5ACZA

Complex of a b21 chicken mhc class i molecule and a 11mer chicken peptide
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
269
structure length
269
Chain Sequence
LHTLRYIRTAMTDPGPGLPWFVDVGYVDGELFMHYNSTARRAVPRTEWIAANTDQQYWDRETQIVQGSEQINRENLDILRRRYNQTGGSHTVQWMSGCDILEDGTIRGYHQAAYDGRDFVAFDKGTMTLTAAVPEAVPTKRKWEEGGYAEGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCRAHGFYPRPIVVSWLKDGAVRGQDAQSGGIVPNGDGTYHTWVTIDAQPGDGDKYQCRVEHASLPQPGLYSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complex of a B21 Chicken Mhc Class I Molecule and a 11mer Chicken Peptide
rcsb
source organism Gallus gallus
molecule tags Immune system
molecule keywords MHC CLASS I ALPHA CHAIN 2
total genus 61
structure length 269
sequence length 269
ec nomenclature
pdb deposition date 2015-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5aczA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5aczA01
1R5VB 4NN6C 5A3ID 4LRIC 4RMVA 1W72H 1K85A 3QUZC 1DVFD 3GSRB 1RUML 4WHTA 3AS3A 3FT4B 3VWJA 4EXKA 4DGVL 1I3RA 1P4LA 5E1AA 1CE1H 5CUSH 4YIQA 4CMMB 1E4JA 5BJTB 1WTLA 5D8JH 1YUHA 1F11B 5KSVB 3L3KB 3BQUA 4Y2OA 4J4PC 1FO0A 1RD6A 4JKPL 1LQSR 3X3GL 1H5BA 3ZE0F 1LEIA 5C0CE 5CD3A 5E6IB 3JV6B 4OCLC 5DTFA 5KG9B 1FZKA 5I1IH 4KH2A 4DVBA 2VLRB 5ETUB 3DX7B 1SYSB 3EJZD 2A6DB 4X7DC 3QRGL 4AENB 3AXLA 1CGUA 4O00A 4FQIH 1K8IB 3FONA 3QI9A 4KV5F 4NNXB 4Y88A 1R0AH 5CMAA 3L5XH 3M8OL 5CEZL 2PR4H 3PWJB 5GJTH 1BFSA 3GMQA 1BZ9A 2R2HA 1MCEA 2G60L 4OCRL 4LLDA 3NZ8A 1AGBB 3C9NB 4DKEL 4JGUA 5FCUL 1KTKE 4YPGB 5FHAH 1ZLWH 1G6RA 3MLUL 1I8IB 1TETL 4U6YB 1H3PL 3ZKMC 2DQDH 4I3SH 1CU4L 2PW2A 4BQ6A 5E2UL 2VKXA 4LCIL 3MRFB 1X5AA 2I60L 1A2YA 1WZ1H 4FFYL 3BHBA 4ZD3L 4ENEC 1ZEAH 4PRHA 1N7MH 5FAAA 4JPKL 3C8DA 3N9GH 4L9LA 5A2KH 5EFIA 3DJ9A 1CYGA 4AL8L 2N56A 4JJHA 5I18H 1NCAL 1Y18B 2C1OB 4YZFE 4MA8L 4ZO6A 1KN4H 3NPZB 2FZ3B 5C0IB 4PRPE 2VXTL 2AK4B 3V5HB 4MXVE 3WMSA 4U6TA 3EJZC 4LAJH 2CLRB 4KKAD 2EECA 3GEWB 2BVUA 4C56E 4HJ0C 3F12A 1TVBA 3TZVD 1HHKB 2EIZB 4ESKA 2YKLH 2R2HB 3C08L 4IEFB 4D8PA 1YMMA 1S5HB 1JVKA 4TUJB 4BZ1L 4M8QB 2NY5L 3RPIA 4IOSD 3WLBB 3MRHB 4UU9B 3T0VA 2F5BH 4U1JA 4XXDA 3T4AA 4I2XB 4OF8A 3UTOA 1T03H 3TFKC 4GSDH 2X42A 4CVWA 4W68A 5C9JA 2ESVD 3ARPA 4PP1D 3MV9A 4KRMB 4WO4A 4WTWA 2VABA 4RRPG 5AWNL 3X14A 4HIJB 4JFDB 3QA3A 4FXGB 4X8JB 2GQHA 1KFAH 2HRPL 1D5BB 4LIQE 4EI6A 3RGVD 5B4MC 4KZDL 1QSEB 4PV9B 1LDSA 3OBAA 2FLBT 1SJEB 5C92A 2KPNA 1LEIB 1A7QL 1MCPL 4HAFA 4U49A 5T33L 5KVFL 1U41A 2Z93A 3M45A 4JHWL 4P9MH 1E0OB 1DN2A 1L9NA 4PB9L 3O2WL 2CXKA 3X17A 3WE6A 4F7MB 3TH4T 2AABL 3EJYD 4HCRH 4DN3H 2DLFL 1A6VH 5LGKA 4X99B 3D2UB 5F9OH 5KVDH 3Q0HA 4YHOH 2IPUG 1M1SA 5IVXA 3P9MB 5DRXB 5C71A 1HYSC 3HFML 4XWGH 3VWJD 2BY2A 4RWYL 1EAJA 1CD8A 1VSCA 3P4LA 2C1PA 3UYRH 3O2VH 3MXWH 4MA1B 4LPVA 4XCNA 2OS7A 1FFOA 4I9WE 2JTDA 4PJHA 5EZIH 2ADIB 4Z7UB 1KULA 4PJBB 1VGEL 5IMMB 2R4SH 3RY4A 1UB5B 4P2CG 1FNHA 5GRVL 1CDHA 2E7LA 2E9JA 4RFNB 4WNQB 4NQCB 3GSRA 1XF5A 3RWEB 1B6DA 5IEHB 3AUVA 2X05A 4FQ1H 5HDQL 5T1KD 3B83A 4QHMB 4LPWA 2R1XA 3VXMD 4TOYL 5CZKA 3NA9L 4O9HL 1RU9L 4PJ5A 2I9LB 1KPUB 5DJXA 2PNDA 5IW6B 5BO1L 4RGOH 4DQOH 1IC5H 2AV1B 5LAXB 4WU5B 3HAEA 2A6KB 4PREA 4LPUA 1JNNL 2IANB 5D7IB 4P5KA 1XR8B 4QCIA 2D03H 2YD8A 2FIKA 4ODVL 4PJ7E 1ORQB 1ACYH 1MRCL 4WNQA 4BQCA 4HUNB 4YDLC 3DGGB 4PJGA 2BSTA 5DJ2B 3ZKMD 4TNVK 2QL1A 1T1XB 4FOMA 1LQVA 5KSBF 3BOVA 1U91B 1K2DB 4K7PH 3AVEA 1JF6A 4WW1A 4XRCA 1RZKH 4X6EA 3S36L 3TYFB 1Q0XL 1CFNA 1FAIL 2XTLA 2PR4L 2P5EE 4R0LA 3TC9A 4Z6AT 1BOGA 4QXGL 5LQBH 4DEPC 1U3HD 4PJEA 1FFNB 1IFHL 3OAUL 4QY8B 1DEDA 2J8UE 4LLQA 5FCUH 4KJYB 2V5RA 5EU5A 4N8CL 2OJEA 4G6JH 3VXMB 4RMWA 5D7IA 3RZCA 1WAAA 4B5EA 4MB4A 3MV7B 4PJXB 5FGBC 3ULVC 3C60C 5DMYA 4JFQA 2AJZA 1HI6A 2A6IB 3U7WH 4GAGH 4U6VH 1MRDH 3KYOB 2C3HA 4YEEA 4X9HA 2GAZA 1DLHB 1OAUL 3QIUC 3OJDA 5HHNB 4JPKH 4DKAA 1EVTC 3IDYB 1NCDL 5M95B 1QD0A 4CMHB 1D6EA 3CUPA 2X9WA 4KY1L 2HG5A 4XBGA 1GZPB 3GB7A 4YXLH 5DD6B 1RJZA 1RJLB 4JPWH 2V5MA 3IKCB 4DK3A 3G04B 2EDDA 12E8L 3LV3B 3RPIB 3C08H 1IM9D 5DJCA 3MUGB 2OXGA 3KJ6H 1AP2A 5GS1C 3H9SA 3BSZL 5FKPB 4Q58C 1P9MC 1S8DB 2DD8H 2DS4A 3A6CL 3QXVA 3L3IB 4MAUL 1KENL 1MCWM 3IJHB 1HHIB 5JHDB 3KYKH 4NQDB 4U1SB 2KQNA 5TDNB 1D7FA 4GBXC 2FB4H 4RGND 1JPSL 3PGCB 5T3ZL 1RJLA 1ZMYA 3KPLB 1KFAL 1UFUA 1P6AB 3LKRA 3TV3H 3RDTA 1U8HB 2YD3A 3BO8B 1IAIM 4AM0A 1N6VA 1V3LA 1MJ8L 2HG5B 2HKHL 4XNMB 2Z8RA 5CGTA 3NTCL 4S1QH 2NY2C 3O81A 1MJ7H 3BHBB 1ZT4B 2XWTA 3BKMH 3CNKA 5I8OL 2FYYA 3KR3H 5LGHH 4Y16A 1BFOA 4O58L 1N6QH 2H45A 1MCHA 2D7TL 4N8VB 4IRZH 2E27L 1CR9L 3DV6A 1CCZA 3PWUB 4FQXB 1EAPA 5SWSB 3MV01 3IRPX 1UM4H 3TJHD 2ICWB 4YDVB 5D4QA 3WXVH 1A7BA 3QDJA 4MA7H 4MJ6B 1QPPA 4GRWE 2P7TA 4LLQB 3ZDYF 5MENA 1F8TL 5JXEC 2OZ4H 5DSCA 4O02L 3FZUD 3TPUA 1A7PL 1SMOA 1VGKB 5IFAL 2FJFB 5IROC 3VD3A 2YXFA 4K3DL 1CICA 1I9RH 3NACL 1LO5A 1D9KA 3AMLA 1CG9A 1QHPA 2OI9A 2NCMA 4KXZI 4X6BA 4XVUD 2NY4D 1FZKB 1I8KB 2RFXA 4H88H 3T3MF 1ZT1A 2I26N 1U8IA 2CUIA 2PYFA 1AXSB 2VLKB 4POZC 3QXDA 5T1MA 3SCMB 4AEHH 4ONFH 1FH5H 4KU1A 4D3CL 1J8HE 3WSQL 5MHSD 5BO1H 1T89C 3M17A 3MRIB 4A6YB 4E0RA 3FKUS 4RNRA 3K2UL 4NNPL 1EMTL 5DK0B 1LO0H 3MJ8B 3V4UH 1UZ6F 1E4KC 2EIEA 3X11B 2X5PA 2VLLB 4U1NA 3BE1L 1A47A 2HFTA 3NFSH 4O4YH 4BFEA 2B20A 4Q9QH 4M43H 4M03A 1P1ZA 1YN7A 3O2DH 4JO3H 3VGBA 3EW3B 4EOWL 3PV6B 4GMTL 3I6LE 1X6LA 5HHNA 2Y36L 1JZ2A 2CDEB 4POYA 2D7OA 1HXMA 5J12B 2DM2A 3L3OB 4M6OL 4HKZA 4AY0A 3EFFA 4IJ3B 3QG7L 3NAAL 5C07E 5J1SC 3TNNB 2Q86A 1PYWA 4C4KO 1KUMA 3CFBB 5DI8A 1XGYH 1CDYA 2ADGB 1C5DA 3DNKA 2OR7A 1LEGB 4ODHL 3U4AA 4NRXA 1FL5A 1Z5LB 3DPBA 3QUZA 4JVWA 4QRPD 1ED3A 2IPTH 1ZSDA 5T1LD 5A3IC 3S96B 1UEYA 1DUYB 1ULVA 3RVWC 4Q97A 5BXFA 1N64L 3N1FC 3KWWA 5IM7A 5A2LH 1S7SB 1MQ8A 2X10A 1VEPA 2ZWLT 4ODUB 5FM8A 5JDSA 3BZDA 3FO0H 5FYLE 1OGAA 3MNVA 2KZ1B 3EFFB 3HZKB 1ZLWK 5DJ2A 1PKOA 2GJ6B 1OVZA 1AO7D 1NBVL 1VFAB 5KSAA 3UROR 3BKJH 4JE4B 2P46B 4OT1L 4HG4K 5GZOC 4PJCB 4PJ7A 1JHTA 3FO1B 4R2GD 5JXEA 2R1YA 3ZYZA 4U1HB 5IMLB 4G8IB 4LU5H 1QRNB 3KYMA 3V7AE 4IOIB 3TBWA 2VDOH 2R4RH 4M7KH 5C70A 1P1ZB 4CVUA 3BGMB 2Z8SA 4PJ5B 4LVOC 5ICZA 4QRTB 4WHYH 5DRWB 3OX8B 4XP4H 3CVIL 1LP9A 4JLRB 2VDRL 5D72H 5B39G 3RWGA 4M5ZL 4C55A 3C09C 3DETD 1T7XA 5GRYA 5MEND 5EA0L 2FYYB 4ZXBA 5I17A 3T0EE 1AGCB 2VDKL 4LPYA 3UTTB 2RCSL 3H9HB 4NKIL 3ZDZE 5FOBB 1CTOA 2XZCL 4HWEL 1CLYH 4XCYA 3OG6B 4XMPH 1C16A 2R2BA 4RZCA 3A6BH 1V8HA 5C08B 4PGJA 1OOAA 3SJVD 2P49B 4U3HA 2NW3B 4QHLA 4ODTL 4S11A 4Q9CA 3L95A 4TN9A 1IM3A 2XG4A 2P44B 3WNPA 35C8L 3IU4L 3WUWA 3HUJE 4ZMAT 3UDWA 4TTDD 4Y4FB 3SCMC 1BHGA 4ZYKA 1U58B 1YY9D 2F54A 3LMJL 3FQNB 4H5SB 4X0KA 1X7QB 1FN4B 3UTPE 1F8TH 1S7WB 1AGBA 3C9NA 1CE1L 2VB5A 4HPOH 4V2CB 4EI5A 4R97C 4P3DB 1Z0NA 4YHKH 3ZMRA 4WU7A 4K9EH 4MQXC 5DLML 5TGBB 3CZFA 2VLJD 4I0PD 5IQ7L 5EU6D 1I1YA 1XH3B 3CU1A 2WUBH 1M71B 1BPVA 2B4CL 2A2QT 1JZ7A 1OB1B 4LAQL 5FYJH 3NZHL 1SYSA 4PTUA 3ARBA 1TCMA 4Y5XA 1MAKA 3HPJB 1M7IA 5TQ2L 4N8VG 4BA8A 2IQAB 1MH5B 2YPKB 1P5UA 4I3GA 5CBEA 4OZGF 4C4KT 5EC2A 4Q2ZA 4Q6IA 5IUSA 3EHBC 2P5EA 1OP5H 3QXUA 4WU7B 1HH6B 5KS9B 4GG6F 3GMQB 3WHE1 3FO9B 2QADB 2HRLA 4OZGB 4TNWF 5LGJB 3R0MA 1GHFH 2NX5A 1KPRB 4L3EA 4DOHB 2X4UA 5CJOH 2F54B 1ZTXL 3MR9A 4Y4HB 4C56A 4HBCL 2A9NH 3VFVB 4HIIB 5EU5B 4HSQA 1IAIL 5CJXC 4OZFA 1RZFL 4NQEE 1W0VA 2FD6H 4FQHA 3UYPA 3SDCB 5EFIB 2A9ML 3GSXB 3H7BB 4U1KA 4X7SL 2WBWB 3MA9L 3K0WA 1OT2A 5I76A 3GNMH 2FEDC 4KJQD 3ROOB 1UA6H 4YXKL 4M93C 3GKWH 3AM8C 2R23A 4XPTH 4PB0L 1HSBA 3LS5L 2B1HL 4NJ9L 4KTEL 4QYOA 2CGRL 1BJ1H 2ZUQC 4NZUL 1VPOH 2B5IC 4NQTA 3D18A 3TO2B 2W9EL 5C07A 4D0CB 1J11A 2QQNH 4Z0XB 5MEPA 5IVZB 3TYGL 2MQCA 3FOLA 4HFUL 1KNOA 3BKYH 3BZEA 1ZS8B 1HI6B 4P23C 5CUSL 4LKCA 2EXYC 2DKUA 5JXED 4ZXBC 2CIIB 4JO4H 4LEOA 2AXGB 3ISWA 3ZE2F 4EVNA 1KV3A 2C3XA 1EERB 3VGEA 5IB1B 1U58A 3K4AA 1LK3L 4QHKJ 2R15A 1NUFA 4PJGF 5C0RL 2AV7A 4H1LB 3R8BB 5F1IA 4LCWE 5B38B 3FN0H 4KAQH 3JTCA 3U0WH 3HC4H 4NM8L 1Q72L 4MMXC 1RIHH 4KKCD 3BP5B 1NBVH 1F3JB 3V6ZB 2PO6D 1FNGA 3QFJB 5IF0B 2EH8L 3VFRA 1H3WM 1G6VK 4MB5A 4U2ZA 3LEYL 4OZIE 1AFVH 2VDNH 3RWHA 4FNLL 4S1RL 3WFHB 2VISA 2NXYD 5EIQA 2CD0A 3G5YB 5SX4H 3ALXA 1UM5H 2AJSH 1AGDB 4QRQB 4ODBD 5GSVB 1ZANH 3FT4A 4LSRL 4Z78B 1GC1L 3GK8L 5F7EL 1T6WA 3LEVH 4B41A 1CICC 5EOQL 2AEQH 4ZFGL 1HHGA 2JLLA 4G6AD 2NY6B 4JZJB 5K9KB 2LTQB 4UZGA 1PY9A 1NLDL 4M3JA 1ZHBB 3VMOA 2J8UB 3DV4A 3HNVL 3K2MC 5IWLA 2UV3A 3U46B 3VXME 3IJSA 4JM4L 4K2UL 3TPUE 1C12B 1WZ1L 3LIZH 4FFYH 4JQVA 4NYLA 1U93B 4JFEB 2X9XA 4HWEH 2JCCE 3HMXH 1NUNB 3H0TB 4XNQB 2VLJA 4GG6E 1NAKH 1A14L 1WSST 2CK2A 4X7CC 2DQGH 2VMFA 3I3DA 4KVCH 3PL6B 2YD7A 2BNRD 3ULUH 5HVHC 4YHMH 1J88A 2MMXA 1HHHB 2QSQA 4J1UB 2FH8A 5CIPB 4Z76A 1YEJH 5IFHH 4U1KB 3LN5B 1INDL 2QHLA 3Q2CA 1R3LA 3BWAB 1MFBL 1I1RA 3TT1H 2EIBA 5CJ8A 4D8PB 4ZUSA 4NRYA 3KG5A 1Z5LA 2WZPD 3PHOB 2YC1A 1P9MA 1ZLVK 1K4DB 1QLFA 2NX5D 4L3ED 4U7SA 4JB9H 2NNAB 4YH6A 3SDAA 3NOIA 5I9QC 4LHUB 4GRLB 2NY3D 1JGUL 1WWBX 4MS8A 1TFHA 4LNRB 1CFVH 2A6JB 1QR4A 4WCYH 1CGSL 3S36H 3GSNL 3FAXA 1Z9OA 4OFYD 3QUXC 2K7PA 4XMKH 3GMRA 1YQ2A 1NDMA 4RSVA 1KLGA 4BFIA 1BAFL 1CXEA 2H8PA 4HGMA 3VGFA 1AKJB 3GRWA 2O5YH 3I02B 4PJFB 1PSKH 2YN3A 3R1GH 4PGBB 4XNZC 3ZT7A 1T2QH 1A9BB 3CVHH 2WLZA 4HGWA 3TWCL 3S3SA 4HCRL 5C0BD 4RGMC 4PJGE 4QRUB 1T66C 3QG6A 2BJML 3FB6A 2E6JA 3WJLC 4GRMA 2LU4A 4OQ1A 3H7BA 1YZZA 5EUOF 3N1QC 2XRAH 4EUPA 5C0AB 3U6RA 2OL3L 4U33A 4LCCB 5J0BA 1BQHA 4YXKH 3FHAA 4S1SH 4HZLB 4UAOC 3W9EB 1J0IA 3GKWL 5KW9L 3MRRB 1FFPA 3CAFA 5CP7A 4H25B 5INCB 4KTEH 4ENED 5GGSA 1DQDH 2ICEB 4YE4H 2Q8BL 2W9EH 4ZAKA 3BDBA 3TNMB 4N90E 3RL1A 1U3JA 1P2CA 2YHGA 4X8XA 4BUGA 1CL7I 4JY4A 4R7DA 1QLFB 3VXUD 3S34H 1G7LA 1HDMB 4JO4L 4PRPB 4Q7DA 5FGSA 3PP4L 1IVLA 4M6NH 2CLZA 5JW3L 2NY3B 5FXCH 1IKFH 4G3YL 4P48A 3ZT6A 5M7QA 3DX9A 4WW2F 4Z76B 2PUQT 3FN0L 4KAQL 2NX5B 2J12B 4L3EB 4J1UA 3ULSB 4JY5H 2OJZL 5JUEL 2NXZB 4OQTH 3WKML 1AO7E 4OCXH 1NGZA 4YWGH 2MCPL 1JPST 4G5ZH 5DJYB 3OL2A 2FBJH 2OSLA 4HX1B 4XNYL 3F5WA 4LF3A 1L0YA 3KPMB 2BNRB 3FQXA 2Q87A 3QQ9D 3MV8B 1OB1A 5LXGL 3OR7A 1F6LL 1XIWA 2D7TH 4JREB 4NO2B 5I8KH 4Y19B 1KCUH 4JDVA 4ZFOA 3MYZA 4G80A 4GQPH 1JHLH 3KXFB 1LO2L 5D1XC 3MGAA 2ATPB 3L3KA 5KOMC 1IGML 5ADOL 3MUHL 5JA8B 4QOKB 2JELH 3MGTB 3U7WL 1QBAA 1XAUA 3O9WA 1JRHH 2BY3A 1T21B 4ODXB 1F4AA 1NFIB 2AK1H 5C0FA 1MREL 4FABH 4CMHC 2XN9A 3VH8A 5FYJE 1QFUH 2IAMD 2ZCLL 1ZLVH 1IM3B 3BYTA 1IT9H 4RWHA 4IOIA 4YXLL 3DMMC 5F7UA 3MLWL 3VXSB 2VLJE 1MSPA 2XIDA 2DQJH 5DQJA 5IGXH 1B2WL 2ZJSL 3SDCC 1KIUA 3OF6D 4LF3B 1FIGL 4D3CH 1FZJA 4R4FH 4Y5YC 3MGOA 3L3GA 2GAZB 3QFJD 2YMXL 5HHPB 1WCBA 1LE9A 2X4TB 1RZ7H 3HAEG 4WJ5A 3SGKA 1EMTH 3SDDA 3E6HA 2V7HB 3KPRA 5L0QB 1C08A 1QFPA 1D5MB 4PS4H 4FZEL 3V95A 3JVGA 3QNYB 5D1XD 4JPIB 2CO6B 4NBZB 3GUTB 1TJIL 5IMLA 4ISVB 2Q3ZA 3CDCA 5J6GB 3NIGE 3GSNH 3OB0K 1UQSB 3RDTC 1G7LB 4KWUA 2ARJA 4CDGC 3F58L 1CQYA 5DURB 5EZOL 3VD5A 4G8GA 4MZ2A 4MAYB 3UTQB 3BRGC 4PJDA 2UUDH 2XKNA 3PIQB 4URTB 3F7RA 3K8KA 2P5WE 4FMKA 3F7VB 5IB3A 4ZUVA 3B9VA 4HC1A 4HD9A 5EUOB 4UIMB 4NUGL 2ZOKB 1NC2A 3M07A 3S97C 3EYUL 3WE6B 5E5RB 4F7MA 5C09B 2BY0A 5FM4A 2NQCA 5MEQB 3QCVH 3L3DA 4ALAH 3LH2L 2XWBB 4RISH 1BZ7A 3MRQB 1TTUA 1NBZA 5EZJA 5C0CA 1WEJH 2X4OA 4OLYL 3BH8B 4PY7B 2MQ3A 4LKCB 5GS0D 4JN2A 4I4WA 2ATPA 1SM3L 3LRSB 2APWA 2ZKHL 5GHWL 5DI8B 5ABDE 3HE6C 4K3JH 5HVWA 1QVOA 3ZYIA 1JPGB 3AREB 3BD3A 3MLYL 4JFDA 2QADD 4CADA 3GSVA 1F90L 1EVUA 2OX5A 3ARDC 1OWWA 4JJ5B 3BFOA 2YUWA 1PLGH 5DVMA 1R24B 1QSFB 4ZQKB 2P47B 4PJDF 3W9DA 3NPSB 3ZO0A 5TE7L 3TVMA 2CXGA 1DSFL 5TH2B 2VDOL 2E5EA 5CAYB 3BWUC 3NCEB 5B21A 1XR9A 5E8DL 1JK8B 2WLYA 5J3HD 2VIRB 5F21B 4LHUA 3W81A 3SN6N 1AR1D 2CLRA 4M43L 2NXYC 1MVUA 2VDRH 4PGDA 1KPRA 4JO3L 4EOWH 4D9LL 1QNZH 5T3ZE 1G7PB 1CD1B 4PRHE 5AZ2H 1E6JL 4NQDE 1H3TA 4EUPB 4CNIB 4PIRF 1I7TA 1R5IB 3U7YH 4NKIH 4UTAL 4MSWA 1CT8A 3PABA 5ALCH 3LKQA 2MPAL 3JWDC 2EDQA 2ICEA 3GSWB 4JFFA 2CKBL 3U82B 2P8PA 5E6YA 3SJVB 1J0ZA 1MAJA 3M8OH 4RAUB 1YMME 3SQBA 2XZAL 3X12A 3RY6C 1A7NH 2BOCB 4R3SA 4F2MA 3DVNA 1WFNA 1WIOA 5JNYB 2LAAA 3I6KB 4L8BA 3B5HA 1VGEH 1L6XA 3VFPA 4MQTB 4OLZH 2LAGB 1A21A 4HUMB 2D31A 2BNUB 5MEOA 2EEAA 2R1YB 3O6KH 1BX2B 1MCRA 3MODL 5C09A 1DZBA 4EDWH 5AEAA 2MKLC 3IDNB 3CCHB 1K4DA 3FMGH 4PFEA 4YHNA 4EBQL 2R56L 2H1PL 2P45B 3WJJA 1IEAB 3RDTD 2AVGA 2W60B 1U92B 4WUUD 5IGXL 3I9GL 1HILA 1EK3A 3HLAB 4F8TA 2CKBA 3HKFA 1UM6L 3RA7L 3DO3A 5E9DB 2OXHA 4P57B 3HZVA 1H5BB 1I1FA 4N0RA 3RP1A 2ZSVA 3QT2A 3QSKB 2D03L 1OW0A 4JHWH 4KJQC 1AE6L 4I13B 2OZ4A 4FFZH 2NR6C 2FX7H 3VFNA 3HC0B 2IFFL 2J7LA 5E4IA 5E0QA 4F7EB 4JGMA 4U0RC 1KTDA 3DO7B 3CGTA 4J12A 1IC4L 4GMSH 2JB5H 2BHUA 2VITA 1RZKC 3BPCA 5H35B 1H0DA 3QEGL 4DZBA 4J3OC 2HFEA 4H20L 1MCIA 3JWNC 1NANI 2FD6L 3BUYB 4PJHE 5T1LB 3O4LA 3FB5B 4JCMA 4J8RB 4P59H 4F9LC 3D25A 4G8IA 2XXMB 2O61A 2YPVH 4XX1G 1HHHA 3NCFB 3SBWA 2V9RA 3GSOA 4LFHD 2UYLB 1RK0A 5TE4H 3MNWA 4XHQA 3ARVA 1E27A 4UB0L 1A9EB 3H3KA 4X6FB 3LY6A 2MNUA 4IRSC 5L2KD 2UZIH 3V2AR 5E6IC 3QXAA 3IXAA 4G8EB 1N2RA 3B5TA 5KVFH 1H15B 3ZKXB 4KK9C 4GAGL 1NFKA 1HYRC 3VCLB 4X6EB 3MO1A 3TYFA 4E41A 2IG2H 5BZDA 4GRWH 2VR4A 5HHOA 1BEYH 1UCBH 2N7AA 5HI5C 1MUJA 1DVFA 2GUOB 3GI8H 1XIWC 4ONHB 1LP9F 4HS6B 3TVMD 3BUTA 4QWWD 4RNRB 4N9GB 3VWKD 4W6XB 3H3BC 4HKBB 4APQD 1TNNA 2X4QB 1FP5A 1H0DB 3MRCA 5F1IB 1WQVT 3T09A 2YN5A 5E2JA 2AS5M 5H94A 4CJ0A 2CO7B 4NHCH 3GBML 4NFBA 5BZWA 3NCCB 2EDHA 3E3QC 3CK0H 2Y4SA 2VXSH 1S7RA 4HH9B 4QHUB 1OT1A 4JM2D 3BSZH 2OI9B 4P2YA 3LHPH 5GGRY 4NO0B 2G9HB 3MOBL 3VD9A 2YD2A 3MOQA 4FHBD 4UT9L 5EC2B 3E6FA 1NGPL 5DHYB 4TUKH 1P84J 1OP3K 4PJ8D 1ZLUH 2LU7A 5MERB 2NY4B 3VI3E 1OY3B 1H3GA 4TRPH 4OIAA 5F7EH 3MNZA 4Z7OF 5JOEA 4S2SA 2H32B 4N90D 3C6LD 3HZVB 2HVJA 4LLMA 3T2OA 1IC5L 1A7OL 32C2B 1NLDH 5I2IA 5DD5L 4GO6B 2SEBB 4PJ5E 1S5IH 4ZTPL 3SDCA 3MUJA 2QQKL 4X99A 1MHEA 3BPCB 5H35A 4YFLI 3VG0H 3MXVH 3HRZB 1ND0A 5KVEH 1K6QH 4HIEA 2P8PB 3SJVA 1HIMH 1JV5B 5IMOB 3WJLA 1Y18A 4WI9A 4NZUH 2Q8AH 5DMIH 5FKAA 4XC1L 1DQTA 1GOFA 1W2KT 3FB8A 3MOAL 3L3JA 5E7BA 4GG8B 5I1AA 2P5EB 3FT3B 5HHMA 1P4IH 1IL1A 1I7RA 3GSUA 1A6ZB 2IEPA 5I76B 3VWJC 1DBBH 3HR5A 4JFPA 3OAUH 2IPUK 4ZXBB 5I17B 3HAEH 4Y5XB 3KJ6L 1YN6A 1OSPH 5I1IL 4EUPG 4A2LA 3L5JA 3VFVA 3N85L 4MXWH 4U0RB 5GGVY 3WFCH 1FRGH 2CQVA 1FE8H 3JV5A 3MCLH 3NZ8B 15C8L 4I4WB 1GOGA 3RBSA 2GSIB 2GTWA 1GSMA 3MV9D 4WO4D 1AGFB 4G7VH 1E6OL 2V5SA 3ARQA 5E6ZA 1IEBB 2R0KH 1EO5A 5EORH 3D85A 1FN4A 1DDHB 1FG2A 5DWUH 4QHNA 3QWRA 1MY7A 2C3WA 3OGOE 3C8HA 1NDMB 4K94C 3V8CA 4X7TB 5FA4A 1MI5B 1VFAA 5KSAB 2HTKD 4L9DA 4P4RA 1ZHLB 4PR5A 2H2PC 1W72B 5CEZE 1UM5L 1T20B 2AJSL 2C3VB 5HPMB 2W0FB 3HMWH 4QO1A 4UINL 1UVQB 1A6ZA 5DRNA 3NIGF 2AKRB 3QQ4A 5CLTA 3IAPA 4XXDB 5F1KC 3LRHA 1HZHL 4OQTA 4XPFH 3WNKA 3ULUE 3MRGB 5E8NA 3FRUB 4PJIA 4KJYA 2MSPA 3X13A 3BIAX 4OZHA 5D7LA 4ZG1A 3N9GL 3RWGB 4CDHA 4PRBA 3RHWK 4X80H 2EDNA 3ARFB 3P4OA 3ARXA 1MHEB 1UENA 2FX8L 3NN8B 4L4TD 2VLRE 4HUUB 2CDFB 3VJ6B 5HYSB 3SDXB 5DD6A 6CGTA 1YDPB 3ARBD 3CX5J 3ARRA 3DSNA 4LLYA 4OD3H 4AEIH 2GJJA 4U1HA 3STBA 1JNLL 1KJ2H 5F89B 4M7ZC 1YEEH 5I1CL 2FEEI 3UJJH 1BEYL 1CXFA 5F7HA 1WFTA 2PF6A 3CZJA 1XMWA 4O2FB 3P0YH 3VXSE 5DC4B 4H26B 1TIUA 3UJTL 4PREB 4LLWB 3AGVA 2ADFL 4JFQB 1S7VB 4PRIB 3BPOC 5DJZA 3RGVC 5C09D 2HMIC 3EYSL 1CWVA 1N5YL 5L88L 1BOYA 5I73B 1MWAA 6FABL 1Q8MA 3KPSE 2IAND 3JUYA 2FECI 1CS6A 3NGBB 4I18A 3B2VH 4XP1L 1CIDA 3CJJA 1WIUA 3FOMB 2VZSA 1EGJL 3PXJA 2DLEA 4N1CA 3QNYA 4YFLF 4UT9H 5SWZA 4MS8C 5HVHB 3E0GA 4JKMA 3D0LB 1V7ML 3X3FH 3ARFD 5SWQA 1BWMA 3ZKNC 4JY6A 3KHOA 1OPGH 2IH3A 2V5YA 4NO5B 1A3RH 3KPQB 4LKXB 4M61B 3BI9X 1AGEA 2OLDA 3G6AA 4XNZB 5F9OL 4N0FB 5I8KL 1CU4H 3T65B 3GMOA 1FLTX 4EUPH 1XGTB 4UTBH 3O6LL 3EDKA 4OGAC 1BECA 4NOBA 5C3LD 1M4KA 2J3SA 4GW1A 4UDUB 2FIKB 4PD4J 3RVTC 3IDNA 5K93A 2L4OA 2XA8H 2WBKA 2VNCA 4NSKB 4ZD3H 4LSTH 3RY5A 2DQTH 1H5BC 4EQ3A 3BGAA 3SE9H 3VFGL 1J1XL 3VWJB 4GS7B 2BFVL 1YEKH 1E4WL 2I07A 1YDPA 1L7TH 2QR0A 3DHMA 3VXOA 4IRSA 3QDJB 2BZDA 3P0GB 1TVDA 3JZ7A 4TNWK 1HWHB 3Q3GA 3LD8B 1DL7H 4IIQA 3ECBB 3T2PA 4MA1C 3FB5A 5LG1A 5HI3D 1JGEB 1U8KA 1ZGLP 4QOKA 3REVA 4OLUL 4W6YB 3ILQD 4WFGE 3I75B 4KROC 4KKBD 4LARL 4YHKL 4GG6B 2H2PD 3LSOB 4JG0L 4YUEL 3WIFB 5J06A 1ZXQA 1UACL 3AAZA 3S34L 4FP8H 5C8JA 1CLZL 1HEZB 1C1EL 5CCKL 4ORGA 4OTXL 2I27N 3QCUH 4WIQA 2NY0B 2HJFB 5DD0H 2E9WA 3RI5K 1IKFL 5I66A 5ISZD 2PYEA 4FQHB 3QHTC 2HTLC 3EHBD 1CLOL 2XY2A 1JWUA 5BVPL 3W11D 1M6OA 4HZLA 4MMZC 3MJ8A 1PGRB 2K1MA 4QHNB 1TJIH 2YPLE 4JO2L 5F7KC 4BK4A 4LCCA 1FAIH 3MRIA 4E42B 3SGJA 5ESQA 1E4KA 4J6RL 3QDHA 3GMLA 2APFA 4MNHA 3F6IA 1L0QA 5EZOH 2CR3A 3P77A 4PRHB 1FZOB 1AY1H 3CFCH 4UNUA 4XPHH 2FLRT 5EC1A 2IQAA 3ORJA 1AIFB 4PGZA 4K71B 3VFPB 3V0AC 3TA3A 4ZPVA 4PJHF 4OJFL 35C8H 3BW9A 1HHJB 1A1MB 5JDJA 3R06A 2VC2H 5CINH 4W6WB 4LU5L 3UYRL 1T1YB 1KEMH 1A6TA 2R4RL 3ARSA 4P3CH 3NH7L 1F4WH 25C8H 1D5IH 1KIQB 3MRPA 3RY6A 2VZOA 5AD0A 3SJVE 4B0MM 1BQUA 2VH5H 1NFDB 4HMDA 1YMMB 1OSZB 2GK0A 2DLGA 4IDJH 4KHTL 1F02I 1S9WB 3F7QA 2YWYA 3CLFL 2P5WA 4PYGA 4CNIA 1JZ3A 2ZOKA 1KJ2A 5ESQB 4JM2B 5FYKD 3EO0A 3MLWH 4F7TB 3VFTA 1J87A 3UTTE 1MFAL 5JW5B 3B6SB 5GPRA 4LMQE 5TQ2H 3A6BL 3IU3A 3EOTH 4WY7H 1DN0B 2BMKA 3OKEB 1I1AD 1HYSD 2DQIL 5SWZD 2HVJB 4LLMB 5JIPA 1KEGL 2AERT 5DK2B 1RZ7L 4NQSB 4TTGA 4RMQA 3LQZA 4N1HB 1JHKH 5E56A 4WWKA 5DJDB 3EO1A 3LSOA 2ARWA 3IDJB 3HRZA 4HPOL 3LB6D 2YC1B 1DLHA 3JTTB 1EO8H 5F71A 4QTIH 1PG7X 3UJIH 3WS3A 2DB8A 5TQ0H 1NQBA 4YNYA 4XPAL 5HYSG 1MF2L 2BVOB 1JGLL 1FVDA 3NCMA 5DC0A 4WUKL 1G9EA 4MJID 5CD5D 5GGUB 4XGZA 3KNBB 5IHBA 4XP6L 3LS5H 4WEMB 4ZUSB 4CVZA 3WXVL 1G7JA 1LNUA 1BJ1J 4Y5VB 1TTGA 5DUPH 4B7LA 5DDHB 3U30B 4MJ5A 2ZPKH 3MNWB 4QT5B 1X4ZA 4YZFF 3SO5A 2Y7QA 3I3EA 4PJBA 5E6IA 3J7HA 2DIJA 3PDGA 3TYGH 3ZKXC 1I8MA 3VXUA 2JIXA 3C8KA 2AJ3A 1YJDL 1AD9A 4GXVH 2NLJB 3B4NA 3T3PF 5ID0A 5ACLA 3UZEA 4MXQC 5JHDE 2B7DT 3JSSA 1ZLSH 2V2XA 3KXFE 1U92A 4KY1H 1ZHBA 3FN9A 3FQRA 1GGTA 4HLZH 5IB4B 2VZ1A 2CJUH 1FYTE 3QDMB 3H9SE 1NBYB 3OPZL 5J57B 1H3VA 4F58H 1AR1C 5DJ8B 3PL6D 2A6KA 3QDGA 1I3UA 1RK1A 4WUUB 4HS6A 1SEQL 4NQXB 3KDMB 2ID5A 5HYJE 4HK3J 1YEFH 4FP8L 3QIWB 4XVSL 2CK0H 1C08B 4BH7B 3P9LB 2Y7QB 4PRIA 5FYKE 1RFDL 3IAGC 1IAKB 3DO7A 1RHHB 3SY0A 2F8VA 3RNKA 4TVPH 5SWSE 4Z7WB 2GFBB 4MA3A 2FSEA 5JOFB 5HI5D 1G9NL 2NY6D 4IHOB 1P5VA 2IPKA 4XWOD 2XV6B 1AXIB 2DIBA 4JFHD 3QUKA 5GXBB 1K8DB 3MCKA 5I15L 3AS0A 3WDIA 3DOSA 2A0LC 1KCVH 3Q6FA 2XTJD 3EJYC 5DRZB 4BSWB 4PGEB 4P59L 4PLNC 3QWOB 1MNUL 1NUGA 2VUOA 5JIHA 1IGYB 3LIZL 4X6CE 1IBGL 3ARDB 4FFWD 1AH1A 3JTTA 4OD2B 4IRZL 2HKFH 5FO9A 1Z0MA 1QPXA 1IC7L 1QBLH 1LP9E 2BNUA 1AGDA 5MEOB 2B39A 3HE7C 3VDAA 3FB7A 2VE6B 2I5YH 5CZXD 3QFJE 5HHXL 4J4PD 3CU7A 1RZKL 1PKQA 4YPJA 3CXDL 2G5BA 3BZEB 3MRPB 2KKQA 5D1ZC 4YHML 5AD0B 1LMKA 4P3CL 3V5DA 5I1GH 5CP7B 4PYHA 2BSED 5GS3A 1N64H 4DN4H 1I85C 4X4ZA 2CKBB 4N0CD 3TO2A 4OZIA 4JKPH 1BBJB 3P73B 3QNZA 1FO0L 1D5BA 3DI3B 4XVTL 1G7JB 4IIQC 4JRXE 3TT1L 1SVCP 1HOCA 3MRBA 5EOQH 1XGQB 4Q6YA 3RX5A 2NR6D 4P23D 3D0VA 4BFBD 4O2CA 5C1MB 3MBEB 3FMGL 1KJ3H 3ROOA 1JTPA 1J10A 5F96L 3OGCB 3HI6L 4UV7H 1FHGA 1AD0B 1NUDA 5AAMA 3RBGA 4RGNE 5JMRA 1CK0H 2VXSL 3VMPA 5FV2A 1Q9LA 3T4YA 2YBRA 5CMAB 3L3DB 3BPLB 4M7KL 4WVRA 2F15A 2UZXB 4XCEA 3BEVB 5CEZD 3SGEI 3CFEA 4TUKL 2OP4H 2E8ZA 1S3KH 3CIQA 1N5AA 1OHQA 5FHAL 3DX6B 2PTTB 1PSKL 1MFCL 3F7VA 3P73A 5HD8D 2EEDA 2V17H 1DE4B 1QVOB 2ZNWA 5HHME 4R6UA 1MFBH 4LCIH 4ZUTB 3L9RA 3C5SB 2P8LB 4KROB 3O2DA 3ERYA 1I7UA 1QP1A 2NXZC 4ZAKB 3BGFC 5E8OB 3G6JE 2D4FA 1KENH 5EZJB 4PTUB 5C0CB 1KIPB 1NMAL 2F5AH 2YUXA 2J6EA 1KTRL 1YYLL 1B6UA 4JG1H 5KVEL 3IU4H 4KTDH 5HDOA 1GVIA 4I0PA 3BT2L 2VXTH 2VIRA 1TQCC 1DQQB 2PXYB 1RJZB 3OJ2C 4P46A 5DUPL 1KLFA 1OQOA 4LSQL 5I19L 1UZ8A 1OARH 3UDWC 5EUKA 4X7FC 1JRHL 5KVMC 3GFUA 3TJEL 2B0SH 4NSKA 3CFDB 3OKMA 1AGCA 5DFVD 2OR8A 4K9EL 4PJFE 4PJ9A 4MVBA 1EFXB 4C57C 4KDWA 1ZVSA 5FOJA 1I3VA 2ERJC 4ZOCA 3PP4H 1MY5A 4MAYC 2R1WA 4IOFC 3ROLA 4UQ2A 3WFCL 4LVOB 3DIFB 4Y4FD 1WFOA 4U3XA 5SX4I 1FIGH 5J13C 3QEQA 4RFOH 1KXVC 5IESL 1NFIA 4EI5B 1W0WB 1FYTA 2GJZA 5D7KE 3QUML 1S7WA 4OCWH 1TCRB 4FQLH 5IFAH 1X5HA 1MLBB 3DGCR 4PRAA 4N0UA 5C0BE 2IAMB 3TGXA 4KHXH 4UDUA 2NY1C 4CJ1A 4MNGA 5C0NC 5JO5B 4GKOA 1OD9A 4XRCB 2ESVA 4K7FB 3TT3L 1CXLA 3CC5A 2V2XB 5F8QC 3EDJA 3HUJB 5IW1B 4UT6L 3VXQB 4XI5C 4J4PA 3E2HA 5BZDB 5EPMA 1FZJB 3QIWD 2F19L 3TCXA 1TZIA 2NZ9C 5EU4A 2EYTB 2VSDA 3K2UH 4NNPH 4PJ5D 1CXHA 1EFQA 4Y19D 1MOEA 4BELD 4KQ3H 5HHQA 4OF3A 4NWUL 4GXUM 1VFUA 3HI1B 5LAXA 3UXFA 4GKZA 2ICWI 2YA0A 4R2GB 4BH7A 1VACA 4MXVF 2KL6A 2CDFA 3QDMD 4HJGA 4HUUA 2R69H 1EEUA 3QUMB 2ADGA 1AO7B 2ITDB 4G5ZL 4Z7QF 3E6HB 3S96A 5F7NC 5DK0A 3PP3H 4QXTB 5I1JH 4G9FB 3M17B 5L2KE 1HDMA 5HXMA 4DQOL 1CFSA 1T83A 5A2FA 5BRZE 2R23B 3GJEA 3U36B 3D5OF 3EGSB 4PJEE 2X4RB 5DA4A 2EH7H 4YLQT 3OWEA 3RKDD 1PYWB 1MPAL 4MHHG 3ZT5A 4PRPD 1UC6A 4ODUA 4DGIH 4N5ED 1LO5B 2DLIA 3VH8B 3RKDC 4JKWA 2NMSA 3GMNB 3MRRA 4OIBA 1J0YA 1XCTB 4LRNL 4OLXL 5GRUH 3MLSL 1W0WA 4QXGH 3RAJL 3FO9A 1PY4A 4X6DE 1IT9L 3FO2A 3WXWH 2OP4L 1S7XA 4OFYA 4WGVB 5EBWA 3UTPD 4PRNB 5HI3C 3BDXA 4YHLH 4G6JL 1KLUB 1T0PB 4KJPC 1JFQL 1H8NA 3GHEL 1G9MH 1F2XK 4LPTA 5DO2C 3D0VB 4Y8AA 2W0FA 1ZS8A 4R4FL 5C0AD 4P46D 4UI2A 2NY7H 3PWVB 1BFOB 1QRKA 2BNRA 5C2BH 2HH0H 3QP3A 4P5MA 4F33A 1RJYB 3HR5B 1B3JA 1CVRA 2XTJE 5HPOA 3IVKB 4KKBC 4LSTL 3IDXL 3WLBA 1BIHA 3OV6A 3T4YB 3B8SA 4LLUB 1HSBB 5ERWB 2AP2A 1J0KA 2EYSA 5DJAB 2PXYA 1PKQE 4JG1L 3TF7C 5C6PB 4KVCL 5INCA 2FX8H 1FIEA 1YNLH 2VJXA 5FHBH 43CAB 2YPLA 1CBVL 1I7TB 3GMLB 4XNXL 4D0BB 3GGWA 3PHOA 4HFUH 2GY7B 4HT1H 3F7YA 5DZNA 3I02A 1MJJB 3N1MC 1JPTL 1NGQH 2K7QA 4GRLD 1GIGH 1YQVL 2VXQH 3UJJL 2XWTB 4OZIB 1VESA 3P0VH 5FDWA 2VL5A 1VFBB 3MV11 2HJLB 3DUHA 4PJAE 3OR6A 5DJAA 5D71L 4EBQH 4LGSB 2BHZA 5I66B 1EUTA 5EN2A 4RMUA 3D48R 3A0OA 4BZ2H 3QO0A 4HEPG 4LQFH 4HCRA 3SDAC 3C5ZA 5IVOA 4R4BA 5JPMB 2OR9L 3GJEB 5T3ZD 1FYHB 5KJRL 2W91A 2HKHH 1WEJL 3O8XC 4FQXD 4OLYH 4ONGL 5GSRB 5F70A 3TPUB 4F57L 5KVGH 1OAKL 4GRWF 4MD0A 1RZIB 3U1SH 5FUCE 4ODSL 2X6MA 3OXRA 4JKKA 3UZQA 3ESVF 5DLMH 5BRZA 1T83C 2Y5TB 1UYWL 3ZSSA 2J8UF 5I75C 4M62L 1AY1L 4LGRB 1A3RL 2GSGB 1JYNA 5FUZL 3MBEC 4LSPL 3HE6A 1RUAH 1X5FA 4TSAH 4HKBA 4TSBH 4NPYB 1A6PA 3B5GA 4P2OD 3FQNA 4KVNL 2YRZA 2Y72A 2ADJA 1QSFE 4ZFOL 4YBQD 5HTSA 2CPCA 3D3VB 1J5OL 4NQDD 2Y6SC 2JJTA 1KC5H 4Z7VF 3RHWF 3OB0H 4G59A 1ADQA 3EDEA 3IDYC 2W9DH 3U2SB 1L6ZA 5HI4D 3UC0H 1PX4A 4GAJL 3T1WA 1G7MB 1DQLL 1JWMA 5TDPA 3P40A 4AEHL 1YEGH 3QDJD 1T0NB 2V9QA 1P53A 1YEJL 1JGEA 1LO3H 4UIKL 3GKZA 4X6CF 3TH2T 2AV1A 4KQ4L 4TUOB 1R3LB 3HB3D 1GOHA 3EOTL 1PVHA 3OX8A 1XF3A 1CDBA 4KJPD 2BRQA 3WN5B 3P4NA 2VKWA 1BFTA 2UWEB 4JB9L 1D9KD 3S6CA 1N2RB 5FYLL 5B3JE 4OKDA 4N68A 1P69B 3DX8A 2DOCA 2VYRE 1KB5L 4PJGB 1PD6A 4HPYH 5D5MB 3VFSB 3QNXA 4C59B 4JM2F 3CPLA 4YWGL 3T0ED 1YN7B 3ELAT 1CFVL 4B7IA 3I3BA 4F8QA 2D0HA 3QEQD 3QJHB 3QEGH 3D6GA 5EPMB 2FHBA 3ULVF 3S98A 5GRUL 1LD9A 2ZG1A 5TQ0L 4YXHH 3HLAA 1F3RB 4XPAH 2DTSA 4PV8B 3IF1B 4LCCC 4KKAC 2H1PH 4NJAH 4S0TD 5K9KA 3HE7D 1ORQA 4OGXL 2QTEA 2VQUA 4TRPL 4AMKH 5MI0C 4QRSB 1T2QL 3MLUH 3SGDI 2QLVB 3ULVL 4G8GD 4RGNC 2VDML 2ZG2A 2CRMA 2XG5A 2NY7L 1H3XA 2VOTA 3C5JA 3IYLW 4P4KB 3CVHA 5BQ7A 2I60H 1PEWA 3LKNB 3AU1A 5EO9A 3MRMB 4GBXA 3ZLQC 5F7LB 3S5LB 4Y4HD 2BVQB 2EEBA 1MCCA 3DYMA 2XQBL 5EZLA 3MJ9A 3IU3B 4XPBH 4N0YH 1EV2E 5I18L 4HUWA 2VZTA 1E28A 4X5WA 2HLAA 1U6AH 2CDEA 4YR6A 4L4TB 4BZYA 3HNVH 5T1KB 3BEVA 1FFOB 1OTSD 1N6UA 4PJHB 4YFEA 2BOBA 2EDFA 3V52L 3TJHC 5LGJA 2AXJA 1SBSL 3KLAA 3HMXL 1GGYA 1CD1A 4O5LL 4F9LA 4HUKB 4X0KB 1JWMB 4L8SC 2OK0H 1QBML 1BM3L 3PV7A 2YPKA 1DANT 1JZ5A 2BDNL 1Z3GH 5BOPA 3CXHJ 1PAMA 4PRPA 3O3BA 4OZ4B 5F6IC 1A3LL 2W59A 5HDBF 1VA9A 5DK3A 3H42L 4NKDA 3OAYK 4HUVB 4XPGL 3GIZL 5LJYH 3MRHA 4UU9A 4FG6D 3PHSA 1DBJH 1DE4A 4J3SA 4U3CA 2Y06H 2PO6C 3DURA 2PTTA 2Y07H 4YHIB 3MV9B 4WO4B 5GRZA 4NHCL 1A22B 2QKIB 3H8NA 4PRDA 5F3HB 4FQ2H 1Z9LA 1J86A 5J7CC 3BPOB 3RGVB 4V2BA 4JFDD 4MQ7A 1PZ5A 1YC8A 5H2BB 2AEWA 2ATKB 5FGBA 1J7VR 3LH2H 4QKXB 5I73C 1V3MA 1QFWI 3O2VL 4ZXBD 2ZZUT 4R3SB 32C2A 5IBTH 4CN4A 1VADA 2Z31D 4LASL 3BEWA 3GHBL 43C9A 4YC2B 5E03A 2J6EL 1QRND 5T3XH 1O5DT 4MCYB 3D9AH 2J1KA 1I1YB 2B4CH 2CJUL 4WHYG 1F90H 5IG7B 4I2XA 2I25N 3I50L 5FYJU 3FQTA 4QXUL 3JWDL 4LVHB 1F6AB 1C7SA 5DYOA 4CMMA 3I6GA 3RGVA 3RL2A 2UWEF 1ERNA 1LVEA 5EBLB 4NDMA 1I1AA 1Z9SA 3C6LB 2WBJD 3V5HA 5C0IA 1ACYL 1MRCH 4XP9H 3WNLA 1NEZG 4I48B 3KLAB 1CFTB 4RX4D 1P4IL 3DSFL 4QHLB 2NW3A 1QO3B 5I2IB 3JV6A 5AZ2L 4I3RL 1R3JB 1K4CA 1BMGA 2LVEA 4H26A 4H0HB 2CDGB 5IMKB 3NGBC 1N0LA 2AEIT 3NFNA 4NZTH 4S1DD 5BJTA 2A6DA 3W0WB 2VAAA 4KK5D 2BSRA 4NCC2 1A1NB 1DBAH 3MCLL 2EE6A 3S37L 4PRNA 5D2NC 2EO1A 1NGXA 3RWDA 3V6OE 1IC7H 5D7JA 1ZLUK 2VLLA 5IBLC 4APQB 2XA8L 3N1PC 3U4BL 3TBWB 1XCQB 3DETC 5I71C 1ZSDB 1UZ6E 4HMEA 5BZWB 2Y9RT 1Q94A 5DJ0B 1K8IA 2XY1A 4OIIH 4EDXA 2X4PA 5E6ID 4HDIB 2VITB 5E8NB 5D96C 4ODWB 4A2MA 3HMWL 3T2NH 3O3DB 1S78D 4Z78A 2WW8A 4JEGB 4ZODA 5DGRA 2FCBA 2F54E 4KJWD 4H8WH 4XI5D 4YDKH 4OV5B 4DVBB 3MNVB 2X4SB 2VR9A 3QUYD 3T1FA 2VDPH 3P9MA 5DRXA 3THMH 2AJXH 1A64A 4HJJH 1XGPA 5D6CB 1KCKA 3HI6H 3KPMA 1OCWH 4GLRI 5GS0L 2J88L 3SKOA 1Y6NR 3VRLE 1F3JA 5E99L 4M6MH 3MJ7A 4EDXB 2COQA 3QDGD 3B2VL 4NN5B 1JYWA 1FDLH 1G9MC 4FABL 5E00A 1FGNH 2X44D 5CJ5A 1AXTL 1BM3H 4UV4L 3WHXB 1ZANL 2E6PA 4G7YL 5DMKA 1NBQA 5J6HA 1JPSH 4PJ8A 2FX9H 2AEQL 4ZFGH 2DQJL 1DQML 3EYVA 1TJHH 2F9BT 4N8VA 1RZJL 4PG9B 1TMCB 4E0RB 4FTVA 1CD0A 2VSCA 3W0WA 5C0GA 3T0EA 3NTCH 4U1LA 2YMXH 5I16A 3MGOB 1OP9A 4JRXD 2BSSA 1DFBL 3RIFF 3FT2A 2Y06L 4OLVH 4MNQD 2F8OA 4F7PB 5DJYA 4XBEL 4F7EA 1T5XB 1B0RB 4IRJB 4HFWB 4RFEB 4X4XB 3TNMA 4XTRD 2DJSA 1Q9KA 3MRKA 3RDTB 3VFMA 2ICWA 2PXYC 3TF7A 4QNPE 3PWUA 3ULUL 3GSXA 3W9EA 1MQKL 1F42A 5HGBB 1RAMA 2AK4A 2CLZB 3SE4C 1OAYH 2OQJB 4OZHB 4MS8D 1CLCA 5D7LB 3JWOL 3D39A 4D0BA 1WBXA 1CDJA 5IFJA 2B0SL 1NAMH 2Z91A 4GBXD 2HFFB 3PDOA 5IJKC 2FEDD 5I1HL 1EAPB 1M7DB 2JCCA 5DC9B 5FO7A 3HG1E 2HJKA 1GGCL 5DF0A 5DHVB 1A0QH 5CSGA 5F7DB 4P23A 4IRJA 4X4XA 1QFWM 1X9QA 5MERA 1WBYB 2R0ZL 4G9DA 2X4NA 4NKMB 5CJXA 3EAKA 1JTTA 4HV8A 1E4WH 1CGSH 1EEZB 3IFNL 1MCDA 2C4FT 3VRJA 5ILTH 3BO8A 5GISL 3FRPA 1T7YA 2FX7L 5CP3A 3D85D 4G6KL 4QRUA 1F2QA 4YHLL 3WHXA 1HNFA 4DAGH 5IJVA 1KIPA 3LDBB 1KBGH 2WIIA 2X89A 5A40E 5K59E 5ETUA 5HGGS 3BDYH 1DR9A 4RQQB 1EEZA 5MEQA 4XXCA 1UXWA 4NM4L 1FVEB 5JA9A 3CX2A 4Q9RL 1F58H 5J11C 5HHVH 3S3PA 3BAEH 1NCNA 1F4WL 4CN6A 1KF9B 3BIKA 4M7JH 1XR9B 4NNYB 1LK2A 5TE4L 2H6PA 4PJBE 1L4IA 5E5UB 1T5XA 2Q8BH 3QJFA 2HT3C 4X6FA 2JJWA 5KSBE 4O51A 2UZIL 1OQXA 2PYEE 4JQVC 1SYVB 3UTTA 4G6AC 4JZNA 2BSSB 5SWQB 1CGYA 4ERSH 1MCNA 2NY5C 3RIAK 1KG0A 5A43C 2A6IA 4CU6A 3GI8L 3TO4A 5HGBA 3G6JF 1GIGL 1YQVH 2SEBA 2VXQL 1R5WA 5A2JH 4I77L 4R0LB 5DQDL 1ZA3A 5E2WH 3LS4L 5ICYB 2Q20A 2H32A 4LDLB 1BZ9B 3S5LG 1XFPA 5AYUH 2C5DC 1GZPA 2HLAB 4L4VA 4B50A 2IC2A 5K9JH 3QO1B 5SV4A 2X4TA 4HJJL 1WT5C 4LVEA 2H3NB 2ZSWA 5IHLB 5EU4B 3W82A 4XAKE 1GGBH 4ONGH 4P2RD 1KB5A 4ZUWA 3SE4A 2CK0L 2HLFC 5HGHA 3UBXB 4NBXB 4IDJL 4KHTH 5F7YC 4WW1B 4X98A 3V6FB 3VXSA 3VXQA 1TVHA 1T7ZA 3O6KL 5FM5O 5E08H 5JDSB 3UTSA 3QUXB 5SX5H 5D1XB 5DJ8A 1YECH 4I48A 1T0NA 4KMTL 3RTQB 3FO2B 4M7LH 1IZJA 5FO9B 1OGAE 1YUHB 4HG4J 1MLCA 3OKNB 4DKDC 1JF1A 1Q9WB 2QSTA 4LSPH 4CVXA 5I15H 4M5ZH 1A6UL 2D31B 4RGMB 5E2UH 1DVFC 5F44A 3RL2B 1GH7A 2HH0L 1V7NL 4KGLA 4ZTPH 1E4XH 5BVJB 3D2UD 3RPKA 4X98B 3QUMA 3NBNA 3HZMB 1ONQA 1LEGA 3D1MC 4FTVE 1CLYL 3MO1B 3HZYA 1VACB 1CFQA 3QFJA 5IF0A 4GJTB 4Z0BL 4W70A 3B9KA 1XGUA 4Y5XC 4WJ5B 2D4DA 3QA3B 4FXGA 3WIIH 1E27B 1S9YB 3U36A 3V9FA 4OD3L 4QRPE 5D70L 5FA3A 5DR5L 1Q1JH 4P5KB 2JCCF 4HWBA 4F58L 1QSED 3LN4A 1JGLH 5D2LB 2ORBL 5D1QA 2YZ8A 4KI5F 3TIDB 1D6VL 3O9WD 4PGCA 3SE8L 2DWEB 1HH9A 5EOCL 5INDB 2P42B 3RX8A 5C7XH 1RIVH 2V9TA 5E8EA 2Q1EA 3F12B 2XN9D 4O2EA 5AZEH 3BN3B 1KPVA 1GPOH 3KXFD 1RV6X 5B38G 5B8CA 3MMEB 1BVLB 1XGRB 3NZHH 2XN9E 5KOVC 3VFNB 4NZJA 2HRPH 3X13B 1ZEAL 1ZE3C 4FQJL 1ZKAA 5E8OA 5IT2L 3DRTB 4AT6B 4QOKE 4XAWH 3L3HB 3K1KC 4Z18A 5LBSL 5DWUL 5HYEA 4ZFOB 1U8NA 1UWGL 1NCAH 4RMSA 1WTGT 2P8MB 4MD4B 4MA8H 2X1OA 1KN4L 4BKLB 3CFKB 4Q0XH 2IH1B 4M48H 4YDLB 1K5NA 1G7PA 3VXPB 4HIHB 4CN1A 5DD1L 2EDOA 2V17L 5D5MF 4WUUE 4TTDC 5MHSE 2VZUA 1S9WA 3LQAL 1RUAL 4EVNB 3MREA 2GT9A 2JJSC 2VZVA 1UH2A 3B2UD 4CUCA 2P7TB 4FTVD 1YEDA 4P5TC 4LHJB 4NM4H 4C83A 3BH8A 5IWLC 2G75A 2ZUTA 4GRWB 1UJ3B 3HNSH 4WI5A 3FOLB 3RWFB 3DV6B 2YD9A 3S7GA 2R9HD 1CDIA 4X5WB 4Y4KB 2H2SC 1CFBA 4G8GE 4CADB 5GQBA 2R0LH 1HXYB 1MCPH 2AI0L 4OLWL 4MSWB 1FNAA 1TQCB 5IVXF 5TGBA 5I1CH 4N9OB 1FNFA 1P2CB 4DVRL 2VN7A 4QRRD 5FDWB 4BSJA 3HCVA 5D93C 3RX7A 1EHLH 3LN9A 4YBHA 2Z91B 3QQNA 1PLGL 2YR3A 5GGVL 1PKQB 1QFHA 3IDIB 5E5MB 4YHZL 4X5XB 3LD8C 3DRQA 1SJHA 1FFPB 1HIML 3V6OC 1LP9B 1Q9OA 2C7UB 5HHXH 2C4FU 2Z4QA 5DEGB 1X5XA 3EYSH 5CZXC 5FYJD 3WFEL 5KZCD 1OP3H 4KRLB 1KB5H 3DX7A 4RCAA 4AG4H 5FYKH 4BKLA 1U8PB 3P30L 4Q74A 5DHVH 1JHTB 2X41A 3BP4B 1QSEE 1Q0YL 4GG6A 1GZQA 1WUNT 2F74A 4PJAF 2VAJA 1A4KA 2VLRA 2GIYA 1OL0A 2QQLH 3CFKA 4PG2A 2XZQL 5E1HB 1U3ZA 3GMMA 2FGWH 4HHAA 4LHUD 4WHTB 4EEEA 2NY1B 5JZ7C 1U8NB 4LP4A 3DBXB 1UJ3A 2VQTA 3WIHL 1ZHKA 2R0KL 5DMJB 1F11A 4G9FD 5JW4N 3INUL 5D1QB 3U4EB 4P4KA 4YAQA 3SDDB 3RJQB 4XWOC 2BFVH 1GGUA 2W0PA 4WEBH 5FV1L 1WCBB 3RZCB 5I1KH 1P7QA 1XCTA 1AQDB 4LASH 5F93C 4Z0BH 3MC0A 1I9JL 3WYRA 3VXPA 3ARGD 1S7QA 3QZWA 5M94B 5D7JC 4WTXA 2CH8A 3VXRE 5C08A 4KKCC 1ADQL 1R3KA 1U8LB 4WFGD 1QA9A 4RMTA 1R3IH 3QPQC 3MUY1 1UM6H 3VXUE 3ILPB 3S37X 4JFED 3WIHA 1WZLA 3PQYB 2EDTA 1D6VH 3O9WB 5D1ZD 3SE8H 2DYPD 3KHQA 4S1DC 5EOCH 4P9HC 2FATH 2XKUA 4PLKD 5EO0A 3MMEA 4YAQB 4HF5H 1U3YA 3JV4B 4X7EC 3KYKL 3UPAA 3O8XD 4LMQI 5DRWA 1GXEA 4JFYA 3ARDA 1NL0H 1M7XA 1MHHA 3OJVC 3BRFA 3HE6D 2IALB 4U6XA 5I30H 3DROA 4NO2A 3H42H 1S7TB 1J1PL 4JRYE 1LD9B 4Y1AA 3MFGB 4M93B 2NXYB 1A4KB 5HYJA 4P2RA 1NFDE 3QISA 4RAUA 1X4YA 4EIGB 4R4BB 3MLPA 2H3NA 5I8OH 3RRQA 4WDIA 1PG7H 4JPWL 5DFVC 2FL5A 4XP6H 2BVPB 2OCFD 5L8JB 1QOKA 4NQSA 1WZMA 2BNQA 5L88H 2AEPH 12E8H 3CVHL 4OGZA 1CG9B 3U48A 1WIPA 5GGSB 3O45B 4XP1H 3CSYA 1QEWB 4YO0A 3U9UA 3RTQD 4XH2A 2XPGB 4EZMA 3UMTA 4XTRC 3BH9B 3O6FB 1G6RH 3O4LD 3ESUF 4UBDC 5IKCA 4KHXL 4EN3D 1BQHB 3QO1A 1CN4A 1S7QB 2DWDB 5JPNA 3FL7A 2W60A 3WO3B 3HMXA 4NP4H 4PJIB 2AV7B 4AL8H 2IQ9H 4JFZL 5FK9A 1MFEH 2O5XL 1FV1A 2DQFB 2PCPB 2XXCB 1MJ8H 4MXQA 3BJ91 4C54A 3ROLB 3BPLC 5JR1H 4I9WD 5K59F 4GS7C 3RIFK 3U9PL 4UAOB 4LLWA 2ZUVA 1OAQL 2PTVA 4MZ3A 3TN0C 3VE0B 1I8MB 1EFXA 5IVZA 3SGJC 1MI5A 4KI5D 2VWEE 3IDUA 4NGHH 2DQIH 3EBAA 3D18B 5CKGA 4FZ8L 4XVJH 2YBRB 3LKOA 3SDCD 5GGRA 1M71A 3JUZA 3M1BB 2EE3A 3VDCA 3PGCA 4OM0H 3VXNB 5DFTA 2MQ0A 3QQ3B 3DX9B 3LRSA 1U8PA 1KCSH 2J4WH 3AROA 3TBSA 4MWFA 4XZUA 2WWMD 5IP4A 1EO8L 2MJWA 4JQIL 4NC1E 3OXRB 4GQ9H 1F13A 2GCYA 1HHKA 4ODSH 1XGQA 4AH2A 1VEOA 3DURB 3MACL 4RAVA 4ELMF 4CL7A 2OL3B 3NACH 1EO7A 5KSBA 4L1DA 2WUCL 4JFXA 5EIVA 1SYVA 5FEBA 5JOPE 1G9NC 1TZGL 1YPZB 4POUB 3MBED 4OLVL 1S9VB 2AKRA 3FHQA 3RUGE 1EEQA 4RBPK 2GW5A 3IDXH 4NHUE 4L3CA 3HRPA 1U8HA 1W8OA 3GI9H 4Z95L 1QBLL 4EN3B 1RULL 4W81A 5CHNB 4RZCB 5EU6B 2DL2A 4XC1H 1KN2L 3ALPA 3Q5TA 3D85B 4HK0B 3SKNA 4KKLC 4L8DB 5HYJB 1WAAF 4K8RD 2BRRH 4NCC1 1TITA 1DBBL 4OFKA 4UOW1 2DBJA 5D1ZA 2EDWA 2DRUA 2X09A 3EOYG 2BP3A 1BD2E 1K3ZA 2J8UA 4J3XA 1ORSA 4GAJH 1NFDF 3O45A 3WS6C 1NC4D 3ILQC 4P3DA 3ARDD 4LCWD 5AG8A 3B9AA 2FHFA 3W2DL 5F6HI 4JPVL 3OPZH 3IKKA 4UV7L 3L5WA 2DWDA 3CXHK 2CUMA 4FS0A 1A7RH 4LQFL 5FO8A 5E4EB 3BH9A 3O6FA 3PQYA 3MZGB 5GGTL 4P5TB 2J88H 1A02N 3RU8H 1T89A 1MVFA 5KANG 5L2JB 2RAMA 5EUOA 5LCVL 1U93A 1CGXA 5TF1H 4ETYA 4AM0B 4KK6D 1FNGB 4H0GA 4MCZB 4ACPA 4M1DH 4K3GA 8FABA 5FHBL 1FPTH 4F7PA 5JO5A 3N50A 3CDGB 3FFDB 2DKMA 2IPTL 5J1AA 4M1GL 4X83A 5ANMA 1BFVL 3DVGA 4ODXA 3TO4C 3O4LE 1C5CL 3RTQA 1RZJH 3EFDH 1XZ0A 1Q94B 5DJ0A 3O3AB 1KT2A 3AB0B 1OAXL 4PG9A 5D93B 3EOAA 3UTSB 2X7LA 4BSWA 3ARGB 2GUOA 3OF6A 5HHVL 3UPRA 3HB3C 2H9GB 3MYJA 4PJ9D 5K9QG 5CILH 4HFWA 4RFEA 1DANU 1A9EA 4HXBH 3VGAC 4YX2H 1J12A 4ZOEA 5CD5C 1II4E 5JZ7D 3RWIA 5JHLH 3VXRD 3VA6A 2UWEA 3F6LA 5GJTL 1MRDL 1UXSB 1H8OA 4ERSL 3TJEH 4HX1A 5KSAC 4XCNB 3QCVL 3QHZH 4RISL 4ETQB 3IFOA 4HS3B 2R39A 3QFDA 4LEOB 4I77H 5T1LA 2IH3B 4NO5A 4XHJC 7FABH 5KS9F 5DMKB 4HS8H 3EZJB 4NHUA 3EYFA 2PW1A 5IB2B 5IHZA 3JV4A 5TPWL 1I9EA 3MJ9H 1I8LC 4KVNH 3QPXH 1KTLA 3NABH 5F96H 3MXWL 3SPVA 3V7MA 1M05A 4OUUA 5JQ6L 1FNLA 3NIFF 3CFJA 5A1AA 1BQSA 4W4OC 2GJ6E 2WP3T 1JNHB 3I2CH 3B9KC 3QQ4B 3F8UB 5D7SL 2OK0L 2ED9A 2DYPA 2AXFA 3AFLA 5EU7E 1MJUH 4PLOB 5JXAH 1M7IB 2BSRB 2F58H 3K3QA 2FB4L 4GOSA 4ZFFB 4HLJA 4L3AA 3C5ZC 1ZVSB 3DGGA 1QRNE 1HXMB 5CJOL 4QCIB 1MCQA 3P3YA 5GGUA 1I1AB 1LWRA 1VADB 1SEQH 3BRDA 2R0WH 1DDHA 1FG2B 3C6SB 3LQAC 3O3EB 3JWOC 3OB8A 2NY5H 4J3WA 4D0DB 3FQUB 3MJ6A 3U6RB 2EDYA 2AJYH 5H2BA 4Y4KD 3W0WD 5E2TL 1HQ4A 1NJ9A 3PGDA 4Q9RH 1KNOB 3GBNL 4U1NB 5JORB 5J9PB 5HSFA 3AC0A 4MQXD 1GGIH 5F7FA 2X4NB 4FQ2L 4PB0H 3T0DA 4AEFA 2HTKC 4YHPA 5DD3L 1YMMD 1GAFL 3MRBB 3KPSB 5C08E 4G8FB 1RUMH 3ZDXE 1I75A 2UVEA 2A83A 2IBZY 3GSUB 4B53A 3RVXD 4XCYB 2R2CA 4JRYD 1F3DH 4LGPB 3DXAB 1MELA 4Z7NF 1A2YB 5E9DE 5JQHC 3O2WH 4NKDB 4HUVA 4OGXH 2OMNA 3GBLA 3BIKB 1RVFH 1NEZA 1W0VB 1J0HA 4U31A 1JUFB 2DLFH 1TZHA 3MREB 4X4YA 1BF8A 4JN1L 3LS4H 3CCHA 4YHNB 2FBOJ 4PRHD 3T0BA 2NNAA 2D0FA 4XCEB 3I50H 3ZTNL 5HJ3B 2DTMH 2DQUL 4U4BA 2BDNH 1UG9A 4AQ1B 1Q9LB 5CWSA 1HQ4B 3NPSC 4LRNH 4TPRH 4MJ6A 1IQDA 2GSIA 5C3TA 2OTUA 3L5XL 2V2TA 5D2LF 4P9HL 3C5ZD 4MJ2A 5DEFB 1UGNA 4IMKA 1DTUA 1A9BA 4WFFD 2FECL 4DKFH 1WVZA 5EOTA 1IKNC 3QIUD 2IMMA 4MJIE 1T20A 2C3VA 2ILLA 2VZ3A 4P4RB 4ZPVB 4Y16B 1T3FB 3HZKA 1XGRA 5F88A 5KS9E 1OTSC 4GAFB 4HH8A 3HNTL 1RU9H 1ZWIB 3H0TA 1N0XH 4KDTC 1NEUA 4LSUH 4DCQA 1JNHA 4JANB 2YPLD 3MTRA 2JJUA 1SBSH 1FQ9C 1DBML 3GZKA 3EUUA 1T1WA 3G08B 2V2TB 3LKNA 3A6CH 4WEUD 3S36X 4J7RA 2X40A 3L7EB 4LLAA 5EH1A 2AJVL 2E3VA 1J18A 5C0RH 2FJGA 2FEEL 2B1AL 3SOBL 3WL9A 1CXIA 5BW7C 4GT7A 1ZGLM 1WICA 2VXUL 3SKUD 5CILL 3NVQA 4OF7A 2CMRL 4M1CD 1R5VA 3CDFA 4GAYB 1WWWX 3QEUB 2DICA 1XF2B 1WJ3A 2NY3C 1AFVL 2VDNL 1VFMA 3K1DA 4PJDB 3KLHD 1QSFA 5HGHB 5FA3B 3SEPA 2W65B 4HKJB 4NUJA 4OZFG 5DQ9A 3HZMA 3P0VL 3DRTA 4AT6A 1J05B 4MHHI 5B3NA 3T2NL 5KSVA 4UDTA 4Z7WA 3QUXD 3KS0J 4H8WC 5EDXA 4C58B 3AREA 5C7XL 5CZVH 1ZA6A 4GW4A 1I9IL 4UILL 4S0UC 5K33A 5AWNH 4BZ2L 4P2RB 4MLSA 3PQYE 2D7MA 4O2EB 5ECJE 3S5LA 4XGZB 4L5FL 3BXNB 3VDBA 5DEZA 3C09B 4JN2B 1QSZA 4JRWA 1YNTA 5DFWH 1BWWA 2AJZB 4HH9A 4QHUA 4OT1H 3VI3F 3TFKD 5FYKL 3FQUA 4QRRE 4KPHH 4YDJA 1U3HB 3GSQB 4WW2A 3LN4B 4QTIL 2IALA 1KT2B 1KYOJ 5CEZH 1AHWB 3GHBH 4TULL 1NGWB 1NBYA 1A14H 1Q9WA 4LSDA 2YSSA 1JZ4A 5GRJL 1NGPH 1IRAY 2VR5A 2X4QA 4V1DD 3LPWA 3OKKA 4U6HA 4MD5B 1NLBL 4WWKB 4Y5VC 3T08A 4G43B 1AXSA 2VLKA 4PV8A 4S10A 3SCMA 3ZE1E 5I6XC 2APVA 1A6WL 1CDUA 3ILPA 3OMZA 1MUJB 4WWKD 3UTQA 4D9RD 4NUJB 1S9XA 3QUYC 2R29H 2ZCHH 4OI8A 4NO0A 5CFHA 4DTGL 2GK2A 2DD8L 4QT5A 5BMFH 4LEXL 4I1NB 1OTTD 5IROA 1P7KA 1S5IL 1MLBA 4PRAB 3O6FC 4XP5H 4GAYA 3EO0B 4OBRA 3VFWA 4E41D 3KGRA 3PHQA 3QEQB 4KRPC 5C9KA 3FTGB 4QNPF 1RZGB 4XC3L 1PX3A 2WK2A 5IV2A 4DFIA 1RZ8A 1RSFA 1DQDL 4NC1C 1U3HA 1L7IH 4WW2B 1S7VA 4NFDA 4XNXH 3FFCA 2LU3A 3EYQC 3VFOA 1CZ8L 5FGRA 1XIWB 3GO1H 2AI0H 3GIVA 2DQCL 1ADQH 1NGXB 2G5RA 1ZHLA 4PR5B 1FLRH 3HI5L 4D94A 4O58H 2L0DA 3BEWB 3EO1B 3VFSA 2WANA 4UT7H 5DQJB 4OSUH 3KPOB 4UOW0 1T03L 2EKSA 3ZSTA 4N5UA 5F7DA 4M02A 2WUBL 2ATKA 2QQQA 4AQOA 2BCKA 5B39A 4WFED 4JKLA 3PWPA 4OAWA 5DA0B 2R0ZH 2EZ0C 1WGOA 5CEXB 4KV5E 3Q5YA 4AG4L 4TUJA 5J4MA 5IVXB 4Z9KB 2HVKB 3VFUA 1RUQH 3OHXA 1KCVL 1RZIA 1LO4H 4ZSOA 3UYOD 3WBDA 3O4OC 1QLEH 4PGDB 1CXKA 3MUGA 1TLKA 3WCYA 1MHPH 1O0VA 1EPFA 5GGQL 5CP3H 4GRLC 3ULUF 4ZUTA 4XMLH 1BGXL 1NEZB 2HT4C 2C3GA 1I8KA 3PWPB 4K8RL 4OGYL 4LLUA 2FGWL 4TSAL 3BKJL 4DUVA 2RR3A 1VB9A 2XFXB 3BDYL 2I5YL 1VHPA 4R7NB 4KK8D 1MWAH 1A6AA 3TIEA 3CD4A 4G6ML 1F58L 3ULVE 1HILB 1MRFH 3MLSH 1UEMA 1JIBA 3CSGA 4X8JA 3V4UL 1NCBH 2H41A 4KK8C 2D9QB 4BQ8A 3TZVB 3FFCB 3VFOB 4JLRA 3NCBB 2P48B 4YGVA 5GRXG 1HWGB 1G9ML 3QG6B 4X6CA 1NJ9B 3PGDB 5D5ME 1S5HA 4Y89A 1J1OH 4ZPTA 5DMGC 4L8BB 3IB4A 4F15B 3PXHA 5ID1B 1CL7H 5C6TH 2GYSA 2BY1A 2NY4C 5LXGH 3TJHA 4KC3B 3UPCA 3P0YL 3L3JB 3UJTH 4JHBA 1AJ7H 3GIVB 1QR1B 1LO2H 3T1FB 1IGIL 3VMNA 3KPLA 3LKRB 4PJ8B 4OM0L 3P77B 1JGVL 2BSTB 1HINL 4K3EL 1OAYL 4FQQB 5A2IH 5DUBB 3BQUB 2YKLL 3UX9B 3PNWB 4OD2A 4NO0D 2XWJB 5JLZB 1MJJA 2BERA 4AH2B 5CLWA 2NX5E 3LEYH 2L7JA 3FOMA 4L3EE 4Y1AB 4TULH 5GZND 4QGTA 2ZCLH 2F53A 2Y07L 3MCG1 5F6IB 1GC1H 4PUBL 1RJCA 5H37H 1BLNB 2EO9A 4OF0A 3O41A 4OFVA 4PJFF 4LAQH 5FYJL 3LEVL 3Q1SL 3QXTA 1YYLH 2BCKB 4E5XB 4PY7A 3IETA 2E7HA 4XBGB 4L4TE 4QGYA 5BV7B 4OV5A 4H1LG 1KCRL 5C8JB 3H9YA 2IADA 3VGAB 5I19H 2OZ4L 3QIBB 1OAZL 3P9LA 4LEXH 4Y19E 5FECA 4NZRH 2G9HA 3VFGH 1GHFL 5IB3B 3DUUB 5B3JF 1N4XH 3QUZD 4WWID 3KLDA 4G6FB 1LILA 3CVIH 4IM8A 1TXKA 3JBG7 5T3XL 3MRMA 3ARWA 3SQOH 1MFEL 2O5XH 1U6AL 4LPXA 2UZYB 5H94B 5C0EA 4TSBL 4HWUA 2JKXA 1SEBA 3CLEH 5MI0B 3HFMH 3QDGE 3V52H 4OF5A 4Q6IC 3ZKSD 3VGDA 4KI5E 8CGTA 2W0KA 3MA9H 2NPLX 1OAQH 4EIZC 1EXUA 1INDH 2RCSH 3GM8A 5IESH 2XZCH 5C0ND 2M8XA 1NMBH 1MLCB 2HFGH 3O11B 3OKNA 3WLWC 4N5EC 1LE5B 2HT4D 3RWDB 4OB5H 2ZSVB 4G80B 4LRIA 3NFPA 5DZLA 2FR4A 3VXRB 5TF1L 2YK1H 4OTXH 4PJIF 1R3JA 3MV9E 3DMMB 4UQ2B 3ZYOA 3FCTB 3BE1H 3FAWA 4BQ9A 1U42A 3MRLA 5CJQH 5IW1A 2ADJB 2YEZA 1HQRA 3P11H 4ZO7A 5SX5K 4K7FA 5L7XL 1D5XA 1RUKL 3RFZC 2MKWA 1QQDB 4PJ9B 3D0LA 2DM7A 1I85A 4RA0C 4JGJA 3DHJA 5KN5B 1AHWA 4GKSA 4EXPX 1PEZA 5JMOC 3MACH 3BKML 3IETB 3DV4B 3TLRA 1N3NB 4LFHG 1MHPL 3U7YL 3WN5A 3NAAH 2H9GA 3MYJB 1DBAL 4LNVA 5ENWB 4ZAKC 4WHDA 4NRZA 3HC4L 1D9KC 4PJEF 3CDYA 3IDGB 4R8WH 2F53B 5I74C 4GKZB 2W07A 4NQCA 3G5VB 3LQAH 3SO3B 1SJHB 4MNQE 2EDEA 2UY7A 4MNGE 5F3BA 1LE9B 3HC0A 1GGBL 2BNQD 3DLQR 5JHLL 4XCCL 2VC2L 5CINL 3KJ4C 1G7MA 5FIEA 5I8CB 2XZAH 2AXHA 3DIFA 25C8L 2L7UA 3PJSB 2UVFA 3QXWA 2WIMA 1ES0B 3LPFA 1BP3B 4M7LL 1PZ5B 4W4NA 1I9RL 3IGAB 4N8CH 1Q38A 4EI5D 1CICB 1RIVL 1N5AB 3DXAE 1RZFH 4ELMA 3QPQD 5J3HC 4RRPA 3B2UC 3WLWD 4PRBB 2YD6A 1IGFL 4Y4KC 5TDOB 2VDLH 3MA7A 1KGCD 5GS2D 4HBQA 2WSKA 2AK4E 3F7PC 4X5XA 2HA1A 3ME0A 5HYJD 5JOPD 2OBGA 5LBSH 1W72L 1EHNA 2VXVH 4M9PA 3IVKA 2G60H 2R1WB 4P46C 4Z8FH 5B39B 5FGCE 1A1MA 5JXAL 1JL8A 5HPMA 4HWBL 5ESAB 3GDBA 4Q9QL 2QHRL 2ZOLA 4IOFD 3TBYA 4A6YH 4J23A 3TM6A 1XH3A 4I0PC 2E9IA 3DTXB 2JB5L 3BP4A 4G9FE 1KCGC 2MHAA 4KGJA 5LWYL 4EN3A 2DAVA 2ESVE 3RVXC 2XZZA 3VWKC 2F8XC 5DHVA 3T0EC 5C0CD 5CS7A 4JFFD 3EIFA 5F1OB 5CSBA 1NH6A 5ITFA 3O9WC 2VWEC 1O7VA 1Q9OB 3BIBX 2HN7A 1C7TA 1JHLL 4ELKB 5TE6H 1ZHNB 3DRQB 4RIRB 1W8NA 4ZFZB 3HS0A 3GIZH 3K8LA 3QWOA 2Q76A 3REWB 3ZDYE 1F6FB 3QH3A 4G42A 4OV6F 3IDMB 3SDXE 5TH2A 2G2RA 2P8LA 4I5BA 4IRJC 1C16B 3WDHA 3B9EA 4LCYA 4M48L 3DTXA 2JK5B 3FB8B 5D1QC 1S7UB 4WV1B 5ICXB 2DQDL 4I3SL 4PJDE 3QXAB 7CGTA 5IHUH 1EJ6A 5L0QC 3FB7B 3KPNB 1ZLSL 1YY8B 2Y1VA 3EOBB 5CEYB 5MENE 2DL9A 4Z7UE 1CD9B 2ZNXA 4PD4K 4DUXA 5HVFB 3WFDH 3EYFB 3OXSB 3WJJC 5I16B 3LEXB 4WI6A 1QFOA 1U8MB 4OI7A 4LLDB 5CGMA 4OUOA 1BD2B 1T66D 2JJSA 1KLUA 3KPTA 4HS3A 3WO4C 1U0QA 2WQRA 1WBZB 3O3EA 2GKIA 4CU7A 2YK1L 2IMNA 1OGTB 2DN7A 2DQGL 2JB6B 4PS4L 2J5LC 1G0DA 1KJMA 4DKFL 4HIHA 5D2NA 4G6KH 3DVIA 1FFNA 3P11L 2GJ6A 4HBCH 2A9NL 3KLSA 4N0FA 4JFHE 1WC7B 5H8DA 3RWHB 1J05A 4D9RE 1K8DA 3MCKB 3T04D 1G7QB 3ZKND 1I1FB 1YEIH 1A7OH 1UKSA 5C2UB 1FVCB 2P24A 3K74B 4P5TA 4N0UB 1MCFA 4IS6A 4LIQL 2QQKH 4KFZC 3WD5H 2GJZB 1RK0B 1AI1H 3HE6B 3ZZ1A 5I1KL 5CSZA 4HDIA 4MJIA 4BJLA 5IEKA 2AGJH 3O8XB 2DIAA 4YQXH 3QDJE 2VDQL 1DQLH 3VA2C 2V7HA 3KPRB 4PTTB 4J8RA 3H9SD 5ESVA 3Q6FB 5DRZA 3O3UN 4APQA 3NA9H 4O9HH 4XMKL 2Q7YA 4R26H 2R1XB 1FORH 4YHYC 4ZOAA 1EEYB 1QZ1A 2NTFB 4Y2DB 4FN0A 4JFZH 3PL6A 3QQ9C 5JPMA 3EYQD 4MJ5B 4P99A 2ZSWB 1QSEA 3HI1A 4PV9A 2N7BA 3R1GL 4Z7NE 5JR1L 3DX8B 3X14B 1RURH 1FL6B 3U9PH 1UB5A 2V5TA 3MV8D 3Q6GL 3R4DA 3C60A 4NM8H 5EWIH 4QWWC 2JK5A 2XRAL 3PG2A 1A4JA 3RZCD 1U8OA 4PJAA 2EH8H 1D5ZB 4S0SD 4TPRL 1F4XL 4KK9D 2NXZD 5DJ6A 4PLJC 4OCSH 4F15C 1DQJB 1JGDB 4FNLH 4S1RH 3QULB 5EORL 3D2UA 1SEBB 4CBPA 2GI7A 4E41E 2VXVL 3MRGA 1NKOA 2C7UA 2APXA 43CAA 5DJDA 4MJ4A 4TOYH 1NLBH 5BV7H 3CFBA 1XF4A 1KXQE 3HN3A 1T1ZA 4OFIA 3U0PA 2RIKA 3STZA 1R3IL 3SHSA 1FVCA 2P24B 4R96A 4UINH 4ZTOH 1KBGL 5F9JA 3I6KA 1JNNH 2MHAB 3VXUB 2ZCHL 3CMGA 1V7NH 2Y23A 4TQEL 1A6TB 2FATL 2IADB 5HHOD 4CAGA 1G6RL 2YRPA 3HPJA 3OKLA 3U7AA 1JPFA 3VE0A 1T2JA 2Y25A 5I9QB 4XPTL 4YHPB 4XPBL 1BVZA 2JB6A 3BD5A 2CRYA 5ADPL 3CFDA 3OKMB 5I30L 3KNBA 2HWZH 1G6RB 1CGWA 4KTDL 2CKBH 4HW6A 3MQIA 3IXTB 4I0KA 4HWZA 4OLEA 3X11A 5HGDA 1B9ZA 3TBVA 2Z92A 1TENA 1BD2A 4OKVA 3LKPB 2NY0C 3K8MA 4Y16C 3P9WB 3BPNB 3SGKC 2RGSA 4ZNEA 1PG7L 2UUDK 4Z0XA 4JZNB 2BVTA 3EKCA 4FQQA 1DCLA 4UQ3A 5C0BB 1RJYA 5CEYA 5IB5A 5FF6B 2BC4A 4N0CA 1KB9K 3H6JA 1GPOL 5J11B 4NUGH 5F9JB 1KELH 2IBGA 4X6BB 3RQ3A 3PABB 3U0WL 2R2EB 1AKJD 5FO7B 2P8MA 2OI9C 2VE6A 2BNQE 3EYUH 3OSKA 4NKQB 3L1OH 4ORGB 1CDGA 5T3ZH 1IGJA 3ZL4H 2DQFA 3QWQB 3BPNC 1I1CA 4MNHB 2D7PA 2DDQL 4XPGH 4FFVC 3RNQB 5DS8A 4S1QL 2IQ9L 4WI2A 3PWVA 4PJIE 4E42A 5F3BB 1LO4L 1U8KB 2EKJA 4FTVB 2J8OA 2NZIA 3LOWA 4KRPD 3LKSA 2ZUXA 4FFZL 5D6DA 4NO3A 4C56B 1FPTL 1V5JA 5B8CB 3DI2B 5T5NG 5TJWK 4F9PC 1PFCA 1IC4H 3L5HA 4GUPB 2VO5A 2G75B 3O0RL 4AZ8A 1CR9H 4IRSB 5ERWA 1ITCA 2HJFA 1NBZB 3GI9L 4I2XE 1OAXH 1JRHI 3OKLB 2B2XH 4NWTH 4P2QA 2NW2B 1D6EB 1OP5K 3IFNH 1C8PA 4HV8B 3GM0A 1JWUB 3TPKA 3MLVL 3S35X 2LVCA 5IBTL 1AC6A 2DQTL 1SY6L 2BHYA 4P2OC 3T65A 4WFFE 3IJSB 3B9KB 1NAKL 3IRZA 3HUJA 1XF4B 2AGJL 1P7QD 4XC3H 1JYVA 3STLA 4Y2DD 4WI7A 2XN9B 4MQSB 1EGJH 3ARGA 3L3IA 2IAMA 4JPVH 4YIQB 2A9MH