5AC8A

S. enterica hisa with mutations d10g, dup13-15, g102a
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
247
structure length
233
Chain Sequence
MIIPALDLIGGTVVRVQRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIASTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGWQENSGVSLEQLVETYLPVGLKHVLCTDISRDGTLVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQCWQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional innovations in the real-time evolution of new ( beta alpha )8 barrel enzymes.
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Isomerase
molecule keywords SULFATE ION
total genus 80
structure length 233
sequence length 247
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2015-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5ac8A00
1W5QA 3QMTA 3W07A 3CWNA 1JCLA 3TKFA 3P7YA 3O8AA 1OG0A 1K8XA 3DGRA 4DF0A 4DPPA 4X3ZA 3W7KA 2C14A 1WXJA 4BF9A 5D04C 2H8ZA 1RR2A 4OGZA 3L0NA 1OF8A 1KFEA 4NVTA 3STCA 4Z08A 4K7VA 3NQCA 4WOQA 3SGZA 5D2VA 3LTPA 3W7EA 1PV8A 4ADSA 2DZXA 1OYCA 4NZJA 2CLOA 3TQKA 3MI3A 5DY2A 3R2GA 3PBUA 3T7VA 1EEPA 4MY9A 3LCHA 1QPQA 1JCYA 1LDCA 1VS1A 3MYOA 2QUUA 3P81A 2BSLA 2H3DA 2BZNA 1VHCA 3DFTA 1G67A 1GVRA 1TTIA 3W1TA 4ZMGA 2ABAA 1LBFA 3S1WA 1F6PA 1W54A 3ELFA 3EB2A 4IQLA 4Q33A 2ZRVA 5F2MA 4QM1A 1BWKA 4AVFA 1MEIA 3W2LA 4BI7A 5I3HA 4GUIA 5D38A 2TPSA 4O0ZA 4AWUA 3L66A 1QOPA 1CI1A 4JEQA 4NJGA 2HSAA 4UTTA 3QW4B 3TK7A 2VEMA 5C6MA 5D2XA 1ICSA 2ZQ0A 3BV4A 2CZDA 6TIMA 1ZHAA 4RZ6A 3Q58A 2ZRUA 4O13A 2WNZA 2GVJA 1ZAHA 4GE8A 2YYTA 3W7HA 1N55A 4MOZA 3NVTA 4ZQMA 1XUZA 3TSBA 3IV3A 1EUAA 1EWEA 5CZJA 5EA9A 3PBYA 5D30A 2QJGA 3Q94A 3BVJA 4IMGA 2CFFA 5I3KA 5BW6A 3G1XA 3NQVA 5KITA 2G95A 5AYYA 3N2MA 4I9AA 1VZWA 5K9DA 2QCDB 5F4WA 3FFSA 2E77A 1QNVA 2I1OA 3PB2A 5DELA 1HO4A 1H1ZA 5FF2A 1T99A 1IXPA 2BTMA 1NSJA 2NLIA 2PURA 3I68A 1GT8A 2DJLA 2QKFA 2VKZG 2OCZA 1GYNA 1W3IA 3W1XA 4UR7A 1SQ7A 2UV8G 4H4IA 3N9SA 2V2DA 4PL1A 3HIJA 2B0MA 4FXSA 3C2EA 2V30A 4Z0SA 1LP6A 2B4GA 2ZRXA 3U6WA 4UTJA 5EYWA 1XCFA 3PF3A 3W85A 5FEXA 3G22A 2Z6JA 2OT0A 3O6YX 3E49A 4NX5A 2CU0A 3KOFA 3TUUA 1XDMA 3FOKA 2YFOA 3MWAA 4I7UA 3NL2A 4R34A 3G24A 5AHLA 1D9EA 3N34A 4P61A 5HUPA 3P84A 3A5FA 1GJPA 3PAJA 3DKLA 5DY3A 5DN1A 4WY0A 3GLCA 2YXGA 2GVLA 3GYEA 1ME7A 2TRSA 3S1UA 3PG8A 4WQ6A 5F2IA 1F6KA 3TJXA 2ZZ5A 1IXQA 1KW1A 3LOTA 4M7SA 1NF7A 4TR9A 2BLEA 2Y6ZA 4RKAA 3W74A 3ABRA 2YX0A 5D33A 4O4VA 4TMBA 2QCHA 4ZVJA 2QCDA 1K3UA 3KRUA 3TAKA 4JD4A 3MP3A 3UYCA 4MKNA 1MSSA 2ZYFA 4O0KA 4O15A 4FHAA 1HG3A 5AFDA 5AYZA 4FNPA 2ZCGA 3NPVA 2ABBA 3HPXA 2QUTA 5KZMA 1QR7A 3GIYA 1G4TA 1H50A 4N9CA 4RCXA 4JXCA 3LHWA 2GVGA 1Z42A 2VOMA 1SO4A 5LGZA 1R2SA 3MBDA 4A22A 4KFPA 3QF0A 1TTQA 3NOEA 3QMRA 3MO7A 2KZHA 1NAL1 1WX0A 3GZ3A 3C3NA 1SPQA 5FEWA 4JYFA 3LRKA 1S5TA 3GR8A 1V7YA 5G5IA 3M5XA 5LGXA 3L0KA 2ZZ4A 6ALDA 2R91A 1MEHA 5DCDA 1L2UA 1VH7A 4Z1CA 2CZFA 1A5SA 4IPIA 3RMJA 4IMFA 4FNTA 4JDYA 3PG9A 1ZENA 1S3HA 3BG5A 1TYGA 1TV8A 3UWQA 1KLZA 4JICA 2FIQA 3M1ZA 1SO3A 1PVNA 2Y62A 3F4NA 1MZHA 3C6CA 1GG0A 1FWSA 1JCNA 1HFBA 1JUBA 3M47A 5AYXA 4CCEA 5FEZA 3QQ1A 1IXNA 4UTWC 2QUVA 1NF0A 4DEFA 3NEVA 3L67A 3ZR4A 5DCEA 2WPBA 4FO4A 1XDLA 3VNDA 1KBIA 1SW0A 1IF2A 4UTIA 2B7QA 5HQEA 1FDJA 2H6RA 1AL7A 3WK2A 3RF9A 2ZA1A 4TU1A 2YFNA 2Z6IA 4MFEA 1PL9A 1OABA 4KFNA 4OWGA 3LCIA 4FF7A 3THAA 2QDHA 3B06A 2GPTA 2CLFA 1H7RA 1J5TA 3GX9A 4M19A 1I2PA 1O95A 3PBVA 2VFHA 2I9EA 1KV8A 2E1DA 5IBXC 2E09A 3KVJA 3GR7A 1DQXA 3N14A 5K4XA 4AHPA 3N19B 4CLMA 2HMCA 3UZ5A 1TJRA 4NU7A 4JTSA 1ME8A 3FLUA 1OF6A 5DCBA 1OYBA 2E6YA 2EAWA 1W5PA 3N2XA 4BWLC 3G1YA 5G4EA 3ABQA 1LTDA 2QJIA 1N7KA 5D02A 4EIVA 1OX6A 5CZTA 3UPBA 1OFBA 1Q3NA 3BW4A 2HS6A 1FXPA 5HMSA 2Y7EA 1KTBA 3CC1A 3V75A 4BI6A 2Y70A 5L9FA 3GNNA 3R5EA 3HGOA 2V9DA 1KLYA 1SO5A 3NM3A 2YGYA 2ZRWA 1M6JA 2A0NA 1LCOA 2C16A 3N9RA 3NYZA 3P5YA 3W1PA 4CCCA 1H5YA 2QCMA 5CSSA 4PFMA 4LVFA 5K9XA 1TV7A 3BG3A 4RLIA 1JQXA 4LVDA 4X2RA 5G2WA 3VKJA 2YZRA 1GYLA 4Z0JA 1YPIA 4FNRA 3A9IA 3S5NA 3FIGA 1M7PA 3F1QA 1O5KA 2FPYA 3FKRA 1FY6A 2FLIA 3PULA 4MLRA 4ADTA 3C8FA 3BW3A 3R12A 3CWOX 3SJ3A 2Y85A 3ATZA 3P5ZA 3W84A 4N9BA 3WJXA 2EPHA 1A5BA 3E12A 3HQ1A 1XBVA 4XZ9A 1OX5A 4WJEA 4O1BA 1VCVA 1H1YA 2G96A 3F4WA 4KWWA 1JR1A 2RDTA 2RFGA 4C1KA 1LYXA 5EBUA 3HGSA 4K39A 3C52A 4U4MA 5BMXA 2EF9A 3EX1A 4NJKA 1VQTA 3G1DA 4W9TA 2J9XA 1SW3A 2PE4A 3LCLA 1GWJA 1EX5A 3BG9A 3IRDA 1UASA 3HGJA 3LXAA 5K7JA 2CWNA 4CQAA 1TPUA 4OE7A 1OK4A 3LCFA 3I7SA 3FJLA 4CQ9A 3A23A 2JK2A 3W2MA 1SFJA 4Y96A 3M43A 4LNYA 4AHQA 4G1KA 2NUXA 2B7OA 1KFBA 8TIMA 5F4SA 1DJQA 2RHGA 4MIMA 1X8FA 3TXVA 1YADA 3O07A 1LLZA 2O7SA 2TSYA 5GVJA 2ATMA 3M0ZA 4K8EA 2QCLA 2ZZ2A 1JUKA 3TC7A 3WK1A 3MHFA 3QJAA 4NQ1A 3HBLA 1TV5A 3C2RA 3TFXA 4IXHA 1MXSA 3B8DA 3NL5A 5LNRA 1TPWA 3LCGA 5K3VA 2FTPA 1RQHA 2VFIA 1PCKA 1F7BA 4O10A 3G3DA 2D73A 1YTEA 4H3DA 2CLLA 4O52A 1Y0EA 3A24A 3O6CA 3DBPA 5F1UA 4AWTA 4JX5A 4ZQRA 4M6PA 4LT9A 2VELA 3B0UX 1Z44A 4HIBA 2Z0IA 5HNRA 2RKXA 3LTSA 1TPDA 4K6AA 5KZDA 3NZRA 1SW7A 4E2BA 4I7VA 2R8WA 1OFRA 1SO6A 4MVAA 4JTIA 2GQ8A 3W23A 3LV6A 1GVFA 1Q45A 1ZJIA 1R47A 1LRQA 4MZ8A 5U7SA 1B9BA 1WAUA 1B4KA 2E5BA 2NZLA 2A7RA 5AN7A 4AF0A 5AHFA 1H51A 4IGHA 1VLIA 2PRHA 4CCDA 4HNNA 1DJNA 1HL2A 1OYAA 3LRLA 2JBMA 5F4XA 1SR9A 5EKYA 1SZEA 4OT7A 3TSMA 3QPYA 3STGA 2V8ZA 1DHPA 2JKEA 3H53A 1OFEA 3W9ZA 4R7JA 3CEPA 1LZOA 1V5XA 2DJXA 1WOAA 1VPXA 5CZSA 2X1RA 3UWWA 3PS7A 3WK0A 4KWVA 3P61A 3I7RA 4DO6A 4XTDA 2C6QA 4GUJA 2V81A 3UQNA 3IGUA 4GUGA 1FWRA 3PWAA 4ONVA 4A29A 3NL6A 1TRDA 2ZA2A 4NNBA 2Y61A 4JIQA 2Y89A 4NJIA 3T4CA 1VC4A 1BTMA 3FYPA 3PUOA 1JCMP 5EMUA 2PRLA 1EP1A 4HKPA 3W22A 1DKWA 2BXVA 4JTUA 2J6XA 3CU2A 4YXGA 3W7OA 2E5CA 2HTMA 3FA5A 3IGSA 3B0PA 1SU5A 1XXXA 3W83A 4E0CA 4UFLA 3NQ6A 2ZRZA 1JRBA 1FXQA 4YCPA 3BO9A 3WFAA 1X6UA 4E2DA 2DZTA 1YTKA 3UY7A 4IMDA 1TQJA 3NQ8A 1O4UA 2AAMA 4FX8A 1KV5A 3S1XA 4UMAA 4IJBA 5KMYA 2C19A 4M6QA 3W7GA 1OX4B 1P4CA 5BOOA 4MUZA 3V1PA 1U83A 2C13A 2QCGA 5HWNA 3LHVA 4PC8A 1PIIA 1ZAJA 3RFAA 2OX1A 4ZQNA 3ABSA 4J9JA 4JTEA 3B0VC 5AHNA 2OMAA 1QMLA 1B57A 1DQWA 4O19A 3CLMA 3MHGA 4HN4A 1B3OA 1ZCOA 1I2OA 1KFKA 1R2TA 3TROA 3W76A 3P74A 3W1NA 4JTKA 2I14A 3LBMA 3FS2A 5BNKA 1ZAIA 4CNOA 5LNWA 3HMJG 4RX0A 3LGEA 3HB9A 4NXKA 3P60A 3GK0A 2CLEA 1DL3A 4Y8FA 4MFDA 1YDNA 3PY2A 1KFLA 3OVRA 1W3TA 3O16A 2NX9A 4K38A 4LWWA 2ISVA 5HWJA 4JR5A 2ISWA 4OQVA 3PM6A 1LOSA 3JR2A 1F74A 3LBCA 4LY8A 4BK9A 2FPVA 2WSQA 1XFBA 3LRMA 3BARA 3USBA 1GZGA 3W86A 1WV2A 4QIUA 3NPWA 4O8RA 3LTYA 3WJYA 3CQ0A 3W88A 3S9YA 5I3GA 3G1HA 3I6RA 4WY0B 2DP3A 3TH6A 3SFKA 1ONRA 3HO8A 3UY8A 4Z1DA 3G1VA 1TPH1 3HG4A 1DBTA 1K8ZA 4O17A 3GKFA 4M5PA 5FI8A 3M9YA 2YW3A 1W0MA 3IIXA 4FB7A 1FWTA 1FWWA 4TIMA 3W7JA 4EF9A 3P8JA 1EB3A 2ZFAA 3RLUA 4AXKA 2E6FA 3T44A 3NQ2A 3EWYA 4S2CA 2Q8LA 5F2LA 1K02A 3H55A 3IIZA 1DORA 3LB0A 5HJLA 1D3GA 1EIXA 2EHHA 5HINA 3DAQA 1MO0A 1TTJA 1VCGA 5CKSA 2B7PA 3W87A 3QYQA 1GQNA 3HG2A 4IMCA 3C2FA 3EKZA 3C56A 5G1TA 2WNQA 4FXRA 5G1YA 4MYXA 3PUEA 3W7IA 1FDZA 3LHYA 4U28A 1T0OA 1UUOA 4MY8A 2YSWA 1LORA 1QPNA 3L68A 5K9CA 1Q6RA 1FCVA 3GXPA 3W1LA 4JTHA 3G1FA 4PEKA 2VFDA 1QDSA 2YCEA 5LZLA 1KM2A 4NJHA 3NG3A 5HUOA 1OX4A 5K4ZA 2W79A 3A22A 2AQWA 3W3OA 2NV1A 4O28A 1UUMA 5EL1A 3BK0A 3LXBA 4JTJA 4EWND 5K2ZA 3A21A 3IVSA 4WXYA 3EX3A 4UFHA 3NM1A 5E1QA 3O05A 2ZZ3A 2QR6A 2CZ5A 1KM4A 3W7NA 3E0IA 1G4SA 4JN6A 3GNDA 2VC6A 2WQPA 4QNWA 1FDYA 1SSGA 3NQGA 3EXRA 3F03K 4UC5A 4JYEA 1R2RA 2A5HA 4RZ5A 1WDWA 1VR6A 3W2NA 3E9AA 3BPWA 3W7LA 4Y6GA 3MP4A 4ZQPA 4JY8A 3EXTA 3TJLA 4PL2A 2J9YA 3PBWA 2H8XA 4JYDA 1FUYA 3TV8A 3P82A 1WYIA 3ZFHA 4CNNA 3VI2A 1P0NA 3M5VA 1WBJA 1AG1O 3TSDA 1FQ0A 2GJNA 5D2YA 2Y63A 5KZEA 1F5ZA 2A21A 2CZEA 1ML1A 2ZDRA 1H61A 3G0UA 1WQ5A 4RK8A 4GBUA 3W7MA 1KTNA 1OFOA 3TC6A 3W2KA 1JQVA 4PTNA 3P8IA 3S42A 3TMLA 2QDGA 4UFJA 2NWSA 1GVSA 4IX0A 4POCA 1TIMA 2A1YA 2W6RA 3O06A 3NPXA 4DF1A 3O15A 1XC4A 3ZS4A 1LRTA 2CLKA 2ZZ7A 1SZGA 5AC7A 3G3MA 2WSYA 5KSWA 4OHQA 3TIMA 2NX1A 1IIGA 5TBOA 2TYSA 4MY1A 3E02A 3FJ6A 3IIPA 2Q3RA 4WY0F 3RLVA 5IM51 4GJ1A 3TW6A 4Y90A 3UWVA 2VXNA 4ORMA 3W7CA 3H54A 4JX4A 4LTSA 1P1XA 5D2WA 4D2JA 1YXDA 4LS2A 3G0SA 1RVGA 4LC8A 3M5YA 2JGYA 2P0OA 3NAVA 1L6WA 2E6DA 1CW2A 4A21A 4IWWA 4HSOA 3S8HA 3AJXA 1VYRA 1KM5A 4H6KA 4XKYB 1G6CA 2V2CA 4X22A 3LI1A 4RR4A 1AK5A 4NUWA 2Q8ZA 4R53A 2P10A 4NX0A 3A5VA 4ZZ9A 3WJSA 1JULA 3B03A 2NXIA 4O11A 1TPVA 2O7QA 4JS3A 3W1AA 3MMTA 2FDSA 3ZWSA 1M5WA 3NNTA 4HNTA 3QPZA 4YMZA 2FB3A 3FEMA 2ZBTA 1YTDA 4CNPA 3EX2A 1VHNA 3TQ0A 5AC6A 5F2GA 3L5MA 4LRTA 3STFA 1K03A 2QF7A 3R8RA 3G8RA 1YDVA 3TMQA 3UXAA 2WOQA 1WBHA 3HOJA 1H60A 3NQMA 3SY5A 5FEPA 1T96A 3UWUA 3HG3A 4S1FA 1ZY9A 4RZ4A 1HUVA 3C61A 5ABTA 1OVDA 2PC4A 4O4WA 4X9SA 1ZFJA 2C3ZA 4LVAA 1OFDA 4AWSA 4NXSA 3N3MA 5TIMA 3DXIA 5LSMA 3IVTA 3PSWA 2EGZA 5MHBA 1XBXA 5D2TA 2VFGA 3KX6A 3W7PA 5LKYA 3O63A 3W73A 2H90A 1LOLA 3BLFA 2DZVA 2Z1BA 1QOQA 2V5LA 4A3UA 4LUIA 3TU9A 1JRCA 2A6LA 3L5AA 3W72A 5G4WA 1LBLA 3R13A 1SSDA 2Y88A 3BLIA 4PA8A 3CB8A 3RK8A 5D37A 3TE9A 1GTEA 3O6DA 2VFEA 2ZZ6A 1TB3A 4MLJA 3VFLA 1C9DA 5IBXA 2QCEA 4WOZA 1ZNNA 3KVMA 4AAJA 1YPFA 1T8XA 5CG7A 3SGUA 3W1MA 4GFSA 4KFOA 2NWRA 3UWZA 1TSIA 2A2IA 3M41A 2CLMA 5AC8A 3VE7A 4DBEA 4FX7A 1EWDA 5EY5A 4YWIA 1TPEA 3M44A 4LS1A 3TW7A 1W31A 2NXGA 1A5AA 4JTTA 3HGRA 1FCUA 1W56A 5FESA 3LCWA 1KM1A 2G5WA 5H91A 5LNSA 3PUDA 1H7XA 4IXXA 2DZUA 2G97A 4K7YA 4NNAA 3PVFA 1QFEA 3MBFA 5D09A 1VLWA 3KRZA 1YYAA 2XFWA 4O57A 4JNMA 3EX4A 1N8FA 3W70A 3STEA 1QPRA 1AW2A 3TFCA 3M7WA 5D05A 2B7NA 2R14A 5C5YA 1SFLA 4C1LA 3LHUA 1PS9A 2C1HA 5A8GA 3MI2A 2GOUA 1XBYA 2PCQA 2V5BA 1SUXA 2QCFA 4AF0B 1W1ZA 1ZALA 2V82A 4UTTC 1XM3A 1UJPA 3LM7A 4TX9A 1VYSX 1AMKA 4WD0A 1FX6A 3GDTA 4JTGA 1XL9A 2J24A 5CPNA 3W71A 4XQ6A 4HPJA 1K7FA 2Z2UA 4LRSA 4O12A 1OK6A 2OT1A 1H62A 4PCFA 1G7UA 3HJZA 4HNVA 4ALDA 4UNLA 1K8YA 1PCWA 4UTHA 4E38A 3GXTA 3IIVA 1TQXA 5D32A 3U2OA 3NR0A 3L9CA 3QSRA 1G7VA 4UMCA 1RZMA 4ZQOA 1U5JA 2QCNA 4PODA 1TREA 2GUUA 1S5VA 2C15A 4TO8A 4Z1AA 2DORA 1KM0A 4LOCA 2IQTA 3M5ZA 3L65A 4O14A 1R46A 3RU6A 3EWBX 4JY9A 3W2UA 3DU0A 4FNQA 3NQFA 4HPXA 1WA3A 2DZWA 5CZ0A 2NUWA 2YR1A 3S0CA 5DLCA 3GDKA 3QM3A 3OBKA 5A5WA 2C0AA 4CQ8A 3DHFA 4RV8A 3LCXA 3DI0A 3NPUA 3CM4A 4O1CA 4UXDA 3QH2A 3UWYA 3UZJA 4WX2A 3LERA 5T26A 4FNUA 3LHZA 4RJEA 1TRIA 3DFOA 3W2JA 1FBAA 2J9ZA 2TMDA 3DENA 3G0XA 3B4UA 3C0JA 3L21A 2ZZ1A 3O1NA 4N6FA 1O94A 5FF7A 2QAPA 1X1OA 3MUXA 1RPXA 3WK3A 1LM1A 4QSHA 2WNNA 1X7FA 3VCRA 3NZ1A 3DH7A 3M6YA 4ADUA 5E0KA 3NQ7A 1KFJA 4DXVA 3EXSA 2WJZA 1JJKA 2NXHA 2YW4A 1TPFA 1BKSA 3TDFA 2ZTKA 5DBTA 4A2RA 3EWWA 1SZNA 5BMWA 3EX6A 2FJKA 2X1SA 4QNEA 3L0GA 3S1VA 4K8HA 4DO4A 5CPOA 1OFAA 3ATYA 3LV5A 3NL3A 5SWUA 2ISSA 4O53A 4PH6A 3CTLA 5EPDA 2VEPA 2A6NA 1LBMA 3EKLA 3KVKA 4FEZA 3THQA 4BFAA 4WUIA 3W1QA 2X1UA 3SR7A 2OZ0A 3IIOA 4UNKA 4O16A 3L2IA 1YDOA 4ICNA 2XN2A 2C18A 3QW3A 4HSNA 4KKXA 3MW7A 4FNSA 3WJZA 3NDOA 3KRSA 1QO2A 4A2SA 1RD5A 4N6EA 5AB3A 2E6AA 4GUFA 5AHIA 3C4UA 1VCFA 1ADOA 3OVPA 1DV7A 4GNJA 2Q3OA 2YYUA 1OFPA 1H7PA 4LW7A 1TTPA 4S2BA 3WJWA 3CIWA 1TPC1 4WXZA 4OV9A 3CHVA 3OHIA 4UFKA 1DVJA 3N73A 2RDWA 1XBZA 3GDRA 3FKKA 1W5OA 2QAFA 4UTWA 1YXCA 1O5XA 3EWXA 4FIQA 4UFMA 3LXCA 3HPSA 1AW5A 5FF4A 2A7PA 1CX9A 4AH7A 3DFNA 5KINA 1Z41A 3JS3A 3DFQA 1AL8A 4O18A 2ZRYA 5HULA 3QC3A 2P1FA 3NA8A 5J5DA 4ORIA 4Q32A 2E5DA 2X1TA 4MZYA 3BW2A 3QEZA 1EP2A 4N02A 3MP5A 5LNVA 1IXOA 2ALDA 1FWNA 3P62A 3LLFA 3L5LA 4RXGA 2Y7GA 3MYPA 1C29A 4GRSA 3QZEA 2Y7FA 3OVQA 4JIPA 3SIZA 3GB6A 3M16A 3GXNA 1I8JA 1LOQA 2X16A 5D03A 3GAYA 3MJYA 3W7DA 4MJZA 1LLWA 4GC4A 5HR6A 4HT3A 1W8SA 2V0TA 3B04A 5L6UA 1C8VA 2NUYA 4IOTA 1VRDA 1GVQA 3OA3A 4XKYA 1BEUA 4UTKA 4UTLA 1XKYA 2QJHA 4DELA 4EVZA 3NQEA 1YXYA 2V2HA 3TQVA 2BWGA 4DF2A 4ZQCA 4NZFA 3TCEA 1JCJA 4UCGA 1VYPX 3CT7A 4XUGA 1P0KA 4DPQA 1H7WA 1UCWA 1ALDA 4Y9AA 1Z48A 5DBUA 4BWLA 3CEUA 2EKCA 2GQAA 3SSJA 4UTUA 1F2JA 1EPXA 1K7XA 2XN0A 3CIXA 4MYAA 4OU1A 3PC0A 3SZ8A 5TQLA 5C2XA 3HF3A 3QRHA 4Q4KA 5C55A 1TJPA 4K36A 1TO3A 2R94A 7TIMA 1OFQA 1P5BA 4AB4A 3INPA 1FCQA 2JKPA 1GPWA 1RQBA 1TPB1 2FFCA 3UNDA 4HNUA 3GDLA 1UB3A 4O1AA 3TXZA 1W5NA 1OJXA 1EA0A 2VFFA 4N9DA 5HWMA 2F84A 4UTMA 4WZHA 1AW1A 3AO0A 1R30A 3QQ0A 4JTLA 3P80A 4AEOA 2FB2A 2A85A 1QCWA 1JUEA 3LI0A 4K37A 1F76A 5AOUA 3HG5A 4IX2A 4MJMA 5I3FA 5CPMA 2X30A 3QSTA 1A5CA 1XUUA 4OBTA 4LV9A 2ZTJA 4IUOA 4UUIA 5AHMA 4LC6A 1WOBA 3G1AA 3KAOA 1JVNA 1QWGA 1D3HA 4MZ1A 1FCBA 2LLEA 3KHJA 1J4EA 3TNOA 2X2GA 3SI9A 4ML9A 4NNCA 2WKJA 1Q6QA 5J5RA 1RQEA 3K30A 1PHQA 3IGXA 5LNUA 4XWUA 4QISA 2FPTA 3YPIA 4ZL1A 3W1UA 4AHOA 3LLDA 3Q2DA 4IMEA 1I2NA 2QCCA 1KFCA 3RNDA 1L6SA 3UPWA 4O54A 2NV2A 3DFPA 5C54A 3EWUA 2DU2A 3UXDA 3LHTA 3B05A 4LVGA 4UR8A 4XTIA 3G8EA 3EWZA 4UMBA 4LS0A 1UBSA 5G2HA 1NEYA 3PSVA 2HS8A 1ME9A 4XBSA 1PHWA 1JCXA 3ANYA 1BWLA 3C2VA 5CPLA 4R33A 2GQ9A 1SZFA 5DXXA 5F1VA 3BGJA 3OIXA 1QPOA 1I2RA 3TR2A 1LROA 3ZWTA 2NX3A 4JX6A 4N9EA 4YLWA 1VJIA 3I65A 3S5ZA 2RH9A 3CPRA 2ATSA 3G18A 3Q37A 4GUHA 3GAKA 5H2ZA 3PB0A 5KTLA 1VGAA 2GJLA 1Q6LA 5FF0A 1PE1A 4OV4A 1KM6A 3MHUA 4N4QA 4LUJA 4UFIA 3S6DA 3EEGA 1I2QA 2H3BA 1HTIA 4EF8A 3KFTA 3P67A 3OEXA 3NQDA 3QFEA 3FYOA 1OHLA 2VEKA 3W7QA 5U4NA 2BX7A 2CLIA 1W37A 2XN1A 1G4EA 2CLHA 1J2WA 2OJPA 1L9WA 1DOSA 1G4PA 4LVBA 3E96A 4M6VA 1KBJA 4JTFA 5HR7A 1NFBA 4QAIA 4B5NA 4N2YA 4MPQA 1X1ZA 3VE9A 1KM3A 1THFD 2WV8A 4DBDA 2WSRA 2VEIA 3GKAA 5AHEA 4EOUA 3DI1A 3HPZA 4NJJA 3W7RA 1K7EA 2Y7DA 4QQ3A 3OG3A 3IVUA 1W3NA 4NT0A 4YCOA 1E51A 1MEWA 1H7NA 3GVGA 3SECA 2QEZA 2A7NA 1LRNA 1GOXA 5LHEA 4TMCA 2DZPA 3T78A 1RV8A 3GDMA 3G1SA 2E68A 1A53A 1G69A 1Q6OA 5CGQA 3C2OA 1M7OA 4FIRA 3NO5A 4Z1BA 1KA9F 2AGKA 3DZ1A 2CW6A 4JGDA 3MI6A 4IPJA 3NXFA 3IEBA 4I7WA 3DKJA 5G2IA 1I45A 2PRMA 1YLVA 3W1RA 1EP3A 3JRKA 2VENA 3S5YA 3ABOA 1B4EA 4N4PA 1GEQA 4BI5A 2JGQA 4FX6M 4M7TA 1H7OA 1GG1A 2J27A 1I4NA 3BGGA 4L4MA 1QO5A 4P2VA 5CSRA 1ICQA 4BR1A 4UIOA 4RXFA 1IIHA 2YDAA 4JDBA 2YPIA 1HO1A 2W0UA 2WO5A 4XBKA 1GTHA 3U8GA 4O50A 1NVMA 1O60A 3NQAA 1L6YA 3TA6A 1XI3A 2RDUA 3D0CA 3R89A 3T40A 4QITA 2JKAA 3NGJA 3KXQA 4L4LA 1IGSA 3LX9A 4GWEA 1F05A 1EUNA 1H63A 2DZSA 1QAPA 1F73A 3BLEA 4O1DA 4GXMA 1KTCA 2A4AA 2J88A 1ICPA 4YL2A 2F7FA 5I3IA 5FF3A 3SW6A 1TCDA 1TMHA 4DQWA 5DXYA 3UD6A 1A50A 4QJ1A 1S5WA 5BRBA 3DHDA 5E93A 5LHFA 3S5OA 3W6YA 3DFSA 3LDVA 5I3JA 3I7QA 4LU0A 3W75A 4LV4A 2ZA3A 4AMAA 4DO5A 1GVOA 3TAOA 3PR2A 1W5MA 3T55A 4HHPA 3TX9A 2FQIA 3KVLA 3QMSA
chains in the Genus database with same CATH superfamily
1HKKA 1AH0A 2VRKA 3W07A 3CWNA 3TONA 2ACUA 3N17A 3O8AA 4Q8OA 5FCZA 3DGRA 4X3ZA 3H2MA 2J6VA 1CXIA 4QLKA 1WXJA 2H8ZA 4YTRA 1RR2A 3L0NA 1OF8A 1V77A 1V7AA 4AMCA 4K7VA 3NQCA 1FRBA 3LTPA 2PDBA 1PV8A 3MI3A 3R2GA 1CWYA 4QEEA 5FJTA 1JCYA 1AZ2A 1LDCA 4CCZA 4EE9A 1P6BA 4F0SA 3MYOA 3EGJA 1JIBA 1EEXA 4DWSB 2BSLA 2H3DA 3CXOA 2BZNA 3E5BA 4KEVA 2HK0A 1W3KA 1GVRA 4ZMGA 2VDHA 4ZOAA 1F6PA 1XISA 4M56A 3AI0A 5F2MA 4AVFA 1P0EA 2D69A 4S3BA 4GUIA 4AWUA 3L66A 3RCNA 3TVAA 3TK7A 1YRRA 5C6MA 4HK7A 5D2XA 2CBVA 3BV4A 3VZYA 2CZDA 4LYQA 7PTDA 5CC6A 6REQA 2DVXA 2GVJA 5A8OA 5FAJA 4Q4MA 4E4FA 2P8BA 4BF5A 1UWUA 4FR6A 2VX5A 2Y2WA 4IL2A 5REQA 3TN6A 2FZMA 1AQFA 1EWEA 5CZJA 2VD9A 1E73M 3S2JA 1QNQA 4PMZA 2REQB 2G95A 4M1RA 3VILA 3B8SA 2J7EA 3FFSA 1NARA 3BLDA 3ISIX 5ECVA 1HO4A 2CBIA 1XKJA 1IXPA 3UERA 2G0WA 2NLIA 2PURA 1V4YA 3I68A 5C2GA 4ZTYA 2PDWA 1YQ2A 4Y8EA 4HA0A 1R8LA 3N9SA 3UVAA 4PL1A 3C2EA 2F8QA 2Z1SA 4HN8A 3WMLA 2BB0A 1MQRA 2B4GA 4L4PA 5IRPA 4DYKA 4ACZA 1TA3B 3P3BA 4XVDA 1J0KA 2BGQA 3KWXA 5FJJA 3BGAA 5FEXA 2Z6JA 3O6YX 4NX5A 2CU0A 2D2JA 1OADA 3NUKA 3FV9A 2YFOA 2NQZA 1RHCA 2A3LA 2NLYA 4I7UA 4LFYA 3T42A 2XGBA 3NL2A 2O9PA 4NKCA 2CZVA 2BP1A 3P84A 1MQPA 1GJPA 5LIYX 1UD3A 2VHLA 5DY3A 5DN1A 4WY0A 3S5SA 1K6WA 1OQFA 3S1UA 2W5FA 1DXEA 4R7WA 3UG5A 5F2IA 3TJXA 4JCLA 3S46A 4KESA 3LOTA 3VNMA 5HPCA 4M7SA 4TR9A 4RKAA 3W74A 4F66A 2YX0A 3KZPA 1RK5A 2QCHA 1E1CB 2KX9A 2DVTA 4BQ3A 2QCDA 3KRUA 3K8LA 4JD4A 1UYQA 3M0JA 1ZJAA 5DMNA 1MSSA 3LLXA 4O0KA 1PPIA 1IT0A 3H4WA 5FL0A 1XIDA 2ZCGA 4PMDA 2YA0A 2ABBA 2C91A 4GNVA 2BXYA 3HPFA 2QUTA 4GQ0A 2TAAA 1QR7A 3CWHA 1G4TA 3R58A 4N9CA 1XQKA 4RCXA 4RNJA 3GU1A 4KCVA 2WCAA 5GQBA 1NDVA 1XDJA 2Z00A 2CKSA 2IKHA 2O55A 2VYOA 4EXAA 3PTKA 1FWFC 1SPQA 3U3HA 1TVLA 1S5TA 2J7CA 1JZ2A 3RO6A 4DAIA 6ALDA 3MTWA 5DCDA 4AD0A 1C7TA 1WUFA 3USZA 4Z1CA 2CZFA 1A5SA 3OBAA 1MRAA 1XW8A 2PU0A 3LPPA 2OZTA 2Y1HA 4JICA 3F4NA 5FA5A 4ZENA 2XH2A 1EQPA 3C6CA 1GG0A 1KCKA 3GXFA 3M47A 3QR1A 5AYXA 5FEZA 1IXNA 4IZGA 1XS2A 3N04A 3MDUA 3ZR4A 1W91A 2O4QA 3FYYA 5DCEA 1T41A 4MWAA 4GYJA 4UTIA 2RUSA 1H49A 2B7QA 5HQEA 3VD7A 3QV8A 2H6RA 2MUCA 2CLPA 3WK2A 6A3HA 2ZA1A 4H8NA 2WANA 4MFEA 3WUEA 1PL9A 4RDWA 3LG3A 4HU8A 1OABA 4OWGA 5JIWA 2OQHA 4PTVA 2CLFA 3GX9A 3LM3A 3PBVA 4XO7A 2IPJA 1DQXA 5K4XA 2J62A 2VWTA 2FTWA 1ADDA 2RGLA 4JTSA 1TR9A 1V93A 2WWCA 3WN6A 3ABQA 2QJIA 1IEIA 4EIVA 1OX6A 5CZTA 3UPBA 1OFBA 3E0LA 5CBIA 4LYPA 1FXPA 4MM1A 2W9MA 4DNMA 2BG5A 4ZE5A 3SCUA 1KTBA 3CC1A 3N1AA 5L9FA 4Q7BA 3HGOA 5A6AA 1SO5A 1OCJA 3NM3A 2ZRWA 4QS5A 3H7VA 2A0NA 3C3UA 1GOQA 2C16A 1FWHC 3N9RA 3LMYA 3NYZA 4JFVA 3HM7A 4Z2LA 1H5YA 2PODA 3J7HA 3VIIA 1DJXA 3PJTA 5G2WA 3IRSA 4X2RA 3VKJA 2F61A 1YPIA 1EJ7L 2E67A 5I23A 3FIGA 1NWTA 5HJXA 2G4JA 2FPYA 1MDRA 3R12A 4GCAA 3W84A 3PBGA 5I5RA 2WPGA 1EKOA 3E12A 3UYIA 4XZ9A 1AD4A 3S83A 1H1YA 1PZ2A 3CL8A 1FWAC 4HHHA 2RDTA 3ZMRA 4C1KA 4JIHA 4U4MA 3MSRA 2O0TA 3EX1A 4NJKA 5BMXA 3G1DA 1SW3A 3EDEA 2J25A 1I0DA 3BG9A 5K7JA 2CWNA 3OGVA 1C8YA 5T8GA 2QYGA 1UH2A 1SFJA 4FAMA 4P7RA 4I8YA 2RHGA 4MIMA 1WXYA 3WF3A 3TXVA 4ECLA 1LLZA 3S9IA 2TSYA 4K1WA 3MVTA 2XHYA 1JUKA 3TC7A 4C91A 4JIRA 1TV5A 2WCGA 4IXHA 1K9FA 3B8DA 3NL5A 5K3VA 2FTPA 1BGGA 1PCKA 4O10A 4F3HA 4O52A 2PUZA 1X7IA 1Y0EA 3O6CA 3DBPA 4DZ5A 1W1B1 3PJUA 4JX5A 1R3VA 4US6A 1D8CA 3B0UX 4IP7A 3KBNA 4NL1A 4TUFA 1UH3A 3V0SA 4HIBA 3DG6A 5KZDA 3NZRA 4XZWA 2CXGA 1JDCA 1CT5A 1W9DM 4NY2A 3CQHA 2YJQA 3PJWA 3W23A 2PTWA 1IZCA 1Q45A 4IIFA 3APGA 1ZJIA 1WAUA 2PDMA 4AC1X 3VOIA 2ANUA 2NZLA 4AF0A 3FW6A 1A5UA 4NHVA 3W6MA 1W9PA 2ZX9A 1OYAA 1UD8A 4NP7A 5F4XA 1SR9A 2XU2A 5EKYA 4OT7A 4B3LA 3CAKA 5TAOA 3CEPA 3H2EA 1V5XA 1W3LA 3UWWA 1BSIA 4KWVA 3TA9A 5JMUA 2OWCA 4IG2A 4HPHA 4A3YA 3AXIA 2V81A 1TMLA 3ORWA 4GUGA 4U31A 3AZSA 3PWAA 3N11A 1B5TA 1XLFA 4A29A 1B0IA 4RNHA 1B30A 4ACZB 2Y61A 4C7GA 3REQB 4JQ4A 4U3AA 3GHSA 3N2TA 5EMUA 1KQZA 2PRLA 1EP1A 1DKWA 2J6XA 3ITOA 5BYWA 4YXGA 2O9OA 3B0PA 2FGBA 1V3LA 2BY2A 5BZAA 4IUGA 4E0CA 2YDSA 1JRBA 1VJSA 2WHMA 4MF4A 4DUXA 5XIAA 4E2DA 4L64A 3RRAA 3LPOA 1HKJA 2WZTA 1TQJA 3BSGA 4J40A 3E3HA 4A3RA 4FX8A 4K2SA 3PZVA 3S1XA 3W26A 4QDWA 3MQTA 2JQXA 4KCTA 1NDYA 2OYKA 5DMLA 4LAUA 2HBXA 1KO0A 1OX4B 3VINA 1VFTA 4IMAA 4IFRA 4QQUA 5A69A 1ZAJA 4JFTA 2NSOA 3SRFA 4Q8UA 4ZXOA 4ZQNA 1XH2A 1R86A 1CNVA 2UBPC 5AHNA 1DXFA 3CLMA 2R1LA 3RITA 1H1NA 4IT1A 1ZCOA 1KFKA 3ZT5A 1A5KC 2PTYA 2XTKA 4FMVA 1W1VA 4ICMA 1VEPA 5B7YA 4JFWA 5BNKA 1ZAIA 4CNOA 3W28A 3A4XA 3LA4A 2PF0A 4UZUA 3PY2A 3VMPA 1W3JA 3DYPA 4M24A 1KFLA 3OVRA 1W3TA 3O16A 3KTSA 4JR5A 4OQVA 1RCQA 3PM6A 2PTDA 4LY8A 2FPVA 4HPGA 1XFBA 3JUGA 4GI8A 1A3XA 3H21A 5C7HA 8XIAA 1X6LA 2BY1A 3BARA 3LRMA 1GZGA 5MKGB 3EMQA 3K1DA 3W86A 4FLOA 3ARUA 3DYMA 1WV2A 4O8RA 3CQ0A 3W88A 3WH6A 2FYMA 3G1HA 4IH3A 3OO2A 3TQPA 3O0FA 5FD0A 3UY8A 2QJJA 4GX9A 1TPH1 3HG4A 1K8ZA 3H2CA 4M5PA 3M9YA 5FI8A 4XISA 1G94A 1V03A 1FWTA 1FWWA 4TIMA 5IXEA 3F2CA 2F6XA 1YBQA 4AXKA 3UJ2A 3QV6A 3T44A 3NQ2A 2FVMA 1JYVA 4S2CA 2OZ8A 3H55A 4A8NA 3QC0A 5BROA 3GNOA 1CPUA 1OM0A 1XLAA 2EHHA 2EPOA 1Q7QA 3BJTA 1TTJA 2OEMA 2WW5A 4M3PA 1JI1A 4G7EB 4HCHA 3QYQA 1GQNA 4QGCA 2BVYA 1JPDX 3C2FA 4PMOA 2GSEA 3NFUA 2G3JA 4W89A 1D8WA 2W63A 1UP3A 2PMQA 4MYXA 4LEFA 4G6CA 1T0OA 2YSWA 4Y9OA 1LORA 4FLQA 1QPNA 2VC9A 4PEKA 2GGIA 3R79A 4G5DA 5LZLA 2ZUTA 1KM2A 4NJHA 5KZ6A 5K4ZA 4JTDA 1E43A 2W27A 3IANA 4P7NA 2IQ0A 3R7MA 1SVDA 2O9RA 4UFHA 3XISA 3LYEA 2CZ5A 1G4SA 1EC7A 3WH5A 4JN6A 2CIPA 2ZX7A 1NFPA 1FDYA 3RILA 2VVNA 3NQGA 3EXRA 2X1IA 3W2NA 4L65A 1MFUA 2PWEA 1E4IA 3W7LA 4MHBA 3R8GA 3BQ6A 3TJLA 4X60A 4HZ7A 1GJUA 5A6TC 1S2VA 2PGEA 2H8XA 4JYDA 1FUYA 4K8GA 2C1GA 3TV8A 4DZHA 3ZFHA 1Q6GA 4CNNA 2OYLA 1WBJA 4Y7EA 3E2QA 3MZNA 3GHRA 1O5RA 2POTA 4FS9A 2Y63A 2A21A 3H6OA 2D20A 1ZJBA 3AHVA 1ML1A 4RK8A 1WKYA 3LNPA 5AC5A 1XRFA 3BDKA 1DJHA 1AZ1A 3C0QA 3WQPA 4PTNA 3B9EA 3KL0A 4MDOA 4UFJA 1ZSXA 3TOYA 2FHFA 3ITGA 4Q8PA 5EMJA 5A94A 3M0YA 4ATDA 4AX7A 3IACA 3ECQA 4DF1A 3CZGA 4BKNA 1RD6A 3I6TA 2WM1A 1CXFA 3FCPA 5BXTA 5KSWA 1HJSA 2OLAA 3BZJA 4HTBA 2PLJA 3UJSA 2IS7A 5CAHA 3W7CA 4JX4A 2WC7A 2XZ9A 4GZ7A 3R0KA 2PU1A 4B2DA 1UJQA 3G0SA 4ZR8A 1SFSA 1WB0A 4XBJA 3NAVA 1FH8A 1CW2A 5FL1A 4IWWA 4H8HA 1ZZMA 2HRWA 4H6KA 3VGGA 1IGWA 1U5HA 5HK4A 3WJSA 4O11A 4JS3A 3W1AA 2FDSA 3UETA 1QI4A 2HPIA 1TR1A 4HNTA 5REQB 2POZA 2FB3A 4LAKA 1VHNA 5AC6A 3K46A 1K03A 2QF7A 3G8RA 1YDVA 3M0VA 2CWXA 4MNKA 3H8AA 5HMDA 1HP4A 1EDGA 3TJ4A 2QV4A 4U33A 1ITUA 3LU2A 3UWUA 3HZ3A 4RZ4A 3C61A 3GY1A 1OVDA 4C6QA 2C3ZA 1OFDA 3F5JA 2ZX5A 5TIMA 3EA1A 3QR0A 1XBXA 2PLKA 1ADSA 1JZ5A 3GWQA 3OQ8A 4K3ZA 3W73A 1QASA 3BLFA 2Z1BA 3PFRA 4LUIA 1XYZA 1GJWA 2QVNA 3OW1A 4GVHA 4DWDA 3IGHX 1DYSA 3CB8A 4R5EA 1GTEA 1XQLA 1PWLA 1JFXA 2VFEA 3VC6A 1EHAA 1TB3A 2PZ0A 3VFLA 4UTFA 2OLSA 1N8WA 5IBXA 1YPFA 4AVOA 3T08A 1RP8A 1VKFA 3VE7A 4YWIA 5EY5A 3M44A 2JE8A 4KIRA 2WVSA 1C3FA 2INFA 1P0DA 1W31A 2VR5A 4B3KA 3GC2A 3WBXA 4JTTA 4L6DA 1FCUA 1FHVA 3A64A 1KM1A 7REQA 2Z26A 2G5WA 5H91A 1HKMA 1SGJA 5LNSA 3CHCA 4C6NA 1WKEA 5HQLA 1X98A 1XF0A 3VCCA 1YYAA 2GGGA 1FTXA 5IFTA 1HGYA 1XIHA 3IJLA 1LUCB 3RDKA 1AW2A 4RPPA 3M7WA 5D05A 3TFCA 2FGZA 4C1LA 1E1CA 3NO1A 1TVPA 3VMOA 3AWNA 4HMCA 2C1HA 2RGMA 2V5CA 2PCQA 3H70A 2QULA 2QCFA 2R24A 4F79A 1W1ZA 1IHIA 1UJPA 1JNEA 4PMNA 1VYSX 4IL0A 4CEUC 1UP2A 3GDTA 2KAUC 3AYSA 5B80A 3OZOA 2Z2UA 4LRSA 1OK6A 4P5UA 1J18A 4ALDA 1PCWA 4UTHA 3PJXA 3GXTA 3AXKA 5D32A 3U2OA 4CNUA 4EANA 3L9CA 4IIHA 3L4WA 3TWBA 2PBOA 2V5JA 5HANA 1TREA 3DN5A 1S5VA 2VX4A 1R38A 4TO8A 2IQTA 4O14A 1ONEA 1KGUA 3WG6A 4XD5A 2PP1A 3NXLA 3OBKA 3QOMA 2C0AA 3DHFA 2CKRA 1QBAA 3UWYA 1ZBCA 3UZJA 4B4FA 3LERA 4C7DA 3LHZA 4RJEA 1J12A 1TRIA 3DFOA 4JKLA 3DENA 3MKKA 3VCNA 3C0JA 1S46A 4X63A 4N6FA 3BWWA 1ITQA 1X1OA 4MWAC 1CGUA 2C79A 3OBEA 2WJZA 3NCOA 1TPFA 2IKIA 5DBTA 1JZ7A 3RYSA 3EWWA 1X6NA 4S23A 1SZNA 4EPBC 1JEZA 1C7SA 3PN8A 4DZIA 1R3TA 2PSNA 4JN7A 4DO4A 5CPOA 1OFAA 4XIAA 3LV5A 3NL3A 2PAJA 2ISSA 5EPDA 4IJCA 4QCFA 3HFYA 1POKA 5BXRA 1W1YA 1HP5A 4MB4A 1VIZA 4BFAA 3W1QA 2X1UA 3SR7A 4G8TA 4HU3A 1F8MA 2ICSA 4UNKA 1J6OA 4HCLA 3ZXWA 3L2IA 1CLVA 2VRJA 4G7EA 5AZ1A 6XIAA 3QW3A 5C9XA 3MW7A 4R9OA 4BY3A 2JIWA 4TX6A 1KC7A 4REQB 3WJZA 1F6YA 4A2SA 5AB3A 5AHIA 3C4UA 1EBHA 3VD9A 1ADOA 1IE7C 1NWSA 2Q3OA 1H7PA 1TTPA 1BG9A 1GGOA 3CIWA 5DFAA 1TPC1 1E4MM 4OV9A 3CHVA 3OHIA 1OGSA 1AJ0A 3IV8A 1RP9A 1PWMA 2ALRA 8XIMA 3GDRA 2QAFA 1OG6A 4UTWA 4Y9MA 4I5XA 4M6UA 3LXCA 3ZR6A 3HPSA 1AW5A 1P6WA 3AOFA 5CJMA 3EOUA 5A6BD 3AUOA 3DFQA 3QC3A 4ORIA 4Q32A 4XAFA 4XZHA 1KCXA 4N02A 4AXNA 1PB0A 4AUBA 2OGJA 4R9XA 1GPFA 3P62A 3TTQA 4PBGA 3GXMA 4JIPA 4HNOA 1Q2SA 3A9BA 2NW0A 3TTSA 1LOQA 1DWFM 2D0FA 1E9ZB 4GC4A 5HR6A 4HT3A 1GOWA 3BAKA 2C71A 5L6UA 3ZR5A 2NUYA 1VRDA 2GVYA 1BEUA 4UTLA 1REQA 1R3SA 4C6EA 1MYRA 2WSPA 3ABXA 2XGIA 1WZMA 3TCEA 4C6JA 3TC3A 1VYPX 3CT7A 4JTAA 2ZICA 4QG9A 3D47A 1DWAM 5CJNA 1EYWA 2GQAA 1AJ2A 3MPGA 4LBSA 4UTUA 2WHJA 4BQ2A 4YHEA 1K7XA 2WK2A 5AVHA 3CIXA 1UMLA 3L2LA 4PR4A 1GVEA 3SZ8A 5TQLA 3HF3A 3NTYA 2BY0A 4XZLX 5C55A 1EJXC 3VPLA 4P7QA 1TO3A 2F2HA 1P5BA 4Z2KA 2F38A 4TQTA 4LCRA 2FFCA 1J9YA 2RDXA 3WKZA 1UB3A 1W5NA 4N9DA 3CJPA 3GU2A 3GNPA 2R82A 3AO0A 1R30A 2V3DA 3QQ0A 2PDXA 2A85A 2O56A 3CUXA 1JUEA 3LI0A 3T2PA 2BOGX 3RCYA 1F76A 4IF2A 3EA3A 2VOTA 4I6VA 5CPMA 5FJOA 3AAMA 4Q6XA 1UROA 3WBWA 5PTDA 2J47A 1NJJA 1WOBA 1QWGA 1D3HA 4HK5A 1R9XA 3HFTA 1XH0A 1YNPA 1ITCA 3KHJA 3TNOA 1ZL1A 1Q6QA 1RQEA 3LSCA 1V3HA 2J7DA 3K30A 1PHQA 4XWUA 4KBXA 4R7OA 1HXJA 3VNKA 4PB3A 1KFCA 2DH2A 4M1BA 1GNXA 3QHMA 3RCMA 5C54A 2PDCA 2DU2A 3LHTA 3B05A 3UA3A 4LVGA 2D3NA 4MNMA 3UF9A 4LS0A 1XLEA 1MWOA 1NEYA 1Z32X 3MUAA 3GH7A 4DNHA 1MW0A 1PHWA 4JCMA 1TVNA 2GFTA 1J0HA 4R33A 2GQ9A 1GKPA 3GG7A 3SQMA 3HQOA 4PMXA 1CTNA 3TR2A 2NX3A 3N13A 5DANA 2V69A 3Q37A 4M0XA 4GUHA 3CYJA 3GAKA 5KTLA 3GYCA 4W87A 5FF0A 4OV4A 2OSXA 5IHRA 1V08A 4N4QA 3IWPA 4LUJA 4Z2JA 3QY6A 2H3BA 1UPPA 1YW1A 3AMKA 2ZUMA 3KFTA 3P67A 1C92A 3OEXA 5HAOA 3SN4A 1KRAC 2AMXA 3QFEA 4YYCA 5U4NA 2XN1A 4QJ3B 1BHGA 1EJUC 1UR3M 2DQXA 3OVGA 1KBJA 1HJVA 1NFBA 1L6GA 4B5NA 4N2YA 4AZ5A 3VE9A 3RXZA 2WV8A 2WJDA 2G8ZA 2WSRA 1F9CA 3ZLHA 1BYCA 3NSXA 3MC5A 4DY1A 3UEQA 2UY2A 4ZA0A 3W7RA 2XUCA 5BXPA 2Y7DA 4H6RA 3OG3A 2QEZA 2PTXA 2ZVRA 2YB1A 1GOXA 4BS0A 4JIEA 5HOSA 1RY8A 3VOGA 3GDMA 3G1SA 1A4MA 2E68A 1A53A 2Y5JA 4Z1BA 4GO8A 3ARSA 3VM7A 3NXFA 3IEBA 2X7WA 1WP6A 1MFVA 3VFCA 4BF7A 2XZ7A 3AHXA 3WO8A 3ABOA 1B4EA 3R25A 3BMWA 3M64A 3UWEA 4NAEA 1H5VA 5EFFA 2J27A 3VOFA 2VC7A 1I4NA 3BGGA 4NASA 4PMYA 1ICQA 1IIHA 2OO0A 1PTDA 4JDBA 2W0UA 4PUUA 4KEUA 2GOKA 1J01A 1TV3A 4O50A 3GG1A 1L6YA 5DT7A 2PB1A 3WEMA 2RDUA 1C9WA 3GIPA 3NGJA 1QU4A 4KEMA 1IGSA 1KXTA 2D3LA 2HXUA 5E9AA 1H63A 4O1DA 1G5AA 1M7JA 1E4LA 1Q6DA 1HJQA 2BDQA 3CH0A 3KOXA 4YL2A 2G41A 3HQNA 5I3IA 4RPQA 3QV7A 1V8EA 1W2VA 4DQWA 3T8QA 3S9ZA 1A50A 4IPPA 1S5WA 5BRBA 2D24A 1BQCA 3IS4A 3VYLA 4RDVA 1A5MC 3OZPA 2AMGA 4LF2A 4F8XA 3B8IA 1J10A 4AMAA 4DO5A 4WSKA 3PZQA 4QTGA 4MG4A 1WPCA 1W6TA 3PR2A 3TX9A 3ZJ7A 1DQUA 2FQIA 1W5QA 1VENA 1JCLA 2X2YA 3KM8A 3P7YA 5HNNA 3WF4A 5CAKA 4JKMA 1K8XA 3AMGA 1EH9A 3PZUA 2P0IA 4KEZA 4BF9A 4G9PA 1LF1A 3CHEA 4OGZA 2PBGA 3GBEA 1IEQA 4E5TA 3ARQA 3EPMA 3CQKA 3E2RA 5D2VA 1ONXA 4IM4A 1RCOB 2WCSA 1PJ9A 1EFZA 4PMRA 2DZXA 4HMEA 3CNYA 3TQKA 5DY2A 3PBUA 3RHGA 1EEPA 2FZ9A 1UWQA 3AC0A 2IXUA 3TOPA 5I03A 3P81A 1VHCA 3DFTA 3N6JA 1HKIA 1XIIA 1YBQB 4K68A 1P6CA 4D6GA 2ABAA 4BEUA 2WKGA 1GK8A 1HJUA 3VD4A 3B0YA 1GQIA 1BWKA 1MEIA 4BI7A 1BRLA 2F9RA 4H19A 4ZO9A 5FSDC 4TV6A 4UTTA 2VI0A 1RBOB 4TX8A 3MUIA 3K4DA 1GKQA 3DERA 4F4RA 6TIMA 2Q09A 1ZHAA 3EOOA 1U1HA 1SJBA 2J75A 4O13A 2WNZA 3Q67A 2X42A 3W7HA 4L4OA 2HZGA 1LL6A 4U2YA 3D46A 4NAFA 3E1F1 4LXFA 4Q6JA 2XSBA 4IMGA 1SJCA 2YLAA 1GHSA 3CV7A 3N12A 5H1WA 2BASA 5AYYA 4AIEA 2HCVA 3N2MA 5K9DA 4GKTA 4DN1A 4DWSC 2QCDB 3SQSA 2E77A 1J2BA 2I1OA 2OSWA 1H1ZA 1Q65A 1T99A 2BTMA 4W85A 4JFUA 2NQHA 2DJLA 4GIYA 2DSZA 2QKFA 4MMWA 1F61A 2OVLA 2BODX 1W3IA 4UR7A 3KL5A 3W27A 5E6ZA 4QJ5B 1XPGA 3HIJA 3URBA 4FXSA 3EAUA 3OJGA 3WBAA 2V30A 1FWDC 2VT0A 2GSHA 2ZRXA 4I8DA 3PAOA 2CHNA 4UTJA 5EYWA 1XCFA 1W9VA 3PF3A 3W85A 4AW7A 3G22A 1MW1A 4Z2GA 4RW3A 4C90A 2OT0A 1WDSA 1O7AA 5JIPA 3FOKA 4Q4OA 2VUYA 4UBPC 3G24A 5I77A 3WQFA 4ZB0A 3WL0A 2A3CA 3OGSA 5CPTA 2J8GA 4P61A 4PULA 3UG3A 3AS3A 4W5UA 3NWRA 2GSJA 3KBJA 4J3SA 4XV0A 1J0IA 3DC8A 3VNYA 1HQTA 2YXGA 4CN1A 2E28A 2WLZA 2GVLA 2TRSA 3CAVA 2WC3A 3A4WA 3R94A 4WQ6A 2XVGA 3SURA 2YXOA 1DPMA 4B9ZA 1ZBWA 3ARRA 2OOFA 1IXQA 2BLEA 2Y6ZA 3ABRA 4O4VA 3GG8A 4ZVJA 2WMKA 1K3UA 3FA4A 3L23A 4O15A 4PSRA 1JCTA 1B3YA 4FNPA 2X0SA 4S3GA 1J5SA 4P7OA 2VNCA 1V02E 1TX0A 1UWRA 3ABZA 4DXKA 4JXCA 1PX8A 1Z42A 4PMQA 1SO4A 4JTRA 3T07A 3SUVA 5LGZA 1PDYA 3QF0A 2Y0FA 1R9ZA 4D71A 3MO7A 2PF8A 3C3NA 4LCQA 3RO8A 2YZ5A 1GHRA 5GJMA 3M5XA 5LGXA 3MCMA 4CN4A 1MEHA 4ROQA 3WQCA 1VH7A 3PZ9A 3WD3A 1MDLA 4IMFA 2PDUA 3U2ZA 4FNTA 3PG9A 4HZ6A 3MKCA 1ZENA 1S3HA 3BG5A 1TYGA 1NWRA 3K5XA 2JF7A 3EBVA 3M1ZA 1PVNA 2G50A 3VUPA 1B3XA 3BOLA 1JUBA 4CCEA 4H7ZA 3QQ1A 2FMOA 4ZO6A 4DEFA 4TVCA 2WPBA 3QZAA 3EOSA 1XDLA 1X38A 3LNMA 4PTXA 1PIGA 3T2QA 1DXIA 1AL7A 1DHKA 3RF9A 2J78A 2YFNA 3JZUA 5I7GA 4RNIA 3U57A 4H9TA 4KFNA 1V3IA 2WAGA 1GONA 3CGTA 2PD9A 2VFHA 1KV8A 2WBGA 2E1DA 2E09A 3KVJA 3N14A 1BD0A 4B4HA 3N19B 3CUJA 2HMCA 4S3AA 4GI6A 1S1PA 4NU7A 2A3BA 5TD4A 5DCBA 1OYBA 3V16A 2EAWA 1XIMA 2GK1B 5D02A 1GW9A 1OZMA 1Q3NA 4YIWA 3GUWA 2HS6A 3WQEA 3EKGA 4MJ2A 2R1MA 2Y7EA 3H12A 3CYVA 4BI6A 4AZCB 1KLYA 4Q8MA 7REQB 1XRSA 4CCCA 1PDZA 4ERGA 1YX1A 1NDWA 2YL9A 1TV7A 3BG3A 2JF6A 1JQXA 2FZ8A 4G56A 4Z0JA 3ONBA 4FNRA 3QQWA 3BE7A 3F1QA 4B92A 1O5KA 3LS9A 2FLIA 2ZUWA 4KERA 3WLNA 2DT2A 2PGRA 3AUJA 2WMIB 2YA1A 3BW3A 1P7TB 3KWSA 1EXBA 3SJ3A 2Y85A 3ATZA 4EP8C 1LQ0A 2CCRA 4KWSA 1UR8A 3TW9A 4NILA 2PDQA 2FGLA 2QJNA 1R0MA 4O1BA 3GM8A 2PDKA 1MQQA 1VCVA 1U30A 3F4WA 4KWWA 2RFGA 4HYRA 1LYXA 4DWSA 4JEJA 1O12A 2CBUA 1Y5VA 2VZVA 1CIUA 1YMYA 3W4RA 1VQTA 2Q01A 2FHCA 2PE4A 1EX5A 1S5MA 3AYTA 3EPOA 2GLKA 2J74A 4DJEA 1RPKA 3I7SA 2VX6A 3A23A 3W2MA 3M43A 4AHQA 2Z2AA 3OLEA 2B7OA 1KFBA 3W01A 8TIMA 5D9PA 4H9UA 2ZE0A 1DJQA 3UR7A 1X8FA 2V38A 2O7SA 3PPCA 2BFGA 3H22A 5GVJA 1UD4A 3K2GA 4K8EA 2IKGA 2OQLA 4NQ1A 3E38A 5LNRA 1TPWA 1RQHA 1F7BA 3WL1A 2D73A 4ILSA 1YTEA 2CLLA 3A24A 1CGWA 3PTMA 1QI5A 4XD4A 1KKRA 4M6PA 4U5IA 2QW5A 2DDXA 4ATLA 4F2UA 1KCLA 2DGAA 3SDOA 1SW7A 4GZJA 2E7FA 1Q5MA 3R1ZA 2R8WA 4ZSUA 1IEWA 3AXHA 1OT2A 5CSUA 2YA2A 3LV6A 4PN2A 2V67A 1ZQ5A 3BJFA 1R47A 4MZ8A 5U7SA 1B9BA 2PEVA 4J7RA 4L56A 5AN7A 5BWFA 4CU7A 1FA2A 4CCDA 4HNNA 4JN8A 1XSIA 1SMAA 1HL2A 2Z7GA 4NI3A 4Q7IA 1JAKA 1Q13A 2JKEA 3UXIA 1OFEA 4X2PA 3VIGA 3TTYA 3WD4A 2FZDA 2E40A 2X1RA 3PS7A 3WK0A 3I7RA 4DO6A 4XTDA 5A6BA 4J3TA 4HGXA 3VDBA 3G6MA 1TRDA 4NNBA 4JIQA 2Y89A 3T4CA 2XIIA 1Q4WA 4AU0A 3MU7A 3PUOA 5MKGA 4GISA 3EOEA 3K13A 3GXDA 1SJAA 2BXVA 2HNEA 1E1FA 2HTMA 3IGSA 4GQBA 1XXXA 5CGTA 5EMLA 4HVXA 4GJJA 1FXQA 5H6HA 4TXEA 4NZ1A 4YCPA 1LT7A 1EO5A 3BO9A 3Q4DA 3WFAA 2DZTA 3N4AA 3UY7A 4LH8A 4ZB2A 3WLHA 4H2HA 3VM5A 3NQ8A 4BEQA 3BCJA 4KH2A 3DHPA 1JF5A 1KV5A 2G3NA 3OU8A 3OG2A 5KMYA 4M6QA 3AISA 4F9JA 1P4CA 4QJ4B 3QHNA 3WQVA 3CBWA 2C13A 1BVZA 2YCIX 3BQ5A 1QK2A 3WLMA 4D72A 2QCGA 5HWNA 2QDEA 2XIQA 1UR4A 2OX1A 3AJ7A 1I9CB 4C6IA 3LPFA 4J9JA 4JTEA 4OECA 3B0VC 2OMAA 1K6AA 1EGMA 1JD9A 3H2AA 3MHGA 5BCAA 1EJVC 3TTEA 1CGVA 1UWTA 3HQPA 1K4HA 1NOUA 3TROA 4WLCA 3WLRA 4HYVA 3UVIA 3BCDA 5ABEA 4WSJA 3E2SA 3HMJG 1KNWA 3DBNA 4JQAA 4RX0A 3S2CA 2PDFA 2J7HA 1XX1A 2CLEA 1GQJA 2IPWA 4XAZA 1YDNA 3KL3A 3LQLA 4LBUA 4K38A 2ISWA 3JR2A 1F74A 3GU9A 3SCRA 1BQGA 3RPDA 1IR1A 3JU2A 1E72M 1A5NC 3ID7A 3AZTA 1YE4A 4DJDC 2CBJA 2VCAA 4UQAA 4WR3A 2DSKA 1QHOA 3I6RA 2HK1A 3SFKA 1ONRA 1B3ZA 1DWIM 2ASHA 5EFDA 3G1VA 3EDDA 4O17A 3WLTA 1W0MA 1NWUA 2PWFA 1QNOA 4EF9A 1EB3A 3HN3A 2YCLB 3BCFA 2VEGA 4P8VA 3EWYA 1K02A 4WK9A 4LCSA 1EIXA 3H7RA 1EJWC 3DAQA 4L5ZA 2VGBA 4HU0A 1MO0A 3N4EA 2B7PA 3K4AA 1XCWA 3QGVA 1R3YA 1HL8A 2P3ZA 3FJNA 3WQWA 1HL9A 5LXXA 4UZSA 4EPKA 4DLMA 2G3MA 3CAWA 3HU7A 3VGFA 3KCOA 3ARYA 3W7IA 3BURA 2PP3A 7XIMA 3L68A 5K9CA 1WDRA 3LUTA 1FCVA 3O2LA 4JTHA 1HKWA 2VFDA 2YCEA 4RE2A 4YYFA 1FOBA 1XINA 3A22A 2FJUB 5LA1A 3N29A 4H01A 1GORA 3LXBA 3B3DA 3QTPA 4IJRA 1XV8A 3WNKA 3IVSA 4WXYA 3BSHA 1XLLA 3P0WA 5E1QA 4J3VA 1JG9A 2QR6A 4EXQA 4DJFA 2QIIA 2VC6A 2GJPA 4Q4QA 4JYEA 1PEZA 4RZ5A 2A5HA 2NT0A 1WDWA 2P53A 1JPHA 4V28A 4Y6GA 5EMMA 5AYIA 3K8MA 1M65A 4OJYA 2J9YA 3FAXA 4CD6A 1UKQA 3SRKA 1G9HA 3MKVA 5I79A 4TTGA 1E15A 4DJDA 3FDGA 3CPGA 4PYSA 1XYFA 3H4GA 3OLDA 1FQ0A 1RUSA 3W29A 2WZMA 1VRXA 3LY0A 3RM8A 3VNIA 2XVLA 3VXGA 1OFOA 3DG7A 3TC6A 3W2KA 4LY4A 3S42A 2XM1A 2YBUA 2QDGA 1RK6A 3ERPA 3BH4A 3WNPA 3DFYA 4R85A 3GW0A 2I5GA 3QVQA 1EIBA 3MSGA 3O6AA 3CMFA 2P5NA 3NPXA 1N82A 3O15A 1XC4A 3BMXA 3ZS4A 2CLKA 3PANA 4DBUA 1SZGA 4PB4A 3G3MA 3FXGA 4OHQA 5A95A 2XWDA 2XISA 5D9NA 3UR5A 1JGIA 4QEHA 2TYSA 3GW3A 3IIPA 2Q3RA 4WY0F 3GTHA 3RLVA 5IM51 3UWVA 4DWSD 1P1XA 2GGEA 4D2JA 4MNLA 2BGNE 4E8DA 3U7VA 3EDJA 6XIMA 1UA3A 1FWIC 4HK6A 2P0OA 4A21A 2HDJA 2Q02A 1VYRA 1O6IA 1G6CA 1OZQA 1XP3A 3LI1A 4RR4A 4X22A 4R53A 2P10A 1JULA 2XJ7A 4AVNA 2OGYA 4ML4A 3T0DA 3B03A 2O7QA 3M4HA 5E6YA 3VD5A 6ENLA 2Z25A 3NNTA 2ZIDA 2IPGA 1HT6A 2GJXB 4NRSA 1AVAA 5F2GA 2XIBA 3L5MA 1JDDA 3TMQA 4OOZA 2PA6A 3IJ8A 5BU6A 2XVNA 4NYYA 3TNBA 1H60A 4ZO8A 1JYWA 5JQ9A 3VDCA 1T96A 4Q8NA 3HG3A 5CSYA 3OP2A 4S1FA 1CGTA 1Y5XA 2PC4A 4O4WA 2OQYA 4X9SA 4HHLA 1XRTA 3CO4A 1PKYA 3HJEA 2WC4A 4NXSA 2BVWA 3PZNA 1L0PA 3DXIA 3GVVA 5LSMA 3IVTA 2EGZA 1AD1A 4H9VA 4AZIA 4WSHA 3W7PA 3O63A 4UOQA 4RE3A 1S5NA 2QHAA 1QOQA 3QTGA 3L2MA 2H9AB 3CZLA 4NAFB 5G4WA 4OTKA 2J7FA 4HMDA 1O68A 3RK8A 1K4GA 3TE9A 3H7UA 2NQ9A 4REQA 3O6DA 1FHUA 4KF1A 4DUWA 1C9DA 9RUBA 1VFLA 4WOZA 1ZNNA 1T8XA 3SGUA 4KFOA 3FVMA 3UWZA 1TSIA 3M41A 5M5DA 2CLMA 5AC8A 4FX7A 4HOWA 1FH7A 4J27A 4LPCA 3TW7A 1A5AA 3CASA 7ENLA 3R0UA 4TTUA 4BA0A 2PD5A 3WUBA 3MMDA 4K7YA 2EEXA 2BHZA 4NNAA 4DJFC 1QFEA 1KR1A 1W1A1 3AICA 2VUNA 5D09A 2XSAA 1NQ6A 2XIMA 3WD0A 4O57A 1YDYA 4CQCA 5JBEA 1IZJA 4V33A 3EX4A 1J8VA 1QPRA 2GJRA 1VBUA 3WFZA 3UJEA 4BQ4A 3LHUA 1TWWA 1HVXA 1LWIA 3FSTA 1XBYA 2WMIA 2V5BA 3CUHA 2AQVA 1XIGA 1ZALA 2PTZA 4IPLA 2V82A 4UTTC 3LM7A 4BJHA 1AMKA 4WD0A 1GOOA 2NQJA 4L6OA 4YVXA 4JTGA 1XL9A 1K7FA 2JEQA 2GWGA 5JUVA 1J0ZA 2OT1A 3ITCA 1H62A 4PCFA 3HJZA 4UNLA 3IIVA 2WLYA 2PGFA 1Q6FA 4UMCA 1RZMA 1I0BA 1U5JA 4PODA 5AKQA 3MCNA 1IT8A 2C15A 1V51A 2DORA 3M5ZA 1HVQA 3EWBX 3NVDA 5CGMA 2VL4A 3LN3A 3NQFA 3GBDA 3SN1A 2DZWA 3VU2A 5CZ0A 5EGRA 1E6ZA 2EJAA 3WQDA 3EB4A 3RM9A 4KW2A 4DI8A 1GYMA 2ACRA 4CQ8A 3KRBA 3ITTA 3CM4A 4O1CA 4UXDA 3SUUA 3QH2A 4A05A 2PC8A 4WX2A 4C6DA 4FNUA 2P76A 1ZLPA 2WB5A 3W2JA 4Q8VA 1FBAA 2TMDA 4FSAA 3L21A 4AYSA 2JALA 1O94A 4DM2A 2Y5SA 2QAPA 3EMCA 1RPXA 3WK3A 1LM1A 2HVNA 2Z1XA 3FAWA 2WNNA 1QW8A 4NZCA 1J93A 4ADUA 5E0KA 2IPFA 4IICA 3EXSA 3S6OA 1QW9A 2YW4A 4J3ZA 3TDFA 4DBWA 3QGAC 3EX6A 2X1SA 2QIWA 1UA7A 2NQLA 4AEEA 2VMFA 4DVOA 1PX3A 2QUMA 4QNEA 4JIIX 1E6NA 3IJDA 4K8HA 2FMNA 3TEVA 4V1XA 3N25A 3KOZA 5HNTA 2VEPA 3ZIZA 3EKLA 4UQBA 4FEZA 4WJ8A 5JBFA 3ZO9A 2OZ0A 1EQCA 1YDOA 3WUGA 4NZ3A 4HSNA 3CT2A 4HD5A 1I1WA 3KRSA 2WHKA 1QNRA 2Z24A 3AIVA 4GUFA 1UBPC 3N3TA 3WDHA 4GNJA 1B2YA 4LW7A 3WJWA 1SFTA 2J79A 4TVDA 3ZM8A 4CU6A 1ISVA 2RDWA 1XBZA 1C8XA 1W5OA 2E9MA 1VIWA 2OX4A 3V36A 3BAIA 4DM1A 1YXCA 3S4TA 4GD0A 5HJYA 3AS2A 4L7ZA 1RCXB 1CX9A 1DWJM 4AH7A 1IT7A 3DFNA 2VDIA 4OBRA 3JS3A 5A6SA 3F2DA 2DEPA 1FH9A 4K1GA 3FVDA 2X1TA 4MZYA 3SADA 2DW6A 5ABGA 1E4NA 3BW2A 4PMJA 4IGSA 2Y8VA 3R0DA 5CC3A 3SCPA 1FWNA 3CHDA 2E0PA 3MYPA 3MUCA 4GRSA 8A3HA 3QZEA 3SIZA 4NAEB 3M16A 5DF0A 2X16A 1PUDA 1U22A 3B8WA 1XIFA 1KBBA 3W7DA 4MJZA 2QF8A 3B04A 4GZIA 3EB3A 4DELA 4DLFA 1UC5A 2HVOA 3EWCA 2AL2A 2V2HA 1EX1A 1WZAA 3TQVA 5CJ5A 1OD0A 2VURA 3M7SA 4UCGA 4DPQA 3QR3A 2CPUA 1ALDA 5DBUA 4BWLA 2EKCA 1GOKA 1Q7ZA 2HISA 4WKFA 5IDZA 3PZOA 4M51A 2XN0A 3FGCB 1V6VA 5C0QA 4OU1A 3PC0A 1E71M 5C2XA 4EPDC 3A4AA 3DEQA 4K36A 1IV8A 2R94A 7TIMA 4AB4A 3INPA 1FCQA 1GPWA 4HNUA 1TPB1 1UZDA 3TXZA 1EA0A 1EOKA 1GVIA 2YCLA 3G1RA 4JTLA 2FB2A 3HV8A 1ISYA 5A2AA 2YCKX 3ITYA 3CL6A 1TV4A 5I3FA 1QI2A 3QSTA 4LV9A 4GFIA 1S2TA 4IUOA 4UUIA 4LC6A 1BG4A 3G1AA 1JVNA 4Y9NA 1FCBA 4BQ5A 3M0HA 1IWAA 1JGMA 3SI9A 3DFHA 5I09A 2ZXQA 1UR2A 2FKPA 2ZXDA 1VJZA 3W1UA 4V2XA 3Q2DA 4IMEA 1I2NA 3GDBA 4O54A 2BGSA 2W62A 3ZT6A 4MDPA 3DFPA 3PTDA 4QCEA 2ON3A 1V6UA 3WQOA 1T8QA 3MV01 4UR8A 4XTIA 2PP0A 3EWZA 2VR2A 1RH9A 1PZ3A 2AGTA 4LYKA 2HS8A 3GH4A 4WDUA 1W17A 4XBSA 4HP5A 3ANYA 4DJED 5CBBA 3BANA 5CPLA 2EBNA 1SZFA 4C5ZA 5F1VA 4H9YA 1LROA 3UZYA 3ZOAA 1MI3A 1VJIA 1FP8A 2XVPA 3VDAA 4O1FA 5G4HC 3ZSSA 1GQLA 3G18A 1F3TA 3AQUA 4X0VA 4PCSA 2XYLA 1VGAA 1PE1A 4IQEA 1KCZA 2ACQA 4H8VA 2Y8KA 2I9UA 3EEGA 2CERA 4H83A 3NQDA 3NGFA 2J8FA 3QGKC 2VEKA 4N0RA 2YOCA 4LUSB 3PWGA 1W37A 3VK5A 1G4EA 3N2OA 3OHMB 4DYEA 1J2WA 1XIJA 3IARA 1F3EA 3EDFA 4E6MA 5HR7A 1PBGA 4OZOA 4XB3A 4MPQA 3I4EA 1I1XA 1KM3A 4WGXA 2NVCA 4YTUA 1VFSA 1BWVA 5AHEA 1ELSA 1NFGA 4PUDA 1JPMA 1XLMA 1E6RA 3GVGA 3SECA 2A7NA 1QK0A 1LRNA 4RDZA 3U7BA 4TMCA 2DZPA 4RE0A 4KRZA 3I4KA 3E0FA 1Q6OA 5CGQA 3C2OA 5C2CA 3NO5A 1KA9F 3DZ1A 4O0QA 2CW6A 3UA4A 2DT3A 7TAAA 1ZP3A 4JGDA 1Y65A 4IPJA 3BV7A 1B90A 3LD5A 3XIMA 4ZTXA 1I45A 2PRMA 1YLVA 1EP3A 3JRKA 4PMVA 3GFZA 2YKKA 3E0VA 4FX6M 4ZOBA 3GTIA 3W37A 1GG1A 4H7CA 1A0DA 2ZX6A 2V68A 2QZRA 2ODOA 1HO1A 3C0SA 4HTYA 1V0MA 4MWAD 4GZEA 3D0CA 2XFYA 4NF7A 5XIMA 1UW9A 3TYBA 3LX9A 3QV9A 1MUMA 3WMCA 2DZSA 1XD0A 2A4AA 2QGHA 2J88A 4C5YA 4U2ZA 3W53A 1B3WA 5FF3A 2OELA 1TMHA 2BHUA 3ZJKA 5DXYA 3ARVA 4QJ1A 3DHDA 3AIWA 1LQAA 1DE5A 2DSUA 5FSEC 3NOYA 4LV4A 2W67A 4QS6A 5ABFA 1IEVA 3TAOA 3P14A 5J8LA 3AMLA 1R3QA 3C86A 3CB3A 3QMSA 3ZT7A 4NZ5A 5DRIA 1YPXA 3VNZA 3TKFA 1VD6A 5ECUA 4E8CA 4C1NB 4DF0A 4DPPA 4GXPA 4S39A 1EDTA 3W7KA 2C14A 4GCXA 3C5QA 3ZSTA 5D04C 4Q8QA 1KFEA 4NVTA 3STCA 4Z08A 1JDEA 4WOQA 3SGZA 2HXTA 3W7EA 2YDRA 4O8AA 4ADSA 5BOEA 1CB7B 1OYCA 2AL1A 1UG6A 2CLOA 4HZMA 4F40A 2OB3A 3T7VA 2PDGA 3IUHA 4MY9A 3WMBA 1QPQA 1R85A 3VKCA 5A2CA 4A8RA 1VS1A 3R6IA 3U0HA 2QUUA 1D7FA 2W4XA 1XJBA 3WNMA 4E4PA 1S38A 1TTIA 4GO9A 3W1TA 1LBFA 1HJXA 3S1WA 1TE1A 4Z2IA 4RZBA 3APYA 3EB2A 4IQLA 4NIRA 2ZRVA 2ADAA 4QM1A 1H11A 3W2LA 5I3HA 4D9PA 4O0ZA 1EGZA 3OLIA 2WYSA 2HSAA 1X96A 3QW4B 3VDGA 1IZKA 4PBEA 1TE6A 1ICSA 3Q58A 4GE8A 2QPUA 3W02A 1N55A 3T0TA 1EOMA 3GNRA 3EOLA 5H8UA 2WMGA 2Z29A 2ACSA 3IV3A 3B97A 3GVQA 3NEHA 1RLCL 3CZ8A 4GYPA 1HW6A 4J3UA 4HQVA 1Y8BA 1ECEA 5E0FA 1QNVA 4I6KA 5FF2A 1H0IA 3CZKA 4FP1A 4WF7A 1AFSA 1A3WA 4ZOEA 4PTDA 1GT8A 3OQEA 5JBDA 2VKZG 1TJ0A 3S2MA 3W1XA 1SQ7A 4JNYA 2UV8G 3ITXA 2V2DA 2NV9A 1ZBKA 4Z0SA 2GDQA 3BAYA 5AVNA 1A3HA 1UOKA 3ZVHA 4ZOCA 4AFYA 3E49A 3MUY1 2X09A 1XCXA 1XDMA 4BHYA 3MSDA 5CC7A 4CD7A 5E70A 4R34A 5AHLA 1JNDA 1C8QA 3N34A 5HUPA 3O3RA 1PAMA 4XX6A 2WVTA 2OXNA 3RG6A 3GYEA 1BVNP 4L61A 3IJ9A 1XGEA 3GE7A 3KBSA 2PLCA 1UOZA 3CUGA 3F5KA 5KEZA 4M8UA 4TMBA 4E2OA 3E6EA 1A47A 1TWSA 5EB8A 3MP3A 5HBFA 4FALA 3MJMA 4QFUA 3M07A 1HG3A 1TX2A 3NPVA 5LA2A 1VBRA 1E5NA 3N6QA 5C9UA 4B5TA 3GIYA 1H50A 2GVGA 5AZ0A 3MBDA 4KFPA 1TTQA 3NOEA 3QMRA 3AYVA 1WX0A 3GZ3A 1ISXA 2OTDA 3BAJA 3LRKA 3GR8A 3TLQA 3L0KA 2ZZ4A 3W24A 2VGFA 5C8BB 3MMWA 3STPA 5A3HA 2WZHA 3VDHA 4D1JA 1ODZA 3ANUA 1PKMA 3GR4A 4KGLA 1NTHA 2ZDSA 4JDYA 3SEPA 5LA0A 1CEOA 2YBVA 2C8NA 1TV8A 3UWQA 1KLZA 5IFPA 2E1WA 2FIQA 3G6LA 5I6SA 3OOQA 6CGTA 1MZHA 3E74A 3WF2A 4H6QA 4PB5A 5A6KA 1FWSA 4UTWC 2QUVA 4QE4A 4H1ZA 3BOFA 2ZC8A 1E0TA 1ESWA 1H41A 3VNDA 4GHRA 1M04A 2EJ1A 3KZSA 1Q8JA 3T09A 2Y4SA 3GRIA 4GQGA 5I06A 4PUJA 2G3FA 4B16A 3LCIA 3NZQA 3F4VA 4FF7A 3THAA 3B06A 4US5D 4A35A 4W8LA 4M19A 3V0UA 2XG9A 1O95A 1JI2A 5LIUX 3UBPC 5IBXC 1WAWA 1RJPA 4AHPA 4RL3A 3UZ5A 1TJRA 3SCSA 1W32A 2V63A 3FLUA 1OF6A 1XYAA 1W5PA 4BWLC 3G1YA 4F0HA 1LTDA 1N7KA 3MS8A 3VNJA 3BW4A 2VZOA 2REQA 1Z9AA 4G2DA 4F0RA 1KBLA 3KDNA 1E0UA 3GNXA 3GNNA 4DYJA 2CC0A 3GSMA 4UOJA 4YN5A 1QUMA 1DJZA 1LCOA 4UOZA 1KRMA 1CXLA 1UR1A 1WDPA 2QCMA 1IWPA 5CSSA 5CBJA 2Q6ZA 3F7JA 1A80A 3NDYA 4LVDA 1DTNA 1GYLA 4IQDA 1TWZA 4F2BA 1KB3A 3A9IA 4CVWA 3MANA 4C60A 3B8UA 3T1GA 1TZ9A 1H0GA 1WNOA 3FKRA 3NDZA 3WEOA 1FY6A 3IAPA 2QS8A 4MLRA 4ADTA 1AH4A 3CWOX 4JFSA 3P5ZA 3BAXA 1HF6A 3C2YA 4N9BA 3WJXA 3TN4A 1A5BA 5GNXA 1E9LA 4HOZA 4GNKB 1XBVA 3HQ1A 4WJEA 3KP0A 5CH9A 1V02A 2G96A 1JZ8A 1F07A 3WDQA 3SSZA 3HGSA 2ZADA 3C52A 2EF9A 2HQAA 1EC9A 2QPXA 4W9TA 1X8CA 1Z7AA 2J9XA 4S38A 5CC5A 5AY7A 3LCLA 1GWJA 3ZJ8A 3B9DA 3IRDA 3LXAA 4CQAA 1TPUA 1OK4A 4PUKA 2ESCA 3LCFA 4IFKA 2JK2A 4LNYA 4G1KA 2NUXA 1P48A 3H2NA 3MSYA 1EZ2A 5HNUA 4AY8A 4BCEA 3A13A 1ZPTA 1YADA 3O07A 4L9XA 3GH5A 2Z1WA 3BMVA 4YHGA 1UHVA 4IGNA 4CQDA 3SQLA 1NP0A 2QCLA 3AHZA 3WK1A 3UNTA 3QJAA 3KHDA 4WHBA 3HBLA 3PFMA 2NSXA 3C2RA 3TFXA 1MXSA 3BLPX 2VFIA 2A3AA 3G3DA 4GGHA 4XO6A 5EBAA 1K9DA 3SCNA 2WBKA 4AIUA 4CUCA 4ZQRA 1EJTC 2VELA 4CQBA 4QAWA 1Z6KA 2VTFA 2B31A 3HURA 3L4UA 5IOBA 3ZVHB 5HNRA 3LTSA 3IUIA 4K6AA 4GLEA 1XD1A 4YTTA 3RLHA 2GGHA 4J4KA 4MVAA 2FTYA 5TNVA 4LALA 1QHZA 2J8TA 2E5BA 1E0WA 1H51A 4IGHA 2J66A 4F0KA 1Z8AA 4DUOA 4WGHA 3LRLA 2HPMA 3PPGA 1CENA 3TSMA 3QPYA 2V8ZA 1DHPA 5BOFA 3H53A 1V6YA 3W9ZA 4R7JA 3SUWA 3GD6A 1LZOA 1LUCA 1REQB 2Z4GA 2DSWA 9XIMA 1WOAA 1VPXA 1ECQA 3P61A 4KWOA 5ENLA 4GUJA 3AWOA 4ZCWA 3FSUA 3ME3A 2C1IA 1FFQA 3ALFA 1XYBA 2GK1A 4L1WA 4A3HA 3POCA 5JH1A 4ONVA 1M01A 4B5WA 2DT1A 3SIMA 1QHPA 1VC4A 5IHSA 1JCMP 3VOCA 4HSHA 4H7VA 2PWDA 3N15A 3WH8A 4DXXA 3GC4A 3BJSA 3AIRA 1E0XA 3CU2A 3TYUA 2A3EA 1QNPA 2PDYA 1KD0A 4J35A 1MUWA 3W83A 4UFLA 3NQ6A 2WVVB 2ZRZA 3U5YA 1X6UA 1XWYA 2FZNA 4LB4A 1EYEA 1PIFA 3UZZA 3M0KA 4IMDA 3WF0A 3TZFA 1ISZA 4PUWA 3VIOA 2AAMA 4CD5A 1HGWA 4J5NA 4IJBA 2C19A 5LIKX 3V1PA 2YBTA 4PCPA 4CD4A 1F4HA 2PWGA 4PC8A 2OKOA 1K70A 3CV1A 4GY0A 3SCOA 1PTGA 1QBBA 3T4WA 3ABSA 1OWQA 5FJRA 3VIFA 3M6DA 3WQ5A 4ZO7A 1P0BA 1QMLA 4V15A 1B57A 2YIHA 4O19A 2XGZA 4KRUA 2FVKA 3RMEA 1R2TA 6TAAA 4UNIA 3Q65A 3W76A 1VFHA 2PZNA 1W9XA 2EPLX 4JTKA 3IUDA 3FS2A 3I6EA 5A2BA 2VQUA 1XG3A 5LNWA 3UXKA 4LQ1A 3ZJ6A 3LGEA 3HB9A 3EA2A 2QGYA 4NXKA 3P60A 3E0WA 3SCTA 4Y8FA 5FAGA 1GOMA 2OOGA 4L1GA 1JZ3A 2ISVA 1CCWB 5E0CA 3MCOA 4ES4A 2PDNA 4OVXA 3LBCA 4BK9A 4GY1A 1HKVA 2WSQA 1KR0A 1PX4A 1YIXA 3VGBA 1QNSA 2FVLA 4HJWA 3USBA 5KETA 2C7FA 1HX0A 1RBLA 5A8NA 4US5A 3WJYA 4DBSA 3S9YA 2EXOA 3TLLA 4GVIA 1W1IE 3TH6A 2DP3A 3WDRA 3HO8A 3VOHA 1DBTA 3GKFA 3WFLA 2HWGA 4PBFA 3GFXA 2E9LA 3RLUA 1GEHA 4RW5A 3QPEA 4AY7A 3RU8X 2Q8LA 3IIZA 3UZXA 1T5AA 2Y5EA 3IJ6A 4IP4A 2ZXBA 5HJLA 1D3GA 4W86A 5CKSA 3W87A 4JNZA 3HG2A 3HV9A 5DT5A 4D6IA 4AD1A 5G1YA 4MKSA 5BRQA 1FDZA 4B90A 1UWIA 3LHYA 4U28A 3WD2A 4MY8A 4R88A 1Q6RA 4FLRA 1HZYA 3GXPA 4YNGA 1VEOA 3G1FA 3U9IA 1TG7A 1QDSA 2QQ6A 3BICA 2ISFA 5B7ZA 3NG3A 5HUOA 1OX4A 1AQMA 2W79A 3KTXA 3AMDA 4O28A 1UUMA 1J0JA 2EG6A 1M03A 5EL1A 4IQJA 1MRQA 3B9AA 4JTJA 1UR0A 3A21A 5A8QA 3NM1A 1CLKA 3RN6A 3O05A 2X41A 2INEA 4B9YA 4KETA 1KM4A 3E0IA 5EMYA 4ATWA 3N6HA 2ZUVA 3GNDA 1J0YA 1XHGA 4QNWA 3MVIA 1PO9A 4UC5A 3LGGA 1R2RA 1VR6A 1J6PA 3E9AA