5AC93

Structure-based energetics of protein interfaces guide foot-and-mouth disease virus vaccine design
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
220
structure length
220
Chain Sequence
GIFPVACSDGYGGLVTTDPKTADPAYGKVFNPPRNMLPGRFTNFLDVAEACPTFLHFEGDVPYVTTKTDSDRVLAQFDLSLAAKHMSNTFLAGLAQYYTQYSGTINLHFMFTGPTDAKARYMIAYAPPGMEPPKTPEAAAHCIHAEWDTGLNSKFTFSIPYLSAADYTYTASDVAETTNVQGWVCLFQITHGKADGDALVVLASAGKDFELRLPVDARTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Energetics of Protein Interfaces Guide Foot-and-Mouth Disease Vaccine Design
pubmed doi rcsb
source organism Foot-and-mouth disease virus - type o
molecule tags Virus
molecule keywords VP1
total genus 26
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2015-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5ac9300
2RS52 2R072 1R1A3 4Q4X1 5DDJ1 1RUD3 1M06G 4CDQA 4RQPC 1HQNA 1X33A 4Q4X2 4CEWB 5K0UC 5JZGC 5JZGB 4FTEA 1ZBA3 4RFT0 1RUC1 4RQPB 1QJX3 5DDJ3 1RVF3 5BNOA 1VBE3 1VBD1 3ZFEC 4WM7B 1MQTA 2RM23 1RUI3 3M8LA 3VBUB 4BCUA 1QJY3 2RMU1 4YVWB 3IDEA 1EV12 1POV0 1CJDA 1PIV2 1Z7S3 2WFF2 5CFCC 3J8F1 4RS5B 5JZGA 2HWB2 1AR61 5DDJ2 1QQP1 4IV1B 4FTBA 3ZFGC 1V9U2 1AR62 1K5MA 5ABJB 2IZWA 4Q4V2 1NCQC 4GMP0 4SBVA 5GKAC 1DDLA 1AYN1 2PLV2 4CEYB 5BNPC 1VBC3 2RS33 2ZAHA 3JBG3 2BFUS 1QJU3 1ND2B 3VBFB 1AL0G 1AR71 1C8M2 1ZBE3 1PO11 4JGYA 1BBT1 1MEC2 1TMF1 4AEDC 1PO12 2HWE1 2RS12 4JGZC 5L7OC 1PVC1 3NAPB 4CDWA 1QQP3 1RUG1 1OHFA 1R083 1NOVA 1R1A2 1NCRB 1B35B 5A32A 1NCRA 1RUE3 4Y5Z0 1QQP2 2RMU3 3TN93 2HWB1 5BNOC 1AR93 1RUI1 5BNPA 1PIV1 2RS51 1C8M3 3ZFFA 1D4M1 5C9AB 5BNOB 1X36A 1R081 1NCQB 1HX6A 5C4WA 4WM8A 4N43A 4N53B 1PGL2 1W39A 1GFF2 5C9AC 4IV1C 5FOJB 2PLV1 2WFF3 3VBHA 3ZXAC 4N43C 1K5MC 4N53C 1V9U1 1COV2 1MQTB 4YVSC 3ZFGB 1RUF2 3VBFA 3VBUC 2HWF1 3HAGA 2RM22 2ZTNA 3JBG2 1VBC2 2RR11 1NCRC 2HWD1 3VBSB 4RS5C 1FOD1 1HRI2 1VBE2 2WS93 5A33A 1Z7S1 4YVWC 4FSJA 4Q4Y1 2HWE2 2RS11 3JD72 1ASJ3 2HWC1 4RQPA 2HWE3 5L7OB 4CDUB 2R062 5ACA1 1ND3C 2VQ0A 1QJY1 1ND2C 3JB4C 1E57A 2RR13 1PIV3 5CFDA 1VAKA 4WM7C 4CEYC 1AYN2 1R093 1VBD3 4Q4V1 3VBUA 5C4WC 1RVF1 5AC93 4RHV3 4CEWC 3DPRB 5K0UA 3J8F2 4RR3A 4FTSA 4RS5A 2R041 2R071 4N53A 2HWC3 1QJX1 2X5IB 1VRH1 1RUJ1 4CDXA 2R042 3VBOC 1ZBE1 1OPOA 5FMOS 5C9AA 1FPN2 1EAH1 1BMV2 1HRV2 3TN92 4PDWB 1RUD2 1RUJ3 2RS53 3VBHC 1FMD2 1RUC2 4EJRA 4GB33 1EAH3 2WWSA 4RR3C 2BFUL 2WZR2 2RS13 4Q4W3 3JD71 3VDDB 2GH8A 5AC92 1VB4A 5BNNC 2X5IC 1VBA1 1ZBE2 1AR81 4YVWA 1RUJ2 1HRI1 1AR73 4GMP1 1NY72 4RHV1 1VBC1 1TME2 2RR12 4LLFA 3LOBA 1AR82 1PO13 1H8TB 5D8AC 5AC91 1MEC3 3VBOB 4AEDA 2R063 3ZFGA 2QQPA 1R091 3JB8A 1V9U3 1QJU2 4JGZA 1HXS3 1RMU1 1K5MB 3VBHB 2HWB3 1AL22 4WM7A 1HRI3 1VB2A 2PLV3 1IHMA 3J8F3 1EV13 1FMD1 1VBB2 4IV3A 5CFDB 1ASJ1 4NWVA 1AL21 1PGW2 1AR63 4IV3B 5C8CC 1RUD1 1RMU2 4GH4A 1QJY2 1RHI3 4JGYB 4WM8C 5BNNA 5L7OA 3ZFEA 1RUF3 3VBRC 1FPN1 4Q4Y2 4GB31 2WLPA 1OOPC 4QPGC 1NG0A 1POV3 3VBOA 1ND3B 2BBVA 1RHI2 1QJX2 2MEV2 1A6CA 3JBG1 2RM21 1ZBA2 4YVSB 1RUI2 1RUH1 1VBB3 2Y26A 2WS92 1AR83 1MQTC 1AL23 1RVF2 1BEV2 2FZ2A 4IV1A 4CDXC 1PO23 1CD3G 2XBO1 1R1A1 3ZFFB 3NAPA 4CDUC 1VBB1 2WZR3 1HXS1 1AYM2 4Q4X3 3TN91 1D4M3 3CJIA 2R061 2BUKA 2ZZQA 1BBT2 1MEC1 1TMF2 1EAH2 4CDQC 1BMV1 1C8M1 1ND3A 1QJU1 5ACA3 4Z92B 4QPIC 4QPIB 4Q4W2 5D8AA 1F8VA 1RUG3 1RHI1 5A33B 1HRV3 3CJIB 2HWF2 1AYM3 1C8NA 4Q4W1 1FPN3 1OOPA 4QPGA 4N43B 2BPA2 1VBA2 2X5IA 1FMD3 2R043 1PO22 3VBSC 2RS32 1BEV3 4GH4C 1EV11 1AYM1 4CDQB 4PDWA 1RUG2 4Q4V3 3FBMA 2XBO2 1PVC2 2RS31 4AEDB 2MEV3 1BEV1 4GMP3 2HWC2 1ND2A 4CDXB 1PO21 3VBFC 3ZFEB 1R092 1AYN3 1VBD2 1Z7S2 5CFCB 1D4M2 4Q4Y3 1ZBA1 4NWWA 2HWD2 3ZFFC 5ABJC 3VDDA 1RUH3 2GSYA 3JD73 4GH4B 3VBSA 4QPIA 1COV1 5CFCA 1SMVA 1H8TA 1HXS2 1PGW1 3CJIC 1ASJ2 4JGZB 5A32B 4CDWC 1NA1C 1AUYA 1RUE1 1COV3 1B35C 3DPRA 4CEWA 1AR72 1HRV1 2FZ1A 2WS91 1QJZA 2R073 4JGYC 1RUH2 4WM8B 5J98B 1B35A 3NAPC 4CDUA 5D8AB 1WCDJ 1RMU3 3VDDC 1VRH3 5LK7B 2HWD3 1PVC3 5K0UB 1TME1 5J96B 2MEV1 4RR3B 4Y4YA 1H8TC 3S6PA 4GB32 5BNPB 2WZR1 2DF7A 1RUF1 2WFF1 5ABJA 2XBO3 1F2NA 1VBA3 5BNNB 3DPRC 4CDWB 1RB8G 1AR92 2XPJA 1TME3 5C8CA 4CEYA 2RMU2 1NCQA 5C4WB 1OOPB 4QPGB 3VBRA 1PGL1 2TBVA 4YVSA 3VBRB 5ACA2 1NA1A 1R082 1FOD3 2HWF3 1BBT3 1TMF3 1POV1 4PDWC 4IV3C 5C8CB 1NA1B 1RUE2 1FOD2 1NY71 1VBE1 4RHV2 1AR91 5CFDC 1VRH2 1RUC3 5FMOL
chains in the Genus database with same CATH superfamily
1KRIA 1G9CA 1UY4A 4Q4X1 1OKQA 4EWAA 4AQ2A 5A3UA 4JQTA 4XEZA 1ZZ8A 4LBJA 1HDKA 3CF6E 3POSA 2VZQA 3WW2A 2ZHLA 4A44A 1ULDA 1PHMA 1UIKA 1X7NA 5T5JA 5JZGC 2YC4A 5JZGB 4CXXA 1QU0A 2BOJA 2NYYA 1GNYA 1TEIA 1ZBA3 3I2IA 4RFT0 1H2NA 1W2TA 2DYCA 2WYSA 2BGOA 2RDNA 4UBHA 3RZKA 1ALYA 2A3YA 3PU3A 1S0FA 4N8MA 2O8QA 3ZFEC 1GANA 5HBAA 4XIOA 1QIQA 4CU6A 4G4FA 5JIAA 4C1WA 5JSOA 1O4ZA 2OIIA 4Y20B 4OCTA 1MPXA 4BCUA 1MS3A 3WD5A 1RINA 4YVWB 5FYVA 3H8OA 1FAYA 2G19A 2B8MA 1OKOA 3N9MA 1LHNA 3ACIA 1PMJX 1DYPA 2D3RA 4TN7A 4OI0A 3VKFC 2VOWA 5CFCC 3NL1A 4FPJA 2WNVA 4HT1T 5JXIA 2JDYA 3H7YA 4XJZA 4LJHA 1IZ3A 1WW6A 1AVBA 3CQOA 2ZX4A 4KGQA 4LBQD 5DDJ2 1YQCA 2B42B 2CWSA 1QQP1 2W68A 2VTXA 4YSFA 4XMAA 4LR4A 3UV9A 1G86A 5IK5A 1LOFC 4AFDA 2XGXA 2UWBA 4BQ2A 4EROA 5F9TA 1LECA 2ZMNA 2C9KA 4GMP0 2LTNA 4LBLA 5GKAC 3ZR6A 4FFFA 3VDAA 2PLV2 4I0AA 4BA6A 4NIDA 4FXKB 4JKMA 3EJKA 4J1XA 2BFUS 5A1FA 1FNZA 1YC61 3NVCA 1ND2B 1DHKB 1US2A 1AR71 2B9VA 1ZBE3 1XE7A 2QQWA 1O4TA 4JGYA 5GLZA 4IW3A 3TOJA 3VHPA 4QXHA 3LEKA 1XU2A 4AEDC 3N7MA 1GV9A 4JGZC 2XDVA 2Y64A 4HN0A 4A2UA 4A41A 3LZZA 3DN7A 3ACGA 4XFAA 2ZGOA 3KMHA 1OQDA 4JKLA 4CP9B 4M00A 2OXBA 1ZVFA 3BU0A 4NRQA 3H3LA 4H3WA 1B35B 1LOFA 3ZXEA 4JDMA 3R6SA 4IE5A 2ZMKA 3BVCA 1BXHA 1K12A 2H6BA 1HN0A 3KZ4C 3S7EA 4YZ2A 5A7NA 1IQAA 1EY2A 5BNPA 2BTVC 4KBBA 4LHKA 1NXD1 3AP9A 3RZMA 5IFPA 1C8M3 4PBOA 1K42A 3ZFFA 1GBGA 3SCHA 2DTWA 5L9RA 2WFPA 2FDFA 2EIBA 4LBKA 2Z5WA 2A6VA 1E5IA 4NHLA 4QU2A 2P17A 4AEKA 4XF1A 4FBFA 4D3WA 1GZCA 4P08A 1LNSA 2CAUA 3WQ1A 4XJAA 4BQ3A 4BXSV 4E2GA 3WDTA 5SV5A 3FUQA 3H1MA 3I2OA 4HETA 1YI9A 4QAWA 3VBHA 4N43C 2ZA9A 3KHBA 2EA7A 4MLOA 2VQTA 1K5MC 2JG8B 5A1LA 2VL4A 3RJ2X 5KHGA 4XZUG 4QD2A 3POFA 3SHRA 1XNAA 4MGIE 3A23A 2W1SA 5FP8A 3MW2A 3VBFA 2AEYA 2IXLA 4U2AA 4L8QA 3SC7X 1XC6A 2VJXA 2BERA 3I59A 3PIGA 2RM22 2ZTNA 4K9SA 3SEPA 2RR11 3B9CA 1N1YA 2HWD1 3FN9A 5E89A 4HFSA 4W65A 5T54A 4V2VA 2Z4FA 5FZAA 4XCBA 4Y24A 1VBE2 1HRI2 1F4AA 2PAMA 3OCPA 4Z1VA 1RUNA 2QCSB 5DMYA 3POYA 4XF4A 2RJ2A 4C0HA 1JU3A 2P5BA 2HWE2 3UKTA 3JD72 4V2WA 3I3MA 1QWRA 3L9JT 4CDUB 5HCAA 2R062 4DEQA 1F4HA 1LB2A 3GBFA 1ZZCA 1XQNA 5FP4A 1H6XA 4QQHA 4UFIA 4AVVA 1WGPA 1H1IA 2VBDA 2C6SA 2LUWA 3T2OA 3P3NA 5DUXA 5CFDA 3IT8A 5JOWA 1GOGA 4OZOA 1VBD3 3VL9A 1W90A 4XYXA 3IBMA 1V6NA 3RZJA 1VALA 3NKTA 4QU1A 4CRQA 2XLAA 3ZXKA 2A3WA 1H9PA 4UT5A 3E6DA 4EZ4A 4OHZA 1XNCA 3IN9A 4NIAA 4CEWC 2C5DA 3O1UA 2ILMA 4ZY9A 1DQ5A 2PN5A 1S0EA 1HKDA 4NOTA 5K0UA 4IXLA 3OGVA 1ODNA 1H6YA 1V70A 3PUSA 4AR2A 5LASA 3O7OA 2R041 2R071 5DAXA 4CU9A 5A3WA 2X5IB 1QJX1 2XJPA 1A3KA 4UW6A 3OTFA 4I0WB 4IEOA 5EJ3A 3K4AA 3NNMA 1W99A 1RUJ1 5BPXA 4CDXA 3G7DA 5IVCA 2R042 2GC2A 2PAKA 1IS4A 2W47A 4JQRA 3BIEA 3KHCA 4KBZA 2VMDA 2IC1A 5G05L 3IPVA 4MXVA 2J1TA 3NRUA 3SKJE 4NN0A 2JG9A 1LHOA 1SCRA 1S0CA 2GN7A 1SEFA 3SMHA 4BK4A 4DINB 3N9QA 3AX4A 1QNWA 4AF9A 4AAPA 1V6KA 3AMMA 1I6XA 4QDSA 3EO6A 4X6RB 1NX9A 4EJRA 4KMQA 5AFEA 1H2MA 2G9GA 4KU8A 2WWSA 1U0AA 4FQZA 1SFYA 2ZXQA 4QX1A 1NT0A 3OUHA 3H1YA 5LBEA 2MHFA 1L3JA 1W8NA 1UZYA 4MGKE 5AVAA 2RS13 4EN6B 4Q4W3 3MI8A 3WHTA 4Q0PA 1OA2A 2X5IC 3ZYBA 1BHGA 3AKTA 1AR81 1RXFA 4MADA 4W4ZA 4UF0B 3WQ0A 3K51A 3NNJA 4CPBD 1ZRFA 1W9YA 2BV4A 3LFMA 4FP2A 5CA6A 4M4PA 2YU2A 4HXCA 1REDA 2YY1A 3U11A 1NY72 4D6RA 1TME2 2J1EA 5CBLA 1H8TB 5D8AC 1ZZBA 2R0HA 5AC91 3RMYA 4YFWA 3S5QA 3H3ZA 4QMAA 2R063 4HPKB 2QQPA 1CAXA 5SV8A 4LULA 3VDCA 5FZCA 4JGZA 2B9UA 1HXS3 2VVFA 2NLRA 4P5HA 1O5LA 3V65A 3VBHB 3WXPA 3WNOA 1RUOA 1URXA 1HRI3 1VB2A 1F5FA 3O14A 5FXWA 3AKPA 4I3PA 3VHRA 3AL6A 4KNCA 5LWBA 5DAPA 3ZYGA 5I91A 1O3RA 2GAUA 4ZU5A 4JHTA 1EV13 1F31A 4DY3A 2QBXA 4XURA 5A3TA 2RV9A 1ASJ1 3T08A 5L9VA 1GZWA 4I30A 3VHNA 2DVFA 3KVBA 5JSRA 1Y3TA 4GH4A 5FIXA 1QJY2 4WM8C 2JDUA 4OHVA 3ZFEA 3WCSA 2D40A 1V0AA 2VUAA 1Y9MA 1FPN1 3A7QA 3FJSA 4PF1A 3IZOA 4A6SA 5K8SA 1GMMA 2RJKA 2RDSA 2Y0OA 1BK1A 5GLUA 3ZSMA 1JZ3A 2ET1A 1OOPC 4QPGC 4FP3A 2VPVA 4LHLA 5JXGA 4WVMB 3ITQA 1BZWA 2PHRA 3OGRA 4OI2A 1X8MA 2WQ4A 1NXMA 1RHI2 2ID4A 3BPZA 4META 4XF0A 3E6CC 5LBBA 3HPNA 1O59A 3JBG1 4K3UA 1N47A 2ZJCA 4DZGA 4CCCA 3IIAA 2ZHMA 4ASLA 1VBB3 1WZXA 3GJAA 3LSDA 4Z2WA 2WAAA 3DYMA 2E51A 1F5JA 2WDBA 3ZIWA 1YLLA 4LO5B 1RVF2 3QLQA 3GF6A 1XBFA 3MEPA 4P9XA 1UU6A 3NJXA 3WF0A 3NNGA 3IM0A 4XQWA 1HJFA 2VZUA 3WDXA 2JECA 4N7UA 4LT5A 1VBB1 2AACA 1G9FA 5GM0A 3A0NA 1J1LA 4YZ4A 2JDZA 1Q5OA 2ERFA 4AHWA 2ZZQA 1ZX5A 1TMF2 4XBLA 4CDQC 1KJRA 3JZVA 3NWKA 4AI3A 4ES9A 5FAXA 1C8M1 1QJU1 4Y22B 4CSWA 5ACA3 4Z92B 4QPIC 1QOTA 1O3TA 2NP0A 1H1AA 2YFZA 3O0XA 1W8UA 4QXKA 4CCEA 1F35A 4IGQA 2WSUA 3K77A 1NLRA 4QQPA 1LHUA 2XL7A 2DVDA 3M3IA 3D82A 5FZBA 4Q5OA 5C3QA 1OUXA 1FPN3 1N1VA 1V6MA 1XE8A 1OOPA 4QPGA 4QDRA 2CTVA 1W6PA 3AM2A 2GP5A 2WZ8A 2QKDA 4HKLA 1HQLA 5EP9A 2DTYA 1PO22 2GC1A 4NAOA 5F6KA 3BKZA 3ORJA 5FJHA 4BQXA 5FDBA 3KVAA 4TWTA 1GKBA 4Y5SA 2VC9A 1F15A 1XNTA 3AVRA 3CKHA 1R1ZA 4BMEA 2IUWA 3WG4A 4IEXA 4HVQA 3HQRA 1EV11 1AYM1 5FY1A 5CU1A 4AHXA 1W6OA 3I54A 3N9LA 3AMPA 2YYOA 1RUG2 4R4ZA 4PCRA 4QKNA 1QEXA 3FLTA 4O7XA 4Y33A 2XWJB 4MH0E 4LNVA 1PVC2 3WV6A 2CU5A 1QOSA 5B4XA 2MEV3 2V5YA 2WIIB 1VMJA 3RRDA 2HWC2 1ND2A 4HZFA 2JX9A 4CDXB 3H0OA 3POEA 2KM2A 2D97A 1R092 1VLNA 3OD4A 4IDZA 4DXTA 3C2UA 3V0BB 1D4M2 2PTMA 2VUDA 2X29A 1MZ6A 3MO4A 5FZEA 5A3MA 1RGSA 1U5XA 1HJGA 2HWD2 1S2BA 1DYOA 3HN3A 3RG0A 4GWIA 5ABJC 1RUH3 1UU4A 2DBIA 2PHFA 3I2GA 3ILFA 2BU9A 2B39A 3AKQA 1BVVA 3J7NA 4CUBA 4HVOA 1YQ8A 2CNAA 3G6JB 4FPKA 2WYFA 3S0MA 2JG9B 1X50A 3FFQA 4BJ0A 3V0BA 4YM0A 4QHBA 2JDAA 4I01A 2WAOA 1G6NA 2OZ6A 3AYDA 2WT0A 5FYUA 3ZYJB 1XB9A 2A75A 4AVBA 1UMZA 4QX5A 1ASJ2 1RC6A 5JVVA 4KG8A 4LKSA 5A32B 1UPIA 1GP5A 3PIJA 2Y6LA 1Q8SA 5GZDA 3UETA 4CDWC 2XKPA 3M1HA 5E88A 1ZNPA 2JENA 3WW1A 5L36A 4XABA 2XJUA 1LGCA 5LY1A 1GR3A 1L7QA 1SCSA 2RDQA 3THPA 3I3EA 2FZ1A 5T5OA 4K7JA 2OX0A 3FMGA 4LO6B 5CB7A 1RUH2 3ZMOA 1IOAA 2ARAA 1OFNA 5LK7B 1WCDJ 1RMU3 2VUCA 3VDDC 4MGZE 1RITA 1WW5A 2HWD3 2F17A 5CADA 1TME1 3M70A 4BDVB 2Y0IA 1YO8A 4LKDA 1UX6A 3ETPA 4GJZA 5F8PA 5E6HA 4AOCA 4AI1A 1YFWA 4CUGA 2ZAAA 3I8TA 4AHYA 3I49A 2W0XA 2VMEA 5FXVA 4GB32 5BNPB 4NHYA 2W08A 2WJSA 5IFTA 3KD4A 3MFCA 3I2DA 2WFF1 2VAUA 3FLPA 3PUHA 1MVEA 3LSEA 3QH6A 3VUOA 4WVVA 2ZABA 2RE9A 2JG8A 4MZUA 5C8CA 4CEYA 1HB4A 3VHOA 5JPNB 2IWGB 2BP6A 1MACA 2YU1A 4A3ZA 2RHPA 4YG0A 1JTZX 4BH9A 5LEKA 5C6CA 1G8WA 4Q1RA 2CGNA 2WC2A 1OOPB 4QPGB 2WNUC 4MYEA 3NMBA 1G7YA 1W9TA 1HQWA 2DCYA 4N9IA 1PGL1 4ZS3A 3N9NA 3I3DA 3POJA 2QUOA 4XBQA 4YVSA 4HN1A 4MV2A 3HNYM 4UFKA 4BMBA 5DZEA 3VL8A 3PMSA 1NA1A 1R082 4IETA 1BBT3 5EJ1B 3BTZA 1POV1 3CBNA 3WF4A 4IERA 2ZEXA 5LEJA 2JDMA 1ULCA 1A8DA 5FK8A 2FDJA 1GICA 1W6OB 1NY71 2ET7A 4Y22A 5B2GB 2HYKA 3IDAA 2YGMA 4AVAA 4AGVA 5L19A 1JZ4A 1RUC3 2VQUA 5DPNA 5G04L 2P4EA 4ARYA 5A3OA 1UN1A 4CUCA 1R1A3 1M06G 1RUD3 4CDQA 4NHMA 4UFLA 2DVBA 4YPJA 3SKVA 1OC1A 2RJLA 4Q0UA 4XFBA 1DU3D 1J84A 3W5NA 3D3AA 4FFGA 1Z0HA 2DUPA 2CSGA 5K9YA 3WDWA 5FO8B 2YBKA 2P3JA 4RGKA 4XW3A 1RUC1 5A3LA 4CCOA 2A71A 5IVJA 5AVPA 4E2SA 4UAPA 1QF3A 1RVF3 2VZPA 3SCGA 2D6PA 3POWA 2ZGMA 3USUA 2VY0A 4DUVA 2QDRA 3VZOA 3NW4A 4O9EA 3R0RA 2P3KA 3LDBA 4F8AA 1XNKA 2FBEA 3D6EA 1QXRA 5FWEA 3TEXA 1LHVA 2C24A 3ZSLA 4CE8A 4ISRA 2QDNA 1I9RA 4ZPIA 4HANA 2YUEA 2HEVF 4LOTA 4OUSA 5EWSA 1ZRDA 1EUUA 3KB5A 3S7IA 2FDKA 2QFEA 2OPKA 5FPLA 4CCJA 1T6BX 1LOGA 2QNKA 3WT3A 1V6LA 1LEMA 1POV0 1PIV2 3AB0A 2WFF2 2CWMA 1SBDA 1YJLA 3J8F1 3BIWE 3PURA 3MFAA 3TB0A 2HWB2 1AR61 1AF9A 1J3QA 4IV1B 5FQ0A 1L7RA 4IEPA 1LCLA 3I7DA 4LHNA 4KWLA 4S2FA 1RXGA 3VZKA 2ZGTA 4HBNA 4ATEA 5ABJB 3HWJA 2IZWA 1KJLA 4Q1PA 4CA9A 4EQVA 3RYRA 3ZXFA 3K2OA 2QVSB 1UD1A 4Q29A 1YQ6A 4DXZA 3OBAA 1OF4A 1WLWA 1TG7A 2ZAHA 3JBG3 4B8EA 3WEZA 3PVOA 2YC0A 2VCBA 2XJTA 1OT5A 1AL0G 1H1MA 2JD4A 3LPFA 4BQYA 4DQAA 4L9BA 1BBT1 2I2SA 3H1WA 3TEWA 1LGBA 4XVHA 5FYBA 2HWE1 5JI9A 1I5PA 1GNHA 2YGLA 3NAPB 2R32A 1OF3A 5FO9B 1VMFA 3MV01 3GZTB 3SH5A 1QQP3 4YGCA 1AJKA 5A7PA 4JDOA 1W03A 3LOIA 1AJOA 1NOVA 1R083 1U12A 3DUIA 3W9AA 2PHLA 4IE0A 3O12A 2UWCA 3S30A 4PQQA 2D6OX 4BQWA 5JMCA 1SFNA 4XJUA 5HCBA 2RDRA 5A32A 4Q27A 1GLHA 4TSVA 4DFSA 1NE4A 1RUE3 1WKYA 2LALA 2F4PA 3K3OA 2CHHA 3TN93 2HWB1 4QX0A 2FMDA 4PI0A 2O1QA 5T5PA 1HB3A 2K2SA 1SACA 3PJQA 1W9WA 4IL7A 1WLDA 1W2UA 2W46A 2RS51 3AZYA 2W52A 3AYCA 2VMCA 1GSLA 2JIGA 3JQWA 4WVMA 3DV8A 2CYFA 4XUNA 3KQ4B 5I8SA 4XJ8A 1D4M1 4AFAA 5C9AB 2QQJA 3V56A 1RL3A 3JQXA 3ZYPA 2TNFA 3QBQA 1YI7A 2FDIA 4UFMA 1OLQA 2X10A 4NAMA 1HX6A 4CCMA 2GNDA 1HIXA 2Y34A 2KA3A 3MICA 5I8YA 4RGAA 2R1BA 4AFBA 4AYUA 3J26N 1W39A 4JX0A 4FAHA 3U0ZA 5C9AC 3ZN4A 5F37A 1UYXA 5J48A 4YG6A 1CPNA 1O91A 1PZ9A 3CIHA 1W04A 5A3PA 2PLV1 1UXXX 2Y60A 1VAVA 3AMQA 1LENA 1UKRA 2A3XA 2LRPA 1WLTA 4IEUA 5FZMA 1XRUA 4LQRA 5IUQA 4E2QA 4K20A 2I07B 1ULPA 5FLIA 3ZFGB 2R1DA 5DUWA 4QB6A 5FBJA 4FFHA 3FHQA 3WSOA 5FYHA 4UW5A 3WQ7A 4Y26A 3VBUC 2E9QA 2HWF1 3AYAA 3OEAA 4ZXKA 1JZ8A 2VO5A 1DQ6A 4P00B 4R9CA 3UL2A 3I2HA 3O0WA 1VBC2 4DOUA 4XTPA 3HEIA 2VCAA 2NZ9A 3MW3A 4GQ7A 3VBSB 1DBNA 1SZBA 3B9IA 1DLLA 3U10A 4ZZ8A 1XXNA 2QQNA 2MPFA 3WY6A 1SBFA 3MF9A 2AZ5A 5FZOA 2HWC1 2HWE3 4FOYA 3KWVA 3IKWA 4COUA 2ZX3A 3TBDA 4DNYA 5KHJA 1UKGA 3JB4C 3ZXGA 1SFPA 3FE5A 1Q43A 4KH9A 3WP4A 4Q0SA 2RR13 5E1RA 1FI2A 1A34A 1U5YA 1VAKA 4Y1VA 1R093 4LO8A 3UGGA 2XH6A 4K1ZA 1EP0A 1ODMA 1JUHA 1RVF1 1LOBA 1JYWA 4PQ9A 1SLBA 5I0TA 3KQRA 4RHV3 3SEEA 4QGNA 2JEMA 4H55A 3DPRB 3WP5A 1C57A 2P34A 2W1QA 3USUB 3D0SA 4AQSA 5JOYA 5KXEA 2YC2A 4RS5A 1WA6X 4XDPA 2WNVB 2F4LA 2E63A 3AZWA 4N53A 5LA9A 1YNAA 4GKXA 2R7EB 2CDOA 4XIKA 3WNLA 3WNKA 1S2KA 3KF3A 4AQ6A 4ISQA 4CP9A 2WLQA 4HONA 1ZZ7A 5FZKA 2HEWF 3HQUA 3ZN5A 5BYNA 1OPOA 3FC0A 4XCAA 2ZGQA 3RYKA 3ST7A 3T0DA 1FX5A 2YBSA 1LULA 3CMGA 1FPN2 2UURA 2VZSA 4IEWA 1RJ7A 3VKLA 3VGIA 3DXUA 4YM1A 5FYYA 2VULA 4PDWB 2IXCA 5EHDA 1LOCA 3FWEA 1PM7A 1FMD2 1FNYA 1W8OA 3Q8BA 2H0VA 1TE1B 1Q8QA 2DURA 1BLZA 3HT2A 4JZRA 3ZN6A 1DZTA 1WBLA 2DUQA 2VBPA 3POGA 4GJYA 3WVJA 3N7JA 1WW7A 5A6QA 1UU5A 5JPMB 5LW9A 4IE6A 1KD7A 2OPWA 2IXIA 2VOKA 4RYDA 2XJSA 4MGTA 1W3XA 2BFUL 1AXZA 2GH8A 2XJRA 1N1TA 5FZ1A 5FZ3A 3LE0A 4NVPA 2WNUB 2VG9A 2WQ8A 3OGJA 4FPYA 4I09A 1DQ1A 1REEA 5EIYB 1AR73 1EYBA 3NV4A 3ZM8A 4B1LA 3ILRA 2GC3A 3POBA 1JI6A 4LLFA 3J4UH 4FOVA 1TQ5A 4R9DA 4YM2A 1CGPA 4D7SA 5FYSA 2Q1MA 3Q9OA 3T2PA 3DECA 3WP3A 4AEDA 1CZSA 5LRSA 1R091 2NM1A 1V9U3 3J9SA 1SLAA 5FZ9A 1ENSA 1V00A 1QDOA 1RMU1 3GGLA 3K48A 4HKOA 1W06A 3VKNA 3KS7A 3OJBA 1FV2A 3MUZ1 4CCNA 2YDEA 2PLV3 3T4VA 4TYSA 1MS9A 4QGLA 3TEZA 2R6QA 2Y6KA 1FMD1 3NJZA 4C8DA 3PUQA 2OQ6A 2Q8EA 1J58A 3T3YA 5GZCA 2GU9A 1AL21 3WCRA 5C8CC 1HB1A 3AKSA 3BI3A 4XF9A 3GCXA 2Q8OA 3TWIA 3BTXA 1O5UA 5BNNA 5ISLA 5T5LA 4QX2A 4D7YA 2HEYF 2D6NA 1E5RA 4Q4Y2 2GALA 3VKMA 1GWKA 4RSUA 4I2OA 2J1AA 4XHXA 5B4NA 1YQ5A 1UY3A 3AJYA 5DUVA 2H0BA 1ND3B 3VBOA 4DUXA 2BBVA 1QJX2 3VD4A 2WKKA 1O3QA 2R16A 4C91A 2LROA 4YVSB 5IVVA 3BOPA 4LK6A 4HOOA 3M3OA 1WMXA 2YHJA 3WDYA 4GD4A 2VM9A 3ACLA 2D44A 2D6KA 1ENQA 1XOYA 2QQLA 2BVVA 4RA0A 3B01A 2A73B 3LFIA 5D2AA 2ADDA 5F32A 5FZOB 3RQ0A 1CAVA 4S2GA 2FZ2A 2YROA 2E7TA 1CZVA 4JVAA 1CD3G 2XBO1 5FZHA 2VZVA 4QHOA 3T4HB 2EXHA 5FLHA 4FPFA 1W28A 2ARBA 3CZUA 2WA3A 4HMZA 3VD7A 5JMOA 4LA3A 1JZ7A 1CAUA 1AYM2 2D5HA 2NN8A 5F3GA 5HV4A 2IFRA 1UMHA 3DKQA 3LA3A 4XJ9A 5LATA 3LDKA 4JDNA 4HLTA 1MEC1 2XUMA 3HNMA 1R64A 4NROA 4CZSA 2P6CA 2V09A 5IK7A 3W21A 3DYOA 1W9FA 5I93A 5JIUA 2VW0A 5D8AA 3H7JA 1DG6A 4UYBA 1WWYA 4M4RA 3ZSKA 3BUCA 2A1XA 1BKZA 1CQ9A 5A33B 3FHAA 2J7MA 2VMFA 3CJIB 4XETA 2HWF2 1QH6A 1AYM3 2WRAA 1C8NA 2WT2A 4XUPA 5JAXA 4OLLA 1FT9A 5F2SA 5GZEA 4CP2A 1MR5A 4LBMA 4X8NA 2ZHKA 1VBA2 2X5IA 1FMD3 2R043 4KG0A 3M7AA 5I0UA 1VMHA 1V6OA 2CGPA 1NZCA 4ZXEA 2WO3A 3LQCA 5L73A 3N3HA 4E8DA 3UGHA 2RS32 4E27A 3WF2A 4YW5A 3E1F1 3ZMNA 4L11A 2JKXA 4PDWA 4Q4V3 5JDBA 1YUDA 5A7OA 2UYBA 3RWNA 3MIBA 1PNFA 2AGSA 4CP1A 2X53S 2XHNA 4AEDB 3ALQA 5ERLA 4A3XA 4CXYA 2K46A 1DGRA 1VBD2 3NNLA 1LEDA 1ACCA 3GXUA 1Q3EA 4MXWB 5FYCA 4QKDA 2WO1A 2A6XA 4Q4Y3 3MUY1 3O5SA 2E31A 2BBAA 2EVXA 3MF6A 4NWWA 4AG4A 3SCFA 5BNQA 1GP4A 2O0OA 3KGLA 4Y5TA 5KHHA 4EV0A 2W5FA 4IE7A 1IQDC 2GSYA 3JD73 4GH4B 1CN1A 4QPIA 1IKPA 3LB9A 4HSJA 3WHUA 1P8JA 4CPBA 4FPHA 5CIRA 2GH2A 4MXWA 3D8CA 4N90A 2VE1A 1SMVA 2I45A 4LK7A 4PIYA 4TLGA 3SH4A 2VZ1A 4YWAA 2NMNA 1S0JA 2DU1A 2P3YA 3ASIA 5JWPA 1E5HA 1HLCA 3W5MA 4AW7A 1ZZ9A 4P9JA 4YGDA 5IVBA 2JE7A 1WLCA 3HIFA 2HKXA 1JOBA 4LBNA 3L2HA 5TSWA 3KV9A 4FPLA 5IATA 2VNRA 1CONA 3WUDA 1PK6A 3LDRA 1X9PA 3MIDA 3N4MA 4XDQA 2IVJA 3UESA 1DZRA 1CIYA 3MDPA 1AR72 4BIOA 2N7GA 1OVPA 2WS91 1QJZA 5FPAA 4PLMA 1QOOA 4AXOA 4WM8B 4D7TA 1JYNA 4OQ8A 3B93A 4QPWA 1VRH3 5C71A 4Y3OA 2B46X 3GYDA 4D6SA 2VNOA 1PZ7A 2ES3A 2WA4A 5T52A 4RR3B 3TAYA 4Z8BA 1Y7BA 5FZGA 5J37A 3M3QA 3THTA 3RGBA 3S6PA 4L92A 1K3IA 1OUSA 3JXSA 1AX0A 4QM9A 1KQRA 2DCTA 2GMMA 2ZX2A 1N3OA 2DCKA 3LIHA 4LUMA 1HW5A 1X8EA 4BU2A 1RUF1 3MBWA 3R05A 3OB8A 2D5FA 2XBO3 1F2NA 1VBA3 4Q2FA 4AWDA 5BNNB 2DVGA 3ME2A 1RB8G 2AUYA 1GP6A 1GQGA 2AC1A 5EV7A 5CEHA 1GU3A 1SLTA 4FT8A 2VZOA 4OFGA 5FKCA 3RJRA 5C3RA 1LAJA 1REFA 3MIHA 5DAWA 3H42B 4OQ9A 5C4WB 5KXCA 1WUVA 4LMFA 4F83A 5JOZA 2VQAA 1PMIA 5C8WA 1W8ZA 2UYAA 3RZLA 1DIWA 3VBRB 3HJRA 4IEQA 1DGWX 1FOD3 1OA4A 5LBFA 3ZYIB 3H8RA 2P37A 1JMUB 1MZEA 2G9ZA 1SHWB 3HNBM 2VBBA 4IV3C 2QQOA 1RUE2 4RHV2 4EWDA 3ENRA 3U4SA 1W6QB 1VPHA 3EBRA 4TZDA 1MVQA 3TNQA 2IXKA 2CV6A 5FMOL 2ZGRA 3M3CA 2RS52 2R072 4LKFA 3BOWA 5FMDA 5H9RA 2L9LA 5J7MA 3ZYFA 5DDJ1 2BWCA 2ZGKA 4RQPC 3RZGA 3IPVB 1ULOA 4Q4X2 5JXJA 2F6BA 1SBEA 5K0UC 3PTRB 2FHRA 5IT6A 2XJQA 5FPZA 1C4RA 2RVAA 3GZAA 1UIJA 3LAGA 4FO9A 3AMNA 4YGBA 2GN3A 1UX7A 5C7GA 4FOQA 4DUWA 1UPSA 4AL9A 3C7HA 3IB3A 4RQPB 1NAEA 1QJX3 1CAXB 5DDJ3 2W94A 5BNOA 2A70A 2G4IA 2ZKLA 1J59A 4DRVA 1VBD1 4WM7B 3GHMA 4AI9A 1MQTA 1W8TA 2AEZA 4QDQA 4OI1A 4COYA 4W6XA 4EYUA 4LBQB 5FOBB 1MZFA 2BJSA 1PNGA 3M8LA 2UY8A 1UYPA 3WQBA 4EZHA 1QJFA 3N36A 4ZKTB 4YG3A 2VTXJ 5A80A 1KGYA 3VKOA 2FD8A 5I0SA 4D0QA 4G9SB 3U37A 2V73A 5FYIA 1DGWA 1Z7S3 1CJDA 1NKGA 1W8WA 3AP5A 3FZ3A 4BLIA 2R49A 2VVDA 1JXNA 4QQ2A 5H9QA 3U1XA 4RS5B 4S2HA 4P9GA 2MNGA 1PX3A 3P3PA 5FY0A 4EN8B 4WZCA 5FWJA 2P3IA 3W58A 3WDUA 3VZMA 1GOFA 2Z42A 5I0RA 3ZFGC 1V9U2 3VD9A 1Y9GA 1YHFA 3ZDSA 4FTBA 2J1UA 5EFUA 3WG2A 1NCQC 4SBVA 1AYN1 4AI8A 3VDBA 2VECA 2UY9A 3WDVA 3N7KA 1LHWA 2XG3A 5FBZA 4HG6B 5C70A 2GNTA 3CL1A 4Y1YA 1QJU3 4ITCA 2CL2A 5IVEA 2WWUA 3VBFB 4URTA 4BZ4A 2HYXA 2TUNA 1UOFA 1MEC2 3PJYA 4PI2A 4FPCA 1D2QA 4ZU4A 4OMDA 4PLNA 4Y1ZA 2QZ2A 3KCCA 2JE9A 4B1MA 4EWEA 4RL7A 3NV2A 3AK0A 5ANQA 1R1A2 3DCQA 3PMEA 1XSQA 2BWAA 4U36A 1UZVA 3N9PA 2Y6GA 2VOVA 3C8XA 2EXIA 5FUPA 4AVTA 2VCMA 2W3JA 5FZ0A 4O65A 5K4LA 1QQP2 2W87A 2RMU3 2VOXA 2XQXA 3UNPA 1BQPA 4DXRA 1AR93 1OA3A 4OI4A 1RUI1 4JRLA 5FYTA 1JOJA 1PIV1 4KWUA 1WD4A 3NSTA 3UGFA 1IS5A 4EN7B 5C3SA 4I3GA 1WCUA 1LKNA 2WBKA 5FZDA 3ZO0B 1NQJA 4ARXA 4INDA 1RYYA 4AVSA 2AREA 4PIXA 2XMLA 2VZRA 1NCQB 2BGPA 3KV6A 5FY8A 5C4WA 4WM8A 1GYKA 4N43A 3BN6A 4TXWA 1JZ5A 4MG2A 4KQ7A 3B5LB 1UW8A 4N53B 3DGTA 1GFF2 2GNBA 4UFJA 4XBNA 3OSDA 5FOJB 4JAAA 2VMHA 4R9BA 5HXMA 1J83A 4OULA 5A6ZA 1W6NA 5HV0A 1W2NA 3O1OA 1X82A 2QZ3A 2WFF3 3OUJA 5FZ6A 2V4AA 3PNAA 3WX5A 3GHNA 3ZXAC 2X8KA 1BVP1 1OD5A 4JCKA 1COV2 1MQTB 4XUTA 4CVUA 1RUF2 5A3NA 1SDWA 1T2XA 3JU9A 3WUCA 1LU1A 2O14A 3E5UA 2GNMA 5J1XA 4EN0A 3HAGA 1D4VB 1EPWA 2A6YA 4MSVA 1CAUB 5JUVA 4XTMA 4B7EA 2Q8CA 5F5AA 1JW6A 2DFBA 4LORA 4RS5C 2JDNA 2JB8A 5CG9A 1E5SA 5A33A 1Z7S1 4KGGA 2G9FA 3KSCA 5DZGA 2JDPA 1S0IA 4FSJA 4Q4Y1 2RS11 4WVZA 1ASJ3 4JRAA 4RQPA 2GZWA 1Y43B 4R9AA 2ZKNA 2BVBA 1JOPA 3E5QA 1ND2C 1SQ4A 1PVXA 1ZYBA 3UK9A 5F7UA 4QGMA 1UQXA 3E97A 2BNNA 1W6QA 2UU8A 4WM7C 2VVEA 5CKNA 2VMIA 1MZ5A 4Y4RA 3IAQA 4Q4V1 5IK8A 2PHTA 3IDBB 4NRMA 3ZKUA 2E7AA 2QJVA 4XE9A 2R30A 4O9GA 4C90A 5AC93 4NIGA 3GZUC 4XACA 2ZACA 5GLTA 1GQPA 1V6JA 1JU4A 1W3VA 1JZ6A 5JSPA 1XJAA 2C0ZA 3I3QA 4OHXA 3WG1A 5GZGA 2IXHA 1IG3A 3ROUA 2PAEA 5A6XA 3SNMA 4AGRA 2ZS6B 1FXZA 2ADEA 1J3RA 2HWC3 4E4HA 2EF6A 4HKWA 2WQZC 4PBPA 4FCAA 3INAA 1CX4A 3RFRA 1EPZA 2EIGA 4R4XA 1H2LA 3LIGA 1IS6A 3EHKA 1BYHA 3VBOC 1S1AA 2V5DA 5FMOS 1VAMA 2WUHA 2KD7A 4B29A 5C9AA 3BB6A 3I3BA 1US3A 5M0TA 2FDHA 2GC0A 3TN92 5KHIA 2W1UA 4Z82A 5ANNA 3ZIXA 1YXWA 1N1SA 3USSA 5FPXA 4JTOA 4UOJA 1RUJ3 1J3PA 1YCIA 2HBTA 2RS53 2VCCA 3WOGA 4YRDA 4DO0A 4NIHA 3MIEA 2VMGA 3WR0A 4GB33 4XILA 5F5QA 1ZRIA 4AK3A 3LKJA 1LOEA 3LCPA 1KS4A 3CU7A 4GWJA 3D5OA 3UKNA 1QNYA 3HBZA 3OGSA 3B00A 2YMZA 4RR3C 5T3NA 1OQ1A 4AFCA 5E8AA 2WZR2 4BLJA 1Q56A 3BPSA 4BK5A 1WMFA 3B02A 2WZPP 5AC92 1VB4A 5BNNC 1VBA1 1N3PA 3A0KA 1KXGA 1D0HA 2ZBJA 4YVWA 4H2AA 3RS6A 2IXJA 2KXLA 2PHXA 3QOPA 1JHNA 1MS5A 2LM3A 1VBC1 2I74A 2OVUA 4OUEA 3LOBA 1W0NA 4BM8A 1AR82 1GZTA 5FKBA 1PO13 4H7MA 3J7MA 1IPJA 1QY4A 1D7PM 2VGDA 4IEZA 3VBOB 2BDRA 3ZFGA 2J1VA 3JB8A 2CAVA 4ES8A 3EMRA 5JR2A 1A78A 1K5MB 1Q8OA 2Y6FA 2HWB3 3OPZA 3T2QA 4AEJA 2EAAA 4BE3A 2YB7A 4COWA 1W6MB 3T2TA 1IHMA 3J8F3 3HN1A 1LU2A 5CFDB 1SG3A 1VBB2 5H9SA 4M3CB 1PMHX 4NWVA 1C5HA 4Y1XA 1AR63 2B7YA 5FP7A 1AHSA 1RUD1 2AR6A 3OG2A 3AC0A 1RHI3 3KLSA 1ZM1A 1SPPA 1RUF3 3AJZA 2C4XA 4D6QA 5KC5A 2Z69A 3P1IA 4ONUA 2WSVA 3H3UA 4EE2A 5EZWA 2Y8KA 4KI5M 3FLRA 2GMEA 2V72A 4FI9A 3I4IA 2QQMA 1OH3A 2DUOA 1STMA 5EJZB 1C28A 1POV3 2QTWB 1YRZA 2R0FA 2MEV2 2VXJA 4N7IA 2RM21 2FCVA 4XQDA 4PIZA 2OA2A 1RUI2 1W05A 4ATFA 2JICA 1WCSA 5FQ0B 4CYDA 4YW2A 1VRBA 4PF5A 2WS92 2ZZJA 2OZJA 2EALA 1I3HA 2VNGA 1YFUA 3AP4A 3BTAA 1LODA 2J1SA 4GKYA 4QPYA 4IE4A 1L7LA 2W1WA 5KXBA 1O8SA 3T0BA 2ZX1A 3UT0A 4CXWA 3LEIA 4ZZ5A 3OPWA 1JYCA 1U5IA 1PO23 4FPGA 5FCCA 1OH4A 1R1A1 5EYXA 3H9AA 4XAEA 4UBGA 3ZFFB 1WW4A 3ZLIA 2Z79A 1UL9A 2A5ZA 4OUMA 3WNNA 1IPKA 1KS5A 1HXS1 2DU0A 3MIFA 3ZN6B 5GLWA 2DCZA 2WO7A 4FOWA 3CJIA 1NUKA 2EIDA 3HBKA 2R061 1BBT2 4W8JA 3V0AA 1EAH2 1BMV1 4XUOA 4C1XA 5IAXA 5F3IA 3LEMA 5F39A 4Q4W2 2NMOA 4BYYA 1C5IA 1OLME 2OYZA 1DGLA 1S2EA 3BODA 4FPOB 1HB2A 1LJ7A 1F8VA 1RHI1 4DPNA 1HRV3 1GNZA 3OOXA 4Q8LA 5LA1A 2IVIB 2XLGA 4K40A 4Q4W1 2X09A 4QB1A 2EXJA 2BPA2 3V64A 1UZWA 1H30A 2XVGA 1DQ2A 2X05A 3VBSC 3I2KA 2D6LX 3OYWA 2E33A 3M2MA 1UF2C 2FQPA 3SLIA 1H4GA 4AHZA 2Z2SB 3AFGA 3KT1A 1QJEA 4TLFA 1M4WA 1DGRN 5FY7A 1QGLA 1TZOA 3B7MA 3C7EA 3CJXA 3HOBA 3IMMA 4M3CF 5C33A 5KWRA 1JH5A 3B94A 4HL0A 4SLIA 2XXZA 3AXDA 1CR7A 4LIUA 4W6YA 4Y20A 5CZKA 4IEYA 1AXYA 3U14A 4AE2A 3U75A 3NV3A 1BEV1 5T50A 5BV6A 1IS3A 5LZ6A 2WN2A 2D93A 3ZFEB 4QKBA 1AYN3 2DV9A 4C0BA 3VZNA 4AAXA 3RDIA 1Z7S2 5CFCB 2Q0AA 2EXKA 4NO4A 3LD8A 1JYXA 3WLUA 3GDBA 4Q0QA 3HT1A 4A45A 4JHZA 3THCA 1ZBA1 3KT4A 2ZEZA 4XJWA 2IFWA 2JE8A 2WT1A 4LBOA 3T09A 4MGQA 4E9KA 1GQHA 3PHMA 4QX8A 2CY6A 4HK8A 2V4VA 3BYWA 1OVSA 4YW4A 4D8MA 4IQPA 3KM5A 5IVFA 3M4FA 1CPMA 3IAPA 1Z78A 3SISA 1S0DA 3J7LA 1LGNA 3ETQA 5CFCA 4P9IA 3LEGA 2W2IA 4JC1A 4XXPA 1KEXA 1WMEA 1LR5A 1UXZA 2P1BA 1DCSA 3URFA 3CEWA 1UNBA 4UFHA 4CP0A 5HPOA 2JDKA 3FL7A 1HXS2 5LBCA 1PGW1 4BISA 2YBPA 3GZEA 1CAWB 4CUAA 4WZFA 1UOBA 1NA1C 1RUE1 4XFFA 2KR2A 1AXKA 1W6NB 1HV0A 5IK4A 2HH9A 3DF0A 5FY5A 5L9BA 1XYNA 3WP6A 2W9XA 3OPTA 3U78A 3AXEA 1I5ZA 1YIFA 1HRV1 1JYVA 5DZFA 2R073 5CYYA 4JGYC 3SH3A 1OLRA 5J98B 3AP7A 3DKWA 3NAPC 4CDUA 5D8AB 3NNFA 3ZYHA 1K5JA 2FCUA 2J22A 5LK5A 4D69A 1PVC3 2CDPA 4Z2AA 5K0UB 3WG3A 2MEV1 3MYXA 5J96B 1H9WA 3MPPG 4NHXA 4XPVA 5FZ8A 4DMIA 5BY5A 4OHYA 3ZOIA 4Y4YA 4L99A 3K75B 2QQUA 4RN5A 3FUOA 4KWKA 5FMBA 3A22A 1CX1A 2OQ7A 2XR4A 4P5YA 5JI7A 4ZU7A 3QD6A 4OVEA 4XFGA 3ACFA 5FJKA 2JKBA 2DF7A 2ORZA 4PLOA 2NQYA 4QWNA 3O1RA 5ABJA 3KV4A 3UKVA 3TEYA 5F1RA 4MUVA 1W8HA 1BJQA 1S55A 3E6BA 1YFXA 2QE3A 4CDWB 4B7KA 3K46A 2JWPA 5GLVA 1PM4A 3Q8CA 1CJPA 1UZZA 4NE9A 4NPMA 2D3SA 1Q8PA 3ZSEA 1N3QA 2AENA 1NCQA 3LPGA 2EIEA 3P6BA 2XVKA 3GJBA 4Q26A 3VBRA 1OQEA 2JJ6A 2TBVA 1NLQA 5K7PA 2XLFA 4AVCA 4E8CA 2JG9C 5ACA2 2RG4A 2ZMLA 2QQIA 5KHKA 1TMF3 5FYZA 2C9AA 5LY2A 4PDWC 3ZPYA 3HVDA 4I0BA 4XQ4A 3H8XA 1XYPA 1VBE1 4PJYA 1PGSA 5FZ4A 5IYYA 1AR91 5CFDC 1VRH2 3K3NA 4NPRA 4P9YA 1GOHA 4YNIA 1ZZ6A 2XONA 2XWBB 3S5AA 1CESA 3VZLA 2E32A 4F3JA 1W0OA 4K1YA 1MS8A 2K0GA 3IIIA 4NMIA 1UMIA 2VUJA 5DAQA 4CCDA 4GULA 1D0GA 1HQNA 1UCXA 1X33A 3RWKX 2ATFA 2BGCA 1BK0A 2WNVC 3F95A 4CEWB 5KXDA 5HCFA 3OBTA 4XC9A 3K4ZA 5CVRA 3BALA 1TNRA 3C7OA 3BU7A 3MGUA 5A7SA 3ZXDA 1PX4A 3CZJA 2XKOA 4FTEA 3O1SA 1KDKA 4J25A 1HN1A 1SLLA 2G1MA 2WWJA 5DQ0A 5DUUA 1O8PA 1NLSA 3POIA 1VBE3 2D7FA 4BHPA 1ULFA 4E4SA 3AZZA 4IGOA 3QH7A 4J1WA 1OD3A 1Y4WA 2RM23 5DAVA 3O0VA 2E7QA 1RUI3 2AH2A 2JDHA 3PL0A 4QXBA 3VBUB 1QKQA 2C26A 3B3QE 1UYYA 2E26A 1QJY3 2B5HA 2RMU1 2WNUA 5CNAA 3IDEA 5FUIA 4GXLA 2P6HA 2XJVA 1UYZA 4CU8A 1OFSA 2WNOA 4K8RB 1EV12 4PT6A 1PK6B 3AZXA 4UXAA 2QQKA 1GZ9A 2BOIA 5FZFA 4V1PA 5JZGA 1GZWB 2BZDA 4CCKA 2JXAA 2ZCWA 4Y1UA 4YW7A 3MZHA 1WD3A 1IPSA 1AR62 2O8OA 3GCWA 5FFOC 1K5MA 4QM8A 3LWCA 2VZTA 5LA2A 4Q4V2 1EUTA 5JR7B 1DDLA 1GWLA 2PA7A 5FV3A 3OF1A 4IEVA 4M3CE 4AI2A 2P2KA 4CEYB 5BNPC 2SBAA 5F5IA 5JCTA 3MW4A 4XFCA 1VBC3 3ZX7A 2RS33 2YPJA 2CGOA 3DL3A 3H8UA 1C8M2 3ELNA 3PLQA 4LO7A 1PO11 4R8HA 3UYJA 5DXDA 1TMF1 5FXXA 3RI9A 3ZKYA 1JBCA 1PO12 2RS12 4HSLA 5L7OC 2PXJA 1PVC1 4IGPA 4LXLA 2XQRA 2Y6HA 3MV11 3HMYA 3JUUA 3ZXJA 4W6WA 4CDWA 5JLVA 3ACHA 2DVAA 5C5TA 1RUG1 1JZ2A 1OHFA 5FPUA 3PUIA 1W6MA 4MGYE 2Q5TA 1CAVB 5A1AA 4UW4A 3O1TA 5FPBA 3K4DA 1NCRB 1XE0A 4AFMA 4YZ1A 3EQEA 1H2KA 4LA2A 5FZIA 5GZFA 4MVTA 4AZZA 1CAWA 3PUAA 1MS4A 3LA2A 1NCRA 1YFYA 2B4KA 4NR1A 5D1IA 4E4DX 3AFKA 4P9WA 1G9DA 1I1EA 4Y5Z0 4F7ZA 1XYOA 2ENRA 4X6QB 3VB9A 1ZA4A 5BNOC 4QXCA 1QDCA 2LW8A 4XF3A 4DY5A 1DQ0A 1GUIA 4GZ9A 5GALA 1CWPA 1UOGA 2H6CA 4WVWA 4XAAA 3RSJA 4AEMA 2W92A 3EYPA 3U07A 3LA7A 1JODA 1UO9A 3J7HA 1F9KA 1W2OA 5BNOB 5A70A 1X36A 4L0PA 4ZS2A 3DEMA 1VR3A 1R081 3DYPA 3WF3A 3S57A 3GBWA 3BGAA 1O3SA 5EPAA 2FDGA 1SLCA 2HLEA 3FX3A 2Q8DA 4MO3M 4M3CA 2VW2A 1PGL2 4RD7A 4RFRB 1ZRRA 4IV1C 1DZQA 2ORXA 3HR9A 4PHZA 5A7QA 2XUEA 1DFQA 4KU7A 3EB7A 1OURA 2AYHA 4MHUA 2VD7A 3FBYA 1H0BA 3AKRA 5FZLA 3A4UA 1QH7A 4M01A 4N53C 4BQ4A 2YPDA 4XZPA 1V9U1 1A8MA 3OD0A 4YVSC 4HPKA 1APNA 1W9SA 1O4YA 3CLPA 3T30A 3ES4A 3V0AB 2VNVA 1POQA 3IMNA 2J1RA 2EAKA 3OYWB 1FV3A 3Q8FA 4AQTA 3DXTA 5FY4A 5HXVA 3JBG2 3FHIB 5F6LB 1NCRC 3ILNA 1LRHA 4A42A 4YARA 2Y33A 1LESA 1QHDA 5FP9A 2DDUA 4LHSA 1QMJA 2HBUA 1FOD1 1ENXA 2VTFA 2W91A 2WS93 3RPQA 3WW4A 4YVWC 4AGGA 3A21A 4FPEA 4K8FA 3GBGA 4NPLA 1UY1A 2PELA 3R4DB 5L7OB 4MX3A 1V6IA 2WO2A 4JKKA 1BCXA 1UOJA 4XOGA 1XU1A 4FAGA 5ACA1 1ND3C 2VQ0A 1QJY1 5JXHA 1C1LA 2A6WA 5F5CA 3LGRA 1E57A 1PIV3 4MGSA 5C5UA 2OKXA 1YWKA 5EYYA 1JN2P 5DG2A 5E16A 4Q8KA 3ZDVA 4CEYC 1AYN2 2XHKA 1UY0A 2BYVE 2VU9A 1WMDA 3GALA 1DQ4A 3N9OA 1FATA 3VBUA 4A6OA 5C4WC 3AMHA 4XFHA 1RJ8A 2YZ4A 1O7FA 3ABZA 1ULEA 4ASKA 1T6GC 2BRTA 3J8F2 3TRSB 5C3PA 4RR3A 4FTSA 1SDDB 1OXCA 5D21A 3AL5A 2ARCA 2YG0A 4W50A 2D43A 4COVA 4GALA 1VRH1 5DG1A 2VH9A 4DEVA 1ZBE1 1G9AA 1B09A 3CHXA 3VN4A 3OUIA 1S0BA 5CISA 1EAH1 1VIWB 2HJIA 3N35A 1BMV2 4H14A 3VD5A 3NKGA 1HRV2 3WINE 2D98A 1YJKA 4YYOA 5AFBA 2EICA 3T1LA 1RUD2 4A4AA 1QXPA 4QX3A 1AX2A 1NQDA 1SPPB 5I8TA 3VBHC 2YXSA 4O61A 3W20A 1RUC2 1ULGA 2D6MA 4K21A 1AZDA 2Q1FA 4DB5A 4LEJA 3AP6A 4YGEA 4P9LA 1EAH3 4AI0A 4XHBA 2QQVA 2OUJA 1OMIA 1C3HA 2Q1ZB 3KCXA 1W6PB 4P02B 2E6VA 4L97A 2LS6A 3JD71 3ATGA 4MHRA 3VDDB 3WNPA 2PQSA 1VP6A 4BWOA 1ZBE2 5KR7A 1RTVA 3RVHA 2WL1A 4M0HA 1RUJ2 4QT6A 1HRI1 4XXAA 3SQOA 4CTEA 1QXJA 5IWFA 5C3OA 3B69A 3OY8B 2OS2A 4GMP1 3PTYA 2BNOA 3I2FA 3BTYA 4RHV1 2RR12 3F2ZA 3C3VA 3OEBA 3PVNA 3E5XA 2PMWB 1WBFA 4BOWA 4YW1A 4ET7A 4XUQA 1MEC3 4D94A 2BNMA 1OLMA 1XNBA 3AZVA 2JB4A 2TEPA 1QJU2 3KT7A 4UWDA 3U4XA 3R4UA 3RI8A 2GMPA 4RGGA 4L2NA 3O1MA 1YYNA 1AL22 4WM7A 3MLKA 3ZYRA 1X9TA 2Y6JA 3Q8EA 2PFWA 3ZXLA 4X8PA 3THDA 2NPIA 4IV3A 3T0AA 5CKMA 4QQLA 3MLJA 1IG0A 5LRRA 1PGW2 3X29B 1ZREA 4IV3B 1RMU2 3RYPA 4TTGA 3AVSA 4QHZA 4QX7A 4JGYB 3RZZA 5I0DA 4ORFA 5L7OA 5FP3A 4BB3A 1JUIA 3VBRC 2ZGNA 4A7KA 4OMCA 1MS1A 4GB31 1GWMA 5HI0A 3VZJA 4LO4B 2ARXA 2WLPA 4G3YC 4WV8A 2OUHA 4JTNA 4MOAA 3O1PA 1O6UA 4E4ZA 1W0PA 1NG0A 2OT7A 4LBQA 1KDMA 1WCKA 1NZIA 4R52A 3O1VA 1WA4A 5KBFA 1K45A 3GNEA 3CNAA 1A6CA 2GP3A 3NO8A 2VR4A 1ZBA2 1AX1A 2WNEA 2YFUA 3PVEA 3QACA 4NIIA 3EXUA 3UJOA 4YLZA 5CAZA 3L2YA 1RUH1 5FXZA 5FK7A 1DLCA 2PHWA 4WBBA 2Y26A 5EQUA 3VD3A 5IAVA 2WABA 1DYKA 1AR83 1MQTC 4BIFA 4YZ5A 4B4RA 5IVYA 1AL23 1IKQA 5T55A 1BEV2 1LTEA 3MIGA 4XMIA 5APAA 4IV1A 4DRRA 1U5ZA 4BPZA 4CDXC 5BUVA 3FFZA 3GM8A 3NAPA 4FFIA 4CDUC 2WZR3 3WNXA 2B45X 1UAIA 3LF7A 4B4QA 1JYTA 1HV1A 2VXRA 4Q4X3 3Q8AA 4OHWA 1D4M3 3TN91 2BUKA 1NE6A 2Y38A 3JCIA 3M3EA 4LITA 1KFUL 3TYJA 4CU7A 1ND3A 3N7LA 4LOSA 5FTTC 3MHZA 4Q0VA 3QCWA 4GWMA 4K6BA 5H9PA 2FCTA 3H50A 1S0GA 4YFZA 4EN9B 4QPIB 1YIPA 5FMCA 4LE4A 5GJ6A 5F3CA 1OSGA 3C7GA 3KF5A 5KC6A 4OYUA 2E53A 4YW3A 1W8FA 4QKFA 4XFIA 1RUG3 4DXSA 1UZ0A 2PHDA 2BQPA 3PU8A 2ETEA 4URAA 1ONAA 1YEWA 2ZX0A 1DP0A 1H8VA 5A6YA 5FY9A 2ZHNA 4GIQA 4LUKA 4N43B 4DS0A 3ES1A 4N9HA 3ZPOA 4UW3A 3NV1A 1KFXL 3R4SA 4Z07A 3I97A 5BXXA 5LCWL 5A7WA 3I59B 4A7ZA 1PK6C 1BEV3 2GDFA 2WR9A 5HCHA 4GH4C 2XVLA 3CO2A 1RIRA 4CCLA 4FVVA 5DABA 5IHRA 4CDQB 4FXGB 3OY8A 4M0NA 4IESA 1OBNA 3FBMA 2XBO2 5J09A 4IUGA 1JS9A 5FR3A 1CVNA 4LTAA 5FYMA 4S2DA 4XDOA 5J3UA 2JG8C 5IW0A 3RMXA 2RS31 2SLIA 4BXFA 4GMP3 4BQ5A 3D4KA 5A7WB 3WW3A 4LKEA 3ON7A 1PO21 3VBFC 2K9ZA 1IGOA 3WZ1A 5DN2A 4A7YA 1UY2A 3PDQA 5FO7B 1VE0A 4B3NA 4JV4A 4LE3A 2XB6C 1C1FA 5FLJA 2VZ3A 3ZFFC 4BQ1A 3VDDA 1NYWA 1CZTA 3OBZA 4GAZA 2DBNA 5LB6A 3SXWA 2JD9A 3VBSA 4J6GA 1LOAA 2W39A 1ST8A 4H7LA 3NJYA 3ZVXA 3WNMA 1D2SA 1W2AX 3OGGA 1COV1 3P5BA 5IJRA 1G9BA 3VLBB 4YZ3A 4GA9A 1H8TA 2ZEYA 4B4PA 1S4CA 2UWAA 3OBRA 2VW1A 3CJIC 2YV8A 4JGZB 5FRAA 3I2JA 3RNSA 1DF0A 1PZ8A 2VOTA 2WN3A 1AUYA 2Q30A 3IWZA 4UF0A 2C1FA 3BCWA 5LA0A 2BEOA 1COV3 1B35C 2ZGSA 3HQXA 3CDZB 4NHKA 2DWRA 3C7FA 3KV5A 3DPRA 3RZHA 2XL9A 4CEWA 1JHJA 1XNDA 2Q4SA 2ZGPA 1MS0A 4QQOA 2WZEA 3PVBB 1TNFA 1TVGA 3NQHA 5FUNA 1B35A 2J42A 3W59A 4UI9L 4YW6A 2ZPXA 1YQ2A 2OW4A 4FQ4A 1XSRA 1UWWA 3KCYA 2XOMA 1ZA7A 5CG8A 2PYTA 1H8TC 3HD8B 3T1MA 1ZRCA 5FZ7A 1Y9QA 1XPWA 4KL1A 4NUBA 3MLLA 4YM3A 2DFCA 2WZR1 4HK9A 4GWNA 3IDCB 3KGZA 3NJVA 4COZA 2ZEWA 3WF1A 1Q8VA 4DIQA 3UJQA 4HVRA 3DPRC 4OZXA 3ECQA 2WINB 3ZSJA 1AR92 2BW8A 2XPJA 1TME3 1WCQA 2RMU2 5EXOA 3SITA 1SLIA 1FYUA 2ZOEB 4P14A 2A6ZA 2JIJA 1J1TA 2ZGUA 3APBA 1ENRA 4NRPA 2DCJA 5FPVA 1JYIA 1KITA 5F3EA 5CKQA 5F2WA 2FMYA 4KWJA 3D0JA 2HWF3 3VV1A 4ZHNA 4NJ4A 1CIWA 5C8CB 3AYEA 1H4HA 1NA1B 2PHUA 2ZGLA 4LLOA 1OI6A 4QB2A 4ZONA 1FOD2 5FREA 3TNPB 4LPLA 2A7AA 3MPBA 4LIVA 3ZR5A 4ASMB 5JOXA 1OPMA 1VJ2A 2PQQA 2W95A 5J36A 2D3PA 4I02A
chains in the Genus database with same CATH topology
1KRIA 1G9CA 4Q4X1 1OKQA 4EWAA 4AQ2A 4XEZA 1ZZ8A 4LBJA 1HDKA 3CF6E 3POSA 3WW2A 2ZHLA 1ULDA 1PHMA 1UIKA 1X7NA 5T5JA 5JZGC 5JZGB 1QU0A 2NYYA 1TEIA 1ZBA3 4RFT0 1H2NA 2DYCA 4UBHA 1ALYA 2A3YA 1S0FA 2O8QA 3ZFEC 1GANA 5HBAA 4XIOA 4G4FA 5JIAA 4C1WA 5JSOA 1O4ZA 2OIIA 4Y20B 4BCUA 1MS3A 3WD5A 1RINA 4YVWB 1FAYA 2B8MA 1LHNA 1DYPA 2D3RA 4OI0A 3VKFC 2VOWA 5CFCC 3NL1A 4FPJA 2WNVA 4HT1T 3H7YA 4XJZA 1IZ3A 1WW6A 1AVBA 4LBQD 2ZX4A 4KGQA 5DDJ2 2B42B 2CWSA 1QQP1 2W68A 4YSFA 4XMAA 4LR4A 3UV9A 1G86A 5IK5A 1LOFC 4AFDA 2XGXA 2UWBA 4EROA 5F9TA 1LECA 2ZMNA 4GMP0 4LBLA 2LTNA 5GKAC 4FAHA 2PLV2 4I0AA 4BA6A 4FXKB 3EJKA 4J1XA 2BFUS 1FNZA 3NVCA 1ND2B 1DHKB 1XE7A 1AR71 5GLZA 1ZBE3 3TOJA 3VHPA 1O4TA 4JGYA 3W59A 1XU2A 4AEDC 3N7MA 1GV9A 4JGZC 4HN0A 4A2UA 3LZZA 3DN7A 4XFAA 2ZGOA 3KMHA 1OQDA 4M00A 1ZVFA 4H3WA 1B35B 1LOFA 3ZXEA 4JDMA 3R6SA 2ZMKA 1BXHA 2H6BA 3KZ4C 3S7EA 4YZ2A 1IQAA 1EY2A 5BNPA 2BTVC 4KBBA 4LHKA 1NXD1 3AP9A 1C8M3 4PBOA 3ZFFA 1GBGA 3SCHA 2DTWA 2WFPA 4LBKA 2Z5WA 2A6VA 4NHLA 4QU2A 2P17A 4AEKA 4XF1A 4FBFA 4D3WA 1GZCA 2CAUA 3WQ1A 4XJAA 4E2GA 3WDTA 5SV5A 3FUQA 3H1MA 4HETA 1YI9A 3VBHA 4N43C 2ZA9A 4MLOA 2EA7A 1K5MC 2JG8B 3RJ2X 5KHGA 4QD2A 3SHRA 4MGIE 3MW2A 3VBFA 2IXLA 4U2AA 4L8QA 3I59A 4K9SA 2RM22 2ZTNA 2RR11 3B9CA 1N1YA 2HWD1 5E89A 4HFSA 4W65A 5T54A 4Y24A 1VBE2 1HRI2 2PAMA 3OCPA 4Z1VA 1RUNA 2QCSB 3POYA 4XF4A 4C0HA 2HWE2 3UKTA 3JD72 1QWRA 3L9JT 4CDUB 5HCAA 2R062 1LB2A 3GBFA 1ZZCA 1XQNA 4QQHA 4AVVA 1WGPA 1H1IA 2LUWA 3P3NA 5DUXA 5CFDA 3IT8A 5JOWA 1VBD3 3VL9A 4XYXA 3IBMA 1V6NA 1VALA 3NKTA 4CRQA 2XLAA 3ZXKA 2A3WA 1H9PA 3E6DA 4OHZA 1XNCA 3IN9A 4CEWC 2C5DA 2ILMA 1DQ5A 2PN5A 1S0EA 1HKDA 4NOTA 5K0UA 4IXLA 1V70A 3O7OA 2R041 2R071 2X5IB 1QJX1 2XJPA 1A3KA 4UW6A 3OTFA 4I0WB 4IEOA 5EJ3A 1RUJ1 5BPXA 4CDXA 3G7DA 2R042 2GC2A 2PAKA 1IS4A 4JQRA 2IC1A 3IPVA 4MXVA 4NN0A 2JG9A 1LHOA 1SCRA 1S0CA 2GN7A 1SEFA 3SMHA 4DINB 3AX4A 1QNWA 4AF9A 1V6KA 3AMMA 1I6XA 3EO6A 4X6RB 4EJRA 5AFEA 1H2MA 2G9GA 4KU8A 2WWSA 1U0AA 4FQZA 1SFYA 3H1YA 2MHFA 1L3JA 1UZYA 4MGKE 5AVAA 2RS13 4EN6B 4Q4W3 3MI8A 3WHTA 4Q0PA 1OA2A 2X5IC 3WQ0A 3AKTA 1AR81 3K51A 1ZRFA 4FP2A 5CA6A 3U11A 1REDA 2YY1A 1NY72 1TME2 5CBLA 1H8TB 5D8AC 1ZZBA 2R0HA 5AC91 3RMYA 4YFWA 3H3ZA 4QMAA 2R063 4HPKB 2QQPA 1CAXA 5SV8A 4LULA 4JGZA 2B9UA 1HXS3 2VVFA 2NLRA 4P5HA 1O5LA 3V65A 3VBHB 3WXPA 1RUOA 1URXA 1HRI3 1VB2A 1F5FA 3O14A 3AKPA 4I3PA 3VHRA 4KNCA 3ZYGA 5I91A 1O3RA 2GAUA 4ZU5A 1EV13 1F31A 4DY3A 1ASJ1 1GZWA 4I30A 3VHNA 2DVFA 5JSRA 1Y3TA 4GH4A 1QJY2 4WM8C 4OHVA 3ZFEA 3WCSA 2D40A 2VUAA 1FPN1 3FJSA 5K8SA 2RJKA 2Y0OA 1BK1A 5GLUA 3ZSMA 2ET1A 1OOPC 4QPGC 4FP3A 2VPVA 4LHLA 4WVMB 1BZWA 2PHRA 4OI2A 2WQ4A 1X8MA 1NXMA 1RHI2 3BPZA 4META 4XF0A 3E6CC 4K3UA 3JBG1 1N47A 2ZJCA 4DZGA 3IIAA 2ZHMA 4ASLA 1VBB3 3LSDA 4Z2WA 2E51A 1F5JA 3ZIWA 1YLLA 4LO5B 1RVF2 3QLQA 3GF6A 4P9XA 3MEPA 1UU6A 4XQWA 3IM0A 3WDXA 2JECA 4N7UA 4LT5A 1VBB1 1G9FA 5GM0A 3A0NA 1J1LA 4YZ4A 2JDZA 1Q5OA 2ERFA 4AHWA 2ZZQA 1ZX5A 1TMF2 4XBLA 4CDQC 1KJRA 3JZVA 3NWKA 4AI3A 4ES9A 5FAXA 1C8M1 1QJU1 4Y22B 5ACA3 2NP0A 4Z92B 4QPIC 1QOTA 1O3TA 1H1AA 3O0XA 4QXKA 2WSUA 1NLRA 4QQPA 1LHUA 2XL7A 2DVDA 3M3IA 3D82A 1FPN3 1N1VA 1V6MA 1XE8A 1OOPA 4QPGA 5KHJA 2CTVA 3AM2A 1W6PA 4HKLA 2QKDA 1HQLA 5F6KA 2DTYA 1PO22 2GC1A 5FDBA 4TWTA 1GKBA 5KC6A 1R1ZA 4BMEA 3WG4A 4IEXA 4HVQA 1EV11 1AYM1 5CU1A 4AHXA 1W6OA 3I54A 3AMPA 2YYOA 1RUG2 4R4ZA 4PCRA 3FLTA 2XWJB 4MH0E 4LNVA 1PVC2 3WV6A 1QOSA 2MEV3 2V5YA 2WIIB 3RRDA 2HWC2 1ND2A 4HZFA 2JX9A 4CDXB 3H0OA 2KM2A 2D97A 1R092 1VLNA 3OD4A 3C2UA 3V0BB 1D4M2 2PTMA 2X29A 1MZ6A 5A3MA 1RGSA 1U5XA 2HWD2 1S2BA 3RG0A 5ABJC 1RUH3 1UU4A 2PHFA 3ILFA 2B39A 3AKQA 1BVVA 4HVOA 2CNAA 3G6JB 4FPKA 3S0MA 2JG9B 1X50A 3FFQA 3V0BA 4YM0A 4QHBA 4I01A 1G6NA 2OZ6A 3AYDA 2WT0A 3ZYJB 2A75A 4AVBA 1UMZA 4QX5A 1ASJ2 1RC6A 5JVVA 4KG8A 5A32B 1UPIA 1Q8SA 5GZDA 4CDWC 2XKPA 3M1HA 5E88A 1ZNPA 2JENA 3WW1A 5L36A 2XJUA 1LGCA 1GR3A 1SCSA 3THPA 2FZ1A 5T5OA 4K7JA 3FMGA 4LO6B 5CB7A 1RUH2 3ZMOA 1IOAA 5LK7B 1OFNA 1WCDJ 1RMU3 3VDDC 4MGZE 1RITA 1WW5A 2HWD3 5CADA 1TME1 3M70A 2Y0IA 1YO8A 1UX6A 4AI1A 1YFWA 2ZAAA 3I8TA 4AHYA 2W0XA 4GB32 5BNPB 2W08A 2WJSA 3KD4A 3MFCA 3I2DA 2WFF1 3FLPA 1MVEA 3LSEA 3QH6A 3VUOA 4WVVA 2ZABA 2RE9A 2JG8A 4MZUA 5C8CA 4CEYA 3VHOA 5JPNB 2IWGB 1MACA 2RHPA 4YG0A 1JTZX 4BH9A 5LEKA 5C6CA 1G8WA 4Q1RA 2CGNA 2WC2A 1OOPB 4QPGB 2WNUC 4MYEA 1G7YA 2DCYA 1HQWA 4N9IA 1PGL1 2QUOA 4XBQA 4YVSA 4HN1A 4MV2A 4BMBA 5DZEA 3VL8A 3PMSA 1NA1A 1R082 4IETA 1BBT3 1POV1 4IERA 5LEJA 1ULCA 1A8DA 1GICA 1W6OB 1NY71 2ET7A 4Y22A 5B2GB 2HYKA 2YGMA 4AVAA 4AGVA 5L19A 1RUC3 1UN1A 1R1A3 1M06G 1RUD3 4CDQA 4NHMA 2DVBA 2RJLA 4Q0UA 4XFBA 1DU3D 1Z0HA 2DUPA 5K9YA 3WDWA 5FO8B 2P3JA 4XW3A 1RUC1 5A3LA 2A71A 5AVPA 4E2SA 1QF3A 1RVF3 3SCGA 2D6PA 3POWA 2ZGMA 3USUA 2VY0A 2QDRA 3VZOA 3NW4A 4O9EA 3R0RA 2P3KA 4F8AA 1XNKA 2FBEA 3D6EA 1QXRA 3ZSLA 1LHVA 4ISRA 2QDNA 1I9RA 1ZRDA 4HANA 2YUEA 2HEVF 4OUSA 5EWSA 3KB5A 3S7IA 2QFEA 2OPKA 1LOGA 2QNKA 3WT3A 1V6LA 1LEMA 1POV0 1PIV2 3AB0A 2WFF2 2CWMA 1SBDA 1YJLA 3J8F1 3BIWE 3MFAA 3TB0A 2HWB2 1AR61 1AF9A 1J3QA 4IV1B 5FQ0A 4IEPA 1LCLA 3I7DA 4LHNA 4KWLA 4S2FA 3VZKA 2ZGTA 4HBNA 4ATEA 5ABJB 3HWJA 2IZWA 1KJLA 4Q1PA 3RYRA 3ZXFA 2QVSB 1UD1A 4Q29A 4DXZA 1WLWA 2ZAHA 3JBG3 4B8EA 3PVOA 2YC0A 2XJTA 1AL0G 1H1MA 2JD4A 4DQAA 4L9BA 1BBT1 2I2SA 3H1WA 1LGBA 2HWE1 5JI9A 1GNHA 2YGLA 3NAPB 2R32A 5FO9B 3GZTB 3SH5A 1QQP3 4YGCA 1AJKA 4JDOA 3LOIA 1AJOA 1NOVA 1R083 1U12A 3DUIA 3W9AA 2PHLA 3O12A 2UWCA 3S30A 2D6OX 5JMCA 1SFNA 4XJUA 5HCBA 5A32A 4Q27A 1GLHA 4TSVA 4DFSA 1NE4A 1RUE3 2LALA 2F4PA 3TN93 2HWB1 2FMDA 5T5PA 2O1QA 2K2SA 1SACA 3PJQA 4IL7A 1WLDA 1W2UA 2RS51 3AZYA 2W52A 3AYCA 1GSLA 3JQWA 4WVMA 3DV8A 2CYFA 5I8SA 4XJ8A 1D4M1 4AFAA 5C9AB 3V56A 1RL3A 3JQXA 3ZYPA 2TNFA 3QBQA 1YI7A 1OLQA 1HX6A 2GNDA 1HIXA 2KA3A 3MICA 5I8YA 4RGAA 2R1BA 4AFBA 4AYUA 3J26N 1W39A 3U0ZA 5C9AC 3ZN4A 5J48A 4YG6A 1CPNA 1O91A 1PZ9A 2PLV1 3AMQA 1VAVA 1LENA 1UKRA 2A3XA 1WLTA 4IEUA 1XRUA 5IUQA 4E2QA 4K20A 2I07B 5FLIA 3ZFGB 2R1DA 5DUWA 3WQ7A 4UW5A 4Y26A 3VBUC 2E9QA 2HWF1 3AYAA 4ZXKA 3UL2A 1DQ6A 4R9CA 4DOUA 3O0WA 1VBC2 4XTPA 3MW3A 2NZ9A 3VBSB 4GQ7A 1DBNA 3B9IA 1DLLA 3U10A 1XXNA 2MPFA 3WY6A 1SBFA 3MF9A 2AZ5A 2HWC1 2HWE3 4FOYA 3IKWA 4COUA 2ZX3A 3TBDA 4DNYA 1UKGA 3JB4C 3ZXGA 3FE5A 1Q43A 4KH9A 3WP4A 4Q0SA 2RR13 5E1RA 1FI2A 1U5YA 1VAKA 4Y1VA 1R093 4LO8A 2XH6A 4K1ZA 1EP0A 1JUHA 1RVF1 1LOBA 4PQ9A 1SLBA 5I0TA 3KQRA 4RHV3 4QGNA 2JEMA 4H55A 3DPRB 3WP5A 1C57A 2P34A 3USUB 4AQSA 3D0SA 5KXEA 5JOYA 4RS5A 2WNVB 2E63A 3AZWA 4N53A 1YNAA 4GKXA 4XIKA 4AQ6A 1S2KA 4ISQA 2WLQA 1ZZ7A 3ZN5A 2HEWF 5BYNA 1OPOA 3FC0A 3ST7A 2ZGQA 3RYKA 1FX5A 1LULA 1FPN2 2UURA 4IEWA 1RJ7A 3VKLA 3VGIA 4YM1A 2VULA 4PDWB 2IXCA 1LOCA 3FWEA 1PM7A 1FMD2 1FNYA 2H0VA 1TE1B 1Q8QA 2DURA 3HT2A 3ZN6A 1DZTA 1WBLA 2DUQA 3WVJA 3N7JA 1WW7A 5JPMB 1UU5A 1KD7A 2IXIA 2VOKA 2XJSA 2BFUL 1AXZA 2GH8A 2XJRA 1N1TA 4NVPA 2WNUB 2VG9A 4FPYA 3OGJA 4I09A 1DQ1A 1REEA 1AR73 1EYBA 3NV4A 3ILRA 2GC3A 4LLFA 3J4UH 4FOVA 1TQ5A 4R9DA 4YM2A 1CGPA 4D7SA 2Q1MA 3Q9OA 4AEDA 3WP3A 5LRSA 1R091 2NM1A 1V9U3 3J9SA 1SLAA 1ENSA 1V00A 1QDOA 1RMU1 3K48A 4HKOA 3VKNA 3KS7A 3OJBA 1FV2A 2YDEA 2PLV3 4TYSA 1MS9A 4QGLA 2R6QA 1FMD1 3NJZA 1J58A 5GZCA 2GU9A 1AL21 3WCRA 5C8CC 3AKSA 4XF9A 2Q8OA 3TWIA 1O5UA 5BNNA 5T5LA 4D7YA 2HEYF 2D6NA 4Q4Y2 2GALA 3VKMA 4RSUA 4I2OA 4XHXA 3AJYA 5DUVA 2H0BA 1ND3B 3VBOA 2BBVA 1QJX2 2WKKA 1O3QA 2R16A 4C91A 4YVSB 3BOPA 3M3OA 2YHJA 3WDYA 3ACLA 2D44A 2D6KA 1ENQA 2BVVA 4RA0A 3B01A 2A73B 3RQ0A 1CAVA 4S2GA 2FZ2A 2YROA 2E7TA 4JVAA 1CD3G 2XBO1 2EXHA 5FLHA 4FPFA 2ARBA 2WA3A 4HMZA 4LA3A 1CAUA 1AYM2 2D5HA 2NN8A 2IFRA 4XJ9A 3LA3A 4JDNA 4HLTA 1MEC1 2XUMA 4CZSA 2V09A 5IK7A 5I93A 5JIUA 2VW0A 5D8AA 3H7JA 1DG6A 3ZSKA 1BKZA 1CQ9A 5A33B 3CJIB 4XETA 2HWF2 1QH6A 1AYM3 2WT2A 1C8NA 5JAXA 4OLLA 1FT9A 5GZEA 4CP2A 1MR5A 4LBMA 4X8NA 2ZHKA 1VBA2 2X5IA 1FMD3 2R043 4KG0A 3M7AA 5I0UA 1V6OA 2CGPA 1NZCA 5L73A 3N3HA 2RS32 4E27A 4YW5A 3ZMNA 4L11A 4PDWA 4Q4V3 5JDBA 1YUDA 2UYBA 3RWNA 3MIBA 1PNFA 2AGSA 4CP1A 2X53S 4AEDB 3ALQA 4A3XA 1DGRA 1VBD2 1LEDA 1Q3EA 4MXWB 2A6XA 4Q4Y3 3O5SA 2EVXA 3MF6A 4AG4A 4NWWA 3SCFA 5BNQA 2O0OA 3KGLA 5KHHA 4EV0A 2GSYA 3JD73 4GH4B 1CN1A 4QPIA 1IKPA 3LB9A 4HSJA 3WHUA 4FPHA 5CIRA 2GH2A 4MXWA 3D8CA 4N90A 1SMVA 2I45A 4PIYA 3SH4A 2NMNA 1S0JA 2DU1A 3ASIA 5JWPA 1HLCA 4AW7A 1ZZ9A 4P9JA 4YGDA 2JE7A 1WLCA 3HIFA 2HKXA 4LBNA 5TSWA 3L2HA 4FPLA 2VNRA 1CONA 3WUDA 1PK6A 3MIDA 3N4MA 4XDQA 1DZRA 3MDPA 1AR72 4BIOA 2N7GA 2WS91 1QJZA 4PLMA 1QOOA 4AXOA 4WM8B 4D7TA 3B93A 1VRH3 2B46X 3GYDA 2VNOA 1PZ7A 2ES3A 2WA4A 5T52A 4RR3B 3TAYA 4Z8BA 1Y7BA 5J37A 3M3QA 3THTA 3S6PA 4L92A 1AX0A 4QM9A 1KQRA 2DCTA 2GMMA 2ZX2A 1N3OA 2DCKA 4LUMA 1HW5A 1X8EA 1RUF1 3R05A 2D5FA 2XBO3 1F2NA 1VBA3 4Q2FA 4AWDA 5BNNB 2DVGA 3ME2A 1RB8G 2AUYA 1GQGA 5EV7A 1SLTA 4OFGA 4FT8A 3RJRA 1REFA 3MIHA 5C4WB 5KXCA 1WUVA 5JOZA 4F83A 2VQAA 1PMIA 5C8WA 2UYAA 1DIWA 3VBRB 4IEQA 1DGWX 1FOD3 1OA4A 3ZYIB 1MZEA 2P37A 4IV3C 1RUE2 4RHV2 4EWDA 3ENRA 1W6QB 3EBRA 4TZDA 1MVQA 3TNQA 2IXKA 2CV6A 5FMOL 2ZGRA 3M3CA 2RS52 2R072 3BOWA 5H9RA 5J7MA 5DDJ1 2BWCA 2ZGKA 4RQPC 3IPVB 4Q4X2 2F6BA 1SBEA 5K0UC 2FHRA 5IT6A 2XJQA 5FPZA 1C4RA 3GZAA 1UIJA 3LAGA 4FO9A 3AMNA 4YGBA 2GN3A 4FOQA 1UPSA 4RQPB 1QJX3 1CAXB 5DDJ3 5BNOA 2A70A 2G4IA 2ZKLA 1J59A 4DRVA 1VBD1 4WM7B 3GHMA 1MQTA 4COYA 4OI1A 4W6XA 4LBQB 5FOBB 1MZFA 1PNGA 3M8LA 2UY8A 3N36A 4ZKTB 4YG3A 3VKOA 5I0SA 4G9SB 2V73A 1DGWA 1Z7S3 1CJDA 4BLIA 3FZ3A 3AP5A 2R49A 2VVDA 1JXNA 4QQ2A 5H9QA 4RS5B 4S2HA 4P9GA 2MNGA 3P3PA 4EN8B 4WZCA 2P3IA 3W58A 3WDUA 3VZMA 2Z42A 5I0RA 4FTBA 3ZFGC 1V9U2 1YHFA 3ZDSA 5EFUA 3WG2A 1NCQC 4SBVA 1AYN1 4AI8A 2VECA 2UY9A 3WDVA 3N7KA 1LHWA 2XG3A 5FBZA 2GNTA 3CL1A 4Y1YA 1QJU3 4ITCA 2CL2A 3VBFB 4URTA 4BZ4A 2TUNA 1MEC2 3PJYA 4FPCA 1D2QA 4ZU4A 4PLNA 4Y1ZA 2QZ2A 3KCCA 2JE9A 4EWEA 4RL7A 3NV2A 3AK0A 1R1A2 3PMEA 2BWAA 4U36A 2VOVA 2EXIA 4AVTA 1QQP2 2RMU3 2VOXA 1BQPA 1AR93 1OA3A 4OI4A 1RUI1 4JRLA 1JOJA 1PIV1 1WD4A 3NSTA 1IS5A 4EN7B 4I3GA 1LKNA 3ZO0B 1NQJA 4INDA 4AVSA 2AREA 4PIXA 1NCQB 5C4WA 4WM8A 1GYKA 4N43A 4KQ7A 3B5LB 1UW8A 4N53B 3DGTA 1GFF2 2GNBA 4XBNA 5FOJB 4JAAA 2VMHA 4R9BA 4OULA 1W6NA 1X82A 2QZ3A 2WFF3 3ZXAC 3PNAA 3WX5A 3GHNA 2X8KA 1BVP1 1OD5A 4JCKA 1COV2 1MQTB 1RUF2 1SDWA 3JU9A 3WUCA 1LU1A 3E5UA 2GNMA 4EN0A 3HAGA 1D4VB 1EPWA 2A6YA 4MSVA 1CAUB 4XTMA 4B7EA 1JW6A 2DFBA 4RS5C 5CG9A 5A33A 1Z7S1 4KGGA 2G9FA 3KSCA 5DZGA 1S0IA 4FSJA 4Q4Y1 2RS11 4WVZA 1ASJ3 4JRAA 4RQPA 2GZWA 1Y43B 4R9AA