5AC8A

S. enterica hisa with mutations d10g, dup13-15, g102a
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
247
structure length
233
Chain Sequence
b'MIIPALDLIGGTVVRVQRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIASTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGWQENSGVSLEQLVETYLPVGLKHVLCTDISRDGTLVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQCWQN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SULFATE ION
publication title Structural and functional innovations in the real-time evolution of new ( beta alpha )8 barrel enzymes.
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Isomerase
total genus 80
structure length 233
sequence length 247
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2015-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5ac8A00
2QJHA 4PTNA 3S8HA 1OFEA 2WKJA 4O14A 4J9JA 3BPWA 1QPQA 2TYSA 4LRSA 4RZ5A 3NQEA 3G1AA 1EPXA 1UUOA 4OHQA 3MW7A 4U4MA 4UTMA 1IXPA 1ZAIA 3W07A 5BNKA 1ZNNA 2NWSA 1K8XA 2C6QA 3HGOA 3DGRA 3FOKA 3LXBA 3EB2A 1LOSA 3A21A 1SFLA 4UCGA 4Y96A 4M7SA 3W85A 1FWRA 3P8IA 3GR7A 1ALDA 2AAMA 3LB0A 4NX0A 3O15A 5D37A 1EUAA 5F2IA 3UZ5A 1I2NA 5K9XA 2ZRZA 3STFA 3LV6A 2X1RA 1F7BA 1DV7A 5K9DA 1SO5A 1I8JA 3I7QA 4LRTA 3WK2A 4N6FA 3SZ8A 5HWJA 1G4SA 1J5TA 4WOZA 1GVOA 3PS7A 4N4PA 3W7NA 1C8VA 2RFGA 2GUUA 3NGJA 2DJLA 3NR0A 1EEPA 2W6RA 4JTHA 2W79A 5CSRA 3G1YA 2OT1A 5I3GA 1QPNA 3NQDA 1QMLA 2ISVA 1QR7A 3A23A 2E68A 3GNNA 4AMAA 3M6YA 1LBFA 2VC6A 3OVQA 3I6RA 1W5OA 4KFNA 1XFBA 1GTHA 5F2GA 1OFBA 5T26A 1X6UA 1FDJA 2H90A 3HG3A 1KA9F 2VFDA 3GDTA 5GVJA 5D2VA 2YGYA 3F4NA 4UFHA 3GDRA 3UNDA 4DEFA 4B5NA 1TPEA 1KTNA 2ZQ0A 4X2RA 1H5YA 2CLFA 3C2FA 4GWEA 3SY5A 1JUBA 3W7IA 1QAPA 5BRBA 4DELA 3WK3A 3QPYA 2A6NA 1G69A 3JR2A 3PSWA 5AYYA 1H7WA 1F76A 4YXGA 3HOJA 1AW2A 3GK0A 3EEGA 3IVTA 2FFCA 3W74A 4KWWA 3ZWTA 3P84A 4FNRA 3FEMA 5HR7A 3E02A 3N34A 1J4EA 2A7NA 4P2VA 2BZNA 2X2GA 4QQ3A 4UNLA 1ADOA 3LM7A 3MWAA 5G4WA 4FX6M 2VEKA 4JS3A 4LUIA 2GVGA 3V1PA 3W83A 1JR1A 3LTYA 3MHFA 1ZJIA 1JQVA 5AHMA 4PL1A 2GQ9A 3R89A 3PM6A 1VCVA 3ZFHA 2Q3OA 2VFGA 3TIMA 5H91A 2ZYFA 4PFMA 3CC1A 1Z48A 3S1UA 1I2PA 5CPOA 4IXHA 5E93A 3W7RA 1YXYA 4LVAA 3O05A 3W6YA 2NUXA 1H50A 1DORA 1TTPA 1LLZA 2E77A 3RF9A 1AL7A 1OX6A 1PE1A 2QCEA 2CLMA 4OQVA 1RD5A 1FWWA 4O8RA 3G1SA 2I9EA 4MFEA 4XUGA 5K4ZA 4MFDA 3SJ3A 4OV9A 4UR8A 4D2JA 4R34A 5J5RA 1KV8A 4JEQA 2ZFAA 1EX5A 4E38A 3P61A 3LX9A 4JIQA 3G8EA 2CLIA 1VC4A 3O8AA 4NU7A 4A2SA 2FLIA 5D38A 4PH6A 3BLEA 3W2NA 4IMGA 4NNBA 3V75A 4DO5A 4QAIA 4O4VA 2WNNA 2NLIA 2QEZA 3MP4A 3UZJA 4WY0A 5FEWA 4GUJA 2QDGA 1KM5A 1QO2A 2JGYA 4JGDA 1VLIA 5AYXA 3NQFA 1Q6QA 4ORIA 4ZL1A 3L5MA 1BTMA 4AB4A 3EX2A 1AW1A 2DU2A 3EKZA 3P81A 4TMBA 2OJPA 4EVZA 1W0MA 5DCDA 3TKFA 1SFJA 3OIXA 4C1LA 4GXMA 4LS1A 3W7LA 3M43A 3TCEA 1K8YA 5AFDA 2XN2A 1L9WA 4LC8A 3BW4A 1T99A 1LRQA 5FI8A 3QSRA 5FF4A 3RNDA 3LI0A 2WNQA 3PB0A 2DZXA 4JDBA 3W2KA 6ALDA 2ZDRA 2ZCGA 4RV8A 3THQA 2PURA 1TPC1 4M7TA 2B7OA 1Q6LA 3IIPA 1FX6A 1JCMP 4K6AA 2FPTA 2JK2A 1JVNA 1WYIA 3C4UA 3ZS4A 3PF3A 3W1XA 1GZGA 3AO0A 3HGRA 2NZLA 3N19B 1OJXA 3TNOA 2QR6A 1U5JA 4HNTA 4NNCA 3DHDA 1F6KA 4LOCA 2X1SA 1TREA 2QCMA 3KAOA 1UCWA 1OFPA 1SPQA 1CI1A 3ELFA 4FNPA 1SR9A 3W84A 4GUGA 4JTTA 3G0UA 5HUPA 1EB3A 1K3UA 3Q2DA 1SQ7A 1TCDA 3TE9A 4OGZA 3TC6A 1N8FA 2XN1A 1OYCA 2Y6ZA 3NVTA 2V8ZA 2BX7A 3TQVA 5IBXC 1ML1A 4CQ9A 1ICSA 4HPXA 4KKXA 1WOBA 2VELA 1A5AA 1KFJA 4FX8A 3A5VA 2RH9A 4N9BA 3DZ1A 5C2XA 1LM1A 3DHFA 3IV3A 4HIBA 4ZMGA 2X1UA 3P7YA 2Y89A 4UTJA 1RR2A 2RDTA 3USBA 1QO5A 5D2TA 1V5XA 3FYOA 1JCLA 4K37A 4N02A 1C9DA 3C2OA 2Y7FA 5U4NA 4GNJA 1M6JA 3Q58A 4FXSA 1R47A 5EL1A 3T40A 1FBAA 3G24A 3TMLA 1A50A 2Y7DA 3L0NA 5A8GA 1F73A 1FQ0A 1K7FA 1S3HA 4UC5A 4XWUA 3SSJA 4HPJA 1SO3A 1G67A 1EP1A 3TV8A 4JX4A 1YLVA 5DCEA 3KVJA 4BWLA 5D04C 3EKLA 2VEPA 4JDYA 1JCJA 1WDWA 2C15A 1R46A 3GDKA 4K8HA 2ZBTA 3R5EA 5HWMA 1CW2A 4JYEA 3FIGA 3MJYA 3NPWA 4LW7A 3O6CA 2HS6A 3L9CA 3P82A 3TDFA 4L4MA 4TU1A 5HUOA 2BSLA 1EWDA 1TJPA 1LCOA 3W1NA 4MLJA 2Y61A 4NVTA 3MBFA 1XXXA 3O6YX 1Z44A 2QAFA 2ZRUA 1SZNA 1JCNA 1PVNA 1TPDA 2H3DA 4W9TA 2C1HA 2XN0A 5D02A 4K7VA 5D2WA 2J9YA 1O5XA 4UMBA 1TJRA 1HO1A 4DO6A 3LGEA 3QM3A 5DXXA 4UFJA 4NJIA 5K4XA 3IRDA 4RZ6A 4DQWA 3NDOA 2ZRXA 4JTIA 5LHEA 4JTGA 3W70A 2FPVA 2BXVA 1QPRA 4Q33A 3FLUA 3S1WA 3ZR4A 1TPVA 2A2IA 3ABOA 4NJJA 1LRNA 3NM1A 4PA8A 4R7JA 4LS0A 1GVQA 2FIQA 5D05A 1YTKA 1SW0A 3OHIA 2CLKA 3DI0A 3E49A 1LP6A 4UFLA 4CQ8A 4IQLA 3W87A 3PSVA 4NQ1A 3GKAA 1NF0A 5CZTA 1FWTA 3GX9A 2WQPA 4HNNA 2E5CA 4K8EA 5H2ZA 3NG3A 1Q6OA 3RU6A 4UTTA 5KTLA 1AL8A 2VFIA 2BLEA 1FWNA 3L2IA 3NQGA 3LCHA 3WJYA 3OVRA 1THFD 1VZWA 4JICA 2YW3A 2TMDA 3B06A 3NQ8A 3W7OA 1K02A 5ABTA 3L65A 3T44A 4X3ZA 1UB3A 2A4AA 3WJWA 2YSWA 5G2HA 4O53A 5KZDA 3CEUA 1RQBA 4GUHA 3I7RA 4AXKA 4L4LA 3EWUA 3RLUA 3LHVA 2H3BA 1IGSA 3TMQA 3SGUA 1M7OA 5KZEA 4O1AA 2GPTA 4RKAA 3LHWA 5AHEA 4JX5A 3HGJA 4Z1BA 3TR2A 2ABBA 3DKLA 1H7XA 1VCFA 1FCVA 4E2DA 1MEHA 4OBTA 5K2ZA 1T8XA 1OF8A 1W5NA 3C61A 3LBCA 3M5ZA 4FIRA 4MPQA 4ALDA 4PCFA 4WZHA 3Q37A 4UTLA 1WOAA 2DZUA 3TAOA 4HHPA 4ML9A 2E6DA 2A7RA 4HNUA 3S6DA 3BG3A 1ZFJA 2TSYA 4O0KA 3L0KA 4IMCA 3NNTA 4AWTA 1H7NA 3NZ1A 1LOLA 1YDOA 2E09A 3IIXA 4UTWC 3DXIA 1O60A 1GG0A 3C52A 3M16A 4UTHA 2R91A 4RCXA 2OMAA 3S5ZA 3LHYA 1ZAHA 3W2LA 1D3GA 1P0KA 4XTIA 5E0KA 3W2JA 4FX7A 1KBIA 3B03A 3G18A 3P60A 1KFEA 3N9SA 5AC8A 1TPUA 4ZQPA 3CM4A 3GZ3A 3DENA 4FEZA 1P5BA 3DAQA 4LVDA 3M5VA 1LBMA 4FNUA 1MEWA 4JY8A 3W72A 5CGQA 4YWIA 1VR6A 4MOZA 1PHQA 1GT8A 5C6MA 3L5LA 3UD6A 1UUMA 3B0UX 2IQTA 4NUWA 1UBSA 3PB2A 4UFMA 2ZZ1A 1EP3A 5KSWA 1XM3A 3NQCA 5TQLA 1U83A 4X9SA 5FEPA 1YDVA 1DHPA 2Y62A 3EWBX 1GPWA 3M7WA 4JD4A 2OX1A 2QF7A 5FEXA 3GAYA 1TTJA 3BGGA 2F84A 1K7XA 1KM6A 2ATMA 3VE9A 1EUNA 2NXGA 1OF6A 1W5QA 1OX4A 4QSHA 5E1QA 3ZWSA 1SSDA 1X1OA 4OE7A 3INPA 3PBVA 1TO3A 1JQXA 3KHJA 3QEZA 3GKFA 5AN7A 3ABSA 4IPIA 3QMSA 1X1ZA 2OT0A 5AOUA 2E6FA 3S1XA 2CWNA 3E9AA 3EWXA 3HPZA 3LXCA 2QJIA 1JRBA 2VXNA 4K7YA 3DFTA 4FHAA 2NX1A 2NXHA 3GR8A 2CLOA 4BR1A 1PV8A 4ZZ9A 4ZQNA 4DPPA 2B0MA 5F4WA 2ZRYA 2E5DA 4R53A 2NX3A 3IIZA 5L9FA 2WSQA 1L6YA 5AHNA 4M5PA 4JTLA 3LCXA 1H51A 1QFEA 4GE8A 1L6SA 4WJEA 1VJIA 3M5XA 2I1OA 1LRTA 1A53A 2OCZA 1XBZA 2A1YA 4IJBA 3TH6A 1KTBA 1H61A 4BK9A 4CCDA 1G4EA 1DJNA 3M47A 4MJMA 1XBXA 2ZRWA 4MYAA 4O54A 3TA6A 4TMCA 1D9EA 4LS2A 1YADA 2ZRVA 3TSBA 1OK6A 2V81A 3P74A 2DP3A 5EKYA 1XKYA 4O15A 3C3NA 4NXKA 2DZTA 1GVRA 2YX0A 2ZA2A 4O19A 1S5VA 2DZVA 2CZDA 1SO4A 2OZ0A 2EAWA 3MMTA 4ZVJA 3MUXA 2QCLA 1OABA 1O5KA 3IVSA 4HSNA 4S2BA 2WSYA 1N55A 1F74A 2Z2UA 4Z1CA 2FPYA 1I45A 3W7EA 4JYDA 3NEVA 3P5YA 4LVGA 1PHWA 4RXGA 3FJ6A 4O28A 4O12A 4QITA 4PODA 1QPOA 3HBLA 3NQMA 2O7QA 3W1UA 2BWGA 3W2MA 1SW3A 1IXQA 5HNRA 4WY0B 2H6RA 4N9CA 1Q45A 2YR1A 3S5OA 1MSSA 1Q6RA 3LXAA 3G22A 2ZZ4A 2VFHA 3NQ6A 1GQNA 2J24A 1VHNA 1TV7A 2EGZA 4CCCA 3QPZA 7TIMA 2B7QA 3W76A 1GVFA 1TPFA 1K8ZA 1A5BA 3W3OA 4FNSA 2YPIA 1WBJA 2O7SA 5D09A 3JS3A 4LVBA 3W7JA 4NXSA 3UWQA 3OVPA 4U28A 3BVJA 4GBUA 5F1VA 1L2UA 5CPLA 3PG8A 2QCFA 3W7MA 3GLCA 5G2WA 3TW6A 1VYRA 4N9DA 1G7VA 1ZAJA 2X1TA 1XL9A 1W3NA 4O52A 4WQ6A 1B4EA 4MLRA 3ABQA 3BLIA 5G1YA 3W7HA 3F03K 1M5WA 2DORA 2PC4A 5D2YA 1NFBA 2FDSA 5EMUA 4ADSA 5I3JA 5KMYA 2V5LA 3LTPA 1F5ZA 2ATSA 5LNSA 3UPWA 2Q3RA 3WFAA 3NQVA 3G1DA 4UTIA 1LBLA 3QMTA 5G1TA 4WUIA 1BKSA 3UWWA 3M1ZA 2Q8LA 2C14A 3TQKA 2ZA1A 5K7JA 4TX9A 3MHUA 1A5SA 2W0UA 1H1YA 3P62A 3G0SA 2JGQA 4UTKA 3G1VA 3PR2A 3T78A 2NWRA 5DCBA 2Y7EA 3W1LA 5KITA 1P1XA 1Y0EA 3G3MA 5AB3A 1I4NA 4CNPA 3W23A 2G97A 4JTJA 2J6XA 3PUDA 2H8XA 1YTEA 1KFCA 2QCDB 2G95A 5F1UA 2C19A 4O57A 3TK7A 1TQJA 2X16A 2CZ5A 5HWNA 3MP3A 1FCQA 3TXZA 1JCXA 1RQEA 4HNVA 1FXPA 3MI2A 4DPQA 3PULA 5KINA 3IGXA 2NUYA 2XFWA 2HMCA 3NM3A 4ORMA 3TFXA 4I7VA 2QCDA 2B7PA 3EXTA 3PUEA 1WAUA 2A7PA 3G8RA 1R30A 5FESA 1XUUA 2VOMA 1JUKA 5C5YA 2YXGA 3UXAA 5TIMA 4OWGA 1BEUA 3HF3A 5DXYA 3GIYA 4DBDA 2LLEA 1QWGA 4IX0A 5DLCA 3EXSA 1RPXA 1OFOA 1YXDA 4N6EA 3WK1A 1O4UA 2BTMA 1IXNA 2Z6JA 5C54A 2Y63A 3CU2A 4QISA 3WK0A 3EWZA 5LNWA 1TRIA 3O63A 4QM1A 3A9IA 1DKWA 1F6PA 3HB9A 1W31A 3NXFA 2D73A 4O18A 4A22A 3IGSA 1MZHA 1TQXA 4Z1AA 2VFFA 4NJKA 3STGA 4LC6A 3CT7A 1SO6A 3LHZA 2QCCA 3C0JA 5EY5A 3LCLA 4POCA 4FNTA 1T96A 4Q4KA 1TV5A 1JULA 5AYZA 1AG1O 1GYLA 3PBWA 1YXCA 5DELA 3W7PA 1I2OA 3TFCA 4K36A 2ABAA 1FCBA 4ZQCA 1VCGA 5I3IA 4OV4A 4IMFA 3W88A 1HL2A 2B4GA 1LLWA 1DL3A 3NPXA 3UWUA 1MEIA 3NL6A 1VLWA 4XQ6A 3T4CA 4GC4A 1TV8A 2VFEA 2CZEA 3S42A 1VYSX 3OEXA 1KLZA 4FXRA 4Z1DA 4Q32A 1HG3A 3LHUA 5C55A 2Y70A 3DU0A 4DF0A 4LUJA 1VYPX 3W1MA 2AGKA 2ZTJA 5LHFA 1TRDA 1M7PA 3P80A 3U8GA 1TB3A 5D32A 3C8FA 3PC0A 1DOSA 4LU0A 3W1AA 1W56A 4YLWA 3E96A 4DXVA 4O16A 4AH7A 4AVFA 1WXJA 4UNKA 2CLHA 5MHBA 1OG0A 1YYAA 3S5NA 4AWSA 3SW6A 3PY2A 4LWWA 4BI6A 1ME9A 2WO5A 3S9YA 1B57A 3W7CA 3QSTA 1DBTA 5HULA 2CW6A 4O1DA 1F2JA 2FTPA 4JTEA 1FCUA 1W54A 3TX9A 1L6WA 4HT3A 1ZY9A 2DJXA 5D30A 2B7NA 3CWNA 1RV8A 3DFNA 3GAKA 1T0OA 4O4WA 1NSJA 2TPSA 5AHFA 4DO4A 3EX6A 5TBOA 3R12A 4NJHA 3CIXA 1YPFA 3DKJA 3MYPA 2Q8ZA 4XBKA 3U2OA 3UXDA 1NEYA 1A5CA 2RHGA 3DI1A 5IBXA 1KBJA 3TQ0A 2J88A 1GJPA 4JYFA 4A21A 3VE7A 3CEPA 2V0TA 2CFFA 5DY3A 4CNOA 2PRHA 3OG3A 3F4WA 1KW1A 1VQTA 1EWEA 4IOTA 4I7UA 3NL3A 5LSMA 2NV1A 2Y85A 4Y9AA 1PCKA 4UMAA 1G6CA 3L68A 3O16A 3F1QA 3QW3A 1PIIA 1TPWA 5CKSA 2GOUA 2QCNA 5U7SA 2YYTA 2ZZ6A 2JKAA 5EBUA 3TXVA 1HUVA 2GVJA 2VKZG 4JTFA 4QJ1A 1J2WA 1H1ZA 2DZSA 4IPJA 4MY8A 4DBEA 3M9YA 4WD0A 3N3MA 3LCGA 3N9RA 1VHCA 1YTDA 3MP5A 1SZGA 1S5WA 4JX6A 4NT0A 1TYGA 1XDMA 5AHIA 4JTSA 1O94A 4OU1A 2WOQA 3HMJG 4NJGA 4WX2A 1HTIA 3W71A 3HQ1A 3GDLA 4MY9A 3W2UA 3DBPA 4C1KA 4LV4A 2H8ZA 1UASA 2A6LA 4YMZA 3C2RA 2VEMA 4BFAA 3HG4A 4FNQA 1H7PA 1IIGA 3HGSA 2JKPA 3UQNA 2YFOA 3E12A 3IVUA 1G4PA 2I14A 4RX0A 3YPIA 2ALDA 3UWZA 1LORA 1MXSA 5EA9A 1W3IA 3W7DA 3W86A 1W5PA 1XC4A 4M6VA 1NVMA 2A85A 4UIOA 4Z0SA 1KM2A 4ZQRA 4GUFA 1OX4B 1VRDA 3U6WA 3ATZA 4O11A 3BK0A 1G7UA 3KX6A 3CIWA 5LGZA 3S0CA 3LV5A 2V2HA 2HS8A 1JCYA 3FKRA 3BARA 3B4UA 3A24A 3VFLA 3LCIA 3C6CA 1PL9A 2HTMA 1H62A 3BO9A 4R33A 2A21A 4TO8A 1DJQA 1H7OA 4O17A 1ME8A 3L66A 3G0XA 2GJLA 3TC7A 5AHLA 2CZFA 4LTSA 3SGZA 1GVSA 3A22A 4FIQA 4LV9A 2E6AA 4JTUA 1LOQA 1XI3A 3B8DA 3EX4A 3LLDA 4MKNA 4RLIA 4UFIA 4WXZA 5J5DA 4YCOA 4K38A 1P0NA 1E51A 3TROA 3BG9A 3VCRA 4KFOA 3LCWA 4EIVA 3I65A 5DBUA 1D3HA 1FY6A 1SUXA 2QUUA 3M44A 4MY1A 4QIUA 4GFSA 3MHGA 3QQ0A 5L6UA 3QYQA 5IM51 1PS9A 2FB3A 4ZQMA 1I2RA 1K03A 2QDHA 1OHLA 2NV2A 3W7KA 1H7RA 2ZZ5A 1FWSA 3C2VA 4JIPA 1KV5A 2V30A 3EXRA 3GDMA 4RR4A 4UR7A 4BF9A 2V2CA 3W73A 1Z41A 4MJZA 1YDNA 1FXQA 4KFPA 4O1BA 4QNWA 5F4XA 4GRSA 1IIHA 5D33A 1ZHAA 2QKFA 3EX1A 3NA8A 4GUIA 4RJEA 5DN1A 3HG5A 3LERA 1KLYA 4LNYA 3HIJA 5G5IA 3UY7A 1Q3NA 2VEIA 2ZA3A 5LZLA 4UTWA 1RZMA 2DZWA 4O1CA 5LNUA 5DY2A 2Z6IA 2ZZ3A 3N2MA 5I3FA 2G5WA 2QCGA 2HSAA 2WJZA 3OBKA 4DF1A 5BMXA 4ZQOA 2Z0IA 3RLVA 4A2RA 3T7VA 3FKKA 3SI9A 2CLEA 1K7EA 1X7FA 4LVFA 2P10A 4X22A 5CPNA 3C56A 5K9CA 1B9BA 4IMEA 1IXOA 4DF2A 1QOPA 3MI6A 4MZYA 2WNZA 4JR5A 3CPRA 3G1HA 2GQ8A 5CSSA 3GNDA 3HO8A 1W3TA 4IMDA 4CNNA 4HKPA 2X30A 2ISWA 3QC3A 1WX0A 1G4TA 1Z42A 3W75A 1I2QA 1ZENA 3PBUA 2YDAA 1KM0A 4NZFA 4Y6GA 1OK4A 5F2MA 4XBSA 4ADUA 6TIMA 2P0OA 4CLMA 3KRUA 3PBYA 3KRZA 3C2EA 4OT7A 1KFKA 3MI3A 2GQAA 3HPXA 3QH2A 5SWUA 1HO4A 1VGAA 2VENA 2V82A 4I7WA 1TTIA 1AW5A 3HJZA 1R2TA 4HN4A 3CLMA 3H55A 4RXFA 4TR9A 5BW6A 4BI5A 5AC7A 1FDYA 1TIMA 4AEOA 3QFEA 3ATYA 3DH7A 4ICNA 5D2XA 3WJSA 3RK8A 4MZ1A 4EF8A 2EHHA 2QAPA 3MO7A 4JXCA 3A5FA 4IWWA 4BWLC 2EF9A 1CX9A 2WSRA 3CWOX 3N2XA 4H3DA 2C16A 4WXYA 4AHQA 3QQ1A 4Z08A 3THAA 5LKYA 4RK8A 3W22A 3NL2A 4P61A 1WV2A 2WV8A 2PRMA 3N14A 1OFQA 3I68A 3TJXA 3DFQA 1H63A 2TRSA 4A3UA 4FO4A 4JY9A 3ABRA 5HMSA 3LHTA 5G4EA 5LNVA 3L21A 4N2YA 1KM1A 2C18A 2GJNA 3ANYA 4UTUA 3STCA 3W7GA 2FJKA 1ICPA 4MUZA 1EA0A 5I3KA 3TJLA 1QCWA 5EYWA 1WQ5A 4IGHA 1OFRA 3N73A 2ZTKA 4Y8FA 3IIVA 2V2DA 3LRKA 3NOEA 3QZEA 4JNMA 1QOQA 3O06A 2FQIA 3I7SA 4O13A 2RDWA 2J9ZA 2P1FA 4M6PA 5FEZA 1KFBA 5LGXA 3HG2A 5FF0A 4O50A 4GJ1A 2Y7GA 2R14A 3KXQA 4XTDA 3LBMA 3MYOA 4LT9A 1OYBA 1AMKA 1JRCA 3VNDA 4AF0B 3SFKA 3G3DA 4H6KA 2YYUA 4RZ4A 1HFBA 2QUTA 1ICQA 3P67A 3LDVA 2QUVA 3MBDA 4AHOA 1GOXA 2YZRA 3EX3A 1R2SA 1VS1A 3BW3A 1N7KA 2EKCA 3LRLA 3O6DA 4MIMA 1PCWA 3NAVA 4ADTA 1KM4A 3CQ0A 3TU9A 1JUEA 1DQXA 1SW7A 3NQAA 3P5ZA 1XUZA 1GTEA 3TAKA 2J27A 3IEBA 4FB7A 5EPDA 2YW4A 2PCQA 3H53A 3VI2A 2F7FA 3K30A 3D0CA 3QW4B 4UTTC 1LROA 4AF0A 2WPBA 1OYAA 3BG5A 3P8JA 5G2IA 1TSIA 3PUOA 3W1TA 3FJLA 3NPUA 4XKYB 3GB6A 4UUIA 3WJXA 4IX2A 4CCEA 1W1ZA 3E0IA 1SZEA 4UFKA 3NL5A 1R2RA 3QRHA 1TTQA 3QJAA 3G1XA 3TUUA 4IXXA 4PL2A 2RDUA 1S5TA 3DFPA 2YCEA 3GXTA 4N4QA 3UWVA 1TPH1 2V9DA 1FUYA 3W1RA 5DBTA 3T55A 4WY0F 3M41A 1X8FA 3KVLA 4XKYA 4S1FA 2ZZ2A 3NQ7A 3NYZA 3RFAA 1BWKA 3NZRA 2UV8G 2YFNA 4G1KA 3TSDA 3SR7A 1XBYA 3LCFA 1W37A 5KZMA 4LY8A 3VKJA 1B3OA 4M6QA 2Z1BA 3CHVA 3NQ2A 3M0ZA 3LTSA 4YCPA 4AWUA 5HR6A 3FA5A 2NXIA 1IF2A 3G1FA 3LRMA 4ONVA 2DZPA 3FFSA 4O0ZA 3UYCA 5K3VA 4NNAA 3PG9A 8TIMA 2GVLA 4JN6A 1ME7A 1O95A 1DVJA 5BMWA 3B04A 4I9AA 4EF9A 4KWVA 4H4IA 4E2BA 5HINA 3B05A 3H54A 5HQEA 3CTLA 1XDLA 3JRKA 4QNEA 1NAL1 3HPSA 3QMRA 1P4CA 3GVGA 3OA3A 3TW7A 3EWYA 3WJZA 3L5AA 3FS2A 3M5YA 2A0NA 3RMJA 5A5WA 1OFAA 3KVMA 1OX5A 4XZ9A 1H60A 4EOUA 3QF0A 3STEA 1RVGA 1ZCOA 3LOTA 4WOQA 3AJXA 2E1DA 5CG7A 1W8SA 3L67A 4YL2A 4E0CA 2CU0A 1BWLA 1JJKA 3B0PA 3R2GA 4M19A 1LTDA 3O07A 3NPVA 2C13A 1UJPA 3GXNA 4AHPA 3UWYA 3LI1A 1RQHA 3BLFA 5D03A 1KM3A 3SECA 1EIXA 3TSMA 3CB8A 1ZALA 2V5BA 1QDSA 2A5HA 3NO5A 2C3ZA 4UMCA 2RKXA 3KFTA 3EWWA 4O10A 2PE4A 1LZOA 2ISSA 1V7YA 5HJLA 1C29A 1AK5A 3O1NA 3B0VC 1GWJA 2NX9A 3BV4A 1W5MA 5CPMA 2QJGA 2QCHA 3Q94A 3SIZA 5CZJA 1LYXA 4A29A 3IIOA 4K39A 1GG1A 1NF7A 3PVFA 1SZFA 3R13A 2NUWA 1QNVA 3DFOA 4UXDA 3PWAA 1DQWA 1OFDA 4EWND 1SU5A 5CZ0A 1TMHA 3PAJA 3L0GA 1WBHA 2KZHA 2G96A 2E6YA 5I3HA 4IUOA 1WA3A 2AQWA 5BOOA 4CQAA 2R94A 3UPBA 1GEQA 3W7QA 4MVAA 4AAJA 1MO0A 5FF2A 1ONRA 2C0AA 4NX5A 3LLFA 1OVDA 1EP2A 1GYNA 2J9XA 3IGUA 1KFLA 2CLLA 4FF7A 1XBVA 3KVKA 5FF7A 3BGJA 4TIMA 5F2LA 2JBMA 2JKEA 4MZ8A 5LNRA 3W9ZA 3W1QA 1VH7A 2ZZ7A 4N9EA 4PEKA 1SSGA 3S5YA 3GYEA 5CZSA 1LDCA 5F4SA 4Y90A 4PC8A 2E5BA 3GXPA 3DFSA 4BI7A 1XCFA 3BW2A 2PRLA 2Y88A 1B4KA 1VPXA 3KRSA 4S2CA 3R8RA 3UY8A 4HSOA 4MYXA 2EPHA 2FB2A 2R8WA 1F05A 5FF3A 3S1VA 4JTKA 4NZJA 5AC6A 4Z0JA 3KOFA 1FDZA 1TPB1 3W1PA 3FYPA 1KTCA 1YPIA
chains in the Genus database with same CATH superfamily
4PTNA 3S8HA 3D3FA 1OFEA 4FLQA 4GQGA 3AMGA 3M0YA 1QPQA 4RZ5A 4LRSA 1EPXA 1UUOA 4GXPA 4WCJA 3JZEA 2NWSA 2IPGA 5M1TA 3OPSA 3ARTA 1DIEA 2WNWA 1L2QA 3GRIA 3HTWA 4Q6JA 4Y96A 4ZOEA 3W85A 1FWRA 1V3KA 3GR7A 4B5VA 1TWIA 2PLCA 5BRQA 2BODX 5K9XA 2WC3A 5HA7A 1LUCB 4TVDA 2QJNA 4WJ8A 1OGBA 3RN6A 1S2TA 3N18A 1SO5A 2V63A 4DB7A 3WK2A 4RNJA 4N6FA 2WZHA 2PDNA 4GI6A 1RCQA 2GUUA 4XK2A 1G94A 3FSTA 2DJLA 3MKVA 1K70A 3BZGA 2G3IA 4OOZA 2ODOA 3H4XA 3BL3A 3N9KA 2ISVA 1RCXB 2E68A 4AMAA 3M0XA 4J3WA 2VC6A 1JNDA 1W5OA 4KFNA 1P6WA 5F2GA 4KETA 5T26A 1X6UA 2H90A 1XIHA 3KHDA 2VFDA 2PU1A 1EGVA 5D2VA 2ZXQA 1S2AA 1HZYA 1KTNA 2CXGA 4B90A 1HJVA 4GWEA 4Q8MA 3CJPA 3W7IA 2G37A 1UPMB 3RR1A 3WK3A 3MKKA 3ZSTA 1RP9A 4XV0A 2J77A 4V33A 1H7WA 3EEGA 3IVTA 3SCVA 3GY1A 1QOXA 4KWWA 3E02A 2A7NA 4GGBA 4HNOA 5JUVA 3VOHA 2X2GA 3EYPA 3ZLGA 3BXWA 1QWKA 3HU7A 3AUOA 3MWAA 4PUJA 3HFTA 3QKZA 3LPOA 4HMNA 3ZJ6A 1JQVA 2GQ9A 3R89A 1VCVA 4IFRA 3E0LA 3SJNA 1XDJA 2ZYFA 3SSZA 3EDJA 2BNJA 1Z48A 2JEQA 4QLKA 5E93A 3TYEA 3NIYA 1UG6A 1LLZA 4M29A 3RF9A 1V6WA 1RD5A 3WLHA 1NDYA 1IZKA 2XIJA 3CQHA 1KC7A 3BICA 1UKTA 1KV8A 2FZMA 1X6NA 2PGEA 4ZFCA 1EJRC 2WHMA 3SN0A 3P61A 4JIQA 4U5KA 2CLIA 1VC4A 4NU7A 1EJSC 2Z1XA 2HQAA 2PF8A 3BLEA 4IUGA 2UY2A 3R7MA 3NJ3A 4DO5A 3WENA 3AMCA 1K9TA 4O4VA 3PZ9A 4HMCA 3UZJA 3PP7A 4PN2A 4GUJA 1KM5A 3BUVA 2JGYA 4X61A 4JGDA 4IIBA 4OJYA 1W2PA 5GQBA 1Q6QA 3OLIA 1OM0A 3EX2A 3P81A 4RL3A 5LHFA 1KBLA 2XJ7A 4GXMA 4DY1A 3PPHA 1XRFA 3TCEA 1XP3A 4LC8A 5FI8A 2NSXA 3PTMA 3GTNA 5FF4A 3M46A 2AKZA 2DZXA 4EXBA 2IKHA 6ALDA 2ZDRA 2ZCGA 3WQ8A 2C79A 3THQA 4FALA 1DP0A 2XVPA 4M7TA 1JCMP 7REQB 3PJWA 4IF2A 1WYIA 3C4UA 3MT1A 2VCAA 3WY1A 2ZUUA 2RGLA 2WMGA 3FGCA 3F7JA 2QR6A 1LG1A 2XHYA 1ZCCA 2OQLA 1Q8AA 4LOCA 1UCWA 1CCWB 1C3FA 1UD3A 4FPSA 1ONEA 5GNXA 4FNPA 2B81A 3W84A 3WO8A 3QR0A 3C0LA 3IV8A 4H1ZA 2A3AA 1SQ7A 4W86A 3TE9A 2X0YA 1N8FA 2XN1A 5EMKA 2C1GA 1E1CB 1MRQA 3V0UA 2BX7A 2D1ZA 5IBXC 3FXYA 1XV8A 4H6EA 3A5VA 3SRDA 1WDQA 3IV3A 2Y89A 2VWSA 2VR2A 4W8LA 1DWJM 2WZIA 4HA4A 1E9ZB 1V5XA 3FYOA 4HOXA 1ONXA 4P8WA 1GZ1A 1RCOB 1C9DA 2Z28A 4BHYA 3SO7A 3THDA 4QCFA 3G24A 4GD0A 3L0NA 2F8QA 4LUTA 1WXZA 1VB9A 1S3HA 4KGLA 4QE1A 4XWUA 4ES4A 4FR1A 1EA9C 1UHVA 3CO4A 4UZSA 1G67A 3RPDA 4BWLA 5D04C 1XSIA 3IJ6A 4KERA 3SRKA 2X42A 4JTRA 4WIWA 1BVNP 2OEJA 3AALA 4F0MA 4R7WA 1HP4A 1RAKA 1J9YA 3GDKA 2ZBTA 4J2MA 5HWMA 1Q6CA 3FIGA 4AWEA 1XLIA 3ZIZA 3NPWA 4YVXA 3NXLA 1ECQA 4KWSA 2W3ZA 2O9OA 4B92A 5FJOA 1U1UA 3P82A 3E2VA 2BSLA 4HK5A 1VFOA 1ITCA 1JYNA 4QS6A 1US2A 1KRAC 4OIFA 1R3SA 4XBJA 4K7VA 3DC8A 5D2WA 3S3GA 3NTYA 5EB8A 4UMBA 4GNKB 1AMYA 3WELA 1HO1A 3IRDA 3W82A 2ZRXA 3QKEA 2BXVA 3FLUA 1V02A 4NJJA 3CPUA 2OOFA 3NM1A 5D05A 3S5NA 3WF2A 1YTKA 2A3HA 1F4AA 5JVLA 1EYEA 2WMKA 3U4AA 2CLKA 3DI0A 3E49A 4CQ8A 1MFUA 4IQLA 3ITOA 3PSVA 1NF0A 3SGGA 1FWTA 1JZ5A 3GX9A 1TKKA 2WQPA 4HNNA 5H2ZA 4DYEA 3NQGA 1Q7QA 5E70A 4JICA 2PWVA 2TMDA 4QRNA 3W7OA 1M65A 4ROQA 4DAFA 5ABTA 3L65A 4X3ZA 3CV1A 3KDOA 5LYRA 4IL2A 3SN1A 3TYAA 1RQBA 3STPA 1CXLA 3LHVA 4BS0A 1M7OA 4O1AA 3VGBA 1BRLA 4RKAA 5AHEA 3II1A 3V16A 1FCVA 4JFUA 1C8YA 1MEHA 4GI4A 4KEMA 2J78A 1OF8A 3DYMA 4V1XA 3C61A 1JPHA 3M5ZA 4FIRA 1HKVA 3RIKA 1QI5A 1XLMA 3Q37A 1PZ1A 1EZWA 4KH2A 3GM8A 2DW7A 5I24A 3AROA 4HNUA 3HPFA 2WVVB 3BG3A 2TSYA 5FAGA 4XX6A 3PK7A 3S2MA 3VCNA 2DZBA 3N15A 3NZ1A 3PTQA 2I9UA 4B3KA 2E09A 3F5JA 4UTWC 2OO0A 3BCDA 1M68A 4XB3A 5C71A 3C52A 3M16A 2R91A 4PMQA 9XIMA 2OMAA 3AIWA 3DCPA 4HU3A 1U1HA 1D3GA 1OT2A 3W2LA 1SGJA 3F2CA 1TIWA 4XKMA 3ANVA 1UR3M 4FX7A 4IIDA 4EAYA 4JFTA 1KFEA 3N9SA 1HJSA 1W1TA 2QDDA 1TPUA 3AWOA 2DVTA 1CDGA 5EFDA 4MNLA 3ZJ8A 1LBMA 2FH6A 2FVKA 2WMFA 3W72A 4YWIA 4MOZA 5C6MA 1PTGA 1OB0A 1I9CB 5KSWA 1IR2A 4X0NA 3GU1A 4XZHA 1D8WA 5TQLA 4TUFA 2Y62A 3EWBX 1GPWA 1LL6A 3L4ZA 4WKFA 1AQHA 2QF7A 5FEXA 1TTJA 4TTGA 3SBFA 2F84A 1OT1A 1OF6A 3PBGA 1W5QA 2PDUA 1UP2A 1SVDA 3LPGA 2UY3A 1RBLA 3QGAC 2F6XA 3INPA 1YMYA 2PWHA 3FX4A 3PBVA 1JQXA 3MMDA 3GKFA 3BJSA 2OT0A 5AOUA 3S1XA 3EWXA 1IEIA 1Q4NX 3N11A 2QJIA 1XLJA 3RO8A 1O66A 4HJFA 1WZAA 2NX1A 2WCGA 1PKMA 4ZZ9A 3CYVA 3XINA 4C6JA 4ZQNA 2INZA 4DPPA 3EMQA 2MNRA 1ZBWA 3WNPA 4MB4A 3QLLA 3FCPA 3WL1A 4AD3A 1A5LC 3RRXA 4ILSA 4JTLA 2CXEA 2DW6A 4L5ZA 2ZWZA 4GISA 1L6SA 4WJEA 2I1OA 2DGAA 2GUYA 4HU8A 4BQ5A 5CPTA 2BMBA 3NVDA 2J7GA 3LA4A 1N8WA 3DIPA 1A4LA 4Q4RA 1Z3NA 3L7RA 1W8GA 3M47A 5I07A 1XBXA 4MYAA 3TA6A 4TMCA 4JIIX 1D9EA 4XZWA 1YE6A 3P74A 3IJQA 1BF2A 2PDYA 4GYPC 3C3NA 1WNOA 1HW6A 4F66A 2OZ0A 1W3KA 1OABA 4IT1A 3CAVA 3VX0A 4HSNA 3ZSSA 3QN3A 4S2BA 4Z1CA 2DT2A 1I45A 3BLDA 4HNCA 4JYDA 3NEVA 3P5YA 3W7EA 3FJ6A 4O28A 2Q01A 2EPLX 3T1GA 1QPOA 3HBLA 3NQMA 2E0PA 1E15A 4WY0B 2H6RA 3EKGA 2YR1A 4DWSC 1KFWA 3MZNA 3SQMA 2J24A 4P8VA 2EGZA 3QPZA 7TIMA 3CYJA 3M0MA 4GX8A 2OKOA 3ZMRA 1DIDA 3BOXA 2DQWA 2BG5A 4DUVA 3JVAA 1VAHA 4GBUA 2Z27A 4I6VA 4Q8NA 2VCBA 5G2WA 5FCZA 1V3IA 1W1B1 1RJQA 1QK0A 4O52A 4WQ6A 3W29A 2FGBA 1M5WA 2PC4A 5D2YA 4MNMA 3LTPA 3T0TA 2PBGA 2Q3RA 2RJGA 3G1DA 2GWGA 4UTIA 4ML4A 1YNQA 3M1ZA 3WD4A 4OTKA 2ZA1A 1GGOA 1H2JA 1CGUA 1KB3A 3S46A 4AIEA 1TCMA 3G1VA 5DCBA 4S3GA 5AVHA 2PB1A 1HJWA 2J6XA 3PUDA 1Q6GA 2E1WA 4C6KA 3WQWA 1ISZA 1EX1A 1JZ8A 1QW8A 3TK7A 1TQJA 1MFVA 2CZ5A 1FCQA 3O0KA 2YKKA 1JCXA 2ONEA 3W26A 2GSJA 3MI2A 1AA1B 3EGJA 1DXEA 2NVAA 4QXIA 2XFWA 4P7NA 2HBXA 4MB1A 1A3XA 2QCDA 4ZB0A 4G6CA 2OLAA 4Q6XA 4UOJA 4NI3A 3UZZA 1H3GA 2XGZA 1XUUA 2VOMA 1V0NA 1OCJA 3UVAA 5B7ZA 5TIMA 1K77A 1BEUA 1R86A 3GIYA 3TA9A 3SY1A 2VQUA 4IX0A 5DLCA 3EXSA 4C6PA 4PMZA 4N6EA 1YXDA 1EJ7L 1O4UA 3UW6A 2ZOXA 1NDZA 2HPIA 2Z1SA 4H9VA 2PDJA 3WMBA 4ZOBA 1DKWA 1GKRA 4YTRA 2J8GA 4FR6A 3U7VA 3K2GA 4GC3A 3GUGA 1W31A 4QE4A 2OODA 2VRKA 2D73A 4MPKA 3A12A 3WF3A 4A22A 4Z1AA 1EHAA 3R43A 4LC6A 3CT7A 2PUZA 5EY5A 4H9MA 4FNTA 3GE7A 1TV5A 4H8NA 2J62A 3PBWA 1YXCA 2PWFA 3EZ4A 1I2OA 5I3IA 3T0BA 2B4GA 4S3CA 3MY9A 3A3WA 3UXKA 3AYVA 1MEIA 1DTNA 3GDBA 3OZMA 4GC4A 4UQCA 2XU2A 1VYSX 2MANA 3L4XA 1JG9A 1XH2A 2CPUA 4RV3A 1HG3A 3ZT5A 1FKXA 1XJBA 4LUYA 1O68A 4LUJA 1VYPX 4B5TA 1TRDA 1M7PA 3QXBA 3PC0A 2J79A 1DOSA 1HN1A 2OG9A 4L7ZA 1W56A 1E6QM 1TUFA 4MM1A 3ZJKA 2AGTA 2CKRA 4GO8A 4AH7A 1EGMA 4AUBA 1FWBC 1OG0A 3TOYA 5IOBA 1GHRA 1LT7A 2VR5A 3MSYA 2FZ9A 4PBEA 2FTYA 2WKGA 1ME9A 3W7CA 1DBTA 4DJED 4O1DA 2G3FA 4JTEA 3OP2A 1W54A 3WUBA 2DJXA 1V3HA 3CHCA 1RV8A 1UOKA 2JF7A 2WQDA 3DFNA 3GAKA 2TPSA 5AHFA 3W00A 1JD9A 3M0VA 2Q8ZA 4HN8A 4I5RA 3UERA 3U2OA 1P7TB 3HN3A 1LQ2A 2RHGA 3MUZ1 2ZUSA 1OG6A 2R1MA 4ZOAA 3VE7A 3UP8A 2FZNA 2V0TA 1LF1A 4CNOA 3C2YA 3OG3A 3F4WA 1KW1A 2Y24A 1EWEA 2FDMA 5ENLA 1OZQA 2DIKA 2Y85A 1GVYA 4GACA 4Y9AA 1PCKA 6REQB 3HZ3A 3QW3A 4P7RA 4B15A 1X7IA 1PIIA 4Z2IA 4EANA 3UF9A 1TPWA 2IMRA 1XG3A 4PTXA 2CBUA 2ZZ6A 3L4TA 3TXVA 2GVJA 1J2WA 2OVLA 3SEPA 2DZSA 3HQOA 3F2BA 4DBEA 2UBPC 1OD8A 4YVPA 5KZ6A 3VNLA 7TAAA 5C9ZA 3N9RA 1X96A 1YTDA 3UFYA 3IAPA 4NT0A 2OLHA 5CBBA 1XDMA 3U5UA 3TZNA 3WLRA 3DFYA 1O94A 2WOQA 4WX2A 3HQ1A 4DVOA 4LV4A 2H8ZA 3ZLFA 2EG7A 3WH9A 5DMYA 3T42A 1E56A 1S2VA 1YNYA 2W63A 5C9UA 2XSBA 2PDBA 2JKPA 3E12A 1G4PA 4RX0A 4XAGA 4IGMA 3UWZA 1MXSA 1XYLA 4PEEA 3OODA 3T2QA 3W7DA 2BASA 1BYDA 1XC4A 4M6VA 2BY3A 3KRBA 1E6NA 2VTFA 3DDMA 4P7OA 4ASTA 5C9WA 1KM2A 1D2KA 1YBQB 4B5SA 4C60A 1BYCA 4L64A 1VRDA 4BY3A 4RNFA 2OWXA 1G7UA 2PU0A 3R0UA 3UZWA 2PDFA 1K1DA 4HZMA 5LGZA 2DSVA 4GQBA 2V2HA 4DYKA 4NRRA 4L80A 3A4XA 4I8DA 3AC0A 3BO9A 4ZA0A 4E3TA 3OVGA 1W91A 4EXAA 1H7OA 2GJLA 3WUGA 1EOKA 3HJEA 3GHRA 5AHLA 4LTSA 4X0VA 1F3TA 1E43A 2WWCA 4NZ4A 1XLGA 4JTUA 4F79A 4MKNA 1CECA 3GFXA 4RDWA 4A3RA 1PUDA 3SCNA 3TROA 4AX7A 3VCRA 4KFOA 2XH4A 3ARUA 4EIVA 3CZEA 2AMXA 5DBUA 2BDQA 1FY6A 3WQFA 2QUUA 1E9IA 1JL8A 3MHGA 2XWDA 3QQ0A 5L6UA 1DE6A 2FB3A 2Y8UA 3FYYA 3T0DA 1OHLA 2NQHA 1MMFA 2CCRA 3WD3A 1FWSA 3C2VA 4JIPA 4C6OA 1IV8A 2WCAA 2YL9A 4NYUA 3CUJA 4RR4A 4UR7A 4A3HA 4BF9A 2V2CA 3W73A 1WUEA 3VKBA 2P8BA 4KFPA 1VKFA 4GRSA 1IIHA 2UWFA 4ACZB 1ZHAA 2VO5A 3EX1A 4LBSA 5F7UA 4GUIA 3CZ8A 2D2JA 4RJEA 4ZO7A 1XG4A 4CVUA 3KOZA 1ZJAA 3LERA 1X39A 2BB0A 3RITA 4A8LA 3HIJA 5G5IA 3TTQA 1Q3NA 4XD3A 4NI8A 4U10A 3LNMA 3F5KA 4O1CA 5LNUA 5DY2A 1JFHA 4A2RA 4QGCA 1QRQA 3H2AA 2R82A 4DX3A 1R85A 3C56A 3IK2A 5K9CA 4IMEA 4PUEA 4XSLA 2E28A 2BOFX 4MZYA 1PZ0A 1UWQA 4C1NA 5M3WA 3GYCA 4YNGA 1K6AA 3CPRA 2GQ8A 3P3BA 3GNDA 2X0SA 4YWSA 4HKPA 4UNIA 3K8LA 1NELA 4AYSA 3D3AA 3ITXA 2OSYA 2X30A 3J7HA 2J13A 3QC3A 1Z42A 3W75A 2WXDM 4NZFA 1PKLA 2A3BA 2P88A 4PCTA 6TIMA 4C91A 2P0OA 1E55A 2X7VA 3C0QA 2GDUA 1EDQA 2GLKA 1Q4WA 4MDPA 2E8ZA 4W7UA 5CJ5A 1HO4A 4XD5A 4I7WA 1TTIA 1S39A 2I17A 1R2TA 4HN4A 2Z2BA 3SCRA 3CLMA 3SUWA 4BI5A 3ZXWA 1JAEA 4ZXOA 3DH7A 4ICNA 3GBEA 1QNOA 3WJSA 3IJIA 5I09A 1XIJA 1C93A 1V6VA 2WSRA 3CWOX 1V6UA 4XUYA 3M0KA 3TYZA 4WXYA 3THAA 5LKYA 2RUSA 3NL2A 4D72A 2PRMA 3H26A 3N14A 2ACUA 3I68A 1CGVA 1AZ2A 2V3GA 1J0IA 4DAIA 4MTVA 3L21A 3UCDA 4N2YA 4L6DA 1PDZA 5CBIA 3WQOA 4P8XA 2FJKA 2YL5A 3DC0A 4MUZA 3U2CA 3TJLA 4IQDA 4IGHA 2GGIA 4Z2GA 3LGDA 3GHTA 3UJ2A 4YYFA 2FQIA 3IS4A 4O13A 1KR0A 3EA2A 1QHOA 1RXOB 1UD6A 3K5XA 5LGXA 5FF0A 4V2XA 2QPXA 4PRTA 3B3DA 3C3UA 1OYBA 1JF5A 2Y8VA 3VNDA 5A6LA 3QTGA 1D7FA 3G3DA 1R87A 2YYUA 2QUTA 1ICQA 3P67A 1NWSA 3URNA 2QUVA 4AHOA 1OINA 1GOXA 2YZRA 3KZSA 7REQA 1SJDA 4ADTA 1JUEA 3MA8A 1UYQA 3NQAA 3P5ZA 1XUZA 1GTEA 1NY1A 4DUOA 3CIVA 4G2DA 2PCQA 3HQNA 1QTWA 3KOXA 1LROA 1B90A 1AJZA 1L0PA 1OYAA 4L6OA 1NWRA 2ACRA 1TSIA 1UWUA 3NPUA 3N2BA 4XKYB 3GB6A 4K2SA 4R88A 1UOZA 2O56A 3AICA 4F3HA 4UFKA 1UZHA 1Z6KA 1XHGA 4BF5A 4REQB 4OECA 4PL2A 4PRRA 1S5TA 2QS8A 4E2OA 5ABEA 3UWVA 1BXCA 1JEZA 3W1RA 1E1EA 3CLWA 3KVLA 4S1FA 3NQ7A 3NYZA 3RFAA 3NZRA 2YFNA 3VOGA 1OIFA 3TSDA 3SR7A 4BKNA 4RE0A 1W37A 5DMLA 3PZOA 1V3LA 3I3DA 4MWAE 3OLGA 2Z1BA 3NQ2A 4E4FA 4YCPA 3UXIA 3RO6A 2ZWYA 3DEQA 1IF2A 3RMEA 2PDQA 4ONVA 1HL9A 4PMUA 5K3VA 1BQCA 3CZGA 3H21A 3OG2A 3POCA 1F8MA 3QQWA 3IJ9A 3MPGA 3PG9A 3BAYA 4N42A 1ME7A 3CXOA 3NDYA 3S9ZA 4XD4A 1F07A 2EBNA 4H4IA 3SCSA 4LB4A 4R5EA 3CTLA 4QNEA 2AAAA 3CH0A 1F9CA 3SCOA 3OA3A 1E72M 3UCCA 2V3FA 2A0NA 3RMJA 1XIIA 2PFHA 1Z7AA 2WBGA 4A8IA 4GYKA 2WWDA 4WOQA 2E1DA 2POZA 2INEA 5CG7A 1BWLA 1JJKA 2DY3A 3WUFA 5CC3A 2C13A 3H2MA 2P53A 3IJLA 1XLKA 2ZXBA 4RW3A 3UWYA 3BLFA 5D03A 4MAVA 1F3EA 3AMDA 1ZALA 2FGLA 1QDSA 2A5HA 1F61A 3WLLA 5FACA 4PCSA 4XD6A 4FAMA 1KWKA 1JZ4A 4O10A 1LZOA 2ISSA 1V7YA 1V6XA 1NU5A 3MUY1 1GWJA 2ZC8A 3VKCA 3FA3A 2DT0A 2QCHA 4RE2A 1LYXA 3IIOA 1GG1A 1WZKA 2REQB 3PVFA 2NUWA 3DFOA 3FXGA 1QW7A 2D0FA 4EWND 3WYZA 3OHMB 4IPLA 4G7EB 2P0IA 4QJ4B 2W4XA 3GXMA 2EO7A 2BVDA 3GBDA 1RHCA 2NQ9A 2AQWA 2BY1A 2OZTA 5BOOA 1HNYA 1MDRA 3VNYA 1GEQA 3RYSA 3SCPA 4AAJA 4GBDA 2UZ9A 1OVDA 3N1AA 1KGWA 1OY0A 3IGUA 2E9BA 1ISXA 1T40A 1DE5A 4J3UA 1W1YA 1OC5A 1GOOA 3W9ZA 2PZ0A 3W1QA 3BDKA 1VH7A 4N9EA 4PEKA 1KRMA 1SSGA 1O5QA 3GYEA 1LDCA 4AQLA 4CU6A 1O12A 3S5SA 3VM7A 1NDWA 2BOEX 1LWHA 3M64A 3BWWA 3R8RA 4CQBA 3UY8A 3EDFA 4XVDA 3VIPA 5FL1A 2GWNA 1GCYA 4Z0JA 1TPB1 1JYVA 2QJHA 2HBVA 4J9JA 4LBRA 1JNEA 2YZ5A 1OCBA 3Q67A 4KRTA 2TYSA 1FHLA 2WVVA 3VIIA 1XIDA 4DO7A 3ARQA 1IXPA 2ZX8A 1ZNNA 2C6QA 1UIOA 3DGRA 3FOKA 2G3JA 3EB2A 1LOSA 3A21A 3RUBL 4DXXA 4UCGA 3T2PA 4Y9PA 1TR9A 2YOCA 1ALDA 4O1FA 3VIMA 3LB0A 4NX0A 4PMNA 3GH4A 5D37A 2WLYA 3UZ5A 3XISA 3I10A 3LV6A 1PSCA 2X1RA 1SFSA 1HX0A 1DV7A 4PFHA 3CT2A 4IG2B 2W67A 2GOKA 6TAAA 2ACSA 3AHVA 4LRTA 3IARA 1XWYA 1DXFA 3FAWA 1GVOA 4N4PA 3W7NA 3RGTA 2QIWA 3UT0A 3VIJA 3RM4A 1CLVA 4WDWA 1QBBA 1P0DA 3BJFA 5T9BG 2W6RA 2W79A 3G1YA 4DRSA 2AMGA 1YQ2A 4N0RA 1EIBA 3UEQA 1QR7A 3WLJA 2QGYA 4HU0A 1GTHA 1UW9A 3R58A 5TD4A 1KA9F 3GDTA 2ZX6A 4DEFA 2OSWA 1EBHA 2ZQ0A 4IIFA 1VIWA 1XYCA 1KXHA 1JUBA 4GFIA 4E4UA 3WL0A 3QPYA 3OA5A 1V6TA 2A6NA 2Y5JA 1I0DA 3PSWA 5AYYA 1F76A 1EKOA 3HOJA 3WQEA 2Z26A 1AW2A 1H41A 3W74A 2XYLA 3FEMA 3KUMA 4XO7A 1JIBA 1OCQA 3QOKA 5D8ZA 4WSHA 1KGXA 3QHOA 2FH8A 3LM7A 2OTDA 2V5CA 1BG4A 5G4WA 3EDDA 2VEKA 4JS3A 2I5IA 1BSLA 3M6DA 3W83A 2VT0A 4S3DA 2F6UA 3LTYA 5AHMA 3QGVA 1MZRA 3H8AA 1R3QA 3ZFHA 2VFGA 3CC1A 3S1UA 1I2PA 4IXHA 5DMMA 1O1ZA 1YXYA 5CSUA 1W2VA 3O05A 5JIPA 2NUXA 1DORA 5A6BD 3B8TA 1PE1A 3RG6A 4AZ6A 5BYWA 1ZS2A 4XUGA 4IQJA 4W84A 4MFDA 3SJ3A 4NZ3A 4OV9A 3WN6A 4UR8A 2C71A 4R34A 1HJQA 4JEQA 1EX5A 3LX9A 3G8EA 9RUBA 1VFTA 4PH6A 4NNBA 3V75A 5TAOA 3WNMA 2QEZA 2F38A 3W6MA 4WY0A 4QQUA 1S46A 1C7SA 1MW0A 1VLIA 2VM8A 4BQ4A 1NP0A 3NQFA 1J0KA 3TEVA 4GX9A 3WLKX 1AW1A 4EVZA 4WK9A 4LS1A 1W9BM 2PTXA 3EOUA 1P48A 4QG6A 5CGTA 5ECVA 1ZRQA 2YB4A 3FGCB 2WNQA 4R9OA 3JW7A 4JDBA 4BCEA 2PZNA 3W2KA 4GCXA 1N82A 3AYTA 1FX6A 4ZEPA 4E4PA 4KGJA 1JVNA 3RLGA 2OYMA 1A4MA 3AMKA 3PF3A 3AO0A 2Z29A 2UY4A 1NIUA 1Z9AA 3CQJA 3N19B 1XIGA 1DXIA 1U5JA 4HNTA 4PR4A 1DWFM 3DHDA 4U3CA 2X1SA 1R8LA 1TREA 2QCMA 3E5BA 3KAOA 3BOFA 4BQ3A 5LIWX 2HVNA 1XYBA 4QDPA 4DWSB 1XIBA 3WDPP 3NO3A 4JTTA 5D9PA 4MGGA 1EB3A 1K3UA 5H8UA 3DHPA 1TCDA 3TZFA 2OKTA 2VOTA 2Y6ZA 3VDGA 3NVTA 4OUEA 1CTNA 2V8ZA 3TQVA 1NOUA 1QI3A 1WOBA 4H6RA 4PMRA 1A5AA 3DG7A 2RH9A 3DZ1A 5C2XA 1LM1A 2PDCA 3BE7A 2GZXA 3DGBA 2X1UA 3B9EA 3H2CA 5JXQA 4I5UA 2QV4A 3CMFA 1I0BA 4G5DA 1QO5A 1KGUA 1JCLA 3FV9A 4PRWA 4K37A 4UBPC 4QR6A 4QCEA 2Y7FA 5U4NA 1M6JA 3Q58A 4FXSA 5EL1A 1FBAA 2OWCA 3ARPA 4CEXC 1F73A 1FQ0A 3H6OA 2IQDA 1K7FA 4JZ5A 2IPFA 4HPJA 4IZGA 4G56A 1YLVA 5DCEA 3KVJA 3EKLA 2VEPA 3OBEA 4PGLA 3A3XA 4IH3A 1JCJA 4NASA 3VGHA 3LU2A 4Z1YA 1OBAA 1ZP4A 8CGTA 1QJWA 4LW7A 4L61A 2NSOA 2XM1A 3L9CA 3WD1A 4S3JA 4AZ7A 3CL7A 4GYFA 4MLJA 2Y61A 2P8CA 1TVPA 1Z44A 1SZNA 1TPDA 4DIAA 2XN0A 2YBVA 4U3AA 3GWQA 1TJRA 4UFJA 3OLDA 4IFOA 1PWLA 4RZ6A 3NDOA 5LHEA 5I0DA 1FOBA 4OBRA 2FPVA 1WZLA 4Q33A 2OYKA 3ZR4A 1TPVA 4Y9MA 2A2IA 3ABOA 1KCXA 4R7JA 2FIQA 3IJ8A 1M9HA 2HVOA 4Q8QA 2Y2WA 4IM4A 4HNLA 1LP6A 4A3YA 4NQ1A 1LJYA 5CGMA 1T6MA 1UPPA 3OZOA 2E5CA 4K8EA 1MQPA 3NG3A 4C6MA 3UR5A 4UTTA 2BLEA 4J7RA 3L2IA 3LCHA 3CV2A 3GG8A 4M0XA 3CQKA 1S5MA 2HK0A 3PZQA 2YW3A 1HVXA 1W9UA 1AFSA 1L8PA 3KWSA 3APTA 3CB3A 4EWJA 4LAUA 4HCDA 3CEUA 3UGRA 3C0SA 3P0XA 2H3BA 1QI4A 3TMQA 3SGUA 5KZEA 1P7TA 2QMJA 2V6AA 3LHWA 3HGJA 4Z1BA 5AZ0A 3DKLA 1VCFA 4E2DA 2VZUA 4OBTA 4A05A 1UA3A 3LBCA 3W53A 4MPQA 1W9XA 1RA0A 3ARRA 6PTDA 3BAXA 6REQA 3TAOA 1XGDA 5A8PA 2QPSA 1Z89A 3WCZA 3K8KA 3GIQA 1WUFA 3H2NA 3UG8A 3UNTA 1FHUA 2TODA 4IMCA 3KWXA 3REQB 1YRRA 1LOLA 3DYOA 3KBNA 1UC4A 1GG0A 3R6IA 4CD6A 1C9WA 3H24A 3IUHA 3LHYA 4Z2JA 1P0KA 2POTA 3O7UA 4XTIA 5E0KA 4OUIA 1KBIA 3B03A 3P60A 1A5OC 4GIRA 4ZQPA 3CM4A 3GZ3A 4FEZA 1ITUA 3HV8A 4L9ZA 2GGGA 5LXXA 4C65A 1RBOB 2VZVA 4GCAA 1XYAA 1V3MA 2WJEA 3EOLA 2HV5A 2YCJA 5CGQA 3XIMA 1VEOA 2XH0A 2Z00A 3L5LA 2IQTA 3ZJ7A 3PB2A 1UMLA 1TZ7A 1EP3A 4BQ2A 1VFHA 1XM3A 4F2BA 5A6BA 4H8UA 2ZIDA 2YDSA 1DHPA 1QK2A 3M7WA 3WX7A 7PTDA 4UB9A 1A5UA 5CLTA 1R9YA 3WQ4A 3I3EA 4F0LA 1EUNA 1YBQA 2NXGA 2QT3A 2QZRA 5E1QA 1SSDA 4JTDA 4OE7A 3JUGA 1R3VA 3OTRA 2PDWA 2OEMA 3LEPA 3SIMA 4I8YA 3KHJA 3KCOA 4IPIA 3QMSA 1NOWA 2WAGA 3RCNA 2YBUA 1ZLPA 3R25A 3GG0A 2CWNA 5CXPA 2O0TA 5C7HA 3LXCA 2FYMA 2VZOA 5BXRA 5T9CE 3DFTA 5JBFA 4RUBA 1E0XA 1PV8A 2OZ8A 2ZRYA 3TYCA 5I02A 3UA4A 4CVWA 3UZXA 1UH4A 4G9PA 5L9FA 3C8NA 1L6YA 1JYWA 4IQEA 4HMDA 4PUNA 3M5XA 2GFTA 3MTWA 4W8BA 2PTDA 3TH6A 4CCDA 5EU9A 1G4EA 3KDNA 1DJNA 2V38A 4KBXA 3ARWA 4V28A 2ZRWA 2IXVA 3CTTA 1TWWA 1YADA 1OK6A 5EKYA 4JQAA 4JKLA 1GVRA 1XX1A 1QXLA 4GQ0A 4ACZA 4ZVJA 3CUXA 2QCLA 1O5KA 1OC6A 2FPYA 3CO8A 3F4CA 4O12A 4DZHA 3KS5A 1QVBA 3WH8A 1BYBA 1XCWA 2O7QA 3W2MA 2Y5SA 1KXVA 3OGRA 4N9CA 4S38A 3KLKA 7ODCA 1MSSA 1HIZA 5CJNA 3AHYA 3G22A 5DO8A 3NSMA 1OZMA 2ZZ4A 3NQ6A 2I5GA 5I79A 2B7QA 4C6IA 2GGHA 3T6CA 4DXKA 3NYDA 3QHNA 3VKKA 3W3OA 3TLQA 3M0LA 1B3YA 3JS3A 4LVBA 4NXSA 1XF0A 1L2UA 2BS9A 4J35A 3GLCA 1TA3B 3TW6A 1VYRA 1FKWA 3AISA 1XL9A 4QEHA 1B4EA 4MLRA 3ABQA 3ARZA 1T41A 5A8MA 1MQQA 5G1YA 3RCMA 4J5NA 4LBUA 3S2NA 4GVIA 5KMYA 2V5LA 1K9DA 1F5ZA 5LNSA 4HQVA 3KE0A 5G1TA 1QI2A 1UKSA 1S3TC 1S2CA 2QNEA 1PKNA 1BKHA 3TQKA 5K7JA 4TX9A 1P6BA 2G3MA 4E8CA 4PULA 1J93A 4RPQA 2JGQA 4JIEA 2R1LA 2YL8A 5KITA 3WDQA 1P1XA 1CLKA 1Y0EA 2RGMA 4V27A 4CNPA 2H9AB 2G97A 1J0YA 4C90A 1YTEA 5JH2A 2QCDB 4DBSA 5F1UA 1J79A 2JIEA 2WMIB 4O57A 1RD6A 1XLCA 5HWNA 3MP3A 2D0HA 3TXZA 1RQEA 2E67A 4A3QA 1FXPA 3LGGA 1RLDA 3R8HA 1RK5A 3PJUA 1J12A 4NSBA 1VPQA 4WSKA 3IGXA 5A6SA 1MUWA 4QLLA 2HMCA 1AJ2A 3TFXA 1GNXA 4KPLA 1U33A 5REQA 2QJJA 3H7VA 2V3DA 3DOPA 5FESA 4F9DA 3UXAA 2ZE3A 1QT1A 2PDIA 3HF3A 2VDHA 4RE3A 1XSJA 5E6ZA 1OFOA 1IXNA 1PYMA 3BOLA 3MCNA 2Z6JA 2ZUMA 3ITYA 2HNEA 3CU2A 4JNYA 4QISA 2EG8A 3VDCA 3EWZA 3ZT6A 1DWHM 5LNWA 1TRIA 4DZ5A 1ZB5A 3UJEA 5HPOA 3WMSA 4KCWA 1GJUA 4O18A 3FSUA 1TQXA 1CZ1A 2VFFA 1E4NA 4C7FA 5LIXX 4GI8A 2VYOA 1ZP3A 3AIBA 1OCNA 3LHZA 3NSNA 3KL3A 1K9FA 5C7VA 1IWPA 1JZ3A 1JYXA 4MADA 5DELA 1VCGA 4FXJA 1HL2A 3LMYA 1LLWA 3UWUA 3WBYA 4Z2HA 2GJXA 4AD4A 3NL6A 4XQ6A 1GOWA 1UH2A 1Q6DA 4B4HA 1WAWA 4FXRA 3G2GA 4Z1DA 4ZXLA 3LHUA 3S6TA 5C55A 5CAKA 2PWUA 1N2VA 8XIAA 2PAJA 1LLOA 3U8GA 3GQYA 3NQBA 3C8FA 4FOKA 1V02E 4FS9A 2PD9A 3W1AA 1NWTA 3E96A 3DECA 2HNHA 1XPYA 1WDRA 4OVXA 1WXJA 4LB3A 1YYAA 4LWWA 1NOFA 2GUBA 2O9TA 3S9YA 5TF0A 1B57A 1GOMA 2CW6A 3L4WA 3ES8A 1FCUA 4C6NA 1VENA 4HT3A 4ZENA 1ZY9A 2ON3A 2P5NA 1L8NA 2VZSA 2B7NA 1Q7MA 3MSGA 2P3EA 2VMFA 5HMEA 3GXIA 4L1WA 3W0KA 2ESCA 4M3PA 3VNIA 4S3EA 1B5TA 3DKJA 4B2DA 3GXFA 1TMQA 5CCZA 2PGFA 4F2UA 1A5CA 2D3NA 4YTUA 5IBXA 2HZGA 4DWSD 1GJPA 2XDFA 5FKYA 2WMJA 2P76A 3CEPA 4LXFA 2CFFA 2V5JA 3QZAA 5DY3A 4N7QA 2X0HA 3KTCA 4QDMA 1Y65A 2YL6A 3URQA 1XYFA 3O16A 3I4KA 4JNZA 3QVQA 1VFSA 5CKSA 2GOUA 1VFMA 2QCNA 2YYTA 3QFWA 1V93A 3KTXA 5FJRA 4JTFA 4QJ1A 5EMYA 1H1ZA 1BVZA 2W61A 4Y2WA 2OGJA 2C8NA 1U2YA 1U30A 4LY4A 2J7CA 3LCGA 2JIWA 2WHJA 2REQA 1EXPA 4S3AA 3QV6A 3MP5A 1W6TA 4DJDC 4DHGA 4CD7A 4G7EA 4I5XA 5AHIA 3RPTA 4DYJA 3WDJA 4NJGA 3HMJG 5MKGB 3S47A 3GDLA 4MY9A 3T0CA 2E3ZA 4JQ4A 1UR0A 3W2UA 3DBPA 1EF3A 4NILA 1ZU8A 2DSZA 2L5HA 4X2PA 3RJYA 3SURA 3C2RA 4QEEA 5A6MA 2VEMA 2CITA 1XGZA 2FZ8A 1V03A 1MW1A 1IIGA 4PCNA 1W9PA 2VEGA 1KKRA 3YPIA 1LORA 2X40A 1W3IA 1W5PA 2HISA 4FP1A 1NVMA 3EPOA 4AEEA 4YHEA 3TN4A 1KQYA 1NTHA 3MVIA 4M81A 2XWEA 4NIRA 3QPEA 5GPRA 1OX4B 1TJ2A 1E6XM 3U6WA 4G8TA 3VKDA 4O11A 2YDRA 4M8UA 3KX6A 4W87A 2HS8A 3VFLA 3E2RA 1XRSA 3MO4A 4Q7BA 4H7VA 4GABA 4R33A 2ZXAA 3AJ7A 4TO8A 4QSFA 2FMOA 2VEFA 2DVXA 2AL2B 4H19A 1UH3A 3PPCA 1GVSA 3A22A 3FK4A 3B8DA 4RLIA 3LLDA 3B8SA 1P0NA 4NF7A 3UR8A 4Q4QA 1E51A 4YPJA 1TFVA 2XUCA 4JAWA 4MKVA 1D3HA 4ZSUA 4QFUA 4TQTA 4X9YA 3H4GA 4JTAA 1SUXA 1TG7A 4H8HA 3M44A 3PNUA 4D1JA 2EPMX 3N3TA 3M4HA 3WSUA 3H7RA 4LH8A 2EKGA 5IM51 2J6VA 4IG2A 3SUVA 1I2RA 1K03A 2QDHA 2W92A 1H7RA 2ZZ5A 3DN5A 3LQGA 3ZM8A 4ZCWA 3ECQA 1VD6A 3VABA 3VU2A 2PDGA 2XFYA 3IRSA 4F0RA 4C5ZA 4MJZA 3MUCA 2Y8KA 2E7FA 4S3FA 5D33A 4WVXA 1WZMA 3CZKA 2QKFA 3NA8A 3LLXA 1VIZA 3WD0A 3SDOA 3MUAA 2WB5A 3HG5A 1MNSA 1KXQA 3MMUA 3DUGA 5LZLA 4UTWA 5I3DA 2DZWA 2VGGA 4GH3A 4AY1A 1UWIA 3W28A 1EOMA 4C1NB 2Y5EA 2G5WA 4CQCA 2HSAA 2WJZA 1PZ2A 2PLKA 2VGIA 4AZIA 1WB0A 2Z0IA 3RLVA 3RJXA 3FKKA 2CLEA 2XZ9A 2P10A 3UG3A 3ZT7A 4K8GA 2V67A 3VD4A 3T8QA 3WMLA 1B9BA 4AD2A 4DF2A 1XSKA 4C7GA 3PANA 3OBAA 3KL0A 3W37A 2WC7A 2YA1A 3G1HA 4FF5A 5CSSA 4WKHA 4JHOA 1W3TA 1XLFA 3L2LA 1PX4A 4DLMA 1DJWA 2Y1HA 3HMCA 4LF2A 3NZGA 2ISWA 2CKSA 1WX0A 1RSCA 4EPKA 4S3BA 1YPXA 4AZHA 4Y6GA 2I16A 2ZUNA 5C70A 3CBWA 2VQTA 2XIBA 3MI3A 2GQAA 1CGXA 5SWUA 2VENA 4WGXA 1J8VA 1HGYA 1XYMA 3PPFA 3H55A 4DZAA 1FDYA 5ECUA 3QFEA 1TR1A 1CIUA 5D2XA 5RUBA 3EDKA 3RK8A 4EF8A 2EHHA 2WVUA 3WDIA 4BZYA 4AYGA 2XTKA 1G9HA 1CX9A 3N2XA 5A6TC 5I00A 4Z08A 2A3CA 4RK8A 3W22A 3RLHA 1WV2A 3QR1A 3TJXA 3ARVA 3E0FA 2O55A 4A3UA 4FO4A 4DJFC 1SFTA 3ABRA 4TTUA 1U22A 3LHTA 3PHAA 5LNVA 1H0IA 1UQZA 3OQ8A 2GJNA 3STCA 2IKJA 1QCWA 3BLPX 2HRWA 4KF1A 4U33A 2ZTKA 3MJMA 1W3HA 3LRKA 3NOEA 3QZEA 1QOQA 1HXJA 2E4TA 3N25A 4NY2A 3GUWA 2J9ZA 1FP8A 1KFBA 3HG2A 1FFQA 3N29A 1B1YA 1OWQA 4GJ1A 2Y7GA 1R7AA 4XTDA 3KZPA 3MYOA 1JRCA 3COTA 4JIHA 3ALFA 4MNJA 3SFKA 1E70M 3W4RA 3TTSA 4D6CA 1B3ZA 4C6CA 4RZ4A 3M0IA 1K9EA 4GYPA 4NG3A 2PDPA 4GGHA 1V4YA 2QIIA 3BW3A 3LRLA 3O6DA 4MIMA 4ERAA 1KM4A 1XICA 3TU9A 4M51A 2WLZA 3T07A 3E3HA 5HMDA 3BMWA 3UG5A 3TAKA 3EWCA 2J27A 3IEBA 2YW4A 5XIAA 3VI2A 4JKMA 1UP0A 1ZSXA 2JE8A 1W1PA 5G2IA 4ZO6A 3WQDA 1W1VA 3FJLA 5IHSA 4E3VA 2G41A 2WM0A 2HE5A 4DWSA 4UUIA 3WJXA 4EX4A 1OADA 4AIUA 4IX2A 3E0IA 4H41A 3E0WA 3N4FA 3QRHA 3ERPA 3QJAA 2XSAA 3G1XA 1OQFA 4JBRA 1EJVC 3DFPA 1TPH1 4WDUA 2V9DA 1FUYA 3ARSA 2J7EA 2OFJA 2KX9A 1X8FA 4PUDA 4FOJA 3SB0A 2JALA 2Q6ZA 3F4DA 1JPIA 8XIMA 4F9JA 4GZJA 1GW1A 2F2KA 2Y4SA 5KZMA 4XIMA 4HTBA 1R9XA 4LY8A 2DQXA 1E6RA 4LX4A 1M01A 4HHLA 2XIMA 2CBIA 3LTSA 1PYFA 3A4JA 3WQ5A 1LG2A 3FA5A 3RRAA 3G1FA 2ZVIA 2DZPA 2INFA 1EF2A 5LIYX 1MWOA 8TIMA 4JN6A 5E6YA 4EAMA 1GK8A 1M53A 3KM8A 2X05A 4KWVA 4TVUA 1M3UA 4LYPA 3AHTA 3H54A 1DHKA 1GQLA 4PYSA 3LZ5A 1XDLA 3JRKA 3KLLA 1V0MA 3WJZA 1E5NA 2YLAA 4H01A 2PMQA 3WBWA 4DI9A 3MV01 3CAQA 1V08A 4RNHA 1GPFA 3KVMA 4US6A 1GVIA 1OX5A 2NT1A 1ODZA 1FWIC 3QF0A 5JQ9A 2XM2A 3MSDA 3WUEA 1RVGA 1ZCOA 3U7BA 1W8SA 3TLLA 4QG8A 4M19A 1VRXA 3W81A 1UJPA 4I3GA 3GXNA 3BSGA 3A13A 3L4VA 3WQ6A 1H11A 2DUZA 4YTTA 3N6HA 1JDAA 1WDDA 1EIXA 1IEQA 5C9XA 1J2BA 2V5BA 3V7PA 3NO5A 4GG9A 4K68A 2RKXA 3KFTA 1DEDA 2YXOA 1SJBA 3A6OA 4QBXA 3EWWA 1EC9A 2AQOA 2BXZA 2YXXA 1C29A 3B9OA 1ESWA 3B0VC 1W5MA 1OGGA 2VNCA 3Q94A 4W93A 3SIZA 5CZJA 3FN9A 5BXSA 1NF7A 3AZTA 3SM0A 1ELSA 3UZYA 1DQWA 2J7HA 5H6HA 4HHHA 4ATLA 2E9MA 1SU5A 1BHGA 5CZ0A 4AVNA 1TMHA 3PAJA 1WBHA 2KZHA 3VINA 3PZIA 1QHPA 3IUDA 5GJPA 1SJCA 5I3HA 3UXLA 3DX5A 4CQAA 4YTSA 2R94A 1UR9A 3UPBA 4HU4A 1KKOA 3AI0A 1HL8A 3LLFA 3SCTA 1EJXC 3QLDA 5EMJA 1GYNA 3OO2A 4H04A 1Q63A 2JKEA 4EACA 4MZ8A 5LNRA 3FY1A 5IDZA 4S3KA 3K4DA 4XAZA 3WDHA 3A64A 3FJNA 3N4AA 4LEQA 7ENLA 1KCLA 3R0DA 1XCFA 1PX3A 2Y88A 3SUUA 2D2OA 2CEQA 3KRSA 4H8VA 4H9ZA 4S2CA 1J11A 4HSOA 3QV9A 1CPUA 4AY8A 4PUMA 5FF3A 4LYQA 3S1VA 1NDVA 2PF0A 5AC6A 4Q7NA 3FYPA 1KTCA 4O14A 3BPWA 3WKZA 3MWCA 1YDYA 3NQEA 3GC5A 3G1AA 1FWJC 2ALRA 4Y8EA 4OHQA 3MW7A 4U4MA 4UTMA 5HOSA 3REQA 5BNKA 3WG6A 4J3SA 3LXBA 5HQLA 5BOEA 1SFLA 4QDWA 4D6GA 2IQ0A 5FSEC 3ZYZA 4JOMA 1EUAA 3BGAA 5F2IA 3OGSA 4IIGA 3STFA 4J3VA 3ZVHB 1TV4A 3LN3A 1MQRA 1F7BA 5K9DA 1I8JA 3WMCA 4RZBA 1G4SA 1J5TA 3PS7A 3VOJA 2F6KA 2RDXA 1EEPA 1VFLA 5CSRA 5I3GA 5AVNA 2OGYA 1QPNA 3ITVA 4DLFA 4PB3A 3PTDA 3NQDA 3GNNA 4HZ6A 3KBWA 4JFVA 1A5KC 4HJWA 3OVQA 4FSAA 3RCYA 1XFBA 1DPMA 1OFBA 3KOYA 3GNPA 3HG3A 4ZODA 3QY8A 3B40A 2YGYA 4UFHA 3GDRA 1TPEA 4X2RA 4O0QA 1JF6A 2CLFA 3ITCA 2XFRA 3B4YA 1QAPA 3PFMA 4IISA 4DELA 3TYBA 2AQVA 2GL5A 3VDHA 1O1HA 2FHFA 3JR2A 3H2FA 3LNPA 1UA7A 5H8MA 3WQGA 2FTWA 4FNRA 5HR7A 2NQLA 3N34A 1J4EA 2J8FA 2PA6A 3VNJA 1TWSA 4UNLA 4A4AA 2BVTA 1K8CA 3MDWA 1ADOA 1HKJA 2VC7A 5JH1A 3SCWA 3C86A 4LUIA 2GVGA 2VVSA 3PM6A 1LL4A 1XRTA 2IUZA 2Q3OA 4YS1A 3TIMA 2HROA 5H91A 4PFMA 4K1GA 4MAZA 1L6GA 3EWDA 5A6JA 5CPOA 3W7RA 3SCUA 3FA4A 4D6JA 2Q71A 3B0YA 3BCFA 4LVAA 5C2GA 1UZDA 1H50A 1TTPA 2Z7GA 2E77A 1AL7A 2QCEA 4HP5A 4OQVA 1FWHC 1JZ6A 3ORWA 5I77A 4MJ4A 3G1SA 2I9EA 4MFEA 3B8VA 5K4ZA 2R1NA 2XVKA 3B97A 2ZFAA 2FJUB 3IANA 4YU1A 4A2SA 3CMJA 2FLIA 4RDVA 1JPDX 2V68A 3TVAA 3GU2A 4QAIA 1XYZA 1Y7VA 3MDUA 3TP4A 1QW9A 4J3TA 1R0MA 4GKLA 3MP4A 3IJDA 4WDTA 3V0SA 1QO2A 5DRCA 3OJGA 3VAVA 1KXTA 3GNXA 2XIQA 4WEVX 1QNRA 1TE6A 1W32A 4ZL1A 1GQIA 1Z32X 4X60A 4TMBA 2DU2A 3AS1A 3EKZA 2OJPA 1W0MA 1S2UA 3G5EA 1SFJA 3N12A 4CN4A 3W7LA 1ZGDA 2CNCA 3M43A 1TWZA 1Q13A 1BXBA 1K8YA 1EC7A 4LEFA 3BW4A 1T99A 3AHXA 3GZAA 4UQDA 3GVVA 4CD5A 1B9ZA 1TA3A 3LI0A 3E5PA 5IXEA 1FHDA 3FVMA 3TONA 2PURA 2WVTA 1TPC1 1LL7A 1ZTVA 4MWAC 1Q6LA 3IIPA 2EPKX 4H6QA 4K6AA 5DF0A 3BQ6A 2FPTA 1B31A 3ZS4A 4AZ5A 4LCSA 2D20A 3E74A 1JGIA 3PNZA 4NNCA 3RX3A 6XIMA 3SCQA 3B8WA 2VHLA 2E25A 3BMXA 5A2AA 1SPQA 1CI1A 4GUGA 2H9AA 1XR2A 4XIAA 4D1IA 3G0UA 1B3XA 4PBFA 1IHIA 2FHCA 5CEWA 2WANA 4YHGA 1PEZA 3TC6A 4AXNA 3N6QA 1OYCA 2WMIA 3CHEA 2PTWA 5ABFB 1PAMA 1C91A 2PEVA 1D3CA 1E9LA 1ML1A 3WLSA 4HPXA 4Q8VA 3ANUA 4KIRA 3CUGA 2VELA 4HPGA 1KFJA 4N9BA 4MKSA 1ITQA 3GW3A 4UQAA 4D71A 3PJXA 1XD1A 1GW9A 5D2TA 3WFZA 4N02A 4M1BA 4GNJA 4Q4OA 1EQCA 1R47A 2YA0A 2PSNA 5D8WA 1A50A 2VRQA 5A8GA 2IPWA 5E0CA 3AFBA 2VD9A 4UC5A 1WDPA 1A5NC 2X8RA 3P14A 3LPFA 4HVXA 1US0A 1GQKA 4LGXA 4BJHA 4PSPA 4RPPA 3F2DA 1WDWA 2HDJA 4K8HA 2ZX7A 1CW2A 1FWDC 3MJYA 2D2HA 3AIUA 3O6CA 1AH3A 4TXEA 4LCRA 4EPBC 3VD3A 4Q22A 3TDFA 3CHDA 3S2JA 4GZIA 4JTQA 1EWDA 1LCOA 5IRPA 1XXXA 4XVEA 3O6YX 2QAFA 2HCVA 4Q4MA 2ZRUA 1JCNA 4W9TA 3V3WA 3LMZA 2O4MA 5D02A 2J9YA 2WJDA 1O5XA 3V5OA 4B91A 1SZRA 2VC5A 5EMMA 1C90A 4DO6A 3ARXA 3LGEA 3QM3A 1ODUA 4IGSA 4PTMA 1E40A 5DXXA 4G7FA 1K4GA 3W70A 4GK8A 4J40A 2WSKA 3APGA 1NJJA 4PE8A 4LS0A 3G6LA 3M0HA 2PTYA 3E2QA 1SW0A 1NFGA 3OHIA 3AS3A 2R6OA 3AHZA 4WGHA 1IQ8A 3GKAA 3TQPA 1UR8A 5CZTA 5FAJA 3VC5A 4JTCA 1E6SM 1KO0A 1Q6OA 1CB2A 1SM9A 2WSPA 5KTLA 2VFIA 1FWNA 2E40A 1VEMA 1BD0A 3R0KA 4HK7A 3OVRA 2CLPA 4FMVA 1VZWA 3AS2A 3B06A 2I5QA 3I6TA 1WKDA 1LQAA 2A4AA 2YSWA 5G2HA 4GJJA 3KP0A 4C6BA 4EK7A 4GUHA 3L4YA 4KEUA 3RM9A 3H22A 3EWUA 1XH1A 3GVWA 4PB4A 4XZBA 3THUA 5BU6A 5C9RA 4JX5A 4JN7A 4WLCA 4KIEA 4HA1A 5IHRA 3U4FA 1RALA 5K2ZA 4HA3A 3GH5A 1W5NA 3MV11 3CNYA 5HANA 2WBKA 4ALDA 1JDCA 4WZHA 4MMWA 4UTLA 2ACQA 1E6PA 3QOMA 9XIAA 5I6SA 4HHPA 2DEPA 4NP7A 1US3A 2O4QA 2E6DA 2DSUA 2A7RA 3VIHA 3AYSA 3CHFA 3L0KA 1HVQA 2DT3A 3NNTA 1J01A 4AWTA 1H7NA 1E5JA 2XVLA 3RM8A 3IIXA 3DXIA 4XZNX 4LYKA 1G01A 4AU0A 2W91A 4HYRA 4UTHA 5AY7A 3S5ZA 4ZGYA 1QASA 1Q2SA 3W2JA 3R10A 5MKGA 3NDZA 4HCLA 1AH4A 3DENA 1P5BA 1CB7B 3QBUA 3DAQA 1TZ9A 2OX4A 4LVDA 3M5VA 1EQPA 3GTHA 3OGVA 4FNUA 1MEWA 3AIQA 4JY8A 4ZBCA 3PZMA 4W5ZA 1VR6A 2VGFA 4ZB2A 1PHQA 4H9XA 3EDEA 1JDEA 1UUMA 2YIHA 4NUWA 2ZZ1A 4DUWA 1PIGA 3KTSA 3NQCA 1A3HA 3RDKA 3U48A 1H4PA 4X9SA 4IMAA 1YDVA 4QTGA 4JD4A 3GFZA 2OX1A 1WDSA 4F40A 1KD0A 3BGGA 1IEVA 2PWGA 4WDXA 2ATMA 4EPEC 2VDIA 1OX4A 4BA0A 4QSHA 1A47A 3I4EA 4IP4A 1X1OA 1ISWA 4HD5A 1KWGA 1GQJA 3QEZA 3WZ0E 1J18A 3URAA 1FFRA 3LM3A 2E6FA 3EBVA 3E9AA 1TV2A 3WBXA 1TE1A 1JRBA 1GVEA 1KCZA 1G5AA 4K7YA 4UQEA 1PWMA 4FHAA 4AC7C 4XZLX 2CLOA 4FI4A 1AZ1A 2AL2A 3AQUA 3WD2A 4F0KA 4D8AA 2E5DA 4ZR8A 2XVGA 4K1WA 2QPUA 4R53A 3A3HA 5AHNA 1XLBA 3CV7A 1SMDA 1UR2A 4GE8A 4JHMA 1E0TA 5I23A 1F3WA 3UETA 1EPVA 1A53A 1KCKA 4IJBA 1KTBA 1QHZA 4OBSA 1H61A 4Q4PA 4HZ7A 3NZPA 1RPKA 4MJMA 4O54A 4V1YA 3AUJA 2FHBA 4GMEA 3UG4A 1GKQA 3V1HA 2V81A 1M41A 3THCA 1IE7C 1H49A 1TJ1A 1TVNA 2EAWA 3MMTA 2G0WA 1PKYA 4AIOA 3N2OA 1GOIA 4AG0A 1E9YB 5I78A 1F74A 2GVYA 3AXXA 4ICCX 5HDRA 4LVGA 3UJSA 1XKJA 4RXGA 1Q2RA 3WLNA 4XZIA 4QITA 3A47A 4GINA 3RHGA 5A69A 2GK1B 1Q45A 1RK6A 4DNHA 1QNQA 3PAOA 3S5OA 1Q6RA 3LBOA 4RDZA 5JBEA 3AXIA 3AS0A 3KL5A 1BF6A 1OC7A 2VFHA 5CC7A 4H00A 4Q8TA 1GQNA 3VGFA 3CZLA 4E2VA 1TV7A 4CCCA 1F4HA 3QR3A 1GVFA 4BF7A 1K8ZA 1UWSA 2PLJA 1A5BA 4FNSA 2YPIA 1Y5VA 2O7SA 1AH0A 4UZUA 2DT1A 3OVPA 3OOQA 3BVJA 2GQ3A 5CPLA 3PG8A 2QCFA 3NURA 3LG3A 2XPKA 4PZVA 3USZA 1ZAJA 2X1TA 4FXFA 3WF1A 4DM2A 3BLIA 4TOQA 1DJXA 3W7HA 3F03K 2DORA 1NFBA 2FDSA 3A4AA 4ADSA