5AC8A

S. enterica hisa with mutations d10g, dup13-15, g102a
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
247
structure length
233
Chain Sequence
MIIPALDLIGGTVVRVQRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIASTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGWQENSGVSLEQLVETYLPVGLKHVLCTDISRDGTLVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQCWQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SULFATE ION
publication title Structural and functional innovations in the real-time evolution of new ( beta alpha )8 barrel enzymes.
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Isomerase
total genus 80
structure length 233
sequence length 247
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2015-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5ac8A00
2BTMA 4O18A 5BOOA 1OX6A 1GOXA 3WJWA 3DENA 3S5OA 1VH7A 3RU6A 4UTKA 4BI5A 5ABTA 3NZRA 1PV8A 1TPC1 5I3IA 1J5TA 2QCNA 1KLZA 3G1HA 2TPSA 1OYBA 1LLWA 2BZNA 2OJPA 3HPSA 3M5ZA 4JX6A 4JS3A 3QRHA 3P8IA 1RD5A 1AW1A 1SZNA 2CWNA 2X2GA 3NOEA 4JR5A 4PL2A 1B3OA 4KFOA 3TROA 1AK5A 1QOQA 3IEBA 4UNLA 4CNPA 5AOUA 1N8FA 1TRDA 3W74A 1W0MA 3GAYA 1VCFA 5KITA 1FY6A 4JYFA 3SGUA 2A4AA 5HUPA 3E02A 2VFHA 4JGDA 3L9CA 4K39A 1LP6A 2WKJA 1QAPA 1AMKA 2C3ZA 2OX1A 4O0ZA 3MHUA 1QDSA 2ISWA 3PBYA 3E9AA 1K7XA 4TO8A 5HR7A 1BKSA 3LHWA 2B7OA 5D2VA 4IXXA 5IBXA 1ML1A 3G3MA 4RK8A 5CZJA 2CZFA 4JY8A 3S8HA 3LM7A 1VYRA 2V0TA 2PRHA 3DFSA 3QW4B 3C0JA 1F5ZA 3LLDA 1YPIA 3W23A 1W31A 3G1VA 2QJIA 3C56A 3DKJA 4IX0A 4DO4A 1ZJIA 3S9YA 3TNOA 1G7VA 2C16A 1YDNA 4W9TA 4MJMA 4PA8A 3ABSA 2B4GA 1K03A 3O6YX 1U83A 4FIRA 1WDWA 3GKFA 2GQ9A 1F6PA 4I7VA 2ZA3A 2D73A 2GQAA 3GKAA 3SY5A 3KX6A 1TYGA 3PVFA 4JEQA 3G0XA 5F2MA 2ABBA 2GQ8A 3NYZA 1M7PA 1FWNA 1ZAIA 5FF4A 2VEPA 2E1DA 1TPB1 1VC4A 4UTTA 2VFIA 3I68A 3G1XA 4Q33A 3M0ZA 3DHFA 3A5FA 3HPXA 3P74A 1W5NA 4X22A 3UXDA 3B06A 3BK0A 3L68A 2NV1A 2Z1BA 1XFBA 1MEIA 3NPVA 1VR6A 2ZRXA 1WAUA 1F2JA 2BSLA 4C1LA 3W84A 1L9WA 1RZMA 3BV4A 2FPYA 1AW5A 3E96A 2I9EA 4NJIA 3GX9A 4MZ1A 3C61A 2GPTA 1R2RA 3EX4A 4L4LA 3P7YA 3G1AA 4OQVA 2WPBA 2Y6ZA 1P0NA 5MHBA 1O60A 1XKYA 4LS0A 1XI3A 5DY2A 4DPQA 1W37A 4JX5A 5AC6A 2E77A 3NR0A 4JICA 2QCGA 3G0UA 4LRTA 3OEXA 1VRDA 3STCA 1GZGA 3MI2A 1JCNA 1I2QA 1S5VA 4ZVJA 3W7QA 1U5JA 1GG1A 2FTPA 2FB2A 3PF3A 4R7JA 4UMBA 3TSMA 2PRLA 4MPQA 5FF0A 2FPVA 1O5XA 4Q32A 4QQ3A 4ZL1A 1QR7A 3UWYA 4PL1A 4U28A 3MYOA 4O17A 1KW1A 3FYOA 1I2RA 2DZSA 3PSVA 4NQ1A 3DAQA 3GZ3A 4K36A 1FCUA 3T44A 3CIWA 3MP5A 4LC6A 3NQCA 3U2OA 3UY7A 2V2CA 4JTKA 4HIBA 5FEZA 2BLEA 3GAKA 3G8EA 4UTHA 2XN1A 3KVLA 4KFPA 3G0SA 5D37A 5LSMA 3PSWA 1EUNA 1QWGA 3WJZA 2H90A 3DI0A 3F1QA 1VGAA 5U4NA 4DQWA 3E49A 5BW6A 1HO1A 3NL3A 3NM1A 3W2KA 5AFDA 2CLOA 3ABQA 2NX1A 4AMAA 3VKJA 4HNUA 3FKKA 3GXTA 1VQTA 2BWGA 3P80A 3O8AA 1P0KA 3B0PA 1G4TA 4IOTA 1EIXA 3STGA 3G18A 2ZQ0A 2J9ZA 1OFQA 3T4CA 2OT0A 1LBLA 4WOZA 2RFGA 3OA3A 3THQA 4IPIA 5HWJA 5CPLA 3CHVA 1PHQA 5KMYA 1SFLA 3L0NA 3ABOA 4NJHA 4UMAA 4RKAA 5EBUA 3R12A 3G1YA 4GUJA 1YTKA 3W87A 5AHIA 3MYPA 4RCXA 1K8XA 1VHNA 1SPQA 1W3TA 4R34A 1GVSA 2GVJA 1ADOA 1R46A 2Y63A 3FA5A 3T7VA 4A22A 3ANYA 2YW3A 1I2PA 2E5CA 3WK3A 3L5LA 3NL5A 1ICPA 3THAA 2ZZ3A 1OYCA 1XC4A 1UUOA 4JDBA 1SFJA 4YCOA 3HF3A 4RZ4A 2QAPA 3SZ8A 3NM3A 3CIXA 3KRZA 1PIIA 2A2IA 1OK6A 2NV2A 2JKPA 5F4SA 4YXGA 4GE8A 1X1OA 3LTPA 3CTLA 5D03A 3QSTA 4LVAA 4QAIA 1YTEA 1PCKA 2ATSA 2CW6A 2RKXA 3P5YA 1IXOA 1EWEA 2YZRA 4YLWA 2YCEA 4LVFA 2NUXA 3DFOA 4KKXA 3B8DA 1VPXA 3UPBA 1JCMP 3F4WA 3OIXA 2NX3A 1LRNA 3NQDA 1H5YA 4LVDA 5CPOA 4XBSA 2Y7FA 3N3MA 3EXRA 1F76A 3QH2A 4FNPA 5KZEA 4BWLA 3TMQA 3W86A 4S1FA 3EX3A 3GK0A 3MMTA 4DO5A 1RQBA 1EP3A 2EHHA 3S0CA 4XKYA 3QJAA 1H60A 1GTEA 3BLFA 4OGZA 3TSBA 3M5VA 3L0KA 2WSQA 1GTHA 3OG3A 4PEKA 2V30A 4XZ9A 3NGJA 4Y9AA 1I2NA 4AWUA 5AHLA 4AXKA 3KHJA 2DU2A 3CC1A 4A2SA 2Y7EA 4O52A 3M47A 2ISVA 5H2ZA 1GVRA 5AHMA 3FFSA 1XL9A 1XDLA 3LV5A 3TFXA 1FDJA 4IMFA 2NWSA 1JVNA 5SWUA 1LBFA 3O07A 4UFJA 5LNWA 2XFWA 4DO6A 1OFAA 4P2VA 3G8RA 4JIPA 3W2MA 5LGXA 3H53A 5DXXA 4YWIA 3EWYA 3W75A 5E1QA 3W3OA 3SJ3A 2W79A 1J2WA 2YXGA 5CZTA 2J9XA 3U6WA 3W7NA 4NX5A 5K4XA 2VEMA 4GWEA 1H62A 4GJ1A 1ZAJA 1OABA 5KTLA 1KM3A 4ZQRA 4FNSA 1C9DA 5AYXA 1XBYA 4FXRA 1AW2A 2W6RA 3IRDA 3LXCA 4M7SA 5I3KA 3RF9A 3EB2A 5D09A 2DZWA 4MKNA 4UCGA 1SUXA 4DBEA 4L4MA 3PUEA 1EP1A 2OZ0A 3M5XA 5HWMA 1UCWA 1NF7A 2I14A 1XUZA 3R5EA 4NNAA 3DFTA 4LS2A 3S1XA 4IUOA 1KLYA 4BR1A 3UQNA 5BMWA 1TSIA 2YSWA 3B0UX 1KM2A 4HSOA 1MSSA 2NLIA 2ABAA 2I1OA 4JTTA 4I7WA 3LI1A 1N55A 1OYAA 3L66A 3N9SA 1LRTA 2FDSA 1B9BA 2HTMA 4Z0SA 2R94A 2ISSA 3V1PA 3O05A 1T8XA 3TKFA 3GDRA 2FJKA 5DY3A 4ML9A 3NL2A 3HG4A 3W1MA 1ME7A 3TQ0A 5LNSA 3BO9A 3IIOA 1W5PA 4FXSA 2E5BA 1Z48A 2LLEA 3LHUA 2VFFA 1TIMA 2QCDA 1EB3A 1W5MA 2V9DA 3ZFHA 5DXYA 3SIZA 3WJYA 2O7SA 4OV9A 1OX4B 1DL3A 3S6DA 1C29A 1JRBA 3C2EA 4O19A 5I3GA 1SQ7A 4O1CA 3ZR4A 3GNNA 1BWKA 1A53A 2J24A 3NDOA 1O5KA 3TXZA 1KFBA 1H51A 1MXSA 1L6YA 1QO5A 1YXCA 4QJ1A 3VCRA 1JCJA 2FIQA 4MZYA 4MVAA 5K9DA 4JXCA 5F2LA 3W73A 4ALDA 1KFKA 3PBUA 1NFBA 1LDCA 1OHLA 3MHFA 5D05A 3PB0A 4ZQOA 3G1DA 1TTQA 2Y85A 1G4PA 5CG7A 3M9YA 3W7LA 3D0CA 1YDOA 3N9RA 4DPPA 1EX5A 1UASA 4Z0JA 3N14A 1QNVA 3P61A 4M7TA 3DFQA 1K7FA 3JR2A 3NQFA 1WBHA 5FF2A 1TRIA 5AHNA 4N9CA 2P0OA 4UFLA 3LXAA 3IVUA 1GEQA 2PC4A 2WNQA 3DI1A 1BTMA 3DH7A 3UPWA 4PFMA 3TSDA 4ORMA 1QOPA 1OFRA 2GJLA 2R8WA 1VS1A 3QW3A 3LXBA 2YDAA 1NVMA 5D2YA 3UYCA 5HJLA 2RDUA 4DF1A 3PM6A 2QAFA 1G67A 1GVOA 2ZRUA 1Q6OA 2TRSA 3KRSA 3B04A 2WV8A 3QF0A 1QO2A 1BWLA 1W8SA 4K8EA 1FUYA 1LLZA 5IM51 1TV7A 4IQLA 2A85A 4JY9A 4LTSA 1KA9F 5TQLA 4WXYA 5G2WA 3QC3A 4O53A 2NUYA 3IGUA 4NU7A 2YX0A 3C8FA 4MYXA 1FWSA 4I9AA 4ZQMA 1H7PA 3TW6A 5C5YA 1F6KA 5HWNA 1R30A 4RZ5A 3TC6A 4UTMA 1GWJA 2ZRWA 1XM3A 3CB8A 3MHGA 1X8FA 1M7OA 4IX2A 4O1DA 2ZRZA 2QDGA 3QPZA 4HSNA 4N9EA 2ZCGA 3GNDA 4HKPA 3W7EA 3LCFA 5AB3A 1DOSA 3TQKA 1TPH1 1BEUA 3EKZA 3LBCA 1B4EA 3L0GA 1GT8A 1E51A 4A29A 2A5HA 1SO4A 1EA0A 3G22A 1H50A 3GR8A 4O4VA 3FJ6A 3WK0A 1TJRA 1SW3A 1TO3A 1TTPA 3TA6A 3LI0A 3SI9A 4AVFA 1C8VA 4WY0F 1JUKA 3B03A 4IMGA 1XUUA 3QFEA 3EX2A 5K9XA 1A5AA 2J9YA 4TR9A 4UFHA 4FO4A 3A22A 1M6JA 1MO0A 1Q45A 2TSYA 5DBTA 1SSGA 4O13A 5J5DA 4QSHA 4J9JA 4CQ9A 1D3GA 3STEA 2V81A 2NZLA 4M6VA 4LT9A 1G4EA 3P82A 1AL8A 4HT3A 3NL6A 1KM6A 2OT1A 3DXIA 3BGJA 3DHDA 3DGRA 1ZFJA 3GVGA 1HFBA 1Z44A 1EEPA 3LCIA 3WJSA 2JKAA 3LLFA 1OX5A 3VE9A 4GUGA 1K3UA 3TR2A 5AN7A 3KXQA 1P4CA 4TX9A 3L21A 1MZHA 4FF7A 2RDTA 2EAWA 5F4WA 4HPJA 2B7PA 5LZLA 3PC0A 3NQ2A 3M6YA 1RV8A 3IGSA 4H3DA 5G2HA 5DCBA 3W83A 4O28A 3TE9A 3DBPA 1I45A 3F4NA 4N6EA 3P5ZA 3A9IA 2A6NA 3LDVA 4LW7A 4JTLA 2VEIA 4ZQCA 4GC4A 1SZGA 3W2JA 3C3NA 4N9BA 1Q3NA 4WY0B 3TXVA 2A7PA 3UWZA 1LM1A 1JULA 3WFAA 3KFTA 4GFSA 7TIMA 2QCEA 5CSSA 4ADUA 3W76A 4K37A 2DZPA 1Y0EA 4OV4A 2FFCA 1TPVA 3GXNA 1JCXA 3DZ1A 3MUXA 5E93A 2ZZ2A 5FEPA 4K7YA 4NNBA 1XDMA 3EWXA 3NAVA 4FNUA 3KOFA 2CLIA 5KZMA 2ZDRA 1GJPA 4N02A 3BG9A 3PBVA 3TAOA 2Y70A 3VFLA 3TK7A 2YYTA 1TV5A 3TH6A 3UNDA 5HUOA 1Z41A 5IBXC 3TUUA 3R2GA 4O12A 1RQEA 4JYEA 3I6RA 1GPWA 3UD6A 3O1NA 4LY8A 1MEWA 2C0AA 2Q8LA 1J4EA 5K3VA 1M5WA 3GDLA 1DV7A 2QCMA 2J27A 5TBOA 1OFEA 5BNKA 2H6RA 3KAOA 3NVTA 2Y89A 3USBA 1H7NA 5G2IA 3W1NA 4HNNA 4UTLA 3PUDA 1LBMA 8TIMA 3WJXA 2ZRVA 2WO5A 3QMSA 2WSYA 1VLWA 3Q58A 2VFGA 3MP4A 3PWAA 4N4QA 4XTIA 3UWWA 3OHIA 3AO0A 4MZ8A 2Z6IA 3CT7A 5AHFA 5EYWA 1XBZA 4UFMA 4QIUA 1WA3A 4UTTC 3LCXA 5BMXA 1YDVA 1YXDA 3LHTA 3O06A 3HG5A 4P61A 1KM4A 5LKYA 3W1RA 3S5YA 4WZHA 2H8ZA 3CLMA 1LROA 1VYPX 2VXNA 4BI6A 4K8HA 1QPQA 4WXZA 1PVNA 3MI6A 1LOSA 1SO6A 5EPDA 1XBVA 2P1FA 1XCFA 1KM0A 1ONRA 1ME8A 1O4UA 3E0IA 3BW2A 1YADA 4WOQA 1T96A 1SO3A 3G3DA 3FIGA 4QNWA 5G4EA 2G96A 2W0UA 3GLCA 1G6CA 5EY5A 4DBDA 5G1YA 2CZDA 5K9CA 4JDYA 4WUIA 3NNTA 1TV8A 1GVQA 2Y88A 4MUZA 1IXPA 3AJXA 5D02A 2YGYA 2CLEA 1K8ZA 1A50A 4LS1A 3IVSA 4Y8FA 4BF9A 3I7RA 3ABRA 4N9DA 3LERA 3MBFA 2DJXA 4X3ZA 5CSRA 2AQWA 2B0MA 1P1XA 4YMZA 5HULA 3W2NA 4AHPA 5D04C 1FDZA 2A0NA 2CLKA 1TMHA 1ZHAA 4OWGA 2DJLA 4IMEA 4TIMA 4NZFA 1KTBA 3EXTA 3SFKA 3HGRA 5D2TA 4WX2A 2FQIA 3Q37A 1NF0A 4OE7A 1OVDA 4IGHA 3W88A 3UWVA 5GVJA 3GYEA 3TX9A 2NXGA 2CZEA 2ZZ1A 1D3HA 3LHVA 5I3JA 2C19A 1RVGA 5D2WA 3E12A 1KFJA 1TCDA 3NO5A 3T40A 2WSRA 4UTUA 4RXGA 3JRKA 3H54A 3EWWA 3W85A 1DKWA 4FX8A 3EWUA 3QPYA 1EPXA 3NA8A 3RLVA 4RV8A 2JBMA 4AF0B 5T26A 3R89A 4XBKA 5KSWA 1XBXA 3O16A 3LTYA 2QEZA 3IIPA 3N19B 2EKCA 3PULA 3C52A 2KZHA 3TQVA 1LZOA 3GB6A 3EX6A 3LRLA 5HQEA 3A24A 5G1TA 3PG8A 2B7QA 5F2IA 3FJLA 4TMBA 1TPEA 3LCGA 4CLMA 1ZAHA 4C1KA 4CCEA 4NXKA 4N4PA 1ZNNA 4DF0A 3A5VA 4WQ6A 3LX9A 4MYAA 3O15A 3NZ1A 1YTDA 4UTWA 4GUIA 4BI7A 3NQMA 3TJLA 4UNKA 4XTDA 4CQ8A 5AYZA 1LYXA 4RR4A 4FEZA 2Z0IA 4AB4A 4Z08A 5FF3A 1GYNA 4E2DA 3W1UA 3LRMA 4IJBA 2Y7DA 5F1VA 1WV2A 4GNJA 3ZWTA 1FCQA 4CCCA 1F05A 2C6QA 6TIMA 2WNZA 3B05A 4YL2A 5DCEA 2A6LA 2GVLA 2YPIA 3HGJA 3T78A 4S2BA 1RPXA 5AC7A 5AHEA 1H7WA 4LC8A 3CEUA 1K02A 2X1SA 2HS8A 4LRSA 4U4MA 1OF8A 4ORIA 3FEMA 3M16A 3LOTA 3RLUA 3PS7A 3CPRA 1IGSA 3HJZA 1DHPA 4O16A 3RNDA 3TMLA 4AHQA 2EF9A 3BLIA 3BW4A 3LHZA 2QUUA 4BWLC 4N2YA 2ZZ4A 4QITA 3QEZA 3S1UA 3BPWA 5HNRA 1CX9A 1K8YA 1SW7A 5D33A 2DZXA 2Q8ZA 3FKRA 5CPNA 3UXAA 1EP2A 1HO4A 3CM4A 1JR1A 2HSAA 4TMCA 3UZ5A 5DBUA 1V5XA 4QM1A 2A7NA 1IIHA 1OJXA 4UC5A 4AEOA 4FB7A 3EX1A 1CW2A 1W5QA 4Q4KA 3ATYA 1L6WA 3F03K 1OFOA 2RHGA 4O10A 1ICQA 3T55A 3G1FA 3IGXA 3W7JA 2VELA 1JQXA 2OCZA 1PCWA 1PL9A 4O15A 3BG5A 4JNMA 1KBIA 5FESA 3EWBX 3IV3A 3O63A 1I4NA 2YFNA 3H55A 2ALDA 5AC8A 1VJIA 3QYQA 3BGGA 1UJPA 3Q94A 1ME9A 4RLIA 2ZA1A 5F4XA 3TDFA 3LGEA 1W5OA 4O1BA 3QZEA 1I8JA 1ALDA 1TPUA 2X1RA 3UZJA 1GYLA 3U8GA 3GIYA 3I7QA 1A5BA 3FS2A 2H3DA 4JTGA 1H63A 2A7RA 3NQ7A 3PBWA 3JS3A 2VOMA 4M19A 1G69A 3WK2A 4KFNA 1QPRA 4NT0A 2VKZG 2VFDA 3M41A 5F1UA 2JGYA 2ZZ7A 1JJKA 5CKSA 4ONVA 1G7UA 4AAJA 5FEXA 3M44A 2R14A 3MW7A 5DCDA 3N34A 3GXPA 1WX0A 1XXXA 1VCGA 1HG3A 4EOUA 3S5NA 1OFBA 4X9SA 1SU5A 3TFCA 1L6SA 6ALDA 2ZA2A 4NNCA 1UBSA 2WNNA 3P84A 1OFDA 3LTSA 4Z1AA 1IF2A 3M7WA 2YW4A 1O95A 1JCLA 1UUMA 2QUTA 5CZSA 2YYUA 3W7OA 1FCVA 3HBLA 5AYYA 3NXFA 1LRQA 1TREA 5K7JA 2Y62A 3CU2A 2GOUA 3O6CA 1B4KA 2DZUA 3NQAA 3NG3A 1SW0A 3OVPA 3L5MA 1YLVA 4H4IA 5DLCA 1W3NA 1FWRA 2AAMA 3NQ8A 3GR7A 1OX4A 4A21A 4UIOA 4IMDA 4G1KA 1AL7A 1TTIA 3W1TA 1KBJA 5D2XA 2F7FA 4LV9A 4UMCA 3DFPA 3CEPA 5C54A 2CLFA 5L6UA 3W1QA 4LU0A 1KM5A 5CZ0A 4CNNA 1ICSA 4MOZA 4I7UA 3BVJA 1KTCA 5LNVA 4JTEA 2X1UA 1TTJA 3LV6A 4ADTA 3QMTA 4MFDA 2H8XA 2XN0A 1DBTA 1FWWA 1V7YA 2YR1A 3RK8A 1TQJA 2CZ5A 4O8RA 4IMCA 1GVFA 1IIGA 3MO7A 1DORA 5LGZA 1KFEA 1GQNA 5J5RA 5G4WA 2X30A 2V5BA 2V5LA 3S1WA 3R8RA 5HINA 4A3UA 4UFIA 2HMCA 3P60A 2QKFA 3IVTA 1WQ5A 4K7VA 3MWAA 5K2ZA 3FYPA 1FCBA 4GUHA 3SR7A 4XUGA 4OBTA 2PRMA 2O7QA 2HS6A 1LOLA 4Z1BA 2AGKA 3EKLA 3C6CA 3NPUA 1S3HA 1ZALA 2CLMA 2TYSA 2QJGA 5D30A 3B0VC 1JUEA 2CU0A 3MI3A 4UR8A 4NZJA 3HQ1A 2GVGA 3G1SA 3UWQA 4OT7A 1X6UA 4FNQA 1FBAA 4CNOA 3KVJA 1G4SA 5EKYA 4XWUA 3M5YA 4R53A 1WXJA 1LORA 1NAL1 4HN4A 3W22A 1LTDA 5EL1A 1K7EA 5FEWA 3P67A 2G97A 4JTHA 5D32A 1CI1A 3NQEA 4DF2A 4GUFA 3PR2A 3VE7A 2Q3RA 1KV5A 4RZ6A 1OK4A 4ADSA 2R91A 2ZBTA 2QR6A 1H7XA 1N7KA 5TIMA 2CLHA 3FLUA 2VFEA 1S5WA 3QSRA 5EA9A 3PG9A 1I2OA 2V82A 3M1ZA 3MJYA 1DQXA 2NUWA 1DVJA 4LUIA 1Q6LA 2EPHA 1H1YA 3I7SA 2WOQA 4JYDA 3V75A 4PODA 3HIJA 2V2DA 1H7RA 3B4UA 4FHAA 2FLIA 2PE4A 4UFKA 2JGQA 1T0OA 4HNVA 2IQTA 1KTNA 4LUJA 5BRBA 3S5ZA 2QF7A 2QCLA 4M6QA 2PCQA 5A5WA 3HPZA 3W7PA 4JX4A 2ZZ5A 3ZS4A 2X16A 4AHOA 4HPXA 2P10A 2V2HA 3EXSA 4IWWA 4Z1DA 1DQWA 3DFNA 2VENA 5CGQA 5DN1A 3TC7A 4KWVA 1OFPA 2TMDA 4O50A 3SW6A 2C18A 5FF7A 1NEYA 3HO8A 4RX0A 2G5WA 3M43A 4O54A 1T99A 3PB2A 4E2BA 3O6DA 1FX6A 1QPNA 3NQVA 3ELFA 4UTJA 4Y6GA 4MY1A 5I3FA 4MFEA 1WOAA 1O94A 3IIXA 1NSJA 4GBUA 3LCHA 4JTUA 3NQ6A 4PTNA 3OVQA 2A21A 1TPFA 3I65A 3LB0A 3S42A 2WJZA 1VHCA 2JKEA 3L5AA 1FDYA 2J6XA 1ZCOA 1VYSX 1EWDA 3LCWA 3VI2A 4WD0A 1FQ0A 1QFEA 4XKYB 4K38A 4UUIA 2Y7GA 1PS9A 1X1ZA 2YFOA 4X2RA 3K30A 2J88A 3L2IA 2VC6A 4S2CA 4A2RA 2QCCA 4DXVA 4CCDA 2B7NA 1LOQA 1DJQA 3SGZA 4WY0A 2Q3OA 1KFCA 3OVRA 1HL2A 2CLLA 4EWND 1R47A 3DU0A 1VZWA 2C1HA 3Q2DA 3STFA 2RDWA 4CQAA 4H6KA 3LBMA 5C55A 3TAKA 4JD4A 5EMUA 4MJZA 1SSDA 1THFD 4JN6A 2FB3A 4B5NA 4MLJA 3A21A 2JK2A 3W9ZA 1YPFA 3R13A 3PUOA 5KINA 1SZFA 1PHWA 1W54A 2Y61A 2QCFA 4FX7A 2VEKA 1OG0A 3W07A 3W7DA 3W7RA 5LHFA 4GXMA 3N73A 4O57A 2E09A 5D38A 2QDHA 4YCPA 1RR2A 2EGZA 2NXIA 4OHQA 4E38A 3BW3A 4UTIA 3CQ0A 3QQ0A 3WK1A 4AH7A 5A8GA 1YYAA 3W7IA 3W2UA 3UWUA 1AG1O 3CWOX 3HG3A 5LNRA 3IIVA 2OMAA 1R2TA 4QNEA 1SO5A 4EIVA 2CFFA 5C2XA 1FWTA 4Y96A 2A1YA 1ZY9A 3C2RA 3TJXA 1F7BA 3HB9A 4Y90A 1TJPA 4WJEA 4RXFA 5HMSA 3W72A 5FI8A 4MY8A 4O4WA 4AWTA 1IXQA 1F73A 4ICNA 3W7HA 2DORA 1TPWA 4MIMA 3MP3A 1YXYA 2E6YA 3TU9A 4JTSA 5E0KA 4PC8A 2QUVA 4E0CA 1MEHA 4ZZ9A 3A23A 4LOCA 3W7MA 3GDTA 4R33A 2F84A 5C6MA 4O14A 2C15A 3P8JA 4BK9A 2G95A 4D2JA 2UV8G 2DZVA 1VLIA 2H3BA 3LRKA 3VNDA 3SSJA 1JQVA 3INPA 4HHPA 1H1ZA 4FNTA 3EEGA 3NPWA 2QCDB 2WQPA 2DP3A 3EWZA 3DKLA 1F74A 1WYIA 1ZENA 2GUUA 4XQ6A 3RMJA 1GG0A 1UB3A 4ZQNA 4NUWA 4LVBA 3BLEA 4IPJA 4EF9A 1IXNA 3UY8A 2NXHA 4O0KA 1H61A 1X7FA 1JUBA 4HNTA 3MBDA 1A5SA 4K6AA 2E5DA 1A5CA 2QCHA 4JTFA 1B57A 1RQHA 1TQXA 3KRUA 4JTIA 3W7GA 3ATZA 2GJNA 1PE1A 1EUAA 3W71A 3P81A 2PURA 4FNRA 3P62A 4LVGA 2NWRA 5I3HA 2E6DA 3W7CA 5LNUA 1WOBA 3SECA 2ZRYA 4NX0A 2BX7A 3GDMA 1QPOA 1HTIA 1Z42A 1HUVA 2E6AA 2QJHA 1KV8A 4KWWA 4LNYA 3W1XA 2ZTKA 4NJJA 4PCFA 4ZMGA 4DEFA 4NXSA 3FOKA 3LHYA 4FX6M 1KFLA 2C13A 4AWSA 3W6YA 1R2SA 4JTJA 3HG2A 5KZDA 4N6FA 3N2XA 1W3IA 4IXHA 1SR9A 1TB3A 1SZEA 5K4ZA 1Q6RA 4EVZA 3NQGA 3HGOA 3W1PA 3ZWSA 3W1AA 3TV8A 1DJNA 1VCVA 1JCYA 4DELA 5LHEA 1LCOA 3NEVA 3C2VA 1WBJA 3PY2A 3YPIA 1KM1A 3KVKA 3RFAA 4M5PA 4TU1A 5U7SA 4MLRA 3QM3A 4AF0A 1L2UA 2ZTJA 3W70A 1QMLA 4O11A 1FXQA 3G24A 1S5TA 4Z1CA 3HGSA 4M6PA 5HR6A 2V8ZA 1Q6QA 3C4UA 3W1LA 2XN2A 2FPTA 1JRCA 2RH9A 2ZYFA 3NPXA 3IIZA 4UR7A 3N2MA 3BG3A 2DZTA 2E6FA 2Z2UA 3KVMA 5L9FA 3L65A 1QCWA 1FXPA 4PH6A 4ZQPA 3TCEA 2Z6JA 1W56A 3QMRA 4MY9A 3W2LA 4LWWA 3S1VA 4BFAA 4FIQA 4NVTA 4EF8A 2ZFAA 3GDKA 5F2GA 5H91A 2ZZ6A 3W7KA 3C2OA 3TIMA 3QQ1A 5G5IA 3CWNA 1D9EA 1W1ZA 3TW7A 4JIQA 3BARA 3HOJA 1H7OA 1TPDA 3PAJA 4POCA 3L67A 2BXVA 4O1AA 3HMJG 2X1TA 4LV4A 2E68A 2ATMA 3OBKA 5CPMA 4UXDA 4RJEA 1OF6A 4NJGA 5DELA 2C14A 3LCLA 1P5BA 2NX9A 4UTWC 3C2FA 4GRSA 4NJKA 4OU1A 4QISA
chains in the Genus database with same CATH superfamily
1VFTA 4DVOA 3AUJA 3CIVA 1IE7C 4GZJA 3DENA 1VFFA 3B97A 1F3WA 5I3IA 1X6NA 2BHYA 3AISA 2PDMA 3SM0A 1OYBA 5LIWX 3QV9A 3HPSA 4FMVA 3CAQA 1KRAC 1RD5A 1E43A 3M0JA 4OUEA 1B3OA 2Q6ZA 3KS6A 2YOCA 3ZVIA 4Y9NA 1N8FA 1TRDA 3GAYA 3T1GA 1E56A 4JYFA 3WEMA 3MZNA 5HPCA 3L9CA 2ACUA 3HM7A 2NQJA 3GTXA 1AMKA 2CEQA 3IK4A 1JPHA 1QDSA 3ES7A 1BKSA 4DUOA 1OIFA 3M07A 5D2VA 2HEJA 1DJIA 1YDYA 5IBXA 4NAFB 1Q4NX 3S2NA 5EU9A 4J3TA 1GHSA 2CZFA 2HWGA 3NCOA 3FYYA 5C7HA 3C0JA 1YNPA 1E1CB 1XIGA 2QJIA 1MXDA 1YDNA 3FHQA 3GC2A 1K03A 1U83A 4FIRA 3GKFA 4FK9A 2JIWA 1F6PA 3TR9A 2D73A 2CBJA 2XH2A 3KX6A 3VD4A 4AZ6A 2CETA 1XWYA 4ECLA 1JZ4A 1FWNA 1ZAIA 2VEPA 3AMCA 2QS8A 1TPB1 2E25A 1HNYA 3G1XA 3GSMA 3WELA 1XS2A 1GVEA 2Z1BA 2OQHA 5HPOA 1CECA 4XZBA 1ESWA 1I60A 1VR6A 2D0FA 3THDA 2CBUA 1VPQA 2BBFA 4C1LA 4HYWA 3W84A 3V0SA 3E96A 1W8GA 4H8VA 2VR4A 4MZ1A 1UOZA 5FJRA 1OSEA 3TYAA 2GPTA 2DT0A 3EB3A 4D8LA 1ZZMA 4P7NA 2YLLA 1KXVA 1BXCA 2WPBA 1GKQA 1JPMA 3AIQA 5MHBA 4Y9PA 4C6FA 4DPQA 3C0LA 3KL0A 4RPPA 4ERAA 4J3XA 5AC6A 2E77A 4HYVA 4YTRA 4KT2A 5REQA 3JW7A 2DH2A 5FCZA 4PUJA 1G9HA 1I1XA 2BOGX 5XINA 1GZGA 2P3EA 4ZVJA 4N0RA 1U5JA 3BLPX 3KTCA 3PF3A 4UMBA 3B9EA 5M17A 2EPLX 1ZBVA 2PDWA 5T91A 3VOFA 4O17A 3FYOA 2DZSA 1FCUA 3T44A 4I90A 1GQKA 3U2OA 2GVEA 1J18A 3VDGA 2D0HA 3F7JA 3G8EA 3B8WA 2ZX9A 3REQA 3G0SA 5D37A 4E4FA 1REQB 3WLNA 3DI0A 3W28A 4DQWA 3E49A 1US0A 1E0TA 2CLOA 1VEOA 4DZIA 1HXJA 3MUZ1 2WJDA 4AMAA 1HKJA 4HNUA 3FKKA 3P80A 1HVXA 3GW3A 3QKZA 3FGCA 4EX4A 4K1WA 3G18A 2Y5SA 1OFQA 4J3UA 2L5HA 2BY1A 3K8MA 1XF0A 3N4FA 3THQA 4IPIA 1FVPA 2FZNA 3RPTA 1UYQA 3SY8A 1XYFA 2JIEA 1K6AA 1A3HA 4RKAA 3KOWA 2AL2A 1YBQB 3M0MA 1E6RA 1OG6A 3TC3A 3VCCA 5AHIA 3MYPA 1K8XA 1S2CA 4CU8A 3U2CA 2GVJA 2INEA 2ZUUA 4F40A 4S3EA 1LUCA 2PSNA 1EXBA 1W91A 1J79A 1XCWA 4KRUA 2OPJA 1XC4A 3BSGA 4JDBA 4JNZA 3V16A 1JPDX 4YCOA 3OQ8A 1XGEA 3HF3A 2X0YA 4JN8A 3SZ8A 3CIXA 3KRZA 3B0YA 3W29A 3UZWA 3WF4A 3OYXA 4M80A 3LU2A 3HMCA 3AYVA 3VNIA 4H6RA 5D03A 3OHMB 1G1YA 2WJFA 2ATSA 3P5YA 1T40A 2VZTA 6TAAA 3DFOA 1OCNA 4KKXA 3VIPA 1VPXA 2WC3A 4N7QA 1JCMP 4YU1A 2NQZA 3L4VA 3L23A 2YDRA 1EJ7L 3U9IA 4Z2GA 2Y7FA 3S6TA 1EGMA 3EXRA 1F76A 2GWGA 3W86A 1LWHA 2R1PA 3EX3A 3KL3A 2EHHA 4GX8A 5I3DA 3QJAA 1UZ4A 1H60A 1L6FA 4W5ZA 1WDSA 4GIRA 2W62A 3H22A 4XZ9A 1IZJA 4Y9AA 1I2NA 3AIWA 2BV9A 2RDXA 3GFZA 4BKNA 4AXKA 2DU2A 5EMLA 3EMQA 3RRXA 3DCPA 3EA1A 4O8AA 3OZPA 2XSAA 1OC6A 1L2QA 4ZA0A 1GVRA 1Q13A 4PMUA 5C9RA 3TFXA 1UWSA 4AEEA 3TJIA 2OXNA 1BVZA 4M1RA 1A3WA 1F4HA 2A3EA 3KTSA 4UFJA 2BOFX 2XFWA 4A3YA 4DO6A 1S2AA 3ICJA 2XFRA 3BTNA 1MW3A 3K4DA 1MUCA 3V3WA 2ZUSA 1R0MA 2FTYA 1U5HA 5E1QA 3W3OA 4Z17A 2WNWA 1ITCA 2FVMA 3NQBA 2ANUA 4QGCA 2VEMA 4GWEA 5E5CA 5LIXX 4H8HA 1E6ZA 4P8UA 3T6CA 5LA1A 1XSKA 1BKHA 5I2UA 4ZQRA 4FNSA 1C9DA 3WQPA 1XBYA 4HYRA 1DIDA 2BHUA 2QVNA 4NF7A 1U5VA 3EB2A 3I3EA 3RF9A 3WZ0E 3ZLFA 3EZ4A 4MKNA 1UMYA 4UCGA 4L4MA 3B40A 4ROQA 2OZ0A 4L9YA 3ZIZA 1F07A 3CZJA 4NNAA 1J0ZA 4JKMA 1UH2A 3S1XA 1JAKA 4EWJA 1FWFC 4LPCA 3WQFA 1L8NA 1KM2A 1MSSA 2I1OA 4LAZA 4REQB 4JTTA 1SJDA 1ZLPA 1N55A 4PBEA 1H3GA 1OYAA 4MMWA 1B9BA 4AG0A 3TN5A 5BXRA 2Z1KA 3A47A 3V1PA 3GDRA 2FJKA 1YNYA 1V8EA 4UOZA 1BYCA 4ML9A 4ZOEA 1EZ2A 4WGXA 2Q01A 3DESA 3GR4A 3APTA 2FMNA 1UROA 4AZGA 2CWXA 2LLEA 2VFFA 1TIMA 4OV9A 4H7CA 4AZBA 3S6DA 3VUPA 1EIBA 1ZBKA 1B0IA 2Z26A 1WUEA 1SJAA 2VDHA 1A0CA 4TVDA 3GNNA 3CPUA 1BWKA 1A53A 4C6MA 3SBFA 1O5KA 1LL7A 3TXZA 2EXOA 1QO5A 1YXCA 2QV4A 1V3IA 1ZRQA 3OZOA 4QJ1A 3VCRA 3BMWA 1PAMA 3EPNA 3L4XA 1JDAA 5HOSA 4MVAA 3CZKA 4F66A 5F2LA 1VFHA 4GINA 5JBDA 1KFKA 4HA1A 3PBUA 2Y85A 1G4PA 1V6WA 4QQUA 4HOWA 3M9YA 4Z0JA 4EPKA 1VFOA 1QNVA 3E2VA 3VIKA 3S2MA 3PPGA 5JXQA 3NQFA 1TRIA 5AHNA 4N9CA 2P0OA 1MFUA 4JIHA 2G50A 3UPWA 3MKKA 6ENLA 4I5UA 4EACA 2VD9A 3ISIX 1JDDA 2PPGA 4L61A 4DF1A 2PWDA 4IG2B 3BC9A 2QGHA 2QAFA 2ZRUA 2TRSA 2WHJA 4IQJA 4MB3A 4K8EA 1FUYA 4IQLA 2FYMA 4LTSA 4WXYA 5G2WA 1V93A 2E67A 3IGUA 1TMLA 3C8FA 4NL1A 4MYXA 2XIBA 1T6MA 1RJPA 1F6KA 3D47A 5CBBA 7XIMA 4F0SA 1XM3A 3MHGA 4XD4A 3SCTA 2VL4A 5LIUX 1W9BM 3QPZA 2Z1SA 4XX6A 4N9EA 4MWAB 1NQ6A 3NEHA 1BD0A 3GDBA 4GJJA 3LCFA 1BEUA 3LBCA 4S3DA 2FDMA 2D2HA 4C6DA 3EBVA 1LL6A 3FJ6A 3WK0A 1SW3A 1Q7ZA 1TTPA 5C2CA 4AVFA 3QFEA 3EX2A 4HPNA 3VOGA 4LX4A 2XH7A 4UFHA 1XGDA 3A22A 3ABZA 1PUDA 2TSYA 1SSGA 4O13A 4ZSUA 5J5DA 3MWCA 2UY2A 4J9JA 5FSDC 1RHCA 2NZLA 4D6EA 3RX3A 3P82A 4A4AA 1Y7VA 3NL6A 4K1GA 3VGEA 2A3LA 3BGJA 1J0KA 3GVGA 1EEPA 4DUWA 3KBJA 1OX5A 3AHVA 4GH1A 1C93A 3TR2A 4PUWA 4J4KA 3L21A 3LZ5A 5F4WA 4F0RA 4HPJA 2B7PA 2X05A 3PC0A 3WQ4A 2W27A 3EPOA 3VNMA 4FA3A 4H3DA 1HZYA 3DBPA 1I45A 3GFYA 4LW7A 3SIMA 4LBUA 4NRRA 1J96A 3WNNA 4DJFD 4OFCA 2EKGA 2JEPA 4GY0A 2WCGA 4N9BA 1Q3NA 2QMKA 4J3WA 2V5DA 4NYUA 3WFAA 3KFTA 1GYMA 3PZ9A 7TIMA 2WVSA 1JZ8A 5RUBA 3ZT5A 5E93A 2ZZ2A 9XIAA 4K7YA 4NNBA 4QROA 3NAVA 4FNUA 3KOFA 1GJPA 4N02A 4H01A 3TAOA 4IFRA 3CJPA 5FL0A 3QZAA 4QCEA 5HUOA 3GG1A 3CUZA 1V77A 4DWSB 3P0WA 5CSUA 3R2GA 1RQEA 5LIYX 2ALRA 3I6RA 3UD6A 3O1NA 4LY8A 4B3KA 1YPXA 4NRSA 2CXGA 3ZVHB 4YVPA 2TAAA 3GE7A 3KAOA 1UR8A 1GOKA 1BFNA 3IJIA 4UTLA 1UD2A 3PUDA 3WJXA 2WSYA 2XH4A 3IJ7A 4A05A 3PN8A 3T0CA 3AMGA 3WUFA 4RW5A 4JKKA 4XUYA 4AEFA 3OHIA 3AO0A 3DFHA 4ZO7A 4KEUA 2UY5A 4UTTC 1TX2A 1K9FA 2EEXA 5BMXA 3O06A 2P5NA 4P61A 4R7OA 3N15A 3LLXA 2H8ZA 4I3GA 3CLMA 2WCAA 1DPMA 4BI6A 4K8HA 1J6PA 2WMFA 3PJXA 1JG9A 3MI6A 5A8PA 3CMJA 3L4WA 2D3NA 1XBVA 1KM0A 1C90A 2I16A 1S2WA 1UKQA 3CQIA 4L6DA 1E40A 4L9XA 3ENLA 4G2DA 3BW2A 1W9XA 4C6BA 2YIHA 3KOZA 3FIGA 2G96A 4M29A 4JIRA 5G1YA 1PJ9A 1E1EA 4JDYA 2J7EA 4C91A 1TV8A 1FP9A 1G0CA 4PEEA 1UD8A 4ZR8A 1EEXA 4GLEA 1RAKA 2XISA 1B2YA 4LS1A 2QQ6A 4D1IA 2WANA 3UGVA 3ITGA 1W6TA 3ABRA 3M0KA 1X98A 3MBFA 4J7RA 2B0MA 1P1XA 5HULA 3WF0A 1UKPA 1FDZA 1ZHAA 2JALA 1GGOA 3SFKA 4WX2A 2FQIA 1M3UA 3VFCA 4IGHA 2HBXA 4X0NA 5GVJA 4ZO8A 3T07A 4XVEA 3RITA 3PANA 5IDIA 2HV5A 1KKRA 1KO0A 3GC4A 3PTKA 2DUXA 1RALA 1EX1A 4W8BA 5GJPA 3T40A 4IPLA 3BZGA 4IIEA 4Y8EA 5I7GA 2WW5A 3EWWA 4JHOA 3EDEA 2FH6A 4A35A 3QPYA 4AZCA 2VQUA 2JBMA 4AF0B 5T26A 2I5GA 3R89A 1XBXA 3O16A 1FH7A 3MV01 3LTYA 3W6LA 5E9XA 3AC0A 3PULA 1YW1A 1PZ3A 1VJSA 2ODOA 4DYJA 2KZHA 1ITQA 3GG8A 1K1DA 2VGFA 3ITXA 3QY6A 2YCJA 2B7QA 3C8NA 1HKMA 4LALA 4TMBA 1ZAHA 4C1KA 4D72A 4NXKA 2AMXA 2VX4A 4DF0A 4LCQA 4DZ5A 4WQ6A 4J1OA 1QNPA 4MYAA 3S46A 4DN1A 2KAUC 3PJWA 3TJLA 4ACZA 3AHXA 4CQ8A 4FEZA 3Q45A 4AB4A 4GO9A 5FF3A 2HNEA 4ZO6A 3ARZA 4IJBA 4Q4RA 1RK6A 2HDJA 4GPNA 4GNJA 3ZWTA 4FALA 2C6QA 6TIMA 5DCEA 4D71A 1XRSA 3HGJA 3T78A 4ATWA 2IQ0A 5AHEA 3V36A 1MNSA 3SQLA 4LC8A 1A5MC 1FWHC 3CMGA 1JXJA 1K02A 4LRSA 3RLUA 3TNBA 3CPRA 1PKLA 1UW9A 3VGDA 3WNMA 4V27A 3VNZA 3TMLA 2QPSA 1AQ0A 3BLIA 3QY8A 4QTGA 4E6MA 1VENA 3BPWA 1MUWA 2YJQA 1CX9A 1BTCA 2DZXA 3CHDA 4AD5A 3CM4A 1QI0A 2HSAA 2GGHA 2GJXB 4KS0A 4QM1A 1SVDA 1W9UA 3KM8A 1IIHA 1UZDA 2WHLA 4UC5A 1X1NA 4AEOA 4NILA 3EX1A 1W3KA 3IJ8A 3VYLA 3F03K 1OFOA 2RHGA 2ACSA 3G6MA 2VELA 1PCWA 3BG5A 4JNMA 3TLQA 2P76A 3QOKA 4I8DA 1TVLA 3KCOA 1I4NA 3QFWA 2J78A 3TYUA 3F2CA 2DIEA 3RN6A 3EDFA 1VJIA 1XYZA 3CT2A 1IT7A 1UJPA 4HPGA 3FK4A 5F4XA 4J3ZA 3TDFA 4US5D 1W5OA 5M03A 1I8JA 4JEJA 5B80A 3GIYA 5C8BB 2VCCA 3NQ7A 3PBWA 2VOMA 5HQLA 4RDZA 1I9CB 5EFDA 4KFNA 3WUBA 1QPRA 4KEMA 4NT0A 1R38A 2OZTA 3WNOA 4GY1A 4C6LA 5FEXA 2R14A 4IJRA 5DCDA 3GXPA 1VKFA 1ZQ5A 1MQPA 1W3JA 4YNGA 4BS0A 1OFBA 1EDGA 6ALDA 2ZA2A 1DXIA 4G1NA 2W3ZA 1QHPA 1UBSA 1OFDA 3LTSA 2XGZA 1SJCA 1MWOA 4Z2JA 1CXLA 1XHGA 2F8QA 2PDIA 3CU2A 4H9ZA 2DZUA 2QW5A 5GNZA 3L5MA 1YLVA 2C8NA 3WLIA 1BHGA 3WBEA 3KP1A 4ZO9A 3MTWA 4JZ5A 2PTDA 3GR7A 1XQLA 4HTYA 1PXGA 1XLLA 3VO0A 5A6LA 1U30A 3VGBA 4PUKA 1FRBA 1W1VA 2HBVA 5C54A 3W1QA 5REQB 1CPUA 1EC9A 5CZ0A 1K8CA 4MOZA 3UZXA 2J13A 1NWRA 5LNVA 4IISA 3CMFA 4JTEA 2H8XA 1PB0A 1E9IA 3WLRA 3H7VA 2FZ9A 1DIEA 2ZX7A 5EB8A 1MI3A 2C79A 1HIZA 1KGWA 1GQNA 5J5RA 1DXEA 5G4WA 2V5BA 2V5LA 3R8RA 5HINA 5HDRA 4A3UA 3FXGA 4UFIA 1K9EA 1W9PA 1OD0A 1E55A 1WQ5A 4K7VA 2IPGA 4ICMA 3REQB 3UVAA 1FCBA 4GUHA 4OBTA 2PP1A 4IL2A 3H2AA 1ZALA 3B0VC 2R9RA 2CU0A 1PTAA 1EJSC 1JYNA 4KF1A 3S5SA 1X6UA 4FNQA 4CNOA 3KVJA 1G4SA 5EKYA 4R53A 4Z1YA 3BH4A 3FGCB 2XHYA 1XLGA 1K7EA 5FEWA 1L0PA 2X1IA 3ONBA 4JTHA 1VF8A 2BDQA 1CI1A 2BFGA 3NQEA 3PR2A 1Q65A 3MKVA 3U48A 4H8NA 1XH1A 1BVWA 2QR6A 2AL2B 1S5WA 3QTGA 3M1ZA 2DH3A 4LBRA 4LUIA 1PTDA 1LUCB 4O1FA 1IEVA 2WOQA 4DJDD 4PODA 1I6NA 1H7RA 3B4UA 4FSAA 4UFKA 2FVLA 5BRBA 3W25A 3AMDA 2QF7A 4RDVA 5DANA 2X16A 4HPXA 2DVTA 4NI8A 4U10A 1E3XA 2DSKA 2G3JA 4I5XA 4PB5A 1E1FA 2V3GA 2DDXA 5AZ1A 5JBFA 4GXPA 4IFOA 4LNCA 1OCBA 3EOUA 4C1NA 1H11A 3SW6A 1UR0A 1Q6CA 3HO8A 1LT8A 2ZX6A 2OU4A 4RX0A 3TTYA 1AD4A 4O54A 4LCSA 3PB2A 4E2BA 3ZXWA 1FX6A 2FZMA 5JH2A 3MQTA 2YZ5A 4UTJA 3U4AA 4CNUA 1RJRA 1WOAA 4GBUA 3LCHA 4PTNA 1XX1A 2A21A 3LB0A 3S42A 3FVDA 1B90A 3OYZA 1FDYA 5HBFA 5DX7A 4CKQA 1XRFA 5LYRA 1FQ0A 4L7ZA 2FZDA 1M65A 3KCLA 5M1TA 3NO1A 4E4PA 2BY2A 1I1WA 1JFXA 4D6DA 4S2CA 5EFFA 1XSIA 1XR2A 3AWOA 3WO8A 1A5KC 4KRTA 4R3UA 1I0DA 3ZZ1A 1HL2A 4U31A 2CLLA 4B2DD 1VZWA 1GOWA 1UHVA 5I77A 4ICCX 4CQAA 2NVDA 5CJMA 4QX4A 4WJXA 4XVDA 5CPSA 3TAKA 3WN6A 4DJFA 2EBNA 1WDQA 2XZ9A 2JK2A 4BY3A 3W9ZA 1YPFA 3PUOA 3P93A 2RUSA 2QCFA 1DQUA 3A64A 4HN8A 3W7RA 5LHFA 2J74A 2QDHA 3R8HA 1UPPA 2EGZA 5C7VA 2BVWA 3W4RA 3SN4A 4MNLA 3QQ0A 1NELA 4AH7A 3AUOA 3W2UA 1AG1O 5A6TC 1E15A 4KCWA 1VEMA 5LNRA 3IIVA 1UQYA 4PR4A 4EIVA 5C2XA 1FWTA 4F8XA 3NURA 3WNKA 3HB9A 5MF5A 4NIRA 8A3HA 1TJPA 4RXFA 3R79A 2OQYA 5HNNA 5FI8A 2DT3A 4J3SA 3ZSSA 1E6QM 3DOPA 2RJGA 3MP3A 1RA0A 2A3BA 3ZQ9A 5A6AA 5E0KA 3NZGA 4PC8A 4UQDA 3A23A 2VC7A 3W7MA 2Z29A 4ZCWA 4R33A 4O14A 4ATDA 2XVGA 2C15A 4D2JA 2UV8G 1XLAA 3CZ8A 4G5DA 1VRXA 1NQKA 4GYPA 3LRKA 3GBEA 4GA8A 3F5LA 2R1MA 3EEGA 1Z89A 2WQPA 1F74A 4UOJA 2V5KA 1EGVA 2GUUA 1GG0A 3NZPA 1UB3A 2VR2A 4ZQNA 4NUWA 3BLEA 2D20A 3UY8A 1H61A 1V6TA 1E3ZA 1DE5A 1X7FA 4HNTA 5FJPA 1A5SA 4NHVA 2NW0A 1XW8A 1RCQA 5PTDA 3EMCA 2QCHA 4JTFA 1B57A 3KRUA 5C9WA 4JTIA 3ATZA 1Y5VA 7ODCA 1EUAA 3P81A 3KDOA 4FNRA 2XPKA 1E6PA 2XIJA 5LNUA 2ZRYA 2BX7A 3GDMA 1YRRA 1QPOA 3RG6A 1OT2A 1Z42A 1HUVA 3WNPA 1W9VA 3W1XA 3CUJA 4FAMA 4UWMA 4KW2A 3LHYA 2PU0A 2ZWYA 3RLGA 4WDTA 4JTJA 3N2XA 3A4XA 3KWXA 1B3ZA 3H2FA 5K4ZA 1TB3A 4WDXA 3NQGA 2Y8UA 3JUGA 4EPBC 3TV8A 1JCYA 2C0HA 4LB4A 1M9HA 2ISDA 3NEVA 3UW6A 1WBJA 3L12A 1KM1A 4WSHA 3RFAA 4M5PA 4TU1A 3QM3A 3W70A 4QLJA 1EJRC 1WP6A 3V7PA 2VX7A 2C7FA 4QFUA 5HR6A 3MJMA 3BSMA 4HMEA 1JRCA 2RH9A 4LBSA 1JGMA 3UCCA 4JPGA 3BUVA 4Z42C 4ZQPA 4FOUA 3U57A 2XZ7A 1ZS2A 1R87A 4MY9A 4LWWA 4EF8A 1KBKA 5F2GA 2XGBA 4DI9A 1D3CA 2DW6A 1XJBA 5G5IA 3CWNA 5XIMA 2DT2A 4JQAA 1W1ZA 4BJHA 4RNJA 1KKOA 3H26A 4LYKA 3HOJA 1DEDA 3K8KA 4POCA 1CNVA 1XIBA 3VAVA 4LV4A 4LCRA 1RVKA 2OX4A 4NJGA 3EKGA 5DELA 2C14A 3WLOA 2O4QA 4D6CA 1B9ZA 3D6NA 3WQVA 1BF6A 3B8IA 4WOZA 4OU1A 4QISA 1HN1A 1Z6KA 4AD2A 1NWUA 1CGVA 1ZBWA 1GOXA 3S5OA 4BI5A 1U22A 5G4HC 3WQOA 1CENA 3G1HA 3VIFA 4S3BA 2BZNA 2CBVA 3GRIA 3I3DA 4AZIA 4JX6A 4QHRA 4JS3A 1AW1A 4PL2A 3GC5A 1S2UA 4Y9MA 3QTPA 4AZ7A 3TROA 4DJEC 1AK5A 4IT1A 3WEZA 1IEQA 4PTXA 4HK7A 1VCFA 5BU6A 3T08A 1PYFA 1FY6A 5JIPA 4EPDC 4BHYA 4PE8A 3AIBA 1WDPA 3N3TA 1VJZA 4TOQA 3A6OA 2C3ZA 1UP0A 1QASA 3ABXA 4JQ1A 1P1MA 4O0ZA 3MHUA 4Z2LA 4ZTXA 1OGSA 4TO8A 3LHWA 2B7OA 3ZR6A 4IXXA 1E70M 4G6CA 1ML1A 3G3MA 4HMDA 5CZJA 1OD8A 3TEVA 3VU2A 3TWAA 3V35A 3F2DA 1F5ZA 3LLDA 2JEQA 3G1VA 2PTWA 3C56A 3DKJA 3TNOA 4HD5A 4MJMA 4DBSA 4IMAA 3RX4A 2VGGA 2O9RA 1OM0A 3CAWA 4XV0A 1FWDC 1WDWA 3MB9A 2XVPA 4I7VA 2VGBA 1UP2A 2GQAA 3GD6A 3GKAA 4B5UA 3URQA 3G0XA 4NZCA 5F2MA 5FF4A 4US5A 1PZ0A 2E1DA 3VC5A 3UJ2A 3MSGA 3BAWA 4Q33A 3GW0A 1CB2A 3M0ZA 1XIDA 1HW6A 1P6CA 1KWGA 3GY1A 3A5FA 2IPJA 3P74A 4X22A 2PBOA 3UXDA 1PWLA 3R25A 3UG3A 2WVVB 3BK0A 3L68A 1DE6A 1D7FA 1DTUA 3BJTA 2OWXA 3NPVA 1XIEA 2WZHA 2FPYA 4XAPA 4X9YA 4NJIA 3GX9A 3ZT6A 5HMFA 3DBNA 2V38A 4IP4A 1RPKA 3OGRA 1X8CA 4L9ZA 1UPMB 1V3JA 2IS7A 3P7YA 4L4LA 4OQVA 1JNDA 3FV9A 3MU7A 4FP1A 2Z25A 1P0NA 1Q6DA 3P2VA 5CJNA 2VX6A 1XI3A 5DY2A 2J25A 3F4DA 4JL1A 5CAKA 1TE1A 4JICA 2WBKA 2PWVA 1PYMA 3OP2A 4PUMA 1QI3A 3STCA 1JCNA 5A6JA 2ZXBA 3DG6A 1U1JA 2QF8A 2FB2A 4JFWA 4PTVA 2PRLA 3SURA 5FF0A 2FPVA 4QQ3A 4ZL1A 3U2ZA 3JVAA 1NDZA 4JTAA 3MYOA 2PMQA 1I2RA 5GJMA 3CIWA 4PUDA 3VOIA 1M1BA 4LC6A 4UCFA 3WH8A 3S9IA 3UY7A 2V2CA 2I7GA 4GQGA 4JTKA 4TVCA 4XAGA 1BAGA 5FEZA 5H6HA 1FKWA 3GAKA 4ATLA 4YN5A 4D6HA 1Q8AA 5LSMA 3IGHX 3WJZA 4KWSA 1XLKA 1ZU8A 2H90A 1GOMA 3BGAA 3F1QA 3IARA 1ZGDA 4XD3A 5U4NA 3SFWA 1HO1A 3R8GA 3ABQA 3PUGA 3DUGA 4RE4A 3C2YA 2GUYA 3LA4A 2BWGA 2XYLA 3B0PA 1PKMA 2RAGA 5AZ0A 2ZQ0A 2J9ZA 3QYSA 1LBLA 3BCFA 3LG3A 4D8AA 2RFGA 3OA3A 4LY4A 5CPLA 3APGA 3N13A 3LMYA 1PHQA 1Z69A 3DEQA 3QV8A 1XKJA 4ZE4A 7ENLA 3ABOA 4DHGA 5A8QA 3T05A 4UMAA 3BDKA 4EANA 1BLIA 4GUJA 2ADAA 4H1ZA 3MZ2A 4AZCB 1QT1A 1V4YA 4MJ2A 4L64A 2YA1A 1ADOA 1R46A 2Y63A 4H6QA 3AHYA 3T7VA 4LH8A 3ANYA 3TW9A 2YW3A 1I2PA 2E5CA 3MO4A 3WK3A 3NL5A 3AWNA 4OKDA 3QR1A 1P48A 2Q09A 4JTCA 1UUOA 3W0KA 4FR1A 4J2PA 5JMUA 2EPMX 4QJ3B 4IQDA 2QAPA 4PN2A 3NM3A 1PIIA 3B8SA 1NDYA 2I56A 2OTDA 1Z7AA 3WD4A 4YXGA 4MWAC 4DJDA 3TCSA 4CU7A 4DAIA 3G77A 4S3AA 1TZZA 2GZXA 1SMDA 4ACZB 4QAIA 2YKKA 3A4WA 4YLWA 2X8RA 3B8DA 3E1F1 4CN4A 3K8LA 1P0EA 4IP7A 4RNFA 2NVAA 3QGVA 1VBRA 4JIEA 1H5YA 1J0HA 4ZB5A 1OGGA 5CPOA 2GGGA 4XBSA 3GU9A 3N3MA 5J8LA 3VZXA 4BWLA 4CN1A 5A2BA 1X39A 3GK0A 2VCBA 5BXSA 4XKYA 4EKJA 4GG9A 1UR1A 2HCVA 3LY0A 3M5VA 2WSQA 1GTHA 2VNCA 2OWCA 3DYMA 3JU2A 1XYBA 4Q4PA 4EPEC 4AWUA 1JZ7A 3T0TA 2VMFA 3KHJA 3VNKA 3WLMA 1F4AA 3CC1A 2ESCA 2G3MA 3SRFA 1R3VA 3P0XA 2ZUNA 5H2ZA 1YE6A 3LV5A 1SMAA 1Y65A 1HKWA 4TX8A 4IMFA 4P8VA 2R6OA 8XIMA 2NWSA 1JVNA 2DZBA 5SWUA 1K77A 2Z1WA 4FPSA 4IPPA 3ZMRA 1N8WA 1XINA 4EXBA 4ZBCA 1D7KA 3G8RA 4E3VA 5LGXA 3H53A 2YCLA 5DXXA 2UBPC 4YTSA 3DECA 3GM8A 3TTQA 4K2SA 4PYSA 1QPKA 2YXGA 4GK8A 1A5UA 1UWIA 3QGKC 3VINA 4R88A 3CXOA 1M01A 3WQEA 1D8WA 1S38A 4Q3MA 2GJPA 5AYXA 4FXRA 3RM8A 1CXEA 2W6RA 5I3KA 5D09A 1B30A 3K1DA 3K4AA 2ASHA 3PUEA 3SQMA 1UCWA 2OLAA 1QBAA 4PMOA 2D2JA 2I14A 4WEVX 1C7SA 2G3NA 1A80A 2YSWA 3V4BA 4Q8VA 2XFFA 1K6WA 2NLIA 3THUA 3GU1A 1J93A 2IXVA 3L66A 1LRTA 2CZVA 2E9BA 2FDSA 1A49A 1SFSA 4NG3A 2R94A 3M0VA 2PDBA 3O05A 3TKFA 2PLCA 3IUDA 3OG2A 3W1MA 4YYFA 5LNSA 3BO9A 2E1WA 2PDUA 3COTA 3SAZA 3N2OA 2XH0A 2QCDA 3LGGA 5BRPA 2V9DA 5DXYA 3WJYA 2I17A 3C2EA 1UBPC 4RW3A 3PNUA 3VGHA 3ZR4A 5JH1A 3WSUA 3NDOA 1UZHA 4WSKA 1UJQA 1KFBA 3AZRA 1VEPA 4L6HA 1DJXA 3LQLA 4LXFA 3BICA 3GHUA 1A3XA 1JAEA 5K9DA 3W73A 1EO5A 3N6QA 1BYDA 5D05A 1TTQA 3ZT7A 3D0CA 4W87A 4DPPA 1EO7A 1YE4A 4LB3A 3WBXA 2FMOA 1UASA 4UBPC 4M7TA 4BZYA 5IFPA 4MKVA 3FJ4A 5JU6A 5E9AA 1V03A 2ZUTA 3LXAA 4NZ4A 4U3CA 3UCDA 4BCEA 1BTMA 3DH7A 1R9ZA 4HB7A 3TSDA 1QOPA 1EC7A 1VS1A 3LXBA 4FLSA 2TODA 2YDAA 2P3ZA 3PM6A 2YDSA 2EJ1A 4IIGA 4URIA 3NDYA 1BWLA 1LLZA 3W27A 1TV7A 4DM2A 2R24A 5TQLA 1KA9F 4EP8C 1DWGM 5BRQA 3NGFA 4QJ5B 1ONEA 3SQSA 1E72M 2YX0A 2V3DA 1UC5A 2IKJA 5AYBA 4AISA 1PX3A 4RZ5A 3A9BA 1GWJA 4MHBA 5KETA 2ZRZA 4HSNA 3RR4A 2ZCGA 2OR2A 3CV6A 3HFTA 2XIMA 2EPNA 4DUXA 3RCYA 1DOSA 3SDOA 5B7ZA 3EKZA 3LZ3A 2NLYA 2GDVA 5CQ1A 3RM9A 1GT8A 4A29A 1KXQA 2DIKA 2A5HA 1R86A 1WPCA 1H50A 3VKBA 3TQPA 1IR2A 1TFVA 1AQHA 1KR0A 4PCPA 3LI0A 3SI9A 4Q8QA 1XUUA 1DP0A 1MYRA 5K9XA 1FWCC 1VAHA 1M6JA 1MO0A 1Q45A 3VABA 1Q2RA 2INFA 5MKGA 3OJGA 4CN6A 4M6VA 3HQNA 1MUMA 3OPSA 3WIJA 4U2ZA 1AL8A 3G6LA 4UQEA 3DXIA 4NP7A 2GFTA 3DC8A 1ZFJA 1CTNA 3LCIA 1UD3A 2JKAA 2IKHA 4BQ4A 3PTDA 4EK7A 2PZ0A 3KXQA 2RDTA 6A3HA 1PO9A 3BURA 3M6YA 2VWSA 5IHSA 3IGSA 4XB3A 1NOFA 1ELSA 2FFIA 1RY8A 3A9IA 2NSXA 4QSFA 2GL5A 2ACQA 2VCAA 3E2RA 3H2MA 3CAKA 2J79A 3ZJ6A 1JULA 3IUHA 4GFSA 2QCEA 1BRLA 4ADUA 1Y0EA 2JQXA 3DZ1A 2GSHA 5FEPA 1HGYA 1E6XM 3GHSA 1XDMA 2OGYA 2CLIA 1QJWA 2DQWA 4PRTA 3IJDA 4V33A 4XBJA 1EL3A 3BG9A 2Y70A 4V1XA 1TV5A 3TH6A 2OYKA 3S4TA 5IBXC 3NOYA 1KB3A 1YQ2A 1PZ1A 1AUSL 1E0XA 3QQWA 2C0AA 3QY7A 1RBOB 5K3VA 1W1TA 1WXZA 2QCMA 5E0FA 2WLZA 2J27A 2GLKA 2Y89A 4HMNA 5EMYA 3D3FA 3USBA 4HVXA 3N12A 8TIMA 2ZRVA 4MDPA 2G37A 4JKLA 2VFGA 3MP4A 4XTIA 1OGBA 5I06A 3M0LA 3OODA 5EYWA 3KBVA 4ZGYA 3LCXA 3SUWA 1W32A 3LHTA 5EBAA 2O56A 3GUGA 4IUGA 1KM4A 4QDWA 3HURA 2HXTA 5D8ZA 4W89A 2HPIA 4I8YA 3AHTA 2ZC1A 2VXNA 4H9MA 1HT6A 1LOSA 1PBGA 1SO6A 4DBWA 2MUCA 1WKYA 1XCFA 4KESA 1ONRA 4Z2KA 5E6ZA 1YADA 3GXDA 1SO3A 4AD4A 3G3DA 3E0LA 3ZSTA 1WKDA 4QNWA 2Z2AA 1GKPA 2OOFA 3GLCA 1G6CA 1V51A 5EY5A 4DBDA 2WHKA 2CZDA 5DFAA 4WUIA 3NNTA 4TV5A 2Y88A 3GNOA 4BQ3A 4BF5A 1IXPA 3AJXA 5D02A 2YGYA 1A50A 4Y8FA 3MUAA 2J8FA 4BF9A 4EAMA 4P8WA 4RE3A 4M51A 3LERA 5CSRA 1EF3A 2VHLA 4JHMA 4AHPA 2A0NA 2D22A 1TMHA 4IMEA 4TIMA 4ZFMA 1KTBA 3EXTA 5DEZA 4GOAA 1XLCA 1CB7B 4A3RA 3GVRA 4XD5A 5HNTA 2GQ3A 3P14A 1DJHA 3KZPA 1KNWA 3BQ5A 3GYEA 4CEXC 3HN3A 2CZEA 2ZZ1A 1HKVA 4MTVA 1D3HA 1RVGA 3MS8A 1A4LA 3AXKA 1KCXA 4B5XA 2QJJA 3W85A 1DKWA 2X41A 3EWUA 4AZ5A 1QU4A 3NA8A 3RLVA 4QS6A 3BQ6A 4IM4A 4XBKA 3GU2A 2Z7KA 4M3PA 5E09A 1XC6A 1ADSA 2QEZA 2EKCA 3AIUA 3PFMA 2NQ5A 4QG9A 2GGEA 4UZUA 1CWYA 3EX6A 2HVNA 5HQEA 3LPOA 3FJLA 1SYTA 2INZA 3L4UA 1JZ5A 3TZNA 3WMCA 4J28A 2HNHA 3A5VA 1MMFA 1HL9A 1UKSA 2J75A 4JCMA 1YTDA 4GISA 3NQMA 4UNKA 4XTDA 3BCJA 4C5YA 5AYZA 4D8ZA 4U3AA 1ZJAA 4C6JA 2XVLA 1QK0A 1TUXA 4LAOA 1NWTA 5F1VA 4Q8TA 3IAPA 1P6BA 3UXIA 3GYCA 1WV2A 5CPTA 1FCQA 1E4MM 1O5QA 1MNZA 2J7DA 2A6LA 4S2BA 4KIRA 3T2OA 4L1WA 4MAZA 4H2CA 2X1SA 3DIPA 4ORIA 3M16A 4XIMA 3WD1A 3IJLA 3E0FA 3NFUA 2GSJA 1IGSA 3HJZA 2XFYA 4G7FA 2Y8VA 4JFTA 3N2CA 4FF5A 2EF9A 2G4FA 1IV8A 1XYCA 3SCUA 1DYSA 2VZVA 1UWUA 3EWDA 3QN3A 3S1UA 2V5CA 4R9OA 1RD6A 4TMCA 1UH3A 3UZ5A 5DBUA 2A7NA 2BY3A 4AWEA 3GNRA 1CW2A 1W5QA 2BGNE 4O10A 4D6FA 3T55A 2ZXQA 3FDGA 3G1FA 3UBPC 4LAUA 3W7JA 2OCZA 4DO7A 3NWRA 3STPA 3ARPA 3E38A 3QPEA 3M0YA 1KBIA 3TP4A 3NDZA 5FESA 4GGHA 4E5TA 2ALDA 2QHAA 3OGSA 1V0NA 3WQGA 3CQJA 2ZA1A 1S3TC 3T09A 2QGYA 1K4HA 2FHCA 3RAOA 3PPHA 1QI5A 1ENUA 3UZJA 1A5BA 4JTGA 3VCNA 2A7RA 1XYMA 1P7TA 3PZQA 3JS3A 1CLVA 4HNCA 3WYZA 1BPLB 4M19A 2J77A 3URBA 4RL3A 4GKTA 2J6VA 3M41A 4MPKA 4YTQA 4HSHA 2ZZ7A 1G94A 2JF6A 1K9DA 3VD3A 2Y24A 3MW7A 3VNJA 5F7UA 2PP3A 1GJWA 1XXXA 1HG3A 4D6GA 1UD5A 1RLCL 3UR5A 4D6IA 2XIIA 5D4YA 3POHA 4Z1AA 1XCXA 4I6VA 2YW4A 5CLTA 2QUTA 3VX1A 5AYYA 4LAKA 2Y62A 3CO4A 4H4IA 5DLCA 2W61A 1OX4A 3WH5A 5FOOA 2ZUVA 2OWWA 1XLIA 1B31A 1AL7A 3EYPA 1TTIA 4W7VA 3W1TA 5ABHA 5D2XA 3O2LA 3MT1A 1XH0A 4LU0A 4R7WA 2Y8KA 3QV7A 4PRRA 1GVYA 1W2PA 2J7CA 2ZDSA 1MW0A 2X1UA 3LV6A 4ADTA 1OT1A 1JEZA 3WQCA 1TV4A 2XN0A 4ZFCA 1NDWA 2ZOXA 2YR1A 3RK8A 2RGLA 3BCDA 3PAOA 2OEKA 1IIGA 1YKWA 5LGZA 1KFEA 2CIPA 1CLKA 3FSTA 5ABFA 3E5PA 3IVTA 1J8VA 1QOXA 3CZGA 4JFUA 3GH4A 3URNA 1XIJA 2BP1A 2OYMA 3UEQA 1JYVA 4Z1BA 2AGKA 1GOOA 4LQ1A 4WR3A 3C6CA 2VVSA 1AJ2A 4BF7A 1KR1A 5TF0A 3HQ1A 1LG1A 1WB0A 3G1SA 3UWQA 4OT7A 1UMLA 1ISVA 4HN4A 2HRWA 1POJA 1LTDA 3MPGA 1BVNP 3CWHA 3L4YA 2YCKX 1GHRA 2J4GA 4DF2A 4WDWA 3PHAA 1Q6GA 1BQGA 4G8TA 4DX3A 4ADSA 3BAKA 3WBAA 4Q8UA 5DQPA 1PSCA 3FLUA 4JBRA 4Q7IA 3AS1A 2CHOA 3MJYA 1DQXA 3EAUA 1QW9A 1DVJA 3B9OA 4DWSD 1Q6LA 1H1YA 4GIEA 3S6OA 3WFZA 4JYDA 3HIJA 3WLTA 2W67A 3I6EA 2WVUA 2FLIA 2VUNA 3L2MA 4BQ5A 2IQTA 1KTNA 4LUJA 4C6CA 1EBGA 2OGJA 3LSCA 1E6NA 2PCQA 5KZ6A 3T0AA 4JFSA 2ZZ5A 3FW6A 3B8TA 3R1ZA 3CH9A 2V2HA 5CGQA 4HCHA 5DN1A 3TC7A 1W3HA 4H41A 3R0DA 5ECVA 4TV6A 4D9PA 2C18A 5FF7A 1I75A 3M43A 1T99A 1Q85A 2CHRA 3H2NA 3O6DA 4WCJA 3ELFA 4MY1A 1E0WA 4Q8MA 3NQ6A 6CGTA 1NDVA 3IRSA 1TPFA 1VIWA 3HU7A 4P8XA 3LBOA 1ZCOA 2FVKA 2BXYA 1VYSX 1QNQA 3VI2A 3G1RA 4XKYB 4UUIA 1PS9A 2PDGA 2DVUA 2Z2BA 4B15A 4S39A 2VC6A 5A6BD 4QR6A 4H9VA 4A2RA 2QCCA 1V6VA 4HCDA 3LM3A 2PGEA 5I79A 1DJQA 3SGZA 3MSDA 4WY0A 2Q3OA 3OVRA 3EEZA 3USZA 4EWND 1R47A 3VKCA 3VIMA 3DU0A 3N29A 2C1HA 2RDWA 1EOMA 4H6KA 3TYCA 1P0DA 1SSDA 1THFD 4JN6A 3SSZA 2FB3A 3EOOA 3A21A 3R13A 1MDRA 1BF2A 3UA3A 1W54A 4M81A 4FX7A 2YCLB 5I78A 3W07A 4XAYA 3PPCA 4GFIA 2P8BA 4F0HA 3S47A 4YCPA 1RR2A 2RGMA 3OB8A 3WK1A 3W7IA 3UWUA 3H6OA 1X7IA 3CWOX 3QZ6A 1R2TA 5B7YA 5EGRA 1A47A 2CFFA 3CUFA 2A1YA 1ZY9A 4A3QA 3TJXA 3R11A 1IT8A 3EOLA 3WEOA 3W72A 2VX5A 1TZ9A 4ICNA 3W7HA 2DORA 1TPWA 3RR1A 2GYIA 5CC5A 3H23A 1TWWA 2YA0A 4AYGA 3GNPA 4E0CA 1B1YA 2FGBA 1LLOA 1ONXA 4LOCA 1IGWA 3GDTA 4CD6A 4C6IA 1J5SA 2QXWA 2G95A 1V0LA 1V3MA 3ALFA 4HK5A 4OOZA 3HQOA 3L2LA 2PWEA 4HMCA 2AQVA 2H3BA 4IJCA 3VNDA 5CEWA 1JQVA 3INPA 1E9YB 4HHPA 2QCDB 2DP3A 3ZJKA 1OCJA 4UTFA 1NARA 4LVBA 2Y5JA 3K4WA 1UC4A 2CKRA 4W8AA 3WLJA 2UZ9A 2PDNA 1WAWA 4C65A 3MBDA 4GD0A 3R0UA 5DRCA 1A5CA 2G41A 1RQHA 4AQLA 3SRHA 5C9ZA 1AVAA 1PE1A 3W71A 4QXIA 2YXOA 4HZ6A 2YLAA 2IPFA 3P62A 1JF6A 4A6GA 2NWRA 3A4JA 1TIWA 2P88A 1AQMA 3MCNA 3SCNA 4MM1A 4NX0A 2DT1A 2WB5A 2E6AA 2OYLA 3MKCA 2WYSA 4NJJA 4PCFA 4ZMGA 4DEFA 5M3WA 1XLEA 1Z8AA 5FL1A 2C13A 1K70A 4AWSA 2E9LA 2AGTA 5KZDA 3ZR5A 3W00A 4IXHA 3ITLA 4GQQA 1SR9A 1Q6RA 1H41A 2YBVA 1MRAA 4DELA 1LCOA 4J3VA 3C2VA 2CCRA 3PY2A 1Y5WA 1OZQA 1UKTA 2J7GA 2C71A 3WG6A 4MLRA 2ZTJA 1KXTA 3UU0A 3UERA 3T2QA 2G0WA 3G24A 1RY0A 1VD6A 5CGTA 1S5TA 4Z1CA 4IF2A 2PUZA 2QPXA 3W1LA 4GYFA 3SCRA 3QXBA 4ILSA 4GX9A 3ITTA 2RJHA 3H4GA 4UR7A 3BG3A 2Z2UA 3KVMA 3L65A 1ZB5A 1QCWA 3VOCA 1W56A 3QMRA 4OOUA 3W2LA 3T9PA 1XG3A 3GDKA 2PDPA 4PFHA 2QYGA 1TA3A 2ZZ6A 3QBUA 3A3XA 1GPFA 3ARXA 3W7KA 2ZE3A 3C2OA 3TIMA 3QQ1A 1GNXA 1D9EA 2J66A 1S1PA 1H7OA 1A5LC 4WLCA 3L67A 4H9YA 4O1AA 3HMJG 2E68A 3OBKA 1OF6A 5A2CA 3LCLA 4MNKA 1P5BA 4IIHA 1R7AA 3C2FA 4GRSA 4NZ1A 2VC9A 3O9NA 2BG5A 1XD0A 5CXPA 3I3BA 2Y2WA 1OX6A 3TONA 4ZENA 2VUYA 5MKGB 1XDJA 2PC8A 3TJ4A 3N4AA 4UTKA 5ABTA 3OU8A 1PV8A 2CESA 3PNZA 4ES4A 5BZAA 1AMYA 4B5VA 4PMJA 1LLWA 3C5QA 1Q8JA 2DUZA 4JR5A 3NOEA 3O3RA 2ICSA 5CC7A 3IEBA 2I5QA 4MB4A 3OLGA 2PTXA 4UNLA 5AOUA 4WK9A 3CHEA 1EJWC 5AVNA 1W0MA 8CGTA 5KITA 5DMNA 3RHGA 1HKKA 2G3FA 5H8PA 5HUPA 4YTUA 2VFHA 4JGDA 4X0VA 1N82A 3SCSA 1LP6A 3ARUA 1QAPA 2ZXDA 3NJ3A 2ISWA 3PBYA 3VNYA 3BLKA 3E9AA 3T4WA 4L1GA 2PZNA 4AZHA 6XIAA 1ZBCA 1TR1A 3ARYA 4RK8A 1BRLB 4TTUA 3VXGA 7TAAA 3AU2A 1ISXA 3BAIA 4HHMA 4JY8A 3S8HA 3LM7A 4ZOCA 1VYRA 3DFSA 3QW4B 1A4MA 1E9LA 2PS2A 3DDMA 2XWEA 1JZ2A 1GZ1A 2XIQA 3CHFA 4IX0A 1ZJIA 2C16A 4W9TA 3ARTA 4PA8A 4AVOA 3ABSA 2B4GA 3UP8A 5LA0A 2QPUA 2GQ9A 3S2CA 1A0EA 2ZA3A 1TYGA 4JEQA 3WLSA 2ABBA 1M7PA 3OVGA 3BSHA 4FR6A 3I68A 2EG8A 4DWDA 1CXHA 3DHFA 3EWCA 4P7OA 2FHBA 1S2TA 3HPXA 1BXNA 1J0JA 3B06A 3E2QA 3RDKA 1XFBA 1DJWA 1MEIA 5A8NA 1NFPA 1F2JA 1E0UA 3HZ3A 2BSLA 3H2EA 3OGVA 3ITVA 1L9WA 3BV4A 3TTEA 3D46A 3SCOA 4QE1A 3IAQA 1AW5A 3LNPA 1OWQA 4CGTA 3GTFA 5A8MA 2D69A 4E3TA 2ZVRA 3C61A 2PTZA 2YL5A 1R2RA 1C3FA 3PFRA 4B92A 3EX4A 3PK7A 1FTXA 1J0YA 2Y6ZA 3PZTA 1MW2A 3LSBA 5AC5A 4LRTA 1VRDA 4X60A 3MI2A 1IZCA 2PB1A 1LT7A 2FTPA 1GG1A 1JNEA 3FCPA 5D9PA 4QP0A 3KW3A 4Q32A 2WLYA 1UZ1A 1QR7A 4R5EA 3UWYA 4U28A 5CG0A 3PSVA 4NQ1A 1E9ZB 1OEPA 2PEVA 3GZ3A 1SFTA 4K36A 4S23A 1H2JA 4UOQA 3MP5A 2PDFA 3NQCA 3IUIA 3BANA 2BLEA 2ZUWA 4UTHA 2XN1A 4M1BA 3KVLA 2IW0A 2FZ8A 4KFPA 2Y5EA 3VMNA 3K13A 4L65A 3PSWA 1QWGA 4DZHA 3GS6A 5BROA 1VGAA 5AFDA 1FFRA 2BY0A 1R9XA 3VKJA 4GQRA 3GXTA 2GJRA 3C0QA 1XLJA 1G4TA 1EIXA 1E5JA 5HAOA 4RDWA 3T4CA 2OT0A 2KX9A 5CC3A 4NZ3A 4Q8PA 5BU9A 1SFLA 4WRHA 3H21A 3FN9A 3L0NA 2OODA 4IL0A 3RLHA 2PGFA 4KIEA 1S1RA 3R12A 1YTKA 4ZOBA 4AC7C 2CNCA 4MUPA 1E4LA 3O0KA 1NFGA 1W3TA 3GVQA 3PJTA 3B4YA 5TAOA 3OZYA 3L5LA 1ICPA 1DWFM 1OYCA 3S1GA 1VB9A 2QUMA 6XIMA 4GNVA 1LF1A 4MJ4A 1JYXA 4RZ4A 1PTGA 2EG6A 2J8TA 5DMMA 2NV2A 4B3LA 3LUTA 4PMYA 2JKPA 5F4SA 4GE8A 2GWNA 4PMXA 3QSTA 3VDAA 1T8QA 3W01A 1R6WA 1YTEA 1PCKA 1CCWB 2CW6A 4JFVA 4AX6A 3R7MA 2YCEA 3CTTA 2NUXA 4LVFA 5A69A 3H24A 3URAA 1VIZA 3UPBA 1QNOA 1PIGA 2HQAA 5C2GA 4MB1A 3RM4A 1LRNA 2OOGA 3NQDA 4ERIA 1WDDA 4LVDA 1QTWA 4GKLA 1H09A 4UB9A 3N6HA 1R3QA 4FNPA 3QH2A 1M53A 2HE8A 3TMQA 2BMBA 1E73M 4S1FA 1IT0A 3CV7A 3MMTA 2XJ7A 4DO5A 3S0CA 3W53A 1W1A1 4S3FA 1KD0A 3BLFA 4F2UA 4HOXA 3TSBA 3L0KA 2V30A 1V3LA 2DPEA 4HU4A 5AHLA 2WHMA 2VP8A 4PBFA 1M04A 4XKMA 2X42A 4A2SA 2Y7EA 1C8QA 1U33A 2ISVA 1PKNA 3W02A 3MUIA 4C6NA 3ORWA 5AHMA 1XL9A 1XDLA 5A6BA 1FDJA 2Q02A 1JDFA 3KBMA 2R1LA 4GY7A 4AFYA 1LBFA 4A8IA 1CDGA 4OZOA 1OFAA 4P2VA 1BYAA 4HU3A 4JIPA 2PGWA 2PD5A 4DXXA 4HQVA 2GVYA 3EWYA 4C6OA 4E8GA 3W75A 4L4OA 3SJ3A 1PZ2A 2AOSA 1I0BA 1EYWA 1J2WA 5CZTA 2J9XA 3U6WA 3W7NA 3N4EA 4NX5A 3GVWA 3SN1A 4AIBA 1ZAJA 1OABA 4DJFC 5KTLA 2J7FA 4DM1A 1KM3A 3MCOA 2GSEA 4LANA 3QHOA 1AW2A 1R8LA 3VPLA 2QIIA 1RXOB 2W91A 2GOKA 5H8UA 3KOXA 2DZWA 3HJEA 3WF3A 1SUXA 4AU0A 1EP1A 1RH9A 1NF7A 1R3RA 3LD5A 1XUZA 2HROA 3AZSA 4Q6JA 1M41A 2E4TA 4QDMA 3VDHA 1KLYA 4BR1A 3VILA 1QHOA 2VDIA 3ONCA 5BMWA 1TSIA 2QV5A 3B0UX 4HSOA 4GQ0A 2XM1A 3ITYA 1HF6A 4I7WA 1UWTA 2ZICA 2HTMA 2P53A 1ONWA 4Z0SA 4L5ZA 1H5VA 3WH9A 5DY3A 1VFLA 3HG4A 3SUUA 1ME7A 4C5ZA 5ECUA 3DC0A 1W5PA 2PD9A 3HPAA 3LHUA 1EB3A 1W5MA 3SIZA 3KS5A 2O7SA 4LF2A 1OX4B 1DL3A 1KRBC 1C29A 3B9DA 4O19A 4O1CA 1BG9A 1S46A 2J24A 3LGDA 5M2FX 5IXEA 2H9AA 1C91A 1H51A 1MXSA 1YNQA 4KGJA 4GYPC 3WKZA 4GYKA 4IGSA 5JIWA 1F6YA 1JCJA 2FIQA 4MZYA 2VWTA 3A12A 1PWMA 4JXCA 4AC1X 4ALDA 4YS1A 1NFBA 1OHLA 1SJBA 3MHFA 4ZQOA 3PB0A 2OG9A 1ZL1A 5ENLA 3N9RA 2A3CA 4XAFA 1EX5A 5D9OA 3GIQA 3DFQA 1K7FA 2QUNA 5FF2A 4M82A 4TQTA 5ABFB 1LG2A 3G5EA 2O92A 3DI1A 1VBGA 3SO7A 2CHNA 1NVMA 2VJXA 5D2YA 3UYCA 3FVMA 3OO2A 3GO2A 3GNXA 1Q6OA 3KRSA 4MWAE 4I5RA 2WV8A 3QF0A 2QNEA 3BAXA 3D3AA 2A85A 4JY9A 3VZZA 4TXEA 4ROPA 1E71M 2GJXA 5ABEA 3QLDA 4F79A 5EMMA 4CVUA 5FA5A 4I9AA 4PMVA 3OW1A 2PLJA 1HJQA 3NVDA 4H9UA 3TW6A 2YB1A 1R30A 3UNTA 3L7RA 2FHFA 1M7OA 3N17A 4AY1A 2PWUA 3TOYA 2AQOA 1XRTA 2QLYA 3R58A 3W7EA 4FOJA 2E7FA 3WLKX 4G7EA 3VX0A 4AXNA 3CV1A 4PMQA 2V68A 2GUBA 5BWAA 3TQKA 1TPH1 4MSSA 1NWSA 4KMQA 1B4EA 3FNDA 4W88A 3RILA 1E51A 1TCMA 5DO8A 1ITUA 1SO4A 1EA0A 4O4VA 1EDQA 1TJRA 1TO3A 4IMGA 4PB3A 1W1PA 4IZGA 1WZLA 3H70A 4TR9A 4CU6A 1XG4A 4FO4A 4HTBA 2CPUA 5DBTA 4D1JA 3CGTA 1HX0A 4QSHA 4CQ9A 3AQUA 3AYRA 3F5JA 3GZAA 3STEA 4JTQA 3KBSA 4WKFA 1R3WA 1G4EA 4CNSA 4E2OA 2ON3A 1KM6A 3B8UA 1VBUA 3SCWA 3DHDA 3KE0A 3UVIA 3ITOA 5KEZA 3LLFA 4AD3A 4W7WA 4GUGA 4NAEA 4F9DA 4G9PA 1ZPTA 1EH9A 4CQBA 5AN7A 1P4CA 3GFXA 4TX9A 5E6YA 1MZHA 5A94A 1TZ7A 2DEPA 5G2HA 2VGIA 3W83A 2PF8A 4O28A 1PDYA 3F4NA 4YYCA 4N6EA 4HGXA 4JTLA 5D9MA 2VEIA 2FH8A 2F6UA 4KCTA 1SZGA 5C9XA 4GVFA 4ZB0A 3C3NA 3LEPA 4WY0B 1V02A 2F38A 2A7PA 4IICA 3MSRA 3FAXA 5CSSA 3VGFA 4K37A 2FFCA 1TPVA 3GXNA 1XQKA 3I4KA 1Q4WA 4NASA 2ISFA 5HNUA 4C7DA 3KRBA 2JF7A 3MUCA 3FX4A 2Z7GA 3CLWA 2QZRA 5DT5A 2X7WA 3VFLA 3TK7A 3DHUA 3UNDA 1Z41A 3KBWA 3S2LA 3VOHA 4YWSA 2YXXA 1R5YA 1MEWA 2PWHA 2XDFA 1M5WA 3GDLA 5T9BG 3NUKA 3EOEA 5LXXA 5TBOA 5BNKA 2H6RA 4FXJA 1XIHA 1H7NA 1EA9C 5G2IA 2A3AA 1LBMA 2A79A 3ARSA 3QMSA 4PSPA 1HL8A 1XGZA 1PDZA 1VLWA 1QRQA 3Q58A 4PMRA 3EDDA 4XSLA 3M64A 3PPFA 4N4QA 4HU0A 3UWWA 3AS3A 4MZ8A 2Z6IA 3CT7A 5AHFA 3UJRA 4UFMA 3RJXA 3GTHA 4QIUA 1MRQA 1UG6A 1YXDA 2NVCA 3HG5A 4ML4A 4F2BA 3PJUA 3W1RA 3S5YA 1IEWA 2DSUA 1VYPX 4HHHA 4FXFA 4DAFA 1PVNA 4DRSA 2X2YA 4GNKB 1N8IA 1EJVC 3K2GA 5EPDA 2P1FA 4L6OA