVC 1H19A 3BPCB 2QPDB 3GM8A 3MI6A 4X6FA 4M4PA 4UF7C 3STZB 4G11A 2YUXA 4HIEB 1RZKL 3DRQB 1EZLA 3EYOB 4G72B 1VF5C 2NDGA 2V6HA 5IROA 5J3HC 3TCXA 3IFLL 1SY6H 3EO1B 4H2AA 1FFPA 3IN0A 3RDTD 4ABUA 4Y8AA 4KHTH 3WJLC 2QL1A 2O6DA 5IIEB 1MHHA 1I1FB 3FCSB 4WFHE 4UTAA 1KCVL 4FQXD 5MERA 1SLUA 5C0IB 3WIFB 2ORBH 3LXAA 4LVHB 4NC2B 4S2SB 5I8EA 3N1QC 1JTPA 5KVFE 4P46A 1HILB 1NMAL 1Y0LA 2W81C 2F7OA 1NM9A 2Q6WB 5C08D 3D39B 4QYAA 1KGUA 2EVHA 2WWNA 3QGVA 1OAKL 4MX7B 4JFSA 4N2HA 5ID0B 2E59A 4XN5A 3C5ZD 1S9WA 3JXAA 1X44A 2P8LA 3QDME 3ATDA 4LF3B 4YSDA 2FATL 3ZYIA 3RGVC 3OR6B 1UKTA 2IF7A 4NAMA 3EXLA 1KB5H 3LXUX 2B5IC 2X4QB 3N06B 2NNAA 3QA3A 4DGYH 5LBGA 3PCYA 4FJ6A 3C6EA 4JJOA 4CU8A 2YR3A 3PUUA 3NJVA 3JTBA 5LCVA 1JGEB 3V95A 2DJ4A 1N4XL 4YSCA 3SYQA 1T04B 4R26L 2WKOA 3QSKB 4HJSA 1GHFH 3H3PH 4AZUA 1U8KA 3QEHA 1U6AH 5EBGA 1A6TB 1R34A 2A0LC 2KLTA 2V3DA 3GBNL 1JHLL 3I50H 4KBPA 4OV6F 4OZ4B 4R96A 5ELIA 5EU5B 3QE5A 1HQ4B 1YMHB 2AJZB 2ZAIA 4YIQB 3OJMB 2UVFA 3ZY7A 1KXQE 5I6MA 3N40F 1ZIBA 4JY6A 3SQOH 1NGXA 4PGBA 4PJGE 2E5EA 3D0VB 4CVWA 1UM5L 3UTTB 2GK2A 3JT2A 5J6SA 2JLLA 2GVYA 2F74A 3G04B 1CVSC 3O41A 4L4VE 4WTXA 3SDYL 5JW4N 2IOMA 3GSOA 1KJMA 2FX9L 3AXLB 5EEXA 4HJJH 4HWEL 5DD1H 4MCNA 3LEYL 4OQTH 4JQIH 1FORL 1IB5A 2OSWA 3KLHD 2YA0A 3LPOA 3BDBA 5DRZA 1GAFH 2WVVB 1NLBL 3DK2A 2ZPKH 4PV9A 4P5TC 3OVUB 5C70A 2D31B 1U8QB 2R4SL 3QULA 1EJ8A 1KJVB 2HJFA 3KVQA 4PLJD 4XHJD 1CCZA 5E1AA 4NM4H 2NW3A 3NZUA 3QFJE 3TVMA 4N5ED 4AQAB 4G43B 4PBXA 5EOQL 3E1F1 4X2UA 3S35X 3HHMA 3C60A 3BVXA 2A83A 2NY6B 3FOLB 1JNNH 3HR5A 5IHZA 3ZT6A 2Q2LA 2XQYG 3T6ZA 1WGVA 2J25A 5GGRB 3QNFA 4B3EA 5F9OL 4IS6B 1OIOA 2D7TH 4ELKB 3VXMB 1C12A 1HOCA 1A1OA 1CF8H 4IRJA 3U36A 2XA3A 3Q8CA 3U46A 1O9WA 2OR7A 1DANT 1KPRB 3KGRA 5IBLC 2NCMA 1HX0A 4YN3A 1U8JA 1JPEA 2BSRB 3ZQXA 1IVLA 1HSAA 2G3XA 4CSTA 4Y16B 4PRBB 3T08A 5JORB 3HHSB 3FFCD 2VAAB 3EF4A 1A4JA 2W0FB 3MJWA 4NQED 2VMEA 4N68A 1XMWA 4IHOA 2ICWB 3C60B 3FOLA 3V55A 1G9NC 8PAZA 1OW0A 2JB6B 3NZ8B 1PKOA 2AK1H 2IOOA 4LCCB 3OSVA 3SPGA 1ED3A 4K2UL 2DLGA 1TLKA 1YY8B 3V4VH 3CUPB 3HE7B 1OGSA 3QWQB 2PO6A 3N1MC 2Z1KA 5B39B 3K2KA 5FHBH 3PP3H 4ATTA 4E0RB 4Z3HA 4QRPB 4U3CA 4XR8C 1SUJA 4AGNA 4QJ5B 3N1FC 2DWSA 1I85A 1MVYA 3RVUC 3ML9A 1COBA 2FJSA 2GG1A 3GSQB 3LN5A 3RVTD 4ZODA 2FX8H 3M8OL 2F15A 2V5SA 5K1NA 5E6IC 3CH8A 4DN4H 1OV8A 4PP1D 3AGWA 3F2LA 3ZHLA 3EJYD 2Z9TA 3FQYA 5IJKA 5DJ2A 2Y7LA 5E1HB 3UAJD 3TBWB 4EIBA 4TVPD 1Q9KB 3L3JB 3MOBL 1RZJL 3CE1A 4U3HA 3OMZA 2CBPA 2Q0ZX 1S7XB 3GMRA 1NUFA 4XBPB 4XI5C 5F0LB 5A2FA 3CBKB 1A6PA 3F58H 4HOWA 3RI5K 4DEPC 4LLYA 4UV7H 3RPIA 2BSTA 3SZ6A 4YE4H 2W0FA 1T6BX 1A4CA 3EGDA 3E2HB 4Q6KA 3HBPA 5AW6B 4LRNL 5AVWB 5JIPA 1K8IA 2V17L 4F7MB 1FNGB 4M43H 1L9RA 3M88A 5HGAA 4KRNA 3GBNH 4NQCB 1OTTD 1ZDQA 5D2LB 2CDEB 1H6TA 4KI5D 1ETJA 3HAEB 3H9SB 2W9EL 5ICZA 1CIDA 1MRDL 4LBEA 5CEXA 3FQTA 2L4OA 1MCOL 5TGBB 3RWEB 3EO0B 2BIPA 3EFFA 2UX6A 4I9XA 3H2PA 3S0PA 5IQ7L 3HE6A 3SJVA 4AQEB 1FN4B 3UPRA 2O5NA 1DZ0A 1X5FA 1IM3D 1R75A 1X7SA 3UAAA 1U36A 2DY2A 5INDA 2R9HD 3WXWH 3D69A 5LUMA 5JDSA 3TO4D 4UT7H 1Z5YD 3CUPA 5B7MA 1WAPA 1N6VA 43C9A 5AFAA 5FECA 1AXIB 4P2RD 4HCRA 5T5FH 2PW2A 4KKQA 5LAXB 2WO3B 5J57B 1TKWA 4RWYH 2HTKD 2NUPB 4X6DA 5T1KB 4ANWA 4MA3A 5EF2A 4EUPG 1B4JH 3NESA 2W5PA 2BVQB 3QUZD 5DD6B 3W39A 1VKXA 2J5LC 4L1LA 5BPPA 2VDQB 4HF5L 1TQVA 4W9KC 4ODVL 3TV3H 2YD8A 4CADA 2MOGA 3NACL 4CN1A 3C08L 2J8UE 3MX0A 4KKPA 4FFVC 4GRLD 4JG0L 3Q1EA 3LVTA 1NUGA 3GI8H 4FF9A 1KTDA 2JIXB 3N50A 4HS6A 4P23B 2MNJB 3A3YB 4JL2A 4FQPA 2ZUVA 4Y2NA 2QHRH 4KK9C 2DMCA 2GJ6E 5TGBA 3NIFB 5LNDA 2AV1A 3TEWA 2WKOF 1LDPH 1WBZB 2ZXWB 1OEZW 4MXWH 5LWYL 5KJ7E 4PJEA 3DNKA 3GI9H 4DP8X 5J8OA 2QR0B 1HHIB 4NUGH 1OM3H 1J9TA 5TTRA 4GG8A 4X42A 1HCFX 2AFNA 3QAZB 2ZOOA 5DRXA 2BM3A 2V17H 5E9DB 4KRPB 2VGLM 3BZFA 3GJFH 3HRPA 1GKOA 1UVQA 3NPSB 2A9CA 4FP8H 4NUQA 4X6CA 1BD2D 3I9GL 1J1XH 3FUKA 3AY2A 3D0AA 2YOCA 4XH2B 5CGTA 4Y8DC 1PX4A 4ENED 1SBBA 3E8UH 3KBFA 4JDTH 4X8CA 4FTVB 3KPNB 4EZLA 5KSAC 1SN0A 1KB3A 1B2YA 1PMYA 3ASNB 3N9GL 5F44A 4C4KT 1BWMA 3E38A 4RFOL 4UTCA 4LNVA 1JGUH 4NRYB 2AJZA 4NO5A 3RL2B 1BREA 2ODHA 4J3OC 4JFOA 1J87A 1PX3A 2GFBB 3LKOB 1NGYA 1FH5H 3L6FA 2EDNA 4O4YH 1LP9B 4F9PC 2X6VA 4IRSB 4X6DF 5C0AE 4D0CA 3DTUB 4R7NB 1WFTA 1NUDA 1T1YA 4JL1A 4K94L 2VLJB 3ECBB 3S34L 3MRNA 1MRDH 5FYKD 1DFBL 4XH2A 1I4FA 5I0YA 1CGUA 3BAXA 3BAYA 3SJVE 3TFBA 1BJMA 3PLYA 3V10A 4NQDB 5J56B 3R1GL 4LLVB 3ZKMD 1UASA 4B9PA 2QV2A 3B7RL 2EINB 3ARDC 4LVOB 5L4FA 2WXNA 1PIFA 3RHWF 3ESUF 1ZMYA 4HH8A 1FNEA 1IC0A 1XCXA 4XPHL 1OANA 3GHBH 4ICXA 1YJDH 2P48B 1J5HA 1D5BA 5DHXB 3DJSA 4JFTA 1WCQA 4XNMB 5H4ZA 3DBSA 2VN5A 2OX5B 3HI6H 3D2UA 5DF0A 5I6XC 5E0FA 1JZFA 1UM6H 4WEUD 1MRFH 4WTZA 4D7PA 3OGCB 3ARFC 1TO4A 3MJ8A 4GRMA 3WS6C 4AM0Q 3NJLA 5AB1A 3FU3A 3FAWA 4FI7A 3VXTB 3S36X 4JFDA 4JRXE 4YHPA 1U33A 2WWOA 1ZGLB 5GS2H 1S9YB 1UCTA 3Q6FA 1S8DB 1I82A 3OKEB 4UT9H 5HHOB 3HN5A 4EJ1C 2ZZUT 3L3GA 5JHMA 3UTZB 4QXUH 3QQ9D 3FTGA 3BUYB 4JLRA 1NEZG 4M7JH 4IHOB 1EJFA 2OL3L 4HHGA 5I6NA 3MGTB 1JI1A 1NBVL 3MBEB 4JFFB 3B56A 4WI4A 3MLRL 4O02H 2RALA 2DQFA 4L29A 4OU3A 5H2BB 4HDIA 4F7TB 1MFBH 1VPOL 1L3NA 4JM2F 2JI2A 3CMGA 4ONGH 3HUJE 1OP3K 3EGSA 5D7IF 4OZIA 2B39A 4N2LA 1L7TL 3V4VL 3PNWA 4OLUH 4PPTA 4YEFA 4J8RA 5D72L 3B7UX 4HOMA 1MCBA 4IU2B 3PGFH 3FULA 2NY6C 3ZTCC 4HQQH 3IN2A 1ZOXA 3L45A 5D7IE 4HU8A 1NAKH 2G4EA 2AJVL 2YAPA 2D0HA 5IMLA 3NCJH 4WK0B 4UQEA 5EU6A 2VDMB 3LZOA 2XUWA 1ZAGA 3L4YA 4NZUH 1IC4L 1HJCA 5HYQB 2IWGA 5CILL 3T0WA 2CIKB 2EDQA 4GO9A 5FM5O 3RQ3A 3JWOH 4BGLA 4X9IA 4EIGB 5B38G 2YD5A 4YEEA 5KSBE 4U6TA 2ZX8A 5B4MC 1AGDB 4L2LA 3CIAA 1N3NB 2O6FA 3L7EA 4MQ7B 2QMKA 2ZUTA 1C08A 5HI5C 2VZ1A 4P46D 3ZN6A 2R9HC 4MB4A 4IBTA 4UI2A 1GOGA 2KZBA 2X4PB 5AYUL 1T7ZA 3VFMB 4O2EB 4NQEE 3PS6A 1URLA 1QEWB 4HMEA 1RJCA 2ZUWA 4PMFA 5E2UH 5C0JB 1RL1A 5L8KB 2OMXB 4ORGA 3G5XA 2JB5L 3GXMA 1BECA 1L0QA 3PDGA 4BRVA 2I7SA 1A9BB 1KJ3L 3NFSL 4JVWA 4LSVH 3ZDZF 1I3UA 1KBKA 1EWHA 3R06B 1DSYA 2BJML 3KHQA 5L7XH 1U2YA 4HXAH 2X3BA 1LK3H 2KDGA 3TYFB 4CVZB 2CRMA 3HZVA 1F42A 4ZZKA 2PCFA 3K2IA 5GRVL 2QLYA 2ZWNA 3N3EA 3SDDA 4QRRA 4YFLI 3ULSA 3DSFL 4KVCH 2PKDA 4B95C 1JYXA 5DVLA 2B15A 4XNXH 5D7LA 4BK4A 2BP5M 1HI6B 2OMXA 3VWJA 5IB3B 3LJ3A 4KKCD 3MBXL 4E5XG 1H5BC 4FXGA 1AAJA 3EYFA 4PS7A 2B3RA 2IWEA 3NYKA 1JVKA 4HUMB 3QDGD 4LLMB 1F3RB 1FZOB 4XMKL 1E6OL 3MU3A 1G1KA 5BRPA 2RMNA 3LPGA 2H8PA 4R7LA 1HILA 1MN4A 5D7IA 1G1CA 3WNMA 1T80A 4JR9H 4Z7NF 2XG5B 4Y19A 4FQXB 4NKQB 1DTUA 3ARDB 4LVOC 3DOHA 2R2HA 3V6FB 1U8PB 1IGTB 1O9ZA 1SM3L 5KW9L 1KWGA 3HVNA 3C08H 2R1XB 4LF3A 5HYQA 2WSDA 1OAKH 1QKZH 1J10A 5C0EA 4BHUI 4B9IA 5L2KA 1T6WA 5E1GA 3TVMD 3QRGH 4MHHI 4KO5A 5ID0A 5IOPB 4JKLA 1SLXA 4Q6IC 2UZYB 5ISZE 5E99H 1GIGL 4OCXH 2E27H 2EZ0C 3WJMA 3HPJB 2XQ0A 1W72B 4MS8D 1WBXA 1ZHBB 5I26A 1GCFA 2F53B 4UT6A 1XXDC 5EA0H 1X5LA 2CBTA 4C4UA 1A0QH 3O3DA 4AX3A 1ET5A 4YHZH 2BVUA 4ZXBC 1OGTA 2OP4L 1F18A 2PYFA 1CICC 1IKFH 3DRTA 1U58A 2G30A 3LZRA 1RSYA 5AVRB 3P0YH 4H13C 1CXIA 1PJWA 3WXWL 2D7PA 4ATWA 3DIFB 3LIZL 4XB8A 4B50A 4LEBA 5HJDA 4EO5A 1T22B 2WWMD 3K4ZA 3UH8A 5KVFL 1AQKH 5D71L 4R3SB 1UYWL 3PDOB 4OLXH 4Q52A 2R2EA 4TSBH 4A6YH 1WH0A 2MOVA 4IU3B 3H42H 1GZQB 3SYAA 3D30A 5HGBB 4WW2C 1WT5C 1CPUA 3ARXA 2KQNA 4M9OA 5TDOA 4DZBA 4BKSC 5BNXD 4M1GL 1CG9A 1UZ8B 5BCAA 2OMVA 4Y19B 3B5GA 1AQHA 3FRPG 1G7JB 1GJIA 5F93C 3BVNA 2VXUH 3P11L 4WVRA 3S96A 3NH7L 2ICCA 3ZT5A 1IC7H 1OGPA 3P30H 3ZL1A 3K6NA 4R90H 4RMQA 1WFOA 1NWPA 3WEMA 4I4WA 5GQBA 5IR1B 5BV7B 1B4RA 4APXA 2ZCHH 1ZRUA 4NUPA 3EKCA 4O5LH 3ZL4H 4JPIA 4X7SL 3SZKC 3MA7A 4HLEA 1FE8L 2G0LA 4NFDA 1SZNA 1X7QB 3RWIB 1P4IH 3VXME 1VERA 3H3KA 3QQ9C 5B1CA 2KZKA 3U1QA 3O4LD 5B3NA 5MEOB 2A9NL 4MJ6B 5ECJE 3Q1SL 3RY4A 5MEQB 3ARQA 2A77L 3FBQA 1DBAH 3DO7A 3C2SA 1SF5A 3CSGA 3POHA 3CFKA 1S46A 3QEQD 4PREA 4S1RH 4TQHA 4Y4KB 3VUAA 4I1RA 5TF1L 1A3RH 1ZLWK 1OP5K 1V7ML 2AKRB 3L3KB 2QZQA 5C0CA 3PWPA 2KLSA 3L3HB 1VGEH 2ISDA 2VDPL 3IMWA 1EZUA 5FGCE 5KSBA 1DJZA 4YPGA 3S2AA 1E8ZA 2W60B 3O0LA 3MLXL 3CVHL 2UUDK 4G5AA 4GKZB 3UEZA 2Z8SA 4WJG3 4U1HB 2YPVL 5E95B 1RVFL 4LEXH 3LEXA 2EDMA 2CKNA 4OCSH 1OSYA 5IB2A 5LGKA 2LHAA 5FUCE 3VFWB 2YAQA 3UMTA 1S7SA 4YFEA 3U6RB 4GAYB 2BIQA 1A14H 4O9HL 4Z7UF 5C9KA 1U8NB 1CFBA 4HS3B 4BYHA 1N0LA 3PL6A 4TNVK 3TWCH 3CN3A 2X4QA 1A25A 4JY5H 1A6WH 2JKIS 5KANG 2CMRL 3OR6A 4LHJB 2J21A 1KYDA 2A6JB 3O2DA 5IMKA 1FAKT 5ADPL 2HSIA 2J88H 4FG2A 1WA2X 3U1PA 2ENQA 2BSSA 2NTFA 3FRUB 5DJ0B 4QDGA 4H8HA 1EDQA 2FQDA 3CSPA 5J6GA 4CGUB 5D5MB 2Y5EA 4PJ7A 5I75B 2GIYA 5GS0H 3EOTL 3BD4A 2A5UA 3HB3D 4YHOH 3RNKB 3O3BA 2VDOB 5A2BA 1OTSC 4KZEL 4D0BA 5AEAA 1TU2A 3MRQA 1THCA 3QZLA 4LCWE 1QBLH 1JDAA 2QPEB 1WG3A 3VI4E 1BP3B 1QO3A 3MA7B 2DJSA 1IBFA 3BPOC 4JGJA 4HCIA 4PCTA 3EYQD 3HE6C 2ZT9C 3OJVC 1DEDA 1HH9B 1S7UB 3IDNB 4WW2F 1Y1DA 1JXFA 1PU0A 3AABA 1Z9MA 4JB9L 4JZJC 4WI5A 5DJ0A 4AEIH 4GRWF 4TSAH 1YNTF 2VWEC 2EXTA 4HJTA 5JYLA 5CFHA 1G0DA 3KBPA 3DC0A 1QSZA 2UZIH 5C09E 1A47A 1NANH 3QULB 15C8H 5E1AB 3NZHH 3BPLB 3MV01 2QLVB 2Z7WA 3KVPA 5C0FB 2EO9A 2YRBA 3VW3L 3ZTEA 3VWJC 5D7JA 4YDJB 4ZPVA 4A2GA 4L4TB 3BP7B 3QJZA 5EBMA 4OF6A 4NXSA 4F57L 2QADD 1CLZL 2VSDA 3P9LB 4E9TA 4EF3A 3CSTA 3FQXB 2LV4A 1A5FH 1NDMB 3I50L 3CLFL 1JPGA 4M8UA 1X5HA 1E5AA 4PJDF 1W72H 1OSZB 2XG4A 2NY0C 4NJAL 2FLMA 3D18A 3H0TA 2XT1B 1ID5I 2FQEA 3WO4C 3QUGA 4DQOH 4LBEB 3NIDE 3HEIB 4LGSB 3SOTA 4RAUA 3HC0A 3MV7D 3FXIC 4RLDA 2QGCA 4F9LC 2OTUB 3LN4B 2A38A 5AOMA 2DRUA 1OPGL 1K72A 3G6DL 3FHQA 4JDEB 4M5ZH 5EULV 3VXUD 2Z35A 2OQJB 2DQHH 2VXTL 2OW7A 3QDGA 4ETYA 1LL1A 4HPYH 4AY0A 1E40A 2NZ1A 4IRZH 1UQSB 4C56D 3FT9A 4HW6A 4AGOA 4ZXBD 4NDMB 1I85C 3VGFA 3L2MA 4B5ZA 1RXLA 5C0GA 4B9ZA 3BEWA 3I6GA 4XP4H 3QW9A 1KPUA 5C2UB 3FMGH 5C09A 5KG9A 4NUJA 3CNKA 4JFED 4JFDE 3MV8D 3NVQA 1ZT1B 4BUQA 5HJ3A 1J0IA 3UEQA 5CBAA 3PV6A 1UH3A 2V7HA 5HHNB 4CRPA 5I2IB 2EIDA 4BCYA 3WLBA 1TITA 2CAKA 2GTWA 2FJGA 3GSNH 3NEEA 2EIJB 4PR5B 3SO3B 3W2DL 1FCCA 4NP4H 1L9NA 4Y5XC 5T33L 5C0IA 4BD4A 1H3WM 1RIVL 3GXIA 3IDXH 4JRXD 3OB8A 4PJXF 1ZE3H 3RUGB 1NCAH 2VYRE 2ZWSA 3A67L 1D5XB 1OQOA 1S7QA 1HKLL 1BVNP 5B38A 4CMHB 1Y7VA 5E8PA 3BP4B 3RIKA 1BQLL 5D7JB 4JY5L 4Y9FA 2WYTA 5IMMA 3MXWH 5B8CC 4P4KB 1CDYA 1NGWB 1RIHL 4P3WA 1T22A 1DQQB 1MCIA 1MI5E 3QWOB 5TE6L 4QXGL 2XA8L 5E4IA 3RVVD 4PJ8A 2CKBB 5A6IA 2EILB 1NKGA 2FX7H 3EZ8A 4Y9CA 3T2PA 3KPRE 3QO0A 1C5CH 5DMIL 1Y6MR 4Q2ZA 4Z7QF 4ANVA 1QNIA 2NX5A 3FFDB 4OF7A 2EVFA 4N2BA 4L5FL 4RAUB 3L4XA 1JSYA 3K6OA 2BOCA 5E51A 5C6TL 4F9PA 1KLUB 3BAJA 4P05A 4OJYA 1NIFA 5B1JC 1DQDH 1V3KA 1WWCA 2OLDA 4R7VA 1JGDB 2D03L 4MCZA 4WSJA 1SBSL 2PMZA 1MCHA 1KJ2H 2YC1B 1TQCC 3N0AA 3ECQA 2HT2C 2J6WA 4I2XE 1JVOA 1OSEA 2ZWYA 4S10A 4PY8J 2WINA 2GSIB 3IMVA 2YQ2A 1ACYL 1HHKB 2OS7A 2YA1A 3TTYA 1SYSB 3GJEA 4JG1H 1VZHA 4XVJH 3V52L 2H1PH 3NRFA 5BZDB 3BVVA 4LLVA 3TT1H 3V6OA 5IHWA 5AW9B 3N42B 4G7RB 1HVXA 1T2XA 4AE1A 1IEBB 3GINA 3LB6C 5K93A 1BF5A 2FH8A 4ZYKA 1Q1PA 1H6FA 4MCYB 4FQHA 2IWKA 4IRJC 2GBUA 2ZTBA 3NDYE 4N2NA 4WEBL 1GOFA 5T1LA 4HK3N 1N2RA 5L9DH 3NP3A 3DYMA 2HKHL 2MQGA 4BJLA 2IG2L 3KAAA 2CUHA 4PGBB 2A6KA 2YS4A 2XWDA 1AKJB 1JF5A 1H6EA 3LOWA 4FAAB 5I75C 2EVIA 1XF1A 4JFFA 4DP7X 2W60A 2F1AA 1UENA 2FD6H 2IXQA 1YPZE 4JUTA 4LSSH 3VVVA 1CXLA 3D9AH 4HKZA 2H45A 3T1WA 1E67A 2WXMA 5E2JA 3MV11 3HB3C 2ED9A 3Q8EA 4Z76A 3S34H 2F53D 4FQCH 1IGML 1BZ7A 3D08A 3DV4A 2ZKWA 1XTLA 1QHOA 2DEXX 1UJ3C 1LEIA 1Z9PA 3QZNA 1EFXD 4Z7VF 2DYPB 3O6MH 2Y7MA 1KZQA 1B4TA 3S9DB 2V4LA 3Q2CA 4JJ5B 3LNFA 3LIZH 2YUVA 1KJVA 2HJFB 3ARBC 3RB5A 4L0ZA 5IW1A 1IGYB 2ZCZA 4U3XA 2R2CA 2IDUA 1QEXA 1D7DA 1PY0A 1EVTC 2QELA 3SBQA 1RU9L 1RUQL 2X88A 4OLEA 4FLOA 3A6BH 1A7QL 1WBZA 3KGTA 1S9VB 2DM7A 4FKEA 4YHIB 2F19H 1KTKE 1YEJL 4M8QB 1LO5A 3BP6B 3FU8A 2OYPA 4PJ9D 4OD1H 3K72A 4K07A 3IMSA 3IGUA 4WWKD 2XNAA 1Q0YH 3IWUA 1PG7W 3C2AH 4DF9A 2CH8A 2QSCL 4JJ5A 4H8WL 5IW1B 3SPJA 1LTXA 2GUOB 4N25A 2RD0A 4NKMB 4PJ7F 5EORL 1E5CA 1FNAA 3HJEA 2XPGA 4XMLL 5C0JA 2VDOH 5H35A 5E6YA 1YYMH 2AJUH 3PWJA 1OKEA 1JZ5A 4AKQA 4FQLL 5CKGA 5M95B 1RUAL 2G2RB 2KZWA 3DVGB 2XC8A 1AO7D 5GJSL 2VRQA 3GQFA 3NCYP 2YQBA 1AS8A 1RZ7L 2I5YH 3MREA 4QJ3B 1ZVSA 4A55A 4Y4FD 1ADWA 5BVJA 2EEDA 5AKVA 3K8MA 4AVKA 2WVSA 4URKA 4JFOB 2LW3A 3KPQA 3L8QA 5D7JD 3HG3A 4XHQA 1UA3A 4JHBA 4MJ5B 5KYXA 3HI5L 2QBWA 1KYFA 3F7YB 4S0SD 4ZMAT 3ZTDC 2WIIB 3LMJH 4EN3B 5T5FA 1AXTL 1PAMA 2DWEB 2BMKB 5DS2A 3WKPA 1I4FB 3MJ9A 4FXGB 2YWYA 5CZKA 3CPUA 2Y2TA 5GISH 4Y9EA 1MCPL 5FOJA 2V7NA 3IDUA 4O2FB 2YGVA 1R3KB 4KJQD 2NY2B 2BNUA 3G9AB 2ZUQB 5HHVH 3WKML 4I9WD 2B9BA 3ORJA 3WTTA 1E28A 4PG9A 5IFJA 1E4KA 1M2VB 1I1AC 1V3LA 3RA7H 5DI8A 1DDHA 5FR3A 2ENJA 4ODXA 1QPXA 1GH7A 3LQAH 4L9LC 3DXAE 5GZNA 1KLFB 3Q6GH 1QUNB 4PRHA 4X8JA 4XCNB 2FR4B 5FYJH 4Z5RA 3ZTNH 5FYLL 5KUKA 2Y3NA 4POYA 1ZGLM 4FL4C 2DBLL 3FO2A 5CWSA 4M6OL 4P4KC 3UOAB 3FN3A 4WFFD 4PWGA 3MV8A 1OB1A 1BAFH 4J8RB 1W8EA 5TF0A 1S9YA 2IG2H 4NM8L 4LHUD 3EFDL 1NMBH 2NXYC 4P48A 4LP4A 2IBGA 1HC1A 3KPQB 3O2VL 2F58H 2ITDA 2F8VA 4WRLA 4X9BA 4AIZA 3BKJH 3CBRA 4ABQA 3MNZA 4HH9A 3FFCE 2JKRM 1MDTA 1MJUH 3GMQB 3UTSD 5DO2D 5HI3D 5FM8A 1E4XL 1IILE 2M1KA 2BP3A 5D5ME 2NY1C 4X0KB 3N40P 1JYVA 3GYRA 3EXJA 1BZ9A 3QUXB 2D3NA 3MOBH 4GFXA 3A6CL 4JKMA 1M6OA 4MZ2A 2KQMA 2VLKB 5JXEA 3L2NA 3LCYA 3ARFB 3QYNA 4KY1H 5FO7B 2N7AA 5AZEH 3ZUNC 1J48A 3L3DA 3M17A 2DD8H 4PP1C 1KCUL 3BFWA 1NBVH 1BM7A 5ICYB 1NCHA 4D9RD 1F0LA 3D39A 2PCPB 3U4AA 5A2CA 5DEFB 2OSYA 4UAOC 2FO1A 2BY3A 2H1XA 2L0DA 3QWOA 3TC9A 4L1DA 5IF0A 5KYWB 1YUKB 2A4EA 2NTSP 3HG1D 3QUMH 4ZFZA 3VD9A 1DP0A 2J6EL 4RGNC 2B0SL 5DMIH 2JCCB 3PWNB 4LDCA 3EUDA 3D0LB 1JG9A 3BHBA 4OZHF 5DUBA 4G42A 1MW3A 3UAFA 1ADQL 3O3EB 1BLIA 2B59B 3CQPA 2D9QB 1TJHH 2PXYC 3HG1E 5EZIH 1MWAL 3GSUA 2JJTA 3PP3K 1AP2B 4LBAA 3JTTA 5D8JH 4XPFH 1MRFL 2O5XH 3F5WA 3DX8B 5D1XA 3QZPA 1KOAA 3IMRA 5F7MC 4WV1C 1G7JA 3LRKA 1MLCA 3UZQB 1IQWL 5LNGA 3O4OC 1NFIB 4CAGA 2ZNWA 2YPVH 1YC8A 1JJUA 2D7MA 3PAYA 3QCTH 8CGTA 1TEFA 2B0SH 3MJ9L 5I66A 3ISWA 4FGMA 4OZGF 1AKJD 1XZWA 3ROLB 4W4OA 4X0KA 3HNTL 1TOXA 3CX2A 3GMOB 1RFDL 4G6AD 5CMAA 1IM3B 1IC5L 3GXFA 3LZPA 3QFDB 3WUWA 4KKBC 3VI3A 1ORQB 1OE1A 4GKOA 3G9VA 3L5HA 5DCCA 3Q6GL 4LCCC 5EIQA 3CH1A 3WFCH 1A6UH 3BAEL 1Q72H 2A74C 4Q0XH 3AADB 4O4YL 1Y1UA 4OUUB 3FTZA 3P4MA 4JFEB 1CD1B 4MJIA 4OAWB 4PJDB 5CR1A 5I8CB 2X53A 4AXWA 1M3JA 5BUGA 5C3LD 1UOWA 3BZ5A 3SCMD 3HN3A 5CD3A 3T0ED 3TT3L 2CG9X 3DV6A 1FE8H 3SPVB 2F53A 4O5LL 4WFFE 1TJGL 3BVTA 1GKEA 1VZIA 2NY3D 3CFQA 1MCEA 1MG2C 4GKSB 2H5UA 3FQTB 1NC4A 2A4ZA 3DV4B 1J1OL 1V55B 3NSXA 5CSZA 3O6FB 3QVAA 1UH2A 3GMLA 4G9DB 4NC1C 1IBZA 1BFOB 3NK4A 3SIKA 2E7HA 5L88L 1N8ZA 4R0LC 3U7YL 3IFNH 4QXWA 3KMDA 1QSEA 2CCVA 1JS4A 3MV7A 5SX4I 3O6FC 4NXKA 3VGGA 4D0BB 4WJKB 4PGEA 1TMQA 1JIBA 3FU7B 3E1ZA 1HHGB 1EAOA 3FKUS 3CSFA 4E9VA 1FG2B 4Y4FC 1RJYA 5F2FA 4L3EA 2GHZA 1IC1A 2ICEA 1NFDB 1TZGH 4IKIA 4TL5A 3IRZA 2GIMA 1N68A 4UV4H 1KC5L 3GUTA 3QFDA 2WQVA 1RJZA 4BUGA 5AKSA 4IGBC 2R2BA 2X6AA 1WVZA 2LFEA 5FKPB 3KW8A 4LSUH 3F12B 2K0RA 1NGQH 4GQ9L 1DO5A 3EYOA 3ABGA 1KFGA 3MRQB 3WN5A 3U9UB 4OI7A 3GIZH 3QORA 1O7VA 4OQ1A 4AMKH 1VCBC 3FFOA 2G2RA 1ES0A 1AXTH 1NC4B 3BCFA 1E4HA 2NXZB 4NZ8A 4Q9RH 2IFFH 1NPUA 1U92B 1QA9B 4ETQA 1USQA 3OXRB 1ZA6B 1KIUB 4G8IA 4JO1H 4I3RL 1EXGA 3WMPA 1YNLL 1DBBH 1GGTA 3NIDB 2ZOWA 2ZOLB 3TBWA 1D5RA 5KG9B 3VFMA 4C54A 4AEEA 4ODTH 2GY5A 1Q94A 3QCUH 3ZE1B 5IM7A 1CDHA 2EDJA 4J1UA 3ZKNC 1UM4H 4YBQD 4U1SA 1TZGL 1H8OA 1YYML 2AJUL 1ZT4B 2X5PA 2CHWA 2OFQA 3K2MC 3AITA 2F74B 3G04A 4Y5XB 3TJPA 3KR3L 4TNWK 3QIWD 3QJFB 4MAYA 1J05B 4HT1H 4B0MM 3MLTB 3E6FA 3RWIA 3MBXH 2AJXL 3PL6C 1KY6A 3CZGA 1A6VL 2G3MA 4XNXL 3QUMA 4XB7A 3CFDA 4P4RB 4G59C 1YEIL 4ZDHB 8FABA 4NKIH 1MNNA 4OD1L 1KCSH 4WW2B 4PJ7B 3BE1L 4X6CE 4V33A 3BN9D 2UYLA 5D2LE 3GHEH 4HPOL 3RL1B 1NC2B 2NW2B 3AY4C 3OMNB 3L81A 2L7UA 4EN3D 1U8QA 3VWKB 4NZDA 4NQCD 1MHCA 1WFUA 5PAZA 1RP8A 1JK8B 1N19A 4BINA 4ZTPH 4I77L 4Z1PA 43C9B 2R7EB 3JV5A 4GBXB 1U3HB 3C60C 3EYSL 4PJ5D 2G9HA 3NEOA 3V0GA 1IMHC 3MCKB 5BRZB 4BKLB 1ZSHA 4GAYA 4ELKA 4OBRA 2LT9A 3UTSA 2MHAA 4W1TA 3IXAA 3HPLB 4GFTB 4MMXA 4RGND 4UMGA 2FYYB 3FTVA 4F7CA 3PWVA 4MYWB 4P06A 4XOCA 1RHFA 3QIUD 1QYGL 4FMVA 2E6JA 4H5SB 3MRPB 4NHUA 1D7BA 1K5NB 2X1QA 5J06A 1KPVB 3SDCD 1DJGA 4RZKA 4NB7A 2VLKA 1H15A 3FUNA 4U6VH 3ULAB 1BQKA 5DC4B 1AZBA 2Y2WA 1LWHA 1JGIA 3H0TB 3ULUH 2R0ZL 3P30L 2PN5A 1UB5B 2DKUA 4LPCA 3WBDA 3ZU8A 5DC9B 5D8JL 4FJZA 3BPCA 3CPLB 4MNQD 4YL4A 2XZQL 5J3HD 3C5XA 4JG1L 1BGXH 3GIVB 2BOCB 5EZIL 4V1DD 2JV6A 3P40A 4HS8H 4G6AC 3DMMB 5D2LF 3U6XS 5IFHH 5JLZA 1A6VH 3GSWB 2EEFA 3CFMA 3IE9A 5CJQL 3P2DA 4PJXA 2CKBL 4TQEL 5EU7C 5I73C 2IWFA 1SXAA 2IPUG 4X9YA 4KDTA 5I1EL 2XX1A 2VL5B 4OLXL 3WIHA 4Y1AA 4D9QE 5CLTA 4WUKL 1JL8A 2D73A 4WO4D 3H4HA 4OV5A 5KVFH 4X6BB 4S2SA 1FYTD 4I8DA 2VSCA 1RUPL 3JUZA 1E2VA 4DVBA 5IJKC 3OJ2C 4GUCA 3GO1L 1ODUA 3EADA 2RCSL 2DEYX 2QHLA 4X5LA 4NZTH 4PM1A 5CBAB 4AG4H 5F1KC 2XTJE 1IAIL 1RIUH 5J4MA 2K4AA 3RGVA 1BQ5A 2BRQA 2VCOA 1MHCB 2EDXA 5I66B 4RMUA 3DRQA 4XZUA 3KJ6H 1JDCA 3WNNA 4MGXA 2WBJB 3C9NB 2FT6A 4HD9A 3P3RA 4F2FA 2EABA 2E6QA 2OR9H 3MRIB 1N64H 4HKXB 4L2YA 2FLRT 4XRCA 3UYRH 1K85A 3JYCA 4LPTA 4PHZA 2VL5A 3KDMA 4HUVA 1UM6L 3O9WB 4DCQA 2YKKA 1KBGL 1QSEE 4KX9A 5DHYB 5AW1B 5D2LA 5MEQA 3LD8C 1RUKL 2F58L 5LXGH 5I1AA 1E8XA 2OTUA 2BWIA 4J3SA 1W0YT 1ZT1A 4ELME 1UD6A 5ANHA 1PYWA 3SDXF 3GMPA 1QP1A 2NY5C 3SCMA 3HNVH 4ZX4A 3GMNA 2DQCL 3IGKA 3I02A 1WZMA 2GUYA 4XAKE 1BAFL 1ZLUK 5KYYB 2ZCLL 4J3XA 3MCLL 4JN2A 5KZCD 3ARED 2P44B 5TQ2H 4LVNC 5BS0D 2XFXB 1IKOP 3F85A 1CLYH 2C4FT 5DQJA 4LGRB 2UWEE 1EERB 1EBPA 4IJ3C 5IY5B 1IL1B 1ZWIB 3QJOA 1WAEA 4JO4H 3P4OB 3VD3A 1WIUA 2O5ZL 4M3HA 4P2QA 2YGQA 5IVXA 3EJPA 3I9AA 1T83C 2LOEA 3K7UA 5LBSH 2NLJB 1E6JL 4XCYA 3G5ZA 2XVBA 2JJUA 2Q8AH 4WU7A 5JIIA 2GHWB 4OCWH 4WIQA 1VKXB 4I5BA 4JO8A 2AKRA 2R69L 1T66D 4DKFH 2ZXEB 5JQIB 5KYUA 1MJJA 1N9PA 4FFWD 3ASOB 5I17A 4MVBD 4LSVL 1P4BH 4HV8B 3HBGA 4N2GA 3BKCH 1UA6H 4G6JH 2YARA 4R97B 4X6BA 2XLLA