5ACZA

Complex of a b21 chicken mhc class i molecule and a 11mer chicken peptide
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
269
structure length
269
Chain Sequence
b'LHTLRYIRTAMTDPGPGLPWFVDVGYVDGELFMHYNSTARRAVPRTEWIAANTDQQYWDRETQIVQGSEQINRENLDILRRRYNQTGGSHTVQWMSGCDILEDGTIRGYHQAAYDGRDFVAFDKGTMTLTAAVPEAVPTKRKWEEGGYAEGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCRAHGFYPRPIVVSWLKDGAVRGQDAQSGGIVPNGDGTYHTWVTIDAQPGDGDKYQCRVEHASLPQPGLYSW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC CLASS I ALPHA CHAIN 2
molecule tags Immune system
source organism Gallus gallus
publication title Complex of a B21 Chicken Mhc Class I Molecule and a 11mer Chicken Peptide
rcsb
total genus 61
structure length 269
sequence length 269
ec nomenclature
pdb deposition date 2015-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5aczA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5aczA01
4HIHA 3THMH 5LBSL 5C0DA 3F58L 4M7KH 5CGTA 1EA9C 1NJ9B 3B3IB 2OJEB 4X6FB 3ALPA 1QUNA 3D9AL 5DUPH 4JZJA 4JM2A 3WHXA 2A0LC 1BFSA 1G0XA 1BZQK 1WCQA 4XVJL 4G8FB 4IM8A 4HG4J 3U2SB 1P5UA 2WINA 1KG0B 5MEPB 3MRLB 1YY8B 5AZ2H 4RGMB 5BVPH 4DKEH 4RWHA 3GK8H 3PWUA 4GW5A 1NH6A 4BK4A 4ETQA 3CCHB 1RZFH 1D3CA 4I48A 3FOMA 4RX4A 4R97C 5DZLA 3RWCB 3T2NL 3IFNH 2B5IB 4YE4H 1W0WA 4PGEA 1ZEAH 3EYUL 4Z77A 4L1DA 4FFVD 1T7WA 3HG1A 1OAYH 2GQHA 3MUZ1 2WAHA 1FNSL 1CGSL 3EO9H 4PYGA 3RWGA 1KENH 1BQLL 5SV4A 1H0DB 5HPMB 1JYXA 2WBJD 4RGNE 3RPIA 3V5KA 1MHPL 1IGYB 4UTAH 1R5IB 4G9FA 1P84K 2BSRB 1U92B 3I2CL 1OAXH 2FO1A 2WZPD 3VXRE 1GCFA 3GSWA 4GW1B 2OXHA 1OPGL 3KWWB 1JTOA 2EC9U 3J7HA 5JPMA 4GJTB 5BRZD 4JRYA 2VXTH 4Y89A 3T4YA 2FX7H 3I6GB 4LFHG 5I75C 4WHCA 2AEQH 4KMTH 2NXZC 1J86A 4AMKL 4N8CH 2NLJA 5C70A 1K5NA 4CNIA 4PRDB 4OLZL 2XG4A 4WFGD 3RAJH 4M61A 4IMKA 5D96C 5AYQA 3LKRA 2E8ZA 4OZHE 1RZJH 3LKPA 4K7FA 4UT6L 5KSBB 4DN3L 3HE7C 1FH5H 3IDXL 3KLHC 2DQCH 3BEWA 3AB0C 3QQ9C 3PP4L 2G9HB 4JJHA 3BN9C 2NY5C 4XNYH 3T4AA 2E9WA 1IGTB 4YHIB 3RIAF 2X4NB 5KSBF 1I1FA 2X40A 1BLNA 4ETYA 2EH7L 1B4JL 1RIVL 4JDZB 1OAUL 3OV6A 1A6AB 43C9A 1S7SA 4ZSOB 4YO0A 4OI8A 4CL7A 1NFIA 4MDJB 4P2QD 1V05A 5JZ7C 4WEBH 3ULVF 3QO1A 1X4XA 3V52H 4PJXB 4NQSA 1YMME 3H0TB 5EIIA 1UM6L 5IHLB 1PVHA 1J9CT 3KLAB 2EH8H 3IS1X 4IRSB 4BZYA 2DIJA 2YUWA 3CSGA 4I0PC 1FAIH 2FIRT 4ZAKB 3ULUH 5DEGA 3H7LA 4CVUA 4URTB 2XFXB 4WHYG 1EH9A 2HTLD 2AJ3B 4HEPG 3QUYB 4M4PA 4JG0L 4L8DA 3RP1A 3RI5K 1TVDA 3EIFA 3EOAB 4PIRF 4W6YB 5E8NB 3WFDH 2FECL 3BUTA 5KSAA 3EUUA 3QAZC 1DQLL 1MFCL 2LV4A 3RZCB 5HYJD 3LN4A 5EN2A 1IM9A 2PCPA 2BOCA 3IDIA 1CDCA 3U7AA 5BO1H 5EOQH 4G80B 4YHOH 5FGSA 3C2AL 4LSVH 1CDJA 4QYOB 3KPOA 4O00A 1HINL 5JIKA 4EQ3A 4AEHL 3MV9D 1BBJB 2DYPA 1JJUA 4LK4A 1NAML 3KYKH 4PJEE 1ZHBB 1AFVL 1A6AA 3MRJB 3DXAE 3GSXA 4FRWA 3UTTA 1EDQA 1JZ7A 15C8H 2H41A 5DC9B 3RWJA 4IDJL 1OAKH 2F53A 5HHQB 4D9LL 5DJ2A 1MI5D 3BWAB 2JJWA 1T66C 4DUXA 1T5WA 3D85D 3ET9F 1F11B 2QHLA 2WM0A 1BWMA 3WD5H 1A6UH 4HF5H 3TCLB 3MRKB 1B2WH 4LDLB 3L5IA 4OI9A 5BXFA 5HHPB 2EIBA 4MQ7A 3TA3C 1S5IH 2HTLC 4OAWA 3MOAL 2Y72A 4GXVL 4KJPD 1I7UB 3L7EB 3STZA 1P2CB 4KKCD 3PQYE 4M5YL 3HRPA 2WANA 2Z92A 2WBWB 32C2A 1L6ZA 3EJZC 4OUOA 2N1KA 3OJDB 5GJSL 1X5HA 2X7LA 4OZGF 5INCB 4IRZL 4X7SL 3BYTA 3SKNA 4DCQA 4HWBH 5F3HA 3W39A 2XIDA 4YHML 4MDIA 3ZDYE 1EEYB 2I9LA 2B39A 3V6BR 1G7LA 4KROC 1X4ZA 2ZZUT 2VABB 3DSNA 4QHKI 4XCFH 2ED9A 1T4KB 2X1WL 1ZMYA 2N56A 4NUGH 3SDYL 4J3OC 1IGYA 2ZUWA 5IQ9A 2OZ4H 3O81A 1W72L 3ARDD 1MCOH 4K23L 3KLHD 4JRWA 4KU1A 3P4LA 4RFOH 4RAUA 3EO0A 1Q0XH 4QXUH 4G6MH 1WWBX 2E27H 3AROA 5DMGD 2ATPB 1INQA 5C92A 3GUTA 3OKKA 4UINL 4NZRH 4NHUB 4OM0H 4PJ8C 5DHXB 3QHZH 3C09C 2XT1B 5DD0H 1KLUA 4ELME 1YY8A 5DK3A 4PJEA 1V3MA 3BGFC 1RK0B 3IETB 1WF5A 3CXHK 4FQ2L 1KGCD 3LN9A 3RU8L 4E9LA 4HIXL 1DVFC 1CDHA 4DVRL 5EU6B 3X13A 1QA9B 4NKIL 1QG3A 1FYTD 3ARYA 4ZUTB 5TDOA 1F2XK 2R1XA 4LVOC 1UB6A 3QUXB 5I74B 1KCRL 2ADJB 2OI9B 4C59B 3KJ4B 5I18H 2CQVA 4I9WD 1RZIB 3QI9A 1L4IA 5EC2A 1EVTC 1G9MC 1GHFH 4PJCB 2IBBA 3VXMB 2IANA 2CKBH 1UVQA 3RPIB 2WNGA 4PJXE 4KI5E 5FGBC 3B5GA 3HR6A 1R0AH 4DQOH 5E9DE 2IAMB 4G43A 4P4KB 4I2XA 2ID5A 3MRRB 4S10A 5FF6B 4ZTOL 4U0RB 1BLNB 1RIHL 3BZDA 5DO2C 4U1KA 1FZKB 1X4YA 1UH4A 5C8JA 1S7XB 3VXME 4JFXA 4MD0A 3SJVE 4YQXL 2UWEA 3GSOA 2HJFA 1BM3L 4XNZB 3G6DL 3MACL 1FGVL 3BH9A 5I1CH 3RDTB 1G7QB 2F53D 3RNKB 3HS0A 1TZHA 2EXYD 3CMOL 3BI9X 5F93C 4KDVA 5DTFA 2VERN 2MCPL 1AGBB 1HSBA 4S1QL 1JPTL 4HS3A 3QIUD 2MHAA 3MJGX 3DX8A 2NR6C 3WFBL 1FIGH 3P0GB 1B4JH 5IV2A 5E2JA 3CDGA 1DVFD 1R5VA 2NY6D 5I1AB 4WNQB 3U7WH 1OM3H 2Z91B 1JGDB 2DQEL 3PWJB 1JPSL 2CDFB 2V7NB 4JLRB 4WENB 3VCLA 4Z7WF 2AS5M 1QLRB 4O5LH 4JY4B 2XZZA 2WY3A 4NRXB 1YN6B 4P57A 3L3OA 4X6FA 4XPGL 3X12B 5AG9A 1Q9WA 4K3HA 1F2QA 1OTTD 3MUHL 4F7PA 4U7MA 4AEIL 3AMLA 1E6JH 3ZKNC 5CS7A 3KHQA 1Q8MA 1SJEA 1NEUA 3AGVA 4X99A 3AM8C 5I1HL 3GGWB 2K7QA 1FE8H 3GSXB 3UTTB 4KK6C 4CKVX 1QSEA 4Z76B 4E41B 3Q6GL 5I66A 1DN2A 4PGCA 4KRPD 3ARFD 4F2MB 4EI5D 4U7KA 4CN6A 2YBRB 4HGWA 1AO7E 4LSTH 5L6YH 3SE9H 5FDWA 3EO1B 3LQZA 2PW1A 5H2BA 3M1BA 4D94A 4EXKA 4PRAB 4GBXC 5EG6C 3RKDC 2YD3A 3QEHB 5H8DA 3FONB 3GI9H 3FO9A 1UADC 4QHUA 1F42A 1NGQL 2EO9A 2FO4B 3KPLA 1U3HC 2GTZA 3QUYA 2R2HA 2APXA 3W0WB 4RGMC 1H8NA 2NY4B 2Q76B 5ITBH 3MFFA 1CIUA 4K71C 3SQOL 4CVWA 1JNHB 5IVXF 2R29L 5FCUL 2P5WE 5JXEA 4KQ4L 4R97B 2FEEL 4J6RH 4H1LB 4YHPA 2VIRB 1OSPH 5IF0A 5DXWA 4GW4B 5F6HI 3L6FB 1F3JB 3MBEA 5EC1B 4DQOL 3UO1H 2O5YH 4LOUC 4LSSH 1LO0H 4PJ5A 3WO4B 2IH3B 3VDBA 5HDLA 2VDKH 1MRCH 2A77H 1LP9E 4NBZB 2FSEA 4LVNC 1AD9A 2O5XL 3RVVD 4KKAC 1FDLL 4NO5B 1CN4A 2DWEA 2NYYC 4QRQB 5GRUH 1CZ8H 1X5AA 4XPHH 1XF3A 5TF0A 1ZKAA 3L3GA 3MNZA 4YO0B 1SEQL 5CKAA 2CUMA 1OP9A 3GIZH 4FFWD 1BP3B 4MNHB 1IGIH 3QUKB 2YKLH 1NFDA 4X8JB 3JTTA 3O8XC 1KT2B 5LGHL 2CKBA 3QG6A 1S8DA 3RY4A 4GG8B 3T0AA 4N8VA 2JCCE 3SKNB 5GISL 4JY4A 1NC2A 4NO2B 3VRJA 1LEGA 3N1PC 4QHMA 4KDWA 4PJEB 1S9WB 3HUJF 5DHYB 3VWKD 4GRLB 2EE9A 1UCBH 2JB5H 3WFCL 5LGJA 1RJYB 4K23H 4CN1A 3MROB 4HUNB 3DVGA 3VGAB 4JQVC 4I4WA 5FDYA 3GIVA 1AD0B 2EC9T 1A8JH 2H2SD 1BZ7B 4F7MB 1LO3H 4X7FC 4MXVF 4B5EA 1N26A 3MLTB 2VXVL 4Z7NF 3VXPA 3BPCB 4NM8L 1TVHA 4OM0L 1I1AC 5ETUB 3E2HC 5DMKB 1EXUA 3D48R 4KJYA 1IKFL 4MJ6A 5AZ2L 1AD9B 1PLGL 3LRGA 1HHHB 3EO0B 1MFBL 3QXUA 2R4SH 2DIAA 1XF3B 1F4WH 4LEOB 1JV5A 1ZHLB 1JZ5A 1XR8B 1DLHB 1J0HA 2CMRH 3EBAA 3GSUB 5DJDA 4PLJD 2XTJB 4BJLA 4NHCH 3QRGL 1AHWB 5DURB 3FT3A 3WL9A 5EU4A 1YEDA 1G84A 3X13B 5KTEL 4Q9CA 2G2RB 4X83A 3HUJA 2HVJB 3EYFA 3FQUB 4NJAH 2VDPH 1U2CA 1ZWIB 3OGCB 1JYWA 1NJ9A 3RZCC 1KCLA 1KTDB 3KNBA 1OF2A 4ZQKA 5C07A 1NUGA 3BWAA 2R0LL 4HH9A 3FB6B 5C09D 1EFXD 3V52L 1N59B 3ARFA 3W9EB 1FZKA 1KIRA 2DWEB 5JQHC 2AQ3A 1TJHL 4HWNA 2A9NL 2HN7B 1BBDH 4PRPD 3ESVF 2XPGB 1CFQA 5BZWB 4ELMB 4I0PD 4PB0H 4LCIL 4K2UH 2JJTC 2A6KA 2W9EL 2DI7A 2R9HC 4OV6F 4OSUH 4S1RH 4YPGA 3ZTNL 4U1SA 1XR9B 2J3SA 4ZFZB 5GRXG 1FFOB 2E27L 2J4WH 1J1OL 1CQYA 1WBZA 5ISZB 4M1GL 1WCBB 3PDGA 2XN9E 3SDDD 3EFFB 3QWQB 2HRPH 2ADIB 1MFEH 2X4PB 2EDTA 4HKZA 5JHDB 3GFUA 2CKNA 2OTPA 1LQVA 2W65B 5MENE 2R56L 3KR3L 1L0YA 4Z7WE 4MD4B 5BO1L 1P9MA 1KPRA 3L3OB 4R4FL 3B5HA 3FO9B 2RFXB 5E8OB 2G2RA 1QLFB 5I1HH 2DKMA 2DKSA 3OB8A 3GHEH 5I6XC 3W82A 4QTHA 3VE0A 3MBEC 1ES0A 3HTLX 1G9ML 3FFDB 5LKNA 4KTDL 4Y19E 4JQIL 1JN6B 3BRGC 4D9LH 5IIEB 3TBTA 5F7LB 1S9XA 5KN5A 2V2XA 1AIFB 2V2WA 3VWKC 4EN3B 3RWEB 2DF3A 4LLQB 1NSNH 3LKSA 3LEVL 4YFEA 1QD0A 2HVKB 4XGZB 3QG7H 1JP5A 3NCBB 2IAND 5IKCB 4OCMC 3RL2B 4POYA 5F6IC 4M62H 1S7TA 4WGWB 4P9ML 1J8HE 3PGFH 4KQ4H 4JPWH 2C3WA 4NZTH 1T21A 5CLTA 1JNJA 2YA1A 5EOCL 4MXQD 2P44B 1V5JA 3IDMA 3LKRB 2O5YL 3B9AA 3JVGC 3X3GL 4M6NL 1INEH 5HHOB 1MRCL 2ADGB 5IB5A 3TH2T 1K4DA 1A14L 5M7QA 1P4BH 2KKQA 2QV2A 4ODTL 3OAYH 4BA8A 3VRJB 1JPFA 4IHOB 1UM4H 3CFDA 3ARQA 2Z8RA 4HIJB 5GGQL 3T8XA 1K2DA 2BP3A 2HA1A 5D6DA 2BVTA 3HE7D 3QA3B 2X4TA 2W9EH 3FTGB 3QZWB 2HFGH 4KFZC 2YKLL 4P4RA 3CFIC 1BAFH 1URLA 3C5ZB 3TZVB 2CH8A 1DQQB 5DMKA 1OP3K 4GS7B 4PRBA 2G5RA 3HZVA 4Y16A 4UOW0 3PHQA 3PIQB 2EKSA 5ACMA 5HPMA 4LAQL 5J6HB 4FP8L 2XQBH 3QR2A 3VFTB 1D9KC 4XNZC 1MREH 4P46A 4OZFB 5D93B 4OGYL 4P46D 5E8DH 5I1GH 2DLGA 2YD6A 1CXIA 1G9NC 4R4BB 2ARJQ 4NKIH 1TVHB 1WV7T 3L3JB 4GRLA 3SKOA 4LMQE 1VACB 2F15A 2NX5A 2H2PC 1QACA 1H3XA 2XZQH 4YHZH 2AKRB 5CUSH 3MXVH 1DSFL 4TNVK 4WRLA 1BOGA 4E42B 5ESQB 5LGJB 1RY7B 4TVPL 4UI2A 2W0FB 4M61B 4PTTB 3BPOB 1UWGH 4LHUG 3W0WA 4XVUC 4GAFB 1U58A 1RJZB 5L88L 2EYTB 2E5EA 4KY1H 4N68A 4FTVA 1XIWD 2AEQL 4GUPB 1BQHG 1Q0XL 3DV4A 3HHRB 4PJDE 3RWIB 3QO0B 5EUKA 3ILPB 1V3LA 2DWDB 3UTQB 3QDMB 3IXTA 5D1ZD 5BS0B 4U6VL 4JY5H 2CGRH 2WUCH 1CLOL 3U4BH 1J0ZA 2Y5EA 3PP3K 5L9DH 3RZWA 1AY1L 1YMHB 1EK3A 3MJ9A 4GG6B 2RCSH 4FTVE 4K8RH 3QIUC 4FHBD 1D9KD 4M7JL 4PJDF 4I3SH 2XQBL 5JDSB 1TTFA 3C60C 3IYLW 5IVXA 1TQBC 4FQCL 5A16A 2ADFH 4JGUA 1RFDH 3BDXA 2VRAA 4CVZB 4JFDA 1T4KA 2JJSA 3T0EA 4KHTH 2HJKB 3CC5A 5D7IE 1RULL 3JWNC 5HYJA 3LIZH 4KZDH 1R3KB 1CXEA 3FQRA 2Q8AH 2I27N 1HEZA 4LGSB 1LGVA 1WITA 1NMAH 1XGPA 1Z3GL 3ARUA 2EDNA 3FOMB 3JBG7 1OARL 4PP1C 4HGMA 3GHBH 5MENB 3TWCL 4ZFOL 4ODSH 2A83A 4LGPB 2YD4A 1JMXA 3DHJA 1Y0LA 5FB8B 5D5MA 5KVGH 2IFFL 5ANMA 3S3SA 5LQBH 5K59E 3FHAA 4NO2A 1SQ2N 2W65A 4WGVB 4N9OB 3Q3GB 5KS9F 3D2UA 4JKKA 2QJDA 4ZAKA 4J12A 4X4MA 2BVQA 4RNRB 1KJVA 5A2LH 4B7LA 1YYMH 5FYJE 3T0BA 2AJ3A 4JREC 3CSBA 1N3NA 3UP1A 4LRIC 4BSJA 2HT2C 4XBGA 4ONHA 1AI1H 4PJAF 5HHMD 1ERNA 5CD5C 4ODWB 1MPAL 3ES6A 1A22B 4Y2DC 4TVSa 3BHBA 1S7QA 1QSZA 3C60D 4M7JH 1PW3A 4Z0XB 1OQXA 1BIHA 3U82B 5FECA 1RVFL 1LVEA 4KXZI 5EWIH 1IM9B 5GGRB 5IFAL 4R26L 4EUPA 4XCNA 4BZ1L 2HLAA 1ETZB 1AXSA 4PLOB 4XCYA 1A3LH 1SM3L 3W11D 5DYOB 1JZ4A 5K9KB 2NNAB 3OKLB 1CF8L 4OLUL 3DUSA 1M7IB 1ZLUK 4DVBB 2W9LA 1U58B 2AERT 1JCKA 4K9EL 3W0WE 3NPZB 1T0MA 2AV7A 4U1MB 1DN0B 2G9HA 3K7UA 1J1PL 3QUXD 4Q0XL 5IB1A 3AS3A 1EFXA 4JPIA 3CVHA 4WI6A 2AAVA 3JV6A 1V8HA 3LKOB 5C07D 2NX5E 4HLJA 1YNTA 3U4EA 3VGAC 1JWSA 2GK2A 3THML 5F7EH 3SE9L 2ZUSA 2BNQE 3GO1L 3CH1A 5HHXH 2BSTB 4GSDH 4GRMB 1XF4A 3WDHA 4CNIB 5HI5C 5DK2B 1BGXH 1M6OA 3A67H 1QFWI 5CBAA 2UY6A 3QI9C 3SHSA 1ED3A 4Y19A 5DS8A 1LK3H 3MLSL 2AV1B 4LAJH 3KS0H 4IJ3C 1UZ8B 2EEDA 3PNWA 2Q6WB 2BNUA 3PHQB 3PIQA 5T3ZL 5FYLD 5HHNA 3S35X 2W0LA 5F7YC 3MRGB 1KCSL 1MCIA 1M7DB 4O2EB 4TOYL 1MHHA 1VGEH 3KDMA 25C8H 4OZFA 5CCKL 2AABH 3QZWA 3QXTA 4M48H 4QRPB 1FHGA 4NRYA 2AK1H 3BEVA 4KTEH 4YIQB 2Y23A 1FNSH 1YNKH 2VDMH 5CIPA 3QNXA 1F6AB 3RQ3A 2LU3A 4S2SB 1VKXB 1AHWC 3GSVB 3LSOB 1IKNC 2D7QA 3VWJA 4F8QA 3MUJA 2NTFB 1Z0MA 2P1YA 4AEFA 3QNZA 5T1LD 2R1YB 5HYEA 2PW2B 1KXTB 1F58L 4P5KA 5DEFB 4QOKE 1PKQB 4HIJA 5DJCB 5KAQF 2V2TA 2YMXL 2XKNB 5HGAB 3UC0L 4JPVH 5JW3L 1CICA 4P5TB 5GS1C 5EFIA 5JXAH 4QKXB 4G8GE 5E7BA 4ZS7H 4FQJH 5DEGB 3CFBB 4OZIE 4P2RD 1BGXL 4PPTA 4YDVB 2I5YL 1EHNA 4PJGB 2WBKA 2YZ8A 2FYYA 4Y19D 1TNMA 2OLDA 2LVEA 3KAAA 5CEYA 5T33H 3C60A 3MRQB 3T1FB 3D87B 5HYSG 2ORBH 3NIDF 1DANU 3RWDA 1S7UB 3QUYD 1EGJA 4R7DA 2UYLB 1ZLVH 1FORL 1JPSH 1YPZA 3M1BB 1YEKH 2ZCLH 1UC6A 2DQCL 3KPQB 4PJBB 3EJYD 1EO7A 5H94A 2JCCB 2OP4L 4P0DA 5SWQA 5HHMB 3VGEA 3NA4A 3BP4A 5HYJB 1T80A 2FSEB 3ARGA 4X0KB 4JZOA 4YLQT 3PUCA 3VA6A 4N5EC 1MCPL 4RAVB 3V5DA 3X3GH 4PJXF 1PQZB 3D2UD 3NZ8A 4GBXA 1U8IB 4JFZH 3RX5A 2X1XR 5F1OB 5BW7A 2VXUH 3WHXB 5BOZG 2B0SL 1JTTA 1ZLSL 3G6DH 5DVLA 1CFSB 5L9DL 3LS4H 2VNCA 1DUYB 1KN4H 5D5MB 3NH7H 1FL5A 4ZFOB 2IF7A 4KUCD 5E2VH 4R90L 3BKYH 2C5DC 3UTPD 4XC1H 3P0YL 5JW3H 4TSAH 5FIEA 5I1JH 5AAWA 2GUOB 5D5MF 1TQCC 2YPLA 1EUUA 2Z91A 4TSCH 5IM7A 2VLLB 1A7NL 3S34L 5F89B 1ULVA 4JFDB 5FYKL 4GRWF 4LOUD 1CU4L 1V7NH 4PB9H 4O5LL 1DVFA 3OXRB 1D6VH 2O5ZH 4KTYA 4OZHB 3RA7H 1K8IA 3ULVL 2ITCA 4S1SH 3ZTJH 4X6CE 4JR9L 4Z0XA 5I9QC 3FL7A 1F3DH 3T0EB 3BPLB 1Q9WB 1YEKL 2F8OA 1MRDH 2ITDA 4KI5F 5D1ZA 5LQBL 4JN1L 2X9XA 3BH9B 3WUZA 1A9BA 4GMSH 3KYMB 4ZYKB 1SJEB 5EOQL 4S0TD 2ENYA 1OT2A 1FP5A 2DQDH 3WHE0 1EHLH 1UWXK 3PDOA 5D2LE 5DK0B 5HI3C 5CZVH 4XHJD 5KSUA 4QHUB 1X5GA 5D6CB 3GB7A 3CDGB 1DP0A 4G8IB 4Q2ZB 4UT9L 5DRNA 4PRAA 4HK0A 1FH5L 2VDOL 4FFYL 1A64A 5I1IL 1YNTB 5DJDB 1A6PA 3IFOB 1KC5H 1JGUH 5ICXB 4L3CB 3CVHB 5HDOA 2X4RA 4U1IB 5FKAB 2GFBA 5T1LB 4XRCA 3PE9A 5I0ZA 4KPHH 4LCUB 4ZPTA 3D0LB 1I9JH 3IRZA 3I3DA 1T20B 4G7VH 4XVSL 2H2SC 4GRWH 4ODHL 2VMFA 3TZVC 3C09B 3UTSA 1MCFA 1QFUL 3K1KC 4FXLA 1GGCH 3JV5A 1F4XL 3BW9A 5GGTH 4YWGH 5M94B 3L3DB 1MVUB 3SGKA 1T6VN 3ZTJG 4XHQA 4Y16D 2VR5A 3NZHL 4K3EL 4LF3A 4WWID 4AM0B 1K85A 3QO1B 4NO5A 5DD1H 2E6JA 4YDIL 2E9BA 3I84A 3CMGA 1L8JA 1NMAL 1NLDH 3MRIA 3S4SG 1Z3GH 2P7TA 1A5FL 3LB6D 1ZLSH 1GOFA 3VFOB 2VXVH 4PD4J 4JN2A 3P9LB 5EO9B 5FA3B 1KJ2A 1IJ9A 1LD9A 4JDVB 2BDNL 4LLDB 1JI1A 5HI5D 1LK3L 3KG5A 4UT9H 1TCRB 3SDXA 3JWOC 3QI9D 3D39D 4EIGB 2VL5B 4OGXL 3U46A 2FEEI 4WJ5B 1IC5L 3V6OE 4X9GA 5IMLB 1JNHA 3VXUD 4OLYL 3MUGB 5E95B 4LQ1A 3AFLA 2V2TB 1S8DB 4QOKA 4XNMA 1JFQL 2XA8H 1MAMH 3RDTC 1RIUH 2HT3C 3O3EB 5JA8B 5CGYC 1EZVY 3G5YB 3QSKB 3GSWB 2ARJA 1WVZA 2C26A 4G8GB 2QSVA 2VOTA 4AY0A 3B9DA 1QFWH 3ORJA 1NC2B 5GRWA 2I07A 5EB9A 1Z0NA 3QIUB 1DZBA 1J0KA 4WDIA 2GYSA 2ZCKL 1IGJB 5BCAA 3KYMA 1FJ1B 5BV7H 5EU5B 4CVXB 2C3XA 3HE7A 3HI5H 3LPFA 5SWZD 1ZLVK 1A4KB 3SCMC 1BQHB 3VI3E 5IFAH 1Q0YL 3HUJE 5CEZH 4ONGH 4M7ZC 4NFBA 2X4PA 1GIGL 5ETUA 4KJWD 3ARDA 4QHLA 4GQPH 3RL1B 2Y06L 2AXHA 4X98B 2D03L 1U8NB 2YK1H 5L2JA 3MMEA 4G9DB 2HFFA 3OKNB 4HLZH 4NQCE 3WS6C 2AW2A 1PKQA 4JB9H 3MV9A 4U1IA 5C08E 1FN4A 4XP9H 1IC5H 1HXYB 3SKJH 4JVWA 2PXYD 3U4BL 3C8HA 4MNQB 2FO4A 3MLZL 4H5SA 4MA8L 2VLJE 1A9EA 1GZPB 3LS5L 4WU5B 3RTQC 5T1DH 4TVPE 5DZOA 2EDWA 2H26A 4GAJH 4JPIB 4MAUH 3SGEH 3WIIH 3SPVB 5HD8C 2OL3B 3IAGC 3EYUH 4KWUA 2A6JB 1JMZA 5BXFB 4HJGA 2VITB 1UM5H 2IANE 4QXTB 4O58L 1UQSB 3SDYH 4MVBD 1U3HB 3TBVA 4Z7WB 1BIIB 4NKOB 1P7KB 5CUSL 1KIQA 4JQXC 3ARVA 1MHPH 3TBYB 4J1UA 4OIAA 2FJHA 5IW6A 4QWWD 4JFHE 1FNLA 3VW3L 4U6YA 1TMCA 5F3HB 4U1HB 5F9JA 4Q9QL 1GZQA 4PRPA 3DARA 1BQHA 2EKJA 3ARGB 1VDGA 2IGFL 4YBQD 5FUCE 2Y6SD 3MV8E 3P4OA 3FN0L 1B4RA 2BY2A 4OQTH 2VWEC 1MI5E 3O3UN 5GS3A 2KQMA 4PJHA 5F1IA 2E3VA 4HLZG 3RIFF 4U6VH 1NFDE 3BO8A 2ATKB 4PY7B 2IBZY 1SMOA 2GKIA 3MRLA 2ZNXA 1YEEL 3FCTA 3SE3A 1HWGB 1X5IA 1FRGL 2ZOLA 1NCDL 1C7SA 1ZLUH 1CD1A 1OCWL 2VN7A 4BZ1H 2RFXA 3ARWA 4JHWL 4ZQKB 3KPMB 4ZS6C 2NZ9C 3WDJA 4L8DB 3QCUH 5IHUH 4M93C 1HKLL 3H6JA 3L9RB 4MQTB 2R0KH 3TO4C 4DGVL 4DAGH 4PJ7A 2OX5A 1EVUA 1CICD 5J56B 4QY8A 3QXAA 2Q8BH 3LRSA 5D1XD 1WEJH 2ENSA 1G9EA 3SJVA 3VXUB 5MEQA 5FUOH 4L5FL 3HPLB 3VJ6B 3SGKC 4I0PA 3TWCH 5CJ5A 2RQ8A 2P5EA 3GHEL 3UZVB 4QWWC 2NLJB 1PBYA 4XB7A 4KKBD 2P5WA 3C5JA 4FABH 4NCDA 4PJ9B 5C09A 3RUGE 5JHLL 1UACL 1C12A 4MZ2A 3TZVD 1GPOL 2B4CH 5JW4Q 1W2KT 5MHSE 4Y5VB 4P46C 5GSRB 4MJ2A 2VKXA 4DOHB 3FOLB 2GTWA 4PJGA 3L5JA 5EBLB 4Z7UF 3ULUE 2AXFB 4RISH 4UQ2A 2ZCHL 4TQEL 4FNLL 2F53E 5DD3L 2DLFH 1G7HB 4M5ZL 3P4NA 2DJSA 1ZA3A 3SDXB 4V2CB 4BK5A 3PL6B 2JE8A 1Z6JT 5E2WH 3MSPA 4NCC1 3NFNA 4LLDA 1MFAL 1MREL 3QEUB 4DW2H 3EYVB 3NCYS 4BELD 4XP5L 1KGCE 1I1RA 3UZQA 5BRZB 4XXDB 1T04B 4PJ8A 1CD0A 3FAXA 4PJEF 3O2WH 1BFVL 1T2JA 4G6JL 2ZSVA 1BJMA 1H9VA 4PRHB 4FOMA 3M8OH 1ACYL 2AJSH 4L3EE 1YJDH 2CSPA 3PABB 1R3LB 2Y7QA 4Q9QH 4OCYL 2ADIA 1I1YA 3QEQA 2QSTA 5GS2H 1JHLH 3IJYB 4K94L 3W2DH 1YUHB 3HMXL 4BM7A 2VLKA 2YUZA 4S1DD 1FNFA 5JHLH 3I50L 1RHHA 3HZYB 2ITCB 4UMGA 1I85C 5BMFH 5LWYH 4G9FD 2DLEA 3ES6B 5IWLA 4PLKC 3ARBD 1CFTA 3F5WA 3VWKA 2DMKA 1E4XL 3QIBB 3X11B 3A67L 3VXSB 3MXWL 5I1KH 5DFVC 1BQUA 4Y4HC 3X3FH 2JJUA 2XY1A 3NFSL 5T3ZE 5HDQL 1X9QA 1E6OL 4MS8C 3RJQB 5D7LB 3GGWA 4PJHF 3HLAA 5B38B 3G5YA 3LN4B 2ADGA 1BQLH 2ZCHH 3Q6FB 4TQEH 5DD3H 1MFBH 4QGTA 2VDRH 5E1AA 3BE1H 3BUYB 2ZCKH 3RVUC 1H15B 3DO3A 4NC1E 5BV7L 2EDOA 2LABA 4MNQE 4EOWL 1A7BA 4YXHH 1RK0A 3IETA 4ONOA 1R3HA 1FBIL 1ZOXA 4FN0A 1MWAH 4PP2A 1FVCB 1IAIH 4KJQD 5GGVH 1QPXA 3SGEI 4OIBA 5ISZD 2D2OA 5HGDA 3QHFL 4ELKA 3SDDB 1V7ML 3TP4A 3VRIB 4BZ2L 4UU9A 4JQXA 4AEEA 3D0VA 1NCCH 1BD2E 4LRIA 2CK0H 4EI5B 3BISA 4LCYB 4HUWB 4D3CL 1T5WB 2MMXA 2QTEA 1MUJB 3BPLC 4S1DC 5F96H 1IFHH 3QCTL 2FGWH 4Y2DA 5I8KL 1YZZA 3BIKA 5I6XB 1BOYA 3S3JA 2WLYA 3MBEB 4JPVL 3EYOA 1B2WL 5E5UB 3RZCD 4ACPA 1KN4L 5SV3A 1YMHA 4ZFGL 1T66D 3MV7B 1XF5B 2DQUH 3V6FA 4YXLL 12E8H 3RBGA 3RWEA 4PBVC 3FZUC 3UTSB 1N7MH 4LU5H 1B6UA 4HSQA 5IB1B 4EN3C 3N9GL 1UM5L 4QXWA 1PYWB 1MNUL 4JRYE 2BNQD 1R3JA 3X12A 1D9KA 3O6LH 1MRDL 2BK8A 4H5SB 3U0WL 3D3VE 5A2FA 2ZSVB 5B8CC 2Z8SA 1KIPA 2BC4B 1CGVA 1KNOA 4OD1H 5IOPA 4GRWB 5TQ2L 1ND0A 4MX7A 1T1ZB 4LCCA 2NY2C 5C3LD 3AU1A 1DE4B 3ULVE 3DX9B 2EDKA 5IV2B 1SY6L 3O3EA 4L4TB 5MENA 1ZVHA 4Y4FD 1N5AA 4AQOA 4RA0C 2VDQH 3MRBA 1HIML 2MHAB 1NKRA 2UUDK 5C0RH 3K4ZA 3WUWG 1P6FA 4QHKJ 2KBGA 2VDOH 3B2UC 5SWZA 3NBNA 2P43B 5DJ8B 1G7MB 4QRPD 5L7XL 1ZGLM 1BF2A 3PQYA 3FFCA 5D1QA 3EW3B 3S5LB 4MA7L 2V5TA 4J4PA 4AYFA 3IF1A 3OKKB 1AKJA 2QQNH 4NWTL 4P3DB 3ZT5A 1DBKL 3X14A 3EOBB 4G3YL 5F7DA 4F7TA 2R23A 5GSVB 2Q7NA 2NPLX 3ZSSA 4B41A 2W60A 4G59A 3S36H 1FIGL 3QIUA 2V9QA 4QLRA 3BFOA 3I3BA 3JTSA 1KPUB 4RMQA 4IDLA 1ZLWH 6FABL 1RZJL 1IKNA 1DDHA 3TN0C 1M05B 4PJFE 3D39A 3U0WH 4GW4A 2AJZA 3O11B 5FYLE 2GK0B 5J7CC 2BNRE 3UTTE 4FABL 5EFIB 1TJGH 2AKRA 5B38G 4X6BB 4PREA 1ZWIA 4Z7OE 3O8XA 1XIWA 2QKIA 4EEEA 5DQDH 3QIWD 3F7RA 3QFJD 3E3QA 1QSFD 4U6XA 4EZMA 3NVQA 4LIQE 3B3IA 5I30L 2DL2A 4MNHA 1VHPA 3PL6A 2IAMA 1H8SA 1NLDL 4M8QA 4X6DE 1N2RA 4YDLB 4JDTL 4I3RL 2FH6A 3GK8L 4O51A 1LO4L 4K7PL 2DQGL 2DWDA 5DA0B 3VFNA 3NTCH 1UZ8A 5C09E 4JQVA 3RUGA 2VAAB 1MAJA 4D8PB 5I1IH 3IGAB 3VI4E 3PQYB 4Y19B 1S78D 5IWLC 5D9SB 1MFEL 1FFNA 2UVEA 4OBSA 1KV3A 5F8RC 3PWVB 3QB7C 4U1HA 5F9JB 5JXEC 3MOQA 3EGSB 2XRAH 1CS6A 2F5AH 3CU1A 4KAQH 1NLBH 1X6NA 2PYFB 3GI9L 4TUKH 1S9VA 2AV1A 1OGTA 2ITDB 2OCFD 4N1CA 4PRHE 4GKNA 5CCKH 5F72S 5EPMA 3CSPA 4N8VB 2UZIL 4OKVA 3RTQB 1WT5C 1U42A 4A6YA 1LE5A 1I1CA 1IZJA 1QSFA 2CRMA 4X6BA 3F6IA 5E7FA 1N6QL 1Y0LB 3PJSB 1E6JL 3IKCA 4WWKB 2X70A 5BQ7B 4OUUA 1LEGB 3LSOA 5DHVH 3EOAA 5TPWH 1HHJA 1TTGA 1NAMH 3KYKL 3QWRA 4M8VA 3HMXA 1UZ6E 3VA2C 3FQWA 1P53A 1CBVL 1VFAA 4LSTL 1A6VH 2PNDA 1HYSC 2X1PA 4FXGA 2WIIB 3ARFC 3GIZL 3H9SD 3ZHLA 1NGXA 2I5YH 1AKJD 1RIUL 3MLTA 4U3HA 1BVKA 2E9IA 1OTTC 4LRNL 2IALB 1HKFA 1YECL 2R1WA 4XXCA 2EH7H 3IDJA 4LLQA 2JJTA 2DAVA 1SM3H 2I9LB 2DDQL 4APQB 3GMRA 1JNNH 4FNLH 4Y2DB 3HC3L 4DEPC 2R69L 4Z7VA 2EZ0C 3V4VH 5F44A 3QJHB 4V1DD 43C9B 1KCUH 7FABL 4LGRB 4F9LC 1R6VA 3QHTC 1INDH 1MLCA 5F7UA 2K9UA 3D0VB 5F9WC 1JZ3A 4GBXD 3RKDD 3O3AA 2VXSL 3VD4A 2NR6D 3EO1A 3LQZB 4QRRD 2C1PA 3I6KA 4MQ7B 4WV1B 1I8MA 4GO6B 3VGHA 1MH5B 1AHWA 1IILE 3ZKXC 3GRWH 4YGAB 5F6HJ 1WBYB 2VZUA 4HBCL 3FMGH 4G5ZH 5EUOF 1T89C 2C4FU 4NO0B 4HKZB 5L8LB 3DRTA 3O4LA 5GZNC 3WFBH 4AQ1B 3SE4A 3BIKB 1QSVA 3V0AC 1WBZB 3VFGH 2ED8A 2CK2A 1AXTH 4HDIB 3AU1B 2DQEH 1QSEE 2XN9B 3GMLB 4NQVB 1NGWA 5J8OA 1SBSH 1NCDH 4U1SB 3RZCA 1TNNA 3OXRA 3MGTA 4KVNH 3H9ZA 3WJJC 1G7IA 3QUMA 3BQUB 4M1DL 3HZYA 3CLEH 3MXVL 3R4DA 4PRIB 3QI9B 1YC7A 3JV0A 1A4KA 3ZLQC 1OSZA 5FOBB 1D5MB 2PCPB 4YWGL 1Q9LB 4IJ3B 1AGFB 2VXQL 5JW5A 2IPTH 3O3DA 1M4KA 4RQQA 3K2UL 3UJIH 5E5MB 1BFOA 1OOAA 5ESQA 1RJYA 1IQDB 2VDPL 2RJMA 5T3ZD 2I60L 3MA7B 3V6OA 3GJFH 2AK4B 4PREB 2LTQC 4HX1A 5DDHA 2VYRE 4NDMA 4WW2B 4KQ3L 1CF8H 3HR5A 4OLUH 2L4OA 2Q86B 1A7PL 4NZJA 4F15B 5E0QA 3V5HA 4UB0H 3DRQB 3BMVA 2J8OA 3LZFL 4OF7A 5GZND 3UPCA 2KL6A 5FO9B 2VZSA 4X0KA 4IOFD 4D3CH 2DL9A 5ISZE 1VA9A 4F7CB 4KGJA 3VMOA 2J6EA 4MJID 1ODAA 4TPRL 4X9BA 5E8PA 5EZLB 4KRNA 1JWUB 3QPQD 1NC2D 4KDTC 2GY5A 3VXMA 1QLEL 3OWEA 3CIQA 2XWBA 3BXNB 3LAFA 4P5TC 1IMHC 4U1JB 1J12A 1QFUH 3EJZD 3T1FA 3IFNL 5IVOA 3GMPB 2XQYG 3N50A 1WIUA 3EYFB 4P57B 4LSDA 5IQ7L 3IDNB 5I1EL 1QTYT 3EYQC 3KPOB 4C83B 3Q5OA 4O51B 1I9IL 2R56H 4BUGA 2BNRB 2I07B 1GJIA 5JIHA 3DROB 3HMXH 3Q1SH 4M7LT 4RIRB 1S78C 1IAOB 4JFZL 4TNWK 1UJ3A 4ODXA 4Z18A 2VLLA 2VB5A 5HDBF 3UJIL 4J8RA 4ODBD 4XNUH 5ERWA 2AJSL 1VGEL 3QA3A 4HGKC 3DVNA 4N0YH 5CWSB 2HYMA 4JRYD 4ONGL 4HWEL 5HXMA 1EO8L 1KIPB 4Z6AT 2DD8H 2GFBB 4X80L 1QP1A 2BDNH 4X5XB 1IVLA 1CT8A 2RGSA 2AJXL 1NGYA 2CO7B 1HXMA 3I50H 3TBWA 5HDBE 4WHYH 3MV01 3REWA 3TNMA 2ILLA 3HAEG 5SWSB 4C56A 4WO4D 5JXED 3FONA 4HCRH 5IQ9B 4LPCA 2Y5TA 3G5XB 3F7VA 4JCMA 5F88A 3AXLB 1INQB 1PY9A 1OGAB 3NPSB 3K2MC 3MRDB 3HG1D 2JIXB 1HCFX 1QSFE 2MQ3A 4RSVA 2R4RL 3LS5H 5E6IA 5F7NC 4AENB 2X4SB 1WJ3A 4PJHB 4MDIB 1A4JB 3HPLA 3K4DA 2CKBL 2BVOA 3TZVA 1TQCB 3S5LA 3L95B 4Q6IC 2HN7A 4XWOC 2FL5A 4NKMB 1S7QB 5FA4A 1UB6B 3QUXA 2L7JA 1IAIL 4ZAKD 5CP7A 4KZEH 4P3CL 5KANI 5CP3H 2NW3A 4CW1B 2V2XB 1QLFA 3BD3A 2BSED 4K94C 1U95B 3SJVD 2Z31C 3TNNA 1Q94B 4LLMB 3T0EC 2D03H 3T77B 3L9RA 2OTWA 3I85A 3NCJH 3MRPA 2CDGA 5HGHA 1LDPH 5DYOA 3KYAA 3RVXC 2AJZB 3O11A 4BQ8A 4QRUA 3R1GL 1P7QD 3CUPB 2BJMH 3MV9B 4NWUH 3BPNB 4PR5A 5CZXC 2EECA 1YECH 4NCC2 4HZLA 5A1AA 4M6MH 4C57C 3U36A 5E6ZA 4L3EA 4UT7H 5DTFB 4RCAA 3TO4A 2B2XH 3VD9A 4PTUA 1C1EL 2HG5B 3BO8B 3F8UB 3EOTH 4K7PH 4XBEH 3VXOB 5GGTL 4CVZA 2PXYA 2PTVA 5DD5H 2PTTB 4NYLB 4MAUL 3E3QE 5EU3A 3WIIL 4NJ9H 5ID1A 3S7GA 5I2IB 5EC1A 2FJHB 5IW6B 1J05A 4OFKA 1W0YT 3IKKA 3KPRE 3QHZL 1KTLB 4OGYH 3ZHDA 3HS0B 4GG6A 3VMPA 3WDIA 3L3DA 4NKOA 4LSUH 3NCEB 2VC2H 2R2BB 3KDMB 1GZQB 3FQXA 4HHAA 1HSAA 3CFCL 2I25N 2RAMA 3SDAC 4EBQH 3CPLA 4JPKH 3V0WL 1KB9K 4ZXBA 2XXCB 4OIIL 3PWVA 4GMTL 3KYOB 4UDTA 4WI7A 3RVUD 4NM4H 2KZWA 3LD8B 1JPGA 2P47B 3VG9C 5ESVB 3MBXH 2Y07L 1HXYA 4PGJA 1LEIB 3HZVB 4Y16B 4YUEL 3G6JE 3IAPA 5L88H 3TCXA 2CD0A 3FFCE 2JK5B 4AT6B 3C5ZA 4XI5C 4C56B 1D5XB 4AG4H 2DMCA 2LE9A 4G6AC 3S8WA 2E7HA 2D7NA 3CZFB 3MR9A 5H35B 4FQHA 5HHOD 5CZXD 4QHMB 2OS7A 4LLUA 3MA7A 3DV6A 1R5WA 3GSRA 1UENA 3RJDA 1UWXH 5IEKB 1H15A 3L3JA 3GJFB 3ARDB 3RL1A 5I75B 3RWFA 4W68A 4XP1L 3G5ZA 4WJ5A 4J1UB 4Z7OF 3UBXI 4UIMB 5DD5L 2Z8WC 3ULSB 2OXGA 1TENA 4XWGH 3GMNB 3C6LB 4GKZA 5D7IF 1MIEH 2FECI 1NMBL 2C3VA 3VXQB 4H25A 1MCDA 4HMDA 2X05A 3OBAA 4NSKA 4R4BA 3MGTB 5HBBA 2C1OB 2FBJH 3ZZ1A 3C2AH 3VXPB 2HFEB 4YHMH 4HC1A 1LILA 1DSFH 2BCKA 3DOSA 3HE7B 7CGTA 2P49B 2ICCA 4X5LA 2FIKB 5SX4I 2BVEA 2HT4D 3Q5YA 3ULUF 3IS0X 2QSCL 15C8L 4PGBB 4GAYA 1JWUA 4LLYA 4MXWH 5LAXA 3S97C 3FRUB 2AGJL 5EZOL 4DKFL 1R3HB 4HX1B 5DDHB 1V3JA 3KLSA 4IOFC 2VSCA 4JZNA 4LIQL 3E0GA 3PDDA 4OGZA 3OGOE 4NNYB 1CDBA 4AT6A 1OL0A 4WWKC 2QQKL 3D1MC 5BMFL 3BZEB 4OD3H 2H9GB 3QWOB 5C0BD 1KTKE 4FMKA 5A40E 4HBCH 1DL7H 3IXAA 4OCXL 1IL1A 4M5ZH 1CU4H 2V6HA 2I24N 1D6VL 1QR1A 1M71B 1QRNE 3R8QA 3FB7B 4QTIL 1FG9C 1DQDH 2XRAL 5IOPB 1F6AA 4J4PD 1Z5LA 2ZUUA 4YR6B 3EYQD 3WFCH 1OAQL 2IAMD 4FXKB 1HEZB 3LHPH 1RSFA 3KJ6L 4RMTA 4D0DB 3VW3H 1J1OH 1ONQA 3UYOD 1ZT7A 5JLZB 4JFEA 1QKZH 2FBJL 5IFJB 3H9HA 1AGDB 2DQDL 1J7VR 3OKOA 3SN6N 4NQEA 4OZ4B 4APQC 2V9TA 4ZUVB 3KR3H 1ADQL 3D3VD 4HXBH 3HNSH 1HK6A 4H8WH 1BECA 3FO0H 4L3AA 5ALCH 1U3HD 4ZFZA 5D7JB 4ALAH 1NBVH 3IAQA 4EN3A 5I0DA 5DD6B 2Z0BA 1YEHH 2IG2L 1XCQB 3BP5B 4MA3B 3UBXB 3UTSD 4D0CB 5I1LA 4GW5B 3EYVA 2CDFA 4LIQH 3SKMB 3ARGC 1DE4A 2JB6B 1W72B 4WV1C 5EULV 5I1CL 1N64L 1I9JL 4G7VL 1S7RB 8FABA 1AC0A 3AS1A 2EDXA 2YD1A 3MRMA 1UZ6F 5ICZB 3HI1A 1X44A 2XNAA 3GB7B 4PV8A 2CIKA 3QDJB 5ADOL 3DTXB 1WEJL 2PXYC 3B6SB 4PRNA 1HE7A 1IGCL 3VD3A 4KRPB 4TPRH 2DBLL 4XCYB 3BP4B 1MOEA 3QUZD 4HKBA 3ARED 4Y4FA 1BEYL 4Q6YA 1YMMD 5GGUB 4QRTA 2YRLA 2G75A 5GISH 4OCLC 2XWJA 3PP4H 1NC4B 1S7UA 4Y5YB 1JI2A 3EYOB 5HD8D 3ISWA 4Z77B 1ZGLB 4P48A 5GS1A 3VFNB 1E4JA 2PTTA 4NYLA 2GJZA 3BP6A 3MC0A 4J7RA 4PJGE 4JHAL 4R7DB 4TYUA 4KROB 4N0RA 4RMSA 4YHLH 3VXSE 3VFMA 4CMHB 1IRAY 2P8LA 1HHHA 2HH0L 2IC2A 2YD8A 4PJ9C 3B9EA 5T3XH 4UUJA 3MRNA 1I8KB 4XVTL 4ZUWA 3A6CH 3GNML 2Z4QA 4L3ED 4OCXH 1IM9D 2CLVB 5I19L 4W6XB 1OAYL 3QISA 1MWAA 1AQDB 1VPOH 1JNLL 5KSAD 3DVNB 5DRWA 4ZDHA 1T0NB 4JRXA 1RULH 1M7IA 4MS8A 3ARZA 4UILL 2AXGB 4A6YB 1VKXA 1PKQE 2HWZH 2YEZB 4RZCB 2AEWA 2CMRL 1JHKH 5T5FH 3S37H 1N0XH 1P84J 3PL6C 3WN5C 4OLVL 1NBZB 5BW7C 5EBWA 5CINH 2BFVH 1CG9B 1OAZH 1W0VA 1HZHL 4MJ6B 3O3BB 1C08A 1HILB 1UXSB 4XP4L 4F57H 5I76B 4LLVA 2X44D 2DM3A 3EHBD 3VXQA 4HK3N 2X4QA 1LE9B 2ICWJ 2XPGA 1VFAB 3I3EA 4RFNC 2BHZA 3T2OA 5TFSH 3BZ4A 4YFLF 1WZLA 2PTUA 4B53A 1RJLA 3IJYA 4O4YH 4WW2F 1GYAA 5FUCC 2APBA 1IEBA 2V7HB 1A7OH 4DN4L 3GSRB 4KY1L 5FKAA 3ECBB 5E2UH 2NY7L 4P2RA 1RZIA 3OKYA 4R90H 4G3YH 3NIFE 5EA0L 2GJ6A 3G04B 1UA6H 1W0WB 1NGQH 4PGEB 4WVRA 4X6CA 4MX7B 5K9OB 2FH8A 1GGYA 3RHWK 1JHTA 2H9GA 3LDBC 4XBPA 4OFDA 1ZHKB 3E6FB 3MOBL 3QNXB 3HPJB 3MLWL 4XCEA 4RX4D 1CLOH 4JG1H 1R3IL 1ORSA 3Q1SL 1U8JA 3LKNA 5FXCH 4O9HH 1V7MH 3QNYB 4GW1A 5E56A 2FHCA 4BZ2H 1CR9L 5HJ3A 1AGCB 1D5BB 2C3HA 2DTMH 4H0IA 4IRJB 2EYSB 2Y36H 5C0CD 3VD5A 3T4AB 1F6FB 4A6YH 4Q0XH 4JR9H 3TF7C 4J23A 1EO8H 5MI0C 4X4YA 1OTSD 4JFEB 5E8EA 4V1DE 2DLTA 3SDDC 2AP2A 1OB1A 1OQOA 3CD4A 3CXHJ 4JDTH 1YJDL 2UZXB 1P9MC 4JFQB 3VXMD 4WW1A 3NTCL 5KBNC 5CJQL 1LO5B 4ISVA 4XNXL 1I8LC 2OZ4L 4MD5A 2IQAB 3L3KA 2NW2A 4QRRE 4EUPG 4X4XB 5FEBA 1IAKA 1DBML 1EEUA 4WV1A 2B8OT 3B9KC 1T5XB 3I9GH 3ALWA 2E7MA 3CSYB 4UQ3B 2KUTA 1G9NL 1WBYA 2VL5A 4NOBA 3QQ4B 4YGVB 5JUEL 2Z35A 1KB5B 3OPZH 4CRPA 2VISB 3CNKA 2X4OB 1Y6NR 2MKWA 3EZ8A 3P9LA 4GBXB 3D2UB 3O6ML 1KJMA 2ZOLB 1BVLB 1ADQH 5E9DD 1A9BB 5I76A 1KB5L 5GIRB 2QADC 1ZANL 2ZOKA 4J3TA 4XPFL 1OP3H 5DI8A 4JGMA 1XGUA 3IT8D 1KSRA 5IMKB 2ZUXA 1Y18A 5IBLD 4UV7L 3HE6C 1BMGA 3DLQR 1ZS8B 4HUXB 1I7RB 2VDLL 3IU3B 4G8EB 3O2DH 4ZO9A 4HKBB 1U91A 3CJJA 1RUQH 5C0FB 5FGCB 3GSNB 3D9AH 5DUPL 3VGBA 3NIGE 3D25B 1R0AL 4L4TD 4QHLB 3IXTB 4U6XB 3VFUB 1TZGL 1DBJH 4O02L 4MCYB 3GKWH 3WFZA 4YHPB 2H6PA 3O4LD 4DZBA 2BRQA 1CFNA 3MACH 2EDBA 4N5ED 4Y7MA 1ORSB 1K4DB 4XBEL 3VFMB 3UYRH 4QTHB 4JKLA 2DQFA 2PR4L 5F1NA 3ILPA 5FYKE 1OW0A 1I3UA 3D5OF 5INDA 4QRRA 1IM3B 3LV3A 3ARDC 1FNAA 1GC1L 1MCNA 2FLRT 4ZTPL 3BIBX 3VG0H 1FN4B 4QXGL 3GEWB 4WEMB 5SX5H 1YNLH 1MI5B 3C6LC 4MQSB 5A16B 3W0WD 5DEZA 3WS6A 1MRFL 3O3DB 5DSCB 3CFJB 1CWVA 2HH0H 5C08B 1HHIB 3HC0A 4NFDA 1TCRA 3I6LE 2L0DA 2Q20A 2J6EL 4GRLC 2X41A 4UTBL 1G9MH 4DGYH 4ZUSA 5AD0B 4XAKD 1TLKA 2AJVL 2YUVA 4KQ3H 4YJZL 2VH5L 1OD7A 3QDMA 2PO6D 1DFBL 4WTXA 3NGBC 4C54A 2IBGA 1R3LA 1U36A 2IANB 1HHGA 3TPUB 4JEGB 3SOBL 3HNVH 4LVHB 3KPTA 3M45A 1C5BL 1FVDB 1T7VA 3QP3A 5TDPB 3OXSA 2IWGA 2X4TB 4WNQA 5DVMA 4NRXA 2SEBA 5KOMC 1HH9A 1JGVL 4WIQA 4LP4A 3VCLB 1FBIH 1BOGB 3BJLA 4JY5L 4KV5F 4IHOA 1NGYB 3TBWB 4JRXB 4XXCC 4NN6B 4XPBL 4U1GC 3S9DB 1D5IH 1KCGC 4XPAL 3GBNL 3KPSB 1KFAL 2VR4A 4XMLL 4YXKH 1A7RL 3MLRL 3MODH 1OTUC 1NFKA 1S9VB 3LKQB 1DBBH 1QA9A 2J7LA 1MY7A 3ROLA 1BFOB 4XNYL 2YC1B 1RK1B 4P2OA 4KK5D 3EJYC 5J4MA 2MTPA 1XGTB 4MYWB 4QXGH 4H20H 3QXWA 3NACL 1H3TA 3QCTH 5CJ8A 3BP7B 3SKOB 2R29H 3CFKA 1NGZB 2NX5D 4KTDH 3IFLL 3RHWF 1G6VK 3RVWD 1TZIB 4P59L 5CZKA 3PHSA 4GRLD 4QRQA 1CFVL 1MHEA 5E2TL 2DQIH 3OB0H 4E5XA 4BH7A 5D2LF 4P5MB 5D72L 1LP9A 1QO3B 4Y4KA 2W0PA 4QOKD 4U1JA 2M2DA 2G75B 3QH3B 4D0BA 1F8TH 4Y8AA 4EDXB 1FG2A 3K1DA 4IRSC 3SJVB 3VXUA 5MEQB 2IQ9L 3UTZB 1I8IB 5GZOC 3SE8H 2EEBA 1BIIA 4ZAKC 4N8VG 3UTPE 4P9MH 2QR0A 4MB5A 1P7QB 4HPOL 2YWZA 5LXGL 5BZDB 4M48L 4H8WC 5IK3B 1AO7B 5I1JL 2W38A 1RZ7H 2Z31A 4U1LA 1KNOB 4DKDC 2X4UA 5IHUL 3O2DA 1F3JA 1I8KA 3MRNB 5FV1L 5TH2B 1SY6H 3QAZB 4DVBA 1DBBL 4NQUA 3RY6A 2MCG1 5MEPA 5I71C 1G7HA 3GJEA 5HSFA 4LSVL 1CFTB 3TJEH 2AXFA 2FATH 5DGRA 2AGJH 5TF1H 2VZOA 4XC3H 2NY3D 3FQXB 3QQ4A 4GXUN 4K8RD 4YGVA 5FOBA 2F8XC 2FJGB 4OQTL 3TNNB 4NQXB 2HFGL 4I18B 1GPOH 2B4CL 2XWBB 4X7TA 1JZ6A 1G0DA 1R5IA 2DQIL 3CPLB 2IPUG 2VN4A 5T5NG 2J8UF 2GCYB 3HNVL 4HXAH 3F7QA 3ZKXB 1G9NH 5GGRA 3PABA 1T83A 3O3BA 4YFLI 1MHCB 1VESA 3MYJB 2Q7YA 3ROOB 4E41E 4U4BA 4M1DH 1JPST 5DUML 1B88A 3U36B 5D4QA 2I9TB 1XAUA 3U7YL 3C8KB 3VXOA 4FQLL 4ETQB 4ONHB 1FGNL 5E2WL 2W1NA 3MLRH 5JMRA 3V7AG 3RBSA 5F7HA 1AP2B 1YEFL 3KHOA 3MCLL 4LRNH 4U2YA 1CGSH 1EUTA 2YD9A 1VFOA 5GQBA 2XZQL 3IJHA 5EIQA 1FO0B 4F9PC 3LEYL 4XH2A 4G6JH 4PS4L 1A1NA 3V6ZB 3WFHB 2Z93B 5IHBA 1KT2A 1CL7L 3QDJE 1F4XH 3UTTD 3X17A 1T7YA 2N7BA 2DTML 1ZSDB 4TUOB 1FDLH 2IPKB 3IFPA 2GK0A 2XKSA 3ZE2F 4L4VD 1KJ2B 1K3IA 1IC4H 4MZ3A 3MBXL 2VDML 2DQJH 2BNQA 3CXDH 3C87A 2ZUQC 3GKWL 3N1GC 5FCSH 2FHFA 1XF5A 3V6FB 3HKFA 1MEXH 3TO4D 5BS0E 5FGCE 3CLFL 2YPLD 1QHPA 2FIKA 2XTJE 1UJ3B 5JORB 3HFML 3HI6L 1X5XA 1GGUA 4I5BA 2BVOB 4P49A 4PJXA 3GNMH 2NY4D 1RV6X 3RAJL 1UGNA 5JNYA 1FVEA 5TDNA 4N0UB 1E6OH 3E6HA 3BJ91 1H3VA 1ZT1A 2YPKB 5J9PA 4HJJL 4QO1A 4DVRH 1Q94A 4GS7C 4WHTA 1I1YB 2DLIA 4IOIB 1HQRB 2GITB 3BZFA 5C07B 3HN3A 3V4UL 4KJPC 3VFSA 3F7PC 5C0ND 3VWJD 3KPSE 1OAUH 4NNPL 3QUXC 3DROA 2CRIA 4WW1B 5E6ID 1XR9A 3UBXA 3TIEA 3ZKSD 4IRJC 5CMAA 2EDQA 4YHNA 3KYNA 5EU6E 3H3KA 4HFWB 3PWUB 4YUEH 2BC4A 3MLXH 5ERWB 1N4XH 2HLFD 4HJ0C 3GBMH 5E2UL 3WIFB 4NBYB 1KN2L 1IQWL 3ARTA 4N0CA 1BX2B 3FRUA 3X14B 3OG6B 4L29B 2GSIB 5GGSA 4UOW1 4GG8A 1PG7L 1EXUB 1QBMH 1CVSC 3VDCA 1MELA 5F88B 4Y4KC 4F33A 4H25B 3GMQA 4CADA 3IJSB 3PHOA 4ZFGH 4QNPF 1P69B 2IEPA 3DUUB 4G9FB 4DGVH 1AJ7L 3O6KH 4WCYL 5C86A 1T3FA 4Q9RL 2C1OA 3NPSC 4JFFB 4XP9L 5T1LA 4MQXD 4NOFA 3S37L 3H42H 4M8QB 5IFHL 3B9KB 3UYRL 3TFKD 1D5XA 2H2PD 3WBDA 1C5CH 1NCNA 3G6JA 4PB9L 1SBBA 4Z5RB 4Y4HD 4NN7B 3L1OH 1R5WB 4Q6IB 3MRHB 3MJ7A 4JO4H 4OTXL 3UDWA 3DMMB 1B3JA 3KLDA 3MRPB 5B4MD 1MCHA 3QUZB 4ZTOH 3DXAB 5I8KH 2Z92B 4JFHD 3H9SB 4FQXD 1MEXL 4IDJH 3GBML 5E1AB 5GGSY 2D7TH 1MLBB 2KPNA 5ECJE 3GMMB 4GSDL 1RURL 5K9JH 4TRPL 3TN0A 2YMXH 4XT1C 4YXLH 4DZ8B 4HDIA 4N0UA 4X5WA 5HHMA 1BPVA 4NQSB 4TVPD 5D2NA 3AREB 5C7XL 2BSSA 2NY3C 2VXQH 4JREB 4PJ7B 4JDZA 5BS0D 4EI5A 5D7LE 1KC5L 4PRNB 3QEGL 2GT9A 5TQ2H 1QSED 2P5ED 4YAQB 5E5MA 3DBXB 4OCRL 4JZJB 1HKLH 5D1XA 3MBED 4M00A 4MD4A 1KFAH 2X7LB 4K71B 4N1HB 2C7UB 3O6FA 4F37F 1A7PH 2JLLA 2WINB 3RGVC 2FX9L 2JB6A 3EYSH 1MCSA 1X6LA 5GJTH 3UTOA 4D0CA 5I30H 5HYSB 4KK8D 1YDPA 1A6ZB 1I4FB 3NN8B 1SYSB 3T0ED 4JFDD 5FECB 1W72A 2O5XH 1FLRH 3EAKA 4TN9A 3QFJE 1FYHB 3EKCA 1KLFA 4HS8H 4P59H 3EOBA 4YZFF 4MNGB 2PYEE 1LK2B 4LPYA 4MXQC 5SWSE 3SY0B 3B5TA 3AVEA 4E42A 1HDMA 1QEWB 1CD9B 3DYPA 4NZTL 5BRZE 4K9EC 3H9HB 2FLBT 1MJ7L 4Z95H 4G9DA 1WFNA 2IPKA 1EEZA 4I3GA 2O61A 2EICA 1ZK9A 4JVUA 4HUUA 5DVOA 1KUMA 4Y4FB 1I8MB 5IMMA 4QYOA 5FYKH 5IP4A 4GLRH 3MREB 4U1KB 3WO3B 2XWTA 1YYLH 4FFEX 5C0AB 5DLML 3W9DA 4QXTA 2EYTA 3FRPG 2FNBA 1PZUB 4HWUA 4MVBA 1IFHL 4OZGB 1MCRA 4GRMA 3STZB 4LMQI 1ZHKA 4FQQB 4NN6C 1Z5LB 3CFCH 5TJWK 4OTXH 3WS3A 3ZYJA 5F70A 5C0EB 4PJCA 2VDLH 3QO0A 3OQ3B 4MD5B 5J11C 4HBQA 1CE6B 3P4NB 5DRWB 4RIRA 2W0KA 3VFSB 5FFLA 4NUGL 3F5WB 4PJ5E 3T8XB 5K9JL 3T0DA 3OKOB 1KACB 1JF6A 1SEQH 5L2KE 4N0CC 1FYTA 1BREA 3HLAB 4L1HA 4LBEB 3JUZA 3MRRA 3QCVL 4HJJH 5EA0H 3DMMD 3ULUD 3BESR 4CVXA 3CDFA 4MWFA 4DAGL 2BVPB 3JV4A 3TF7A 5F1IB 5JNYB 1YQ2A 4EUPB 1UXSA 3INUH 4XAWH 1FNHA 4N9GB 3CK0H 3WIHH 4XVSH 4OBRA 5IB3A 2V7NA 4JLRA 5D71H 4XPBH 3HG1E 4GLRI 1RZKC 3N1MC 1MVFA 5ALBL 5FM4A 4TVPH 4R7NB 1E28B 1FZMA 4KJQC 3S5LG 3IDXH 1RUAL 2NXYB 2Y36L 2IADB 1KCUL 7FABH 2JJVA 3Q0HA 3RTQA 3CVIH 4CDGC 2IG2H 3P77B 1DBAH 2OMBA 1N3NB 4HULB 5A2IH 2YN5A 5DR5H 4JE4B 3JV6B 3BRFA 1T1XB 4L9LC 2KZ1B 1YEIH 1KJVB 2HT4C 2YWYA 1MWAB 3DRQA 1GGBL 5C6TH 5E4IA 5F9DC 5E94A 3MYZA 5FO8A 1NPUA 3U9PL 1UB5B 4WUKL 5EOCJ 1NEZG 2PYFA 1H5BC 4MNGA 3MZGB 5JW5B 3MZTA 1WAAE 3DGGB 2DBJA 3FMGL 4J2XA 4WW2A 1KBGH 4LPWA 4H88H 2DICA 2NY7H 3G04A 1I1AD 3OX8A 2NNAA 2MNUA 3HAEB 1JRHH 3QULA 3CXDL 3VFTA 2NY1B 2ZJSL 1XF1A 3SCMD 3FZUD 5JOFB 4HIEB 4X7SH 3QPXL 3T0WA 1HI6A 4N1EA 2YPVH 4I18C 2F54A 1DN0A 3VXTA 4KMQA 3P40A 4L8SC 3MLWH 3WE6A 2FX8H 3HNTL 3W5MA 1N5YH 3VXNA 4LNRB 3V8CA 3VFVB 2D0HA 1ZHBA 1OARH 1MJJA 3S35H 3AY4A 3L3GB 3MNZB 5HY9B 3D85A 1OCWH 5ITBL 1RZKL 1GH7A 5IBLC 2PXYB 3EDKA 4LQFL 4ZODA 1W72H 3WN5A 3QCUL 4G6AD 2QSQA 5E24E 4WEUD 3VFWB 5DRXB 2XY2A 4PRHA 4HWBA 3T2PA 4NRZB 5CSGA 1GOGA 3UTQA 3MFFB 3EDDA 2ICES 4FFWC 4ZFFB 1WZKA 4P5KB 3G6AB 5JOPD 5EUKB 4APQD 2VZ3A 4XC3L 1NAKL 2BXYA 2CIIB 2BY1A 1K6QH 4U6HB 2ICWA 5C0AD 1UYWH 1W8OA 3FT2A 4XX1G 1T03L 1T0PB 3E2HA 5FYLL 1CL7I 2GIYA 5IBUG 3ARSA 3OKMA 3LQAC 3FFCD 5D1QD 1T5XA 5C2BH 2OZ4A 2VDRL 4S11A 4CUCA 1J8HB 5IVZA 4PJAB 2J8UB 4YDJB 5E08H 4X4XA 2ZUQB 5EZIL 5IEHB 1D5MA 5FA4B 5KVDH 1FL3A 4K3JH 3BYYA 4GFTB 1NEZA 1ZLWK 2ATKA 4YPJA 4PRIA 2N7AA 1UJ3C 1CFBA 5DJAA 1SJXA 5LGHH 1U8OB 1KF9B 5KS9A 3FAWA 1A3LL 5MEND 2CUHA 5D2NB 1KENL 5DJZB 5ALBH 2J2ZA 3OJMB 5E6YA 3ALXA 1QQDB 1KB5H 3S35L 5EBWB 1TITA 2DJUA 2YRPA 1U91B 3UYPA 2B4CC 1J11A 3BQUD 5GIRA 4U1NA 1UCBL 1IC4L 4UU9B 1YNLL 2GAZA 3B43A 1Z2KA 5HGDB 3O2WL 4QRUB 5EZJB 1S3KH 2FX7L 3O45B 4P2QA 5CEYB 1AGCA 1A7OL 4DN4H 3C9NB 2P48B 3MCKA 4MAYA 2YZ1A 2A6IB 4LPUA 4KJYB 3KVQA 2XV6B 4UTBH 3SDDA 4ZXBC 4NNXA 4Q97A 2X4OA 3WL9B 1IEHA 4D9RE 4FQIH 4PYHA 3ZE2E 5HGHB 3MV7A 4OLXL 2D9CA 4PRDA 2FL5B 5HI4C 3TYGH 4KI5D 4Z7QE 5EBMB 4G6ML 3L5WB 3CZJA 3ECBA 5GRUL 1PD6A 4JG0H 1DLFL 1QBLL 2GJJA 3C5ZC 5I8CA 2E9JA 2VZTA 1NFIB 4MDJA 4TSAL 1S7VB 1JPGB 1QO3A 4Y4KB 1Q1JL 2J5LC 1BFTA 4UDUB 4D0DA 1TJIL 2XWTB 1TETL 1F13A 3U4AA 3RIAK 3B2VL 5DJZA 3O9WC 1N0LA 5DMGC 3BE1L 4JJ5A 3B8SA 3MNVA 2AEPH 1R24B 1HXMB 2ESVA 1NBYB 3TIDA 5DMYA 4OV5A 4NNPH 3IGAA 5DZNA 2Y5TB 3F7VB 5HYIA 1GHFL 1XF4B 3OF6A 2F9BT 1BVZA 1H0DA 1N5AB 4HQQL 4DTGL 3HC4L 5F3BB 2WBJA 3WXWH 1YA5A 4J3XA 5LVEA 3MV8B 1NDMA 4R96B 1WC7A 1H5BA 1IBGH 3BRDA 1IM3A 1SBSL 4K2UL 4K3GA 3DMMC 3HB3C 3S36L 1HH9B 4R3SA 3LKQA 5CILL 2E8YA 5MP6L 5D71L 1FNGB 3BT2H 1HH6A 5E8DL 2H8PB 3U2SA 1CFSA 2HRLA 4M02A 1BD2A 4W4OA 5DMIL 3D39B 5E99L 3NA9L 5C0JB 1OW0C 4ZPVB 3JTSB 1DBAL 3BEVB 4YIQA 1E28A 1TJIH 4HWBL 3KXFD 1TQBB 3HRZA 1F90H 1L7TH 4LNRA 1LO0L 3B2VH 4F7MA 2Q8AL 2BSRA 1R3IH 3OAUL 2NMSA 4PJ8D 2NY3B 2BMKB 4KUZL 4NQTA 5FHAH 4LHUD 4GMTH 4HKXB 2EDEA 1T83C 4LCUA 1REIA 1S5HB 5CSZA 3CFKB 4DGIH 4MJ5B 1OGAD 3IFOA 1QR1B 1BJ1H 4PTUB 4TRPH 2V5SA 1FPTH 3N1FC 4DOHE 4XVUD 4RFOL 2UWEE 1C7TA 3I6GA 3WFHA 5GRVL 3WCYA 1JWMB 2CLVA 2NY5L 2R9HD 4Q74A 5IIEA 3GRWL 5B39G 3SE8L 1KTDA 3KNBB 4I9WE 4X6DF 3EOTL 3M07A 3JXAA 2K7PA 4M6AA 5ID0B 5DD0L 1KELL 4MCYA 1BF8A 3K3QA 3L7EA 2R0ZH 1MFAH 5TE7L 4O2CB 2B7DT 2VO5A 2I9TA 2E6PA 1EAPA 1TETH 5C9JB 1P6AB 3JWDC 5JOEA 1WUNT 1WIPA 1U3JA 1MCCA 5T1MA 3I02A 1KULA 5EU7C 4KROD 4OZHA 5D2NE 1S7TB 3LH2L 3LMJL 4GQ9H 2R2CA 3IVKB 1RIVH 3RDTD 3CLEL 5DFWH 5DVNA 5MEOA 2D7OA 1U9KA 5JQ6L 3TT1H 5DJAB 5MERA 2BHUA 3LVEA 1CFQB 4ELMA 1Q38A 4OCSL 3TO4B 2DMBA 4K9EH 4XMKH 4NQCD 4H0GA 2HAZA 4JO3H 1T7ZA 1PLGH 4RGND 3CFJA 4BFGA 1UM6H 1QZ1A 2Y6SC 3MGOA 3GI8H 3TFKC 4Y2OA 5IFJA 2FEDC 1YYML 4HXAL 1VEPA 1B0RB 1VB9A 1MJ7H 5DFTA 5JW4N 2EYRB 3V4PH 1ONQB 2F5BL 3TA3A 3CZFA 4KKLD 1EJOL 5H35A 2GHWB 4JQIH 4MNQA 2CIKB 2NY2D 2PKDA 3U9PH 1IZKA 5FGRA 5L0QC 2EIZB 5DVKA 1TZIA 5A2KH 1GGCL 4W6WB 4PJIB 1VENA 1BZ9B 35C8L 1T6WA 4TTGA 1FGNH 3RRQA 5CJOL 4M1CD 2XOTA 1FFQA 3JWOH 1QQDA 3O0RL 2XWJB 2KQNA 5DGQA 1NAMB 2RIKA 4JANB 3BP5A 4MA3A 4X98A 5FO7B 3UTZA 5KJRH 5L2KB 2JJSC 1VEOA 2YSSB 1LO2L 4DFHA 2XICA 3ARXA 3DUUA 1XZ0A 3V0VB 2AK1L 4EQ2A 3RY6C 3MRJA 2V17H 1YQVL 2VR9A 1BBDL 3TT1L 3WE6B 3KPSD 3WFEL 1ZVYA 1YY9C 1S9XB 3C6LD 3O41A 4FQIL 3MLUL 3C5SA 3ZTNH 4G43B 3RWIA 3QULB 1FAIL 4P5MA 5JORA 4R8WL 4WY7L 4G42A 3ULSA 4C55A 4XNQA 1UEYA 3IXAB 2F54B 2WBJC 4PJHE 2MCPH 5E5RB 1N64H 2AJXH 1NBQA 4XB8A 3MV8A 3DXAA 2QR0B 1QSFB 2X10A 5C0BB 4POZC 2BVQB 4EBQL 1H3PH 1L9MA 2P8MA 1HQRA 1RUAH 3OKDA 4F80A 1YC8A 3INUL 4J3WA 4YK4B 3CVIL 1U93B 2NXZD 2AABL 3PP3H 1Q0YH 4AIXA 4PLJC 2HTKC 3D18A 1JGLH 3PGDA 2D3VA 3AAZA 2AXJA 5D7KE 2G60L 3C8KA 8CGTA 5B4MC 5CIPH 4WHDA 3L5XL 1JBJA 3D69A 2ZNWA 1K4CB 2VLJA 1U8HB 1MFDH 1QSEB 5JMOC 2JIXA 2ADJA 2OI9A 2FDBP 4OGAD 1KCVH 4IIQC 1LQSR 4PRBB 1RMFL 1ZGLP 1NFDF 4QHNB 2C4XA 2WQ8A 4H26A 1KEML 1C08B 1HILA 4L29A 5GGSB 1A1OA 4EI5C 2K3TA 1A5FH 1N6VA 1Q9KA 1U8MA 4RRPA 1VFBA 2VDNH 2FB4L 1BZ7A 4PJDB 1UXWB 1GL4B 3P73A 3QDJA 5D72H 5I2IA 5T1KA 3ABZA 5GRJL 1WAAF 3VJ6A 1FC1A 1PG7W 4U05A 5CJOH 5CGMA 4M43H 4AK1A 3WEXB 4P5TD 2A6IA 1J0YA 3K4AA 4KAQL 5E8OA 3WIHL 5BVPL 5ICYA 1V3KA 3N06B 1XH3A 2XZCL 1G1CA 3SE4C 2PYED 1I3RB 3RVTD 5JDJA 3S88H 4E0RB 2DLFL 1MRFH 4HS6B 4LKXB 4EDWL 3WS3B 3TBSB 4LCWB 2HTKD 4HS3B 4LSRH 5EBLA 5ID0A 5J12C 5GGQH 1DCLA 1NGPL 3TCLA 3HAEH 1WBXA 2YPKA 3WJJA 5B8CB 3HE6D 4MXQA 5AWNH 3WNNA 5I9QB 3IJSA 1WAAA 4UIKL 3S37X 5MEOB 1J88A 1ZVSB 4WFHE 4ERSH 2EDRA 2D7TL 1FZJB 5E08L 3DV6B 4P4KA 4UBDD 4F7CA 2HP4A 4Z9KB 4Y5XA 3V6OC 2BOBA 1H8OA 5FYLH 3IU4H 1OGAA 1FZOA 1BVLA 2APVA 3QPXH 5CMAB 5FKPB 4YHNB 5B39A 4PP8C 3O4LE 4NO0A 2H26B 4N8CL 3GBNH 4LPXA 4TULL 2VUOA 1JF5A 1XGUB 2VIRA 1P7KA 2VLKB 1T0NA 4O2FA 4RGNC 3QDGB 1B0RA 1MH5A 1AI1L 3H2WA 3QEQB 4W70A 2ZG2A 4JG1L 3NAAH 4IOIA 4Y88A 3T3MF 3ROLB 3MGAA 2MSPA 2J8UE 2EC8A 2QHRL 4PJAE 1WQVT 4L8BB 2Z35B 3DYOA 5ESAA 3U83A 4NO3B 5J6GB 1BD2D 4HWZB 3V4VL 4OZFG 4JPWL 4XP4H 4F57L 3MLXL 1IGML 3BWUC 3BN3B 1R5VB 4JGJA 1B0WA 1LNUB 5A3IC 3GI8L 1AE6L 1T2XA 3JZ7A 2GI7A 4JFFA 4M03A 3OHXA 2R1YA 4R96A 4NM8H 2GJ6B 1Y18B 3B9KA 2PF6A 3UDWC 3TVMB 4QRPE 3P9MA 3VWJB 5GGRY 3T0VA 3C08L 1DLHA 5H94B 4DK3A 4KVCH 4X99B 1FE8L 2XN9D 4Z8FL 4ELKB 1NGZA 4DJMA 2BMKA 4X80H 2GSIA 1IGCH 4I1NB 2W07A 2ADFL 4S1QH 4YZFE 3VXNB 1RFDL 1D5BA 4LASH 5HVWA 4YDLC 4EJ1C 2X89D 4LLWA 2VWEE 2ESVD 1U8JB 1YY9D 3HUJB 5IFHH 1RZFL 3MROA 5C0IB 4X4ZA 1IEAA 3WXVH 1ITBB 1F4YL 2A2QT 4XBPB 1DL7L 3ZYZA 1OF2B 2O26U 1X5LA 2VQ1A 3TM6A 2P5WB 3C5JB 2P4AB 2GTZB 5JR1H 1G1YA 1RJZA 3V5HB 1MQKL 2QHRH 1TTUA 5BRZA 3NOIA 1TCMA 4R7NA 3QG6B 1EIBA 1FIEA 3ZDYF 3HC4H 4OF5A 4PUBL 3F58H 4LNVA 5T3XE 2I60H 5E8EB 1CIDA 4KTEL 3KPPB 2X4NA 1OB1B 3KPNB 5I19H 4NN7C 4X6EB 5I1KL 1A6WL 3MJ9H 5IW3A 3GMPA 4XP6L 1NCAH 2DQTL 4ZOEA 1HIMH 3JTCA 1KBGL 1QVOB 4HUKB 3MJ6A 5IB3B 5C08A 5E2VL 4X5XA 2J1KA 4JO2H 3OZ9H 1IQWH 3STLB 3WNOA 1JFQH 2XA8L 5HHNB 5E99H 1RUPL 4HF5L 4L8CA 3G9AB 3JWDL 1MWAL 3BP7A 4FQHB 2RBLA 3BT2L 4L4TE 2BNRD 3LEYH 1A7NH 3SBWA 4PS4H 2RHEA 2NTFA 3AUVA 5DMIH 2CR3A 2OTUA 3ARFB 4G8FA 4KK6D 3LEXA 2F19L 2J8HA 5E70A 4HMCA 1A21A 2MWCA 1A7QL 3UJTH 3TO2B 4R9HA 1VFBB 4NUJB 1KG0A 3GM8A 1DJSA 1BZ9A 3QJFB 3D39E 3VFUA 4PJCE 5IMMB 3DETC 4JZJC 3FT3B 3ULUL 3GKZA 5I15L 2PETA 3GO1H 5ADPL 4OZIA 3QH3A 2F8VA 3U9UB 2XKUA 5F9OH 5F7FA 2VL4A 4XTRD 1PG7X 1T22A 5F9WB 4KXZH 3HG1B 4R2GB 4N9GA 1L6XA 1AIFA 2V2WB 4ZD3H 1HN1A 5GS0C 3I6LD 3NCCB 4Y5XC 5AUMA 4LEOA 4XPTL 4LASL 1Y6MR 4MCZA 2YPVL 4WUUD 4I3RH 1SEBA 4JO2L 5E9DB 5HVHB 3SDXE 4M62L 5GPRA 3TYFB 1XF2B 3LPWA 4X6DB 4FP8H 4ZG1A 4YHOL 4Y1AE 1FSKC 4JM2D 2HKFL 4XCCL 5FYJU 5LCVH 1T1WA 4PJ5D 2Z9TA 1XIWB 1FVCA 1MJUL 2CLZA 3HB3D 3ZE0E 4ZFOA 3F12B 4TSBL 4FG6C 3T1WA 1C5DB 1S7WB 2OR7A 5ITFB 3S34H 5J3HD 5ALCL 1E0OB 2DI9A 4M93B 1P2CA 4WEBL 2GUOA 2X4UB 4YHZL 3TBSA 5IESH 3EFFA 4AEHH 4PJFB 4OAWB 3N85H 3B2UD 5IK3A 1OT1A 3SCMA 4IRSA 2CIIA 3B8YA 1RZGB 3VH8A 2AEIT 2DD8L 3K81A 2HJKA 3RKPA 3SO3B 1MJ8L 1NL0L 1HHGB 3TPUA 3S4SA 1G7JA 2BERA 4F9PA 4G7YL 3KPQA 1YPZE 5DD6A 4IMKC 4JFOA 4RFEB 4FFZL 4PB0L 3FT4B 2VLJD 2LTQB 3U46B 1MJJB 1IAII 3OZ9L 4K7PX 5A2JH 4WW2C 5TPWL 2IALA 3OAYK 4R0LA 2VABA 1DEDA 4IRZH 3O9WA 2B2XL 1JGVH 1GC1C 2GCYA 4PV8B 4BFIB 1MFCH 1CTNA 2MQCA 4LLVB 1DLFH 1QBLH 4I18A 4X7TB 3MRMB 4QF1A 3RI5F 5EORL 1MQ8A 2D4DA 1ZT7B 5IT2H 3DX9A 3HA0A 4WWKA 2R0KL 3IDYC 1S7RA 8FABB 4LU5L 3OX8B 4DW2L 3WUWA 1T1ZA 4LCCB 5KG9A 2QQLL 4FS0A 5ICZA 3PGCA 5FK9B 1A7QH 4S0UC 5KSVA 2CPCA 1T1YA 5T3ZH 5JQ6H 2C3VB 2ED7A 1OM3L 2PW2A 3QJFA 2DOCA 4WU5A 2D4FA 5CJXA 4LSQH 4P4RB 5HPOA 5ITFA 3ILQD 1CGXA 2MQ0A 4NO3A 3DMMA 2VLME 3PWLA 2D7PA 3BD5A 1F4AA 2NXYC 5TGBA 3U1SH 4A6YL 1ZHLA 1NGXB 3TJHD 5KVGL 1WZ1H 3DO7A 1JHTB 3BKJL 1UXWA 3P3YA 4UUJB 1MY5A 3NABH 4OT1L 4G7YH 2QBWA 1U41A 1LP9B 5C0RL 2E7LE 2WUCL 4QRSB 1BBJA 2DYPB 2LU4A 4GAGH 4UINH 2ZG3A 4EDXA 1HI6B 1EV2E 2BRRL 4NKDB 1FO0H 5CJQH 5KSAC 1UFUA 4XNXH 4FQ1H 1DTUA 1PSKH 1JL8A 3KPRB 3PDOB 1QVOA 3EDEA 3SE3C 1J0IA 4BSWA 3Q48A 4H1LG 1XGQA 5GXBB 1R24A 5CINL 3EO9L 4Y4HB 1BHGA 4IMLB 3RL2A 3KYNB 3N0PB 1N59A 3CH1B 4TSBH 2WWKT 3BVNA 1KIQB 4JM4L 2ZWLT 3OKEB 4JRXE 4ENEC 1AO7D 2KDGA 6FABH 3OAUH 4NM4L 5K33A 2EO1A 4QOKB 4XNMB 4PLNC 2EDYA 4WI3A 4BQ6A 2VXTL 4N0UE 5EBMA 5CEXA 1JGDA 3PWJA 5FB8A 3SOBH 4U6TA 2VSDA 4YC2B 3WXWL 1WGOA 5J1SC 4TNVF 4L4JA 4BSVB 5IB5B 4MJ5A 3L7FB 1SJVA 1OTUD 4IS6B 4GG6F 3L3HB 5KANG 4NT6A 2EDHA 3BSZH 2CXGA 1E27A 2DTSA 1U8PB 2NY0D 5FM8A 2VDNL 4M7LH 5J0BA 2D31B 5DQJA 3W81A 4OZ4A 4Y1AB 2D0FA 3TLRA 1KELH 3BPNC 1MIEL 5ACZB 3QIBD 5B3JE 1INDL 4IRJA 4ZUUA 5D7LD 3IFPB 4OM1L 5I18L 3MRCB 2F5AL 3LHPL 5FO9A 5T1DL 3DTXA 4GAJL 3V95A 4Z78A 1L0XA 4D2NA 4WFED 5D2NC 5IW1A 1A3RL 4RGNB 3RX8A 4LSRL 1L7IL 4QY8B 1KEGH 4OF3A 1MCEA 3UX9B 1N0XL 3RGVD 4S1SL 4B7IA 1I9IH 3VGGA 3LN5B 1AFVH 3FB8B 3SQBA 3U9UA 3GMMA 1CVRA 5J57B 2VDQL 1L0QA 1UWGL 1AGEB 3QXDA 1IEBB 2V7HA 1JWMA 3GJFK 3GDBA 3ERYA 1KN2H 2WMPA 3H7BB 1FV1B 1DUZA 2NY5H 4TULH 4P9HC 4L4VB 1HSAB 1MSPA 1G6RB 4FQXA 3T0EE 3VG9B 1AP2A 2N4IA 2YXFA 5C0DB 4Y5VA 1BVKB 2BSSB 1A2YB 3CK0L 4LHUA 3V7AE 3BH8B 2EXWC 1RHFA 2COQA 4Z7VB 4FQ1L 1KIUA 4JFOB 5IVXE 2VLRE 3WFDL 5JDSA 1IAKB 5BJTA 4R0LC 5IG7A 5JTWA 1A4JA 1MI5A 4Y4HA 1HNFA 3Q5TA 5C0GB 2P24A 3E8UL 5EU7E 5L2KD 2HKHL 4X5WB 3KXFA 1ZANH 1D6EB 5KSBE 2EE6A 2W59A 5MERB 4Z7VF 3WYRA 5F9AC 2AEPL 4HMEA 1OAXL 2VE6B 4OD1L 1RUPH 3MTRA 1GGTA 5IR1B 1LEKB 3UMTA 5T1MB 1ZV5A 3FQTA 1NGPH 1C16A 4JKPH 4OD2A 2A6DA 1FC2D 2MOVA 4PGZA 3TN0B 3WLWC 4DZ8A 2YPLB 1C5DA 2OP4H 3T04D 1FQ9C 1PGRB 3BKMH 3QDGE 4NN5B 1A6TA 1JUFA 4X6EA 3K8LA 5GGVY 2A6JA 4JY6B 5FUOL 4LKCA 1UH2A 2GSGA 3T65A 4ORZC 4B0MM 2AK4E 2JF1A 1NDMB 1QOKA 3L95A 3K80A 3C08H 4DFIA 1WWCA 1IAOA 5EO1A 5IB4A 3PWNA 3IU4L 2Q86A 4WTWA 1S5IL 3PGCB 5FK9A 2BY0A 4K8RL 5DHVA 2UYLA 4NP4L 5BZDA 4HUWA 2ICEA 1KLGB 4EKXA 5KW9H 1N6UA 5SWQB 2Q1EA 3VG0L 4P23D 2X4QB 3T2QA 5LAXB 4M6NH 3RPKA 4ZPVA 5DRZB 1ORQB 3TH3T 2UZYB 4WU7A 4XNUL 4PP2B 4YXHL 3V0VA 5B8CA 1U92A 1KYOJ 2W91A 2NY0B 3MRDA 4K7FB 1U93A 1CTOA 4Y0GA 1IGTA 1JIBA 1S9KC </