5ACZA

Complex of a b21 chicken mhc class i molecule and a 11mer chicken peptide
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
269
structure length
269
Chain Sequence
LHTLRYIRTAMTDPGPGLPWFVDVGYVDGELFMHYNSTARRAVPRTEWIAANTDQQYWDRETQIVQGSEQINRENLDILRRRYNQTGGSHTVQWMSGCDILEDGTIRGYHQAAYDGRDFVAFDKGTMTLTAAVPEAVPTKRKWEEGGYAEGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCRAHGFYPRPIVVSWLKDGAVRGQDAQSGGIVPNGDGTYHTWVTIDAQPGDGDKYQCRVEHASLPQPGLYSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC CLASS I ALPHA CHAIN 2
publication title Complex of a B21 Chicken Mhc Class I Molecule and a 11mer Chicken Peptide
rcsb
source organism Gallus gallus
molecule tags Immune system
total genus 61
structure length 269
sequence length 269
ec nomenclature
pdb deposition date 2015-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5aczA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5aczA01
4I48B 1YMMD 5DLMH 4JVWA 4X6DF 1TTFA 4ODVL 5EU4A 2X70A 2ZWLT 4P4RA 2F8VA 4X98A 4PJCB 5JW3H 2ENSA 2H9GA 3CX5K 2H26B 5J57B 1NGQH 4X6BB 4HSQA 2X4OB 1NCCH 3P2TA 2DQHH 2RQ8A 4ODHL 4F7CA 4BZYA 4NQEB 3D39D 4P57A 1C5BH 1JGLL 1UADC 2EDOA 3B9VA 4P2QD 4CAGA 4E41A 4WWKA 4OCLC 2N7BA 1AHWA 5DO2C 4EKXA 4ZAKB 5CJOH 3BDBA 5GGRB 4U6VL 3NPSC 2J12B 3QCVL 3ZE0F 4U7MA 2VE6A 5DK2A 5IB3A 2G5BA 3WFBL 1IKFH 1MAJA 1F90L 4ZTOL 1KBGH 5CWSB 4U1JB 2EDEA 2E8YA 2X41A 4HBQA 2HFGL 5IKCB 4OLEA 1M1SA 3IB4A 3MBEA 2NY4B 2RJMA 2BNRB 1BOYA 3HFMH 4PJ9C 4AL8L 2YN3A 5I1LB 2NNAA 1A9EB 2P5WE 1ORSA 1AO7D 4LSPH 5I16A 2GJZA 3MROB 1YA5A 2FD6H 3KS0J 5GRVL 3RQ3A 4PRHD 1DBKL 1BVKB 4OKDA 1QSFA 4JPWL 1WAAE 2OTPA 1XGRA 2OJEB 1NGWB 2J6EH 1Q9WA 1CQKA 1DBAH 3E8UH 1D5IH 2AXGA 4LVHC 4YXLH 3L7EB 1ZLWK 4L8CB 3G6DL 4OZGA 4OFVA 5GRWA 2BVEA 3DXAA 5JZ7C 5EU5A 5KS9F 4NQSB 5SWZB 4I0PD 2NY6D 4M5YH 4P9HH 5DQJB 2XQYG 3RVVC 3KYKL 3F7PC 3CC5A 4JJHA 1J1XL 1FPTH 1NUFA 2DQCH 3S36H 1QA9B 3U9UB 4CDGC 1OAXH 4CVWA 3VW3H 2ADJB 5BS0A 2ZG3A 3IRZA 1N7MH 5FM8A 3C6SB 3NH7H 2FLRT 1Q0XL 4MXQC 2FJFA 5L7XH 3VGEA 4HXBL 1AXTL 1DANU 2CDGA 4RSVA 5D7IF 1MCKA 5ILTH 2V9TA 1C16A 5DJCB 1G7HA 2PW1B 1BZ9A 4GG8B 4LHUA 1T3FA 5I1IH 4MZ3A 4EI5B 5DJ6B 1AXSB 5D93B 3OMZA 3LS4H 1YEGH 1M7DB 2W9EL 3KR3L 4JKMA 4M7KL 2X2YA 3VXSD 1ZGLA 4K7PH 1FNSL 1P84K 1U8MB 4XHJC 1HEZA 4NC0B 4YLQT 5F9WC 2ZUQC 1YUHA 2Z31A 1CDUA 3SPVA 4X0KA 4U1GB 5FF6B 1NH6A 3D1MC 1L0QA 4Q2ZB 3RL1A 4LLUA 2Z8RA 5TGBB 5D2NB 1KIQA 2DJUA 3SDDA 3MOQA 3SQOH 4YE4L 2FWOB 2HLFC 4RMTA 2GAZB 1UKQA 1F8TL 1JHTB 3KWWB 4K71C 1WCBA 4PRIA 2KUTA 4S2SA 1A3LH 1OM3H 2ZNXA 4WRLA 4XWGL 4DKFH 4ODTH 2OBGA 1MREL 4NCC1 3TZVC 1GGYA 3AB0C 5F6HI 3M45A 4MJ6A 5BV7H 2HT2C 3S9DB 3HNTH 5J06A 4LCWE 4LLVA 3ARED 4HWBL 5DFVD 4MXWL 1I7ZB 3QNZA 1J86A 4JPIA 3L5XL 3WJLA 3MJ8B 4N0FA 4Y4KB 5K33A 1JI2A 1JVKA 1XMWA 4FNLH 2CGRL 2BHUA 4NP4L 3AROA 1NKOA 1BOGA 3JV4B 4PJEA 3MRNA 5TFSL 1C12B 4P46B 4RISH 4D9QD 2GHWB 1OAKL 1JMXA 1A7QL 4FQJH 4OZHA 4YXHL 5D96C 2FO4A 1IM3B 5FA4A 4XCEB 5IHZA 3FMGL 3JV6A 4I18A 1UCBH 4O5LL 3MACH 1VFBB 5J3HD 1RU9H 2P48B 1YC8A 1FIGH 3BKCH 4QY8B 3H42H 3WSQH 1OD7A 2Y5TB 4FQXD 3TO2B 1UWGL 4ZDHB 3VH8A 5GS0C 3FOMB 4JO4H 1HH6A 3RVTD 3SDCA 1B6DA 3X17A 4FXLA 1KC5H 4HIJA 3WNKA 3LV3A 3IYLW 5KSUB 3FOLA 2ARJB 1BJ1H 3DX6A 3H2WA 1JCKA 5ESVA 5FA3B 1P7HL 4GAJH 2E5EA 1ZHKA 5ID1B 4QYOA 5EOQL 4XPHH 4P4KB 3MNWB 2FIKA 4HG4K 3JWOL 3QXTA 4TQEH 1G9EA 4DQOL 3HMXA 1IC4H 4ONHB 1F3JA 4QTIL 5L2KE 3PG2A 1QUNA 2VDQH 2ATKB 1QBAA 5I1KH 4FMFA 5E4IA 2OL3A 2AJUL 3VG0H 5E9DD 1I9JH 4Y1AD 1BFVH 4YBQC 3FRPA 1XIWA 4XP9H 2WZPD 2R29L 5CZXD 2ATPA 5FGCB 1S7TB 2R0LL 4X4YA 5BVJB 4XXDA 3WNMA 2RFXA 4PBXA 3W39A 2O93L 1BGXL 4IDJL 3T0ED 4NQDA 1XEDA 1VEOA 5BW7A 4J4PD 5GGSB 4U31A 1IAKA 5DRZB 4I3GA 5E5MB 2ICES 3LB6D 5DJ0B 3DIFA 3QQ3A 3I85A 4FQ1L 3MRRB 5I75B 1X6NA 3B9KA 5ID0A 1KTLA 4M4PA 4D9LH 1GGIH 4ZAKD 5MHSD 2W0FA 1NFDA 1N6VA 3B9DA 2FJHA 1OP5H 4GXVH 4M7ZC 3UAJD 1BECA 1MQKH 3UBXI 4JFPA 4NQCB 4MJ5A 5F72S 3RWGB 2BSED 4UBDD 4YHKL 3D87B 2BNRD 4OZFA 4YQXL 1GJIA 4JLRB 3QG6A 1UYWH 1KXVC 3RNKA 4PGJA 5DVNA 4KK9C 3VFVB 5H2BA 3ZLQC 1T0NA 2F5AH 4WI8A 1N3NB 4S1DC 4F7MA 4O2FA 2IEPA 4PGDA 5D7KD 1NBZB 3REWA 4DUWA 2CK2A 4ODSL 5BV7B 5IJVA 3D39A 1PQZB 4JQXC 1F4WH 4NO0D 5FV1L 4F7PB 5E8NA 4HUNB 3RTQC 5J4MA 2A83B 1OLLA 2GFBA 4WU5B 1I9EA 4DFIA 3MLXH 3C09C 4HUKB 5IBUG 2F8XC 3CH1B 1NEUA 1VPOL 3VXNB 3DX7B 2DQGL 5SWZD 3BE1L 4OGXH 5HVHC 1YJDH 3P0VL 12E8H 3ARBC 4GQPH 4NSKB 3ARFD 3FFCE 3QPXH 4E0RB 1MVUA 1U8PB 3PHQA 4NQVB 4Z9KB 5D72H 3W2DL 3BZ4A 4ZFFB 3S3JA 2A9MH 3FB7B 5AG8A 5FHBH 4DVRH 5C0EA 3D3VB 2VXUH 2FB4L 1AO7A 3ELAT 1RUPL 3GSXA 1DQQA 1WTGT 5IQ9A 2CKBL 1UJ3C 2FGWH 3TBSB 4B7LA 32C2A 5EBMA 4A2LA 5KSBA 1R6VA 4Z7VA 1AE6L 5JQHC 4NWTH 4KJQC 3TA3A 3UYRL 3FT4B 3M1BA 7FABL 3V95A 2HH0L 1WBXB 2AJ3B 5H8DA 1HSBA 4LLYA 5FYKH 1NGPH 3IAQA 4PG2C 4M7JL 1MFAH 1QSVA 4OFIA 2R69H 5IHUL 2WUBH 4RGNE 5C0CE 4XC3L 2IAMC 3WIFA 1UB5A 4QRTA 4DEPB 4XXCC 1ORQA 3L3GA 3WE6A 2NXZB 4R7NA 5DI8A 3WFEL 4XMLH 3MRKB 2X1XR 5DQ9A 4IDLA 1ZLSH 4EJ1C 1I8IA 3OAUH 3DX8A 3MJ9A 1OAUL 3EDJA 3L5WA 3UTSE 1EXUB 5GJSL 3T0XA 2IH3A 4JFHD 4LEXH 4EN3D 2YA0A 3O81A 4H20L 4ZS6D 3WDJA 3DHMA 1D5BA 5I1JH 3RKDD 5E2WL 3SGEH 1QVOB 4ZQKA 1DQDH 2Q3ZA 2VLKA 1HILA 4JQVA 5A3ID 1V3JA 2I07B 3FQRB 1MCSA 4M9OA 3RAJL 1B2WL 2Y07L 2EDHA 4NC1E 4Y88A 4UT7L 3HPLB 4KRPD 5D1XC 5T1LB 5D6DA 3BZFB 2EE9A 4MAUL 4XPAH 5FOBB 2FR4B 8CGTA 4OUUA 1G7QB 2FHCA 3QDGB 4CVUA 1SVCP 2VXQL 4HPOH 5GRVK 1ES0A 2B4CC 3HC0A 1FAIH 3CFBB 1C5CL 5F3BA 4HC1A 3CX2A 3VCLB 4X5WB 2P8MB 1CI5A 4DN3L 1L7IL 2J8HA 2XXCB 1BEYH 3BWUC 1KG0B 2IG2L 3MV7D 1JMZA 3WS3B 4M1DH 3QNYB 1LEIB 1KCRH 1C1EH 4XCCH 2YUZA 4XP1H 4ZFGL 5FKAA 5HY9A 3VGHA 4ONGH 3L7FA 1DEEA 1SYVA 1DN0B 3RUGF 1MFDL 1PEZA 4UILL 5ISZE 1ZT4A 2X70B 4XNZC 5BMFH 2YEZB 1EDQA 4X98B 3ZE2F 2VZ1A 3VXRE 4XP4H 1AIFA 2DL2A 3O2WH 5IW1A 3LIZL 4PJDA 1U3HB 4F7CB 5C2BH 1TJHH 3NAAL 1EIBA 4M4RA 3RDTD 2DTMH 5DJYA 3SDYH 2EDWA 3ZL4L 4X6EB 4PYGA 1F13A 5HGDB 3U7AA 1ONQA 4X6CF 2R8SL 1MFEL 4E41B 3ARDA 1JFQL 4WTXA 4RGOL 1ZEAL 3MJGX 1AHWB 5LQBH 4K23H 3HN3A 1FFQA 3U30C 1A7PH 1U41A 3KPQA 4TSBL 3RPKA 5DK2B 2VE6B 5IB3B 2VAAB 3SDAD 1QSED 2ESVE 3NGBC 4JGMA 4K3EH 3V0VB 3I3BA 1Q72L 4FQXA 4KUCD 3MO1A 3GMOA 4Q9CA 5DD1H 1DQML 3VRJA 2WINB 3HI5H 4MGXA 1KFAH 3PIQA 2WBWB 3N50A 4MA7H 2D0HA 2BVQB 5AUMA 1T2JA 1ORSB 2AJYH 1JZ6A 5LAXA 4GRWE 4QRRA 3FQNA 2GJZB 3TN0C 4PJ8C 1QKZL 3WEXA 1ZVSA 4K94H 1DJSA 5I1AB 1J12A 4D0CA 2PUQT 4ELKA 1TJIH 1A6PA 1KB5L 3LQAL 4XVSH 3KHQA 1F2QA 1T1WA 4L8BA 4M93C 1Q9WB 4F57L 4GS7B 2AXGB 4MNQE 1YEKH 1YEHL 3PNWA 5K9QI 1BFTA 4KVCH 4YDVB 3HMXH 3MODL 4OZGB 2CLRB 3NFPB 1P4BL 3DXAB 2NR6C 2OL3H 4RRPA 2F15A 4N5EA 3QIWA 3O11B 5D2LF 3FN9A 1KTRL 1IC5L 4Y2DC 1SM3H 3CC5B 4FFEX 4IRSD 5HXMA 4ZTPL 3EJYD 5DJAA 3EBAA 5C0GA 3W11C 1U3YA 2ZPKH 1KJ2A 4E41E 2CDGB 4N90D 3S37L 1C16B 2OR9L 1G7HB 1NUDA 4K9EL 1BZ9B 4LHUB 2VXTL 1JN6B 1T3FB 4LRNL 3LEXB 3MLYL 1IL1A 2ICWI 1GGCL 4Y4HD 1ZGLB 3G9VA 4IRJD 4JZJC 3PHSA 1ZSDA 4HX1B 4R8WH 1CTNA 1YUHB 4S0TD 2DBLH 2XRAL 4ELME 3QHFL 3SPVB 4UQ3A 1NDGA 3EYSH 5A16B 3RL1B 4LLUB 2LABA 4OZFH 1R0AH 5I15H 1KPUA 1KIQB 4XNMA 3F5WA 4AEEA 3U6RB 1RZFL 4PJ7F 4PUBH 3PV7A 1PW3A 4UTBL 1WCBB 1P4IL 5B39G 4X7SL 4KDWA 4S2SB 1LP9A 4EDWL 2H32H 1QSFE 4P59H 1G9NL 4MQTB 4YHNB 1RUKL 2Q7NA 5DZOA 4JFZL 5AAMA 4U1LA 4FFWD 4MJ6B 3EDEA 3KYOA 1WT5A 5CSZA 1RJLA 1NCWL 3QNZB 4JPIB 3C5ZB 2NXZD 3SKJL 1OW0A 4EXPX 1FN4A 3AU1A 4TSAL 3FJTA 4F33A 1FL5B 3VI3F 1BOGB 4PJEB 3MRNB 4RMSA 2MQ0A 3MNZA 1XZ0B 1Z9LA 3QDME 1IT9L 3LPGA 3RL2B 2I60H 3BWAA 1HYSC 5IHZB 4D94A 3JV6B 4I18B 5BS0E 1GGTA 3V0WH 3X3GL 1CWVA 2P46B 4N0CD 4TVPD 4Z8FL 3BIKA 3UC0L 4OKVA 3T3PE 1RUMH 5I1GH 5FM5O 4M6NL 4R2GB 2QQLH 4K8RH 5I71C 4TSCL 3WHXB 4BUHA 1ZS8A 1MF2H 5ACZA 1TZGL 1NAML 4JRYE 4K3JL 5IVXE 3E6FA 3LV3B 3FOLB 4ZOAA 3IT8D 3DX6B 1D5MA 1IEHA 1ZHKB 4MD4B 2XN9B 3UXFA 5D7LE 2WQ8A 1KXTB 5C07D 2FIKB 3HZKA 3IDJA 4XNXL 4X99A 4Z7QE 1T04A 3VFGH 4JM2A 1F3JB 5CSBA 4PRIE 4HKXA 3MV8D 2OL3B 1LO5A 5EU3A 1UQSA 3N1FC 3CDYA 1MFCL 4DW2H 3MJ9H 3QO1A 3GIZL 1XIWB 4OZIF 3WO4C 3C08L 5I6XB 2OMBA 3DV4A 3BH8A 4X4YB 4ZO8A 4XXDB 1FBIL 2J88L 4KK6D 4DGYL 2RFXB 3W39B 5CBAA 1NC2D 1U3HD 4NQDB 1WZKA 3UROR 3OGCA 4QOKD 3WD5L 4PJEE 2A77L 2Z35B 4HV8B 1T0MB 3K80A 3PWVA 5FHAL 3DIFB 3QQ3B 3GI8H 4OIIL 4NRZA 4OZHE 3B9KB 5B3JF 1HSAA 1KTLB 4PLKD 4HS8L 5DK0B 4NFDA 3H3BC 4CJ0A 3SY0B 5TJWK 2I5YL 5SWSB 3OHXA 4NZJA 5MP6H 2YPVL 2C3HA 3ZKMD 4HC1H 4UOW0 1F00I 4JFPB 1ZWIA 1IGYB 2R9HC 5JOPD 4TRPH 1ETZA 4EDXA 3N1PC 2FX8L 3QG6B 2GYSA 4UQ2B 1J8HE 5HI5D 2B5IB 3RNKB 4WEBH 2E9BA 3NCCB 3P0GB 5M95B 4HWUA 5H2BB 1T0NB 1CFQB 2H32B 2YRZA 4G8GA 3U7YH 1BQHG 3MRMB 1FORL 4PGDB 4XCFL 1P5VA 4DOHB 4L3CB 3EHBD 1J88A 4PDCE 2VZ3A 1VCAA 3H9HA 3P4NB 2HN7B 2H2PC 1T2QL 1GYAA 3MRQA 5ALBH 4UINH 2C1OA 4WJ5A 2ZJSL 3KLAA 5E8NB 4PTTB 5TE7H 4NGHL 4GAYA 3V7MA 5L0QC 1OTUC 2GFBB 1A7BA 4EZMA 3GSOB 2AXHA 2QKIA 1BZ7A 1MJ8L 2CLZA 2VDOH 5AZEL 2CR6A 1MCQA 2F54B 3GB7A 2UWEF 1MLBA 2WQRA 4NQUA 5I73C 1INEH 1YEFL 2IBGA 1EUUA 2YUXA 1NLBL 2NY0D 4AENB 5F96H 5IBTH 1MVUB 1AD9B 3UJIH 3EFDH 4GXUN 2J4WH 3BZ4B 2MMXA 2J5LB 3HR6A 1K5NB 3DMMD 3K74B 4KJPD 3VWJA 5C0EB 2FEDD 4GQ9H 1IGTA 5JTWA 3ULVD 2GKIA 3GSXB 2YWZA 1DQQB 3QIBD 4EUPA 3ZYJA 4J2XA 1UKSA 4Q9QH 1SMAA 4P2RD 1MNUL 2R1XB 5HHNA 1NFDE 5B38B 1N0LA 3TA3B 4MA8L 1W8OA 3WFCL 3G5XA 2VAJA 5DA0B 1W0WB 1ZLVK 2VDMH 5JO5A 1OP3H 1T5XA 4OFYA 3GSNH 3QZWA 2R2BA 3TPUE 4FZ8L 4QRTB 3L3GB 3WE6B 3SCMD 5DI8B 1VFUA 2RIKA 3CH8A 5DQ9B 3DTXB 3EO1A 3DX8B 2QR0A 4J3VA 3RA7L 4BJLA 4NRXA 1A6TB 1X5XA 4PB9H 2IH3B 4MHHG 1DP0A 4PJHA 4WTZG 3NABH 5DJXB 4X7TA 1PY4A 3MUZ1 3D39E 3ARQA 1ND0A 1NL0H 4HIHA 5FYJD 5JDSA 2ADIA 2ADFL 4QEGA 2VLKB 3GDBA 1HILB 2IAMA 2Z91A 4C56B 3HE7C 3QT2A 3ROLB 2V2WA 5I19L 3LD8C 3IF1A 1I3GL 3BAEL 4KHXH 4OLUH 2YXFA 3G5VB 5KVEH 3ILPA 2DLGA 2EXWC 2K9UA 1CXEA 1KJ2H 3HCVA 4HF5L 4R90L 4WCYH 1YNTA 1S3KH 5HBBA 3BISA 5GS1A 5DDHA 4RIRA 5TPWH 4IRJA 4QXUH 3VFNB 1GIGL 1TZHA 4G3YL 1ES0B 4YX2H 1TFHA 5LBSL 1N0XL 5ITFA 5F3BB 3ME0A 4RX4A 2P43B 1MI5D 1AO7E 4G9DA 4RMWA 1N4XL 5GS2H 4LVOC 4CL7A 3U1SL 3QEQD 4F7TB 3MLWL 1IQWL 1NUGA 5FUZL 4KI1A 5E2VH 2DQIL 3VW3L 5KSBE 4Z7VE 4PRHE 1DLFH 2X1OA 4OD1H 3BJLA 5HY9B 1SMOA 3ARGD 3L7FB 1DEEB 2PO6C 3QQ9C 3IJYB 2EYSB 2BVTA 1MPAL 4TUOA 1ZT4B 5E70A 1FO0L 1UCTA 2ZUYA 4BQBA 5KSAB 2XN9D 2DF3A 3QUYC 3HZMB 1IJ9A 1HHJA 1R3LB 3BPOB 5FECA 1K85A 3A0OA 5IW1B 4PJDB 3IDXH 3WXWH 3MLZH 5L88L 2BJML 1ZE3C 4WUKL 4JQIL 1NJ9A 2V17L 3TWCH 4UB0L 1XGTB 1ONQB 2VISA 3WN5C 4MLSA 3S5LG 3ARDB 5C3TA 5T5NF 1AGFA 3MRJA 5D5MF 1FFNA 4OQTH 1MAML 1PGRB 3WJJC 3RHWF 4RGMB 1XT5A 1ED3B 3MRIA 1A3LL 2AJZA 3KPQB 4UV4H 1WC7A 4F80A 4WVRA 5KBNC 4NRYB 4UI2A 1AQDB 2XA8H 3QDHA 5TQ0L 5CEXA 3PWUA 2ZUXA 1P4LA 1SQ2N 4LSDA 2YD7A 5FAAA 3BQUC 3VXSE 3PIQB 5AUMB 5CJ5A 1JRHL 1XR8A 4LCCA 4MAYD 5LAXB 3FQNB 3RGVC 4LSQL 1RULL 1I7TA 3WEXB 5JQ6L 4HS3B 3SGJC 3FKUS 2DQTL 4QO1A 5C07A 1M7IA 4J8RA 1UM6H 2JLLA 4ELKB 3AY4C 1HCFX 2I9LA 3PXHA 3GSNB 1EJOH 2R56H 2F9BT 1YNLL 1E6OH 3O6FA 3CDCA 1KN4L 2X1QA 1UZ8B 2X4SA 2A73A 3PGCA 3G6JF 3MJ6A 1SJVA 2VQUA 2Z92A 1ADQL 3VWKD 5B21A 3S8WA 4HHAB 4PTUA 4JPKL 1IGMH 4LPUA 4I0KA 5E6IC 1NC2A 4CN6A 3CMGA 5CD5D 3QAZC 3T3ME 3WDIA 3TNNB 3GI9H 2BK8A 3PWPB 4LVHB 5IFJB 2D31B 1UH3A 3B5TA 2X05A 3EO9L 3DYOA 3MRGB 1CLYL 1P2CA 5C0GB 1JRHI 2E9IA 2NX5B 3OKNA 4NOBA 3T1FA 1KJ2B 2R4RH 4KJWD 5BVPL 3I2CH 3O3AA 5D1QA 4CVZA 1NEZB 2F54D 4PJBB 3MOBH 3CSBA 3KPMA 4ZXBA 2KBGA 4GKNA 3FB8A 4XPBL 3C9NA 1RUAL 2V5RA 4M5ZH 2NY2D 4Y2DA 1LNUB 4UV7L 5IQ7L 2Z8WC 3MCLH 4WFED 3QUZC 1FCCA 1D9KC 1ZSDB 4QRSA 4Z0XA 5EUKA 5D7JA 4F58L 3RY6A 1QG3A 3LEYL 4H8WH 1DLHA 3KJ6L 1MSPA 4QRRE 3WIIH 4FFZL 1AY1H 3ZT5A 1Q0YH 4GSDH 3TJHC 2VZVA 1LP9B 1KPVA 6FABH 2F53B 3KDMA 5IGXH 3SOBL 4CMHC 1NLDH 2G60L 1MRFH 1U95B 1NFIA 1OARL 3NIFE 5E9DE 2OTUA 4KRMB 4OF8A 5CSZB 2E9WA 5HDLA 4L3EB 2H8PA 5C0BA 4QTHA 3ZHKA 1FP5A 3DSFH 3OR7B 4ZODA 3QXDA 5E2UH 4F33B 1GAFL 4HCRL 3MRDA 1A1OA 1MWAH 4K71B 3I6LE 2OQJB 3E6HA 3V6BR 4UNTA 4MVBC 3VD9A 2HT4C 3T0EE 1AP2A 2JIXD 3OF6D 3GBMH 2A9NL 1XF5A 4J12A 1U8IB 3AB0B 4HPYH 2KKQA 1KCVL 4P23A 5CEZD 4GMTH 4IEFB 1JGVL 5AWNL 3ZTJH 1HHHA 1HOCB 2EICA 4C56D 1G7PB 1RPQA 2IPUG 3G08A 4Q9RH 3QIBA 4NN7C 2BP3A 4KKBD 5IB2A 4P9MH 4MYWB 3BIKB 3VFRA 3NA9H 4P2RA 5MHSE 3V9FA 4OKVB 1RI8A 2CMRH 5L6YH 3L5JA 3GJFH 4M62H 4AG4L 5HPMB 2XWJA 4NNXA 4EUPH 4LAQH 3S96B 1WFOA 3U82B 4E42A 3WL9A 5D96B 3X13B 2HJKA 1JZ7A 5ACZB 3BW9A 4Y19A 3R0NA 3E6FB 1EJ6A 4PBWD 1A64A 3P11H 1D5MB 5GRUL 5JHDB 2A6DB 2GCYA 2W60A 5J7CC 3NPZB 1ZHNA 3HZKB 3OX8A 3IDJB 4L9DA 1OVZA 3S34H 4X99B 1T04B 4OAWA 4NO5A 3I3EA 5D7KE 2MQCA 3D85A 5DURD 4JM2B 5HYEA 3MUY1 3JVGC 4HIXL 8FABA 4HKXB 4YK4C 5EU3B 1UQSB 1Z3GL 4XBPA 5HYJB 4KTEL 4D8PB 3QO1B 43CAA 3I50L 3F65A 3DV4B 2QADC 3BH8B 4X4ME 4I3RL 1H15B 1KEML 3UTPD 1KN2H 4GRMA 4FG6D 1SYSA 1EEQA 2Q87A 3JWOC 2QBWA 2NPLX 5HHVH 1JHKL 2XTJC 2R1WA 2YSSA 5C0RH 5GS3A 1N64L 2NZ9C 5IEKA 3PWVB 4ENED 2JJUA 2QHLA 3AM8A 4OGAC 2NYYD 2OI9C 4NRZB 4OM1L 5DHVA 1WJ3A 3HG1A 5IVZB 4YXKL 1UG9A 1Z9MA 1MI5A 1OGAD 4OI9A 2EEBA 2OX5A 2XZAL 3OHXB 1CFVL 4LEXL 2YD3A 5CP3H 2K7PA 1KEGH 4EIGB 4ERSL 1LO3L 4WWID 5C0AA 1UVQA 1WCQA 1ETZB 3KPPB 4XP6H 3WXVL 2CLVA 2VC2L 3IFPB 3O4OB 2X89D 1IQDB 5DVMA 3T2NL 4LSTH 2YD9A 4PJIA 3N9GL 4H26B 4DTGH 5DO2D 3H9SD 5DD5H 3LAFA 4RFNC 3BXNA 3VXMA 4M7ZB 4AM0A 2NLJA 3I75B 4Y5YC 4BUGA 2EKSB 4QRPD 2VJXA 1NCDL 2IAND 1BFSA 4JVPA 4HPOL 3V6ZA 3H9HB 4KHTL 3PHOA 1KIUA 2WIMA 2GQHA 4PJAF 4M3KB 3MRQB 4PJ9D 5HGAA 4KVNH 3GRWA 4HGWA 4HUUB 1X5LA 3VFSB 4G59A 3EOBB 4GW1B 4P5KA 3WO3B 1MWAB 4YHZH 3S35H 2QKIB 3HZYB 4M1CC 1BZ7B 1G1CA 2CLZB 2MPAL 1UH4A 2Y1VA 3IETA 3LOWA 2BCKA 3GB7B 4MXVF 5LWYL 1MLBB 2QL1A 4X9FA 1JL8A 5I8OL 4NHUA 4ONGL 4PJCF 1GC1C 5F21B 1YZZA 1I1YA 1QFUH 1U93B 1H3WM 2GJ6A 3PWPD 2ZNWA 1NKRA 4OCNC 1EO7A 4UT9L 1E4XL 3VWJB 3P9MA 4LU5H 5IBLC 5JZ7D 3GJFB 4QNPF 4MAYA 3GK8L 4XGZA 5DUPL 4R4FL 1EEYA 4JREC 4Z7OE 4ZSOE 1IC7H 3RVVD 5AZ2L 4HMDA 3ARBB 4Q97A 3BPLB 1D7FA 4ZUTB 3MV7E 2YMXL 3F6LA 2KQMA 2UUDK 4JRXA 3U46A 4GUPA 4LEOA 5KAQG 3C2AH 4JO2L 4MHHI 4WO4C 5GS2D 2WANA 5JO5B 3I9GL 1T5XB 3CSGA 4MXQD 3Q1SH 4JFDA 1SVZA 5C0FB 4CMMA 3TM6A 3QI9D 4JFEA 1OOAA 5E4EB 3B8SA 4G6AC 4G8GE 1TMCB 2QR0B 5FIEA 4X6CA 5T3XH 4NRXB 5HDBF 4PY7A 2VIRA 2R15A 2YRLA 5LGHL 2F5BH 2Q86A 3KYAA 1ND0B 1E4XI 3JTCA 1EAJA 4YR6B 2ADIB 3A6BH 1I8KA 2WBKA 4XPFL 2IAMB 2Z91B 1RMFH 1EA9C 4L3ED 1A21A 2DI7A 2HLFD 3WBDA 3CVHA 3VRLE 1U8HA 5EZLA 5F6IC 3CDGA 4NBZB 3HCVB 2KDGA 4FXKA 4WGVB 3IDYB 1RZJH 5CJ8A 3UX9B 3IDMB 1QSEE 4ONFH 5KVMC 3GMRA 4RIRB 1XF4A 5DDHB 1A5FH 4N0UE 5I9QC 3TZVD 3F7VB 1J0IA 1TZHB 4NT6A 4FA8A 3P30L 1YY8A 4MCYB 2WAHA 2HT2D 5ITFB 4AQ1B 5DC9B 1O5DT 3WUWA 4G9DB 1YQ2A 3P77A 3OB0K 2QHRL 3QCTH 3TVMC 2APFA 4E5XB 5HHOB 5HVWA 2CUHA 4S0UC 1KB9J 3HC4L 4TNWK 4PJFA 3BP7B 4OF0A 5CEYB 4OD3L 5CP7A 4LHJB 5KS9B 3BRGC 3TYGH 5D8JL 4TUOB 1CGXA 1LO0H 2AP2A 2A6JB 4KROB 5D1ZC 4YZFE 5MENA 4O00A 3IXAB 5EN2B 4GRLA 4APQA 3M17A 2XQBH 1BVLB 3CPLB 5GS0D 2D7TH 4WU7A 1YEEL 1TCRB 1NJ9B 2PO6A 3OF6A 3KHOA 3MMEB 4PJHE 1BD2D 3HI6H 1JGEA 3RVXC 1A7NL 2AQ2A 5KW9L 3RJQB 5IVOA 1JYXA 4XNZB 5FO7A 2Y36L 5C6TL 1AGFB 4DWHA 4PREB 2HFFA 3STLB 5I2IA 1FFNB 2HKFH 1V7ML 3CSYB 5IWLC 1FZMB 3MRIB 2BZDA 1GGBH 2W9DH 1WC7B 4XVJL 4M1GH 4Z7WA 1L4IA 3PE9A 4KQ4L 1CDBA 3JWDC 3SGDH 3TP4A 1TQCB 5J12C 1G1YA 1P4LB 4FTVD 4U33A 3L3OB 1MEXL 1VADB 3OR6B 4ZMAT 1R5WA 1VEPA 1QPPA 4ZYKA 3SDXE 1IFHL 2P5ED 1RJZA 2PXYA 3ARZA 3D0VA 1DCLA 3ZZ1A 3UPRA 1M05B 3X3FL 3QHZH 1WBZA 3GSVB 3U30B 5IMKB 4YHIA 3GO1L 5J6HA 2ZKHL 5LXGL 4U7KA 1MCWM 1NGXA 5CZVH 4LKCA 4J8RB 4G9FD 4S1QH 3KVQA 1AFVL 2X4RB 2GT9A 1WEJH 5E2TH 3O6FB 1Q94A 3R4DA 1IGIH 1ZLWH 5I17B 4XBEH 1DZBA 1OAZL 1QFHA 2X4SB 4XNUH 3PGCB 1JPTH 4QXGH 4AH2A 3DO7A 3TN0B 4PJ8B 4NO3A 5I1GL 1X44A 2IJ0C 2VQ1B 4UNVA 4NDMB 4NJ9L 1I1FA 2GSIA 4JDTH 2IQAA 3L3JA 3TCLA 1MF2L 1NBYA 2XOTA 5DMIL 3DVGB 3UCRA 3IKKA 4RMQA 2V2TB 1J1PL 3INUL 3OAZK 3QEGL 4JGJA 3QFJD 1WWBX 5D9SA 1AI1L 4JAMA 3V8CA 1P2CB 5K9KA 3T1FB 3DO3A 1NBVL 4XCYA 3O3AB 5CJXC 3U9PL 4S1DD 4CVZB 1S5HA 2BOBB 4KGJA 3O6LL 2HMIC 4ZXBB 3KPMB 4TVPE 5DD6B 5GISL 4GKNB 2DIBA 4RAHA 5IJKA 3C9NB 2C1PB 2JCCE 4Y2DB 2NY3C 3SHSA 1F3DH 2JJTA 5F3HA 5JDJA 2E9JA 1EV2E 1FLRH 1R3JA 3RTQD 4F2MB 3IDGB 3PABB 5BRZA 2HJLB 4Z0XB 1MUJB 5D7JB 2XPGB 4F15B 3KPSD 1OGTA 1RHHA 1JWMB 2HLAA 3RWCB 4JPVL 1YEIL 1FCGA 3BYTA 1DLHB 4BSJA 3L3HA 3TCXA 4PRBA 1TVHA 3ARBD 2Z0BA 3RIAK 3V6OC 2ORBH 5C07E 2BVYA 4W68A 3Q5YA 5I1EL 2JB6A 4Z5RA 3KDMB 3T4YA 4Y89A 1FGNH 1CL7H 3ULSA 4H25A 1DVFC 1DBBH 4JR9L 4OFPA 1NFIB 3MV8E 1MRCL 1T1YB 4LGSB 4HUWA 4PG9A 2OTUB 1WIPA 2MHAB 2BNUB 1S9XA 2GUOB 2J7LA 2H8PB 4KI5E 3BJ91 2ZCKH 5A2JH 3C60A 4RA3A 1JTTA 3HTLX 3QXDB 4KJQD 1A1OB 2PYEA 5BZWA 3E6HB 3G5YB 5F8RC 4JFFD 2A74A 2NMSA 5I1HH 2EYRA 1I8LA 4M6MH 4QOKE 1H0DA 1XF5B 2DDQL 1HKLH 5ADOH 4R26L 4OCSH 3WCYA 4TULH 3STBA 4P23B 4K07A 4X4ZA 2CJUH 3MV9B 3RX5A 3QG7L 3G08B 2FX7L 3KLHC 2DYPA 5IB2B 1QBLH 3DWTA 4GKZA 3OGOE 1UZ6F 4LVEA 2XWTB 5C09D 2B2XH 4CNIA 3PGDB 2XWJB 2BSTA 4EOWL 2HWZL 4RDQF 1YMHA 1OF2B 2PTUA 5FV2A 3FN0L 4E42B 5JOPE 3CMOL 3PGFH 4RA0C 4KAQL 2HJKB 1KCLA 4DJMA 1CICA 1T22A 1F58L 2UVEA 1YQVH 5JXEC 4OF5A 1NCUA 5DGRA 2W9LA 1JTPA 3MGOA 2I24N 2V5MA 2EH7H 5I66A 3QI9A 3VDBA 2W60B 4TNWF 5HHMD 5D1XD 4MX7A 3OX8B 5HHOD 2HTLC 4HK0B 5EH1A 4NO5B 3QUML 3EO0B 3DV6A 5I71B 4L5FH 3D85B 5DMKA 3FN3A 2PR4L 8FABB 1OSPH 1EAPA 1SY6L 4WDIA 1CFBA 15C8H 4TUJB 4EIZC 1CXIA 1NCNA 3SE4A 2D7OA 4PRPA 2EDBA 3P9LB 1LK3H 4UDTA 1DQJA 4MQXC 5HJ3A 3VG9B 2ENYA 5C70A 1Y18B 4YHMH 5C0BE 3ZKXC 5DJ2A 4LPXA 5C3LD 2VSCA 2B0SH 3IFLH 5F9OL 5ICZB 4N8VB 1WVZA 1VERA 3CCHA 2XKUA 3CVHH 1I7RA 3CZJA 4OCWH 5ESAA 2NY4C 4L8DA 5EIQA 2FYYA 5TF1H 2R2EA 4H0HB 1IGJA 3HG1B 5EU7C 1A6VH 3VFMA 1SJHB 3ULVE 4JO3H 3MXVH 3UBXA 1QR1B 4H5SA 4XNQB 3OPZL 2AXJA 4P2RE 3GMQA 4PBVC 2XWBA 1NL0L 5F1IB 4UIMA 5DEFA 3MPCA 2CLVB 1QSZA 1IEBA 2IQ9H 4WW2F 4KY1L 4YPGA 4NZTL 3B5HA 4PJIB 4P3DA 4DGVL 1ZVYA 4Q7DA 2DD8L 1QNZH 2QSCH 5JW5A 1TZIB 4OLZH 4Y19E 2VDNH 1VFMA 5HGHB 1QOKA 2DWDB 4UUJA 5E0QA 4AM0B 3U0PA 5DFTA 2F19H 4U3XA 2Q8AH 5CINH 1OL0A 4JVUA 4QXUL 5HVFB 2ZUUA 5CCKH 1RIHL 3H7BA 3SE3C 3LHPL 4PLNC 3LS5L 3TO4A 1PKQE 5HGAB 4RBPH 3MRCA 1RVFH 1CK0H 4IHOB 1BBDL 1FDLL 3DVFA 1RZ8A 1NSNH 3ZKNC 1Z6JT 2WBJD 5IF0A 1G7LA 4P5KB 3TN0D 1RZIA 5FUOL 5FYJE 2DM2A 1EMTH 1IM9D 3PDDA 5JIHA 1D6VL 3VXOA 4PP1C 4ALAH 3MRPB 4KUZL 1A3QA 1ZOXA 3A67L 3E3QE 2Y4SA 5D93C 1VGEL 3BGMA 1EBAA 3ET9F 4NM4H 2O61A 1Q9OA 3L5HA 2GJ6B 2BY2A 1EGJL 3QEUA 5L0QB 1QPXA 5TE6H 5DMYA 4QHKJ 4LDEB 2NR6D 4LQFH 5FM5M 4JFOB 4L1HA 2FJGA 1NMBL 5DHYB 2UZIL 3D69B 2GJJA 3U2SA 4ODVH 1MI5E 3LKRB 2XKSA 5C8JA 3QEQE 5F44A 5ADPL 4JRXB 3U46B 4GUPB 1UWEL 3RUGB 1D5XB 2IMNA 2DLTA 1LO4L 3C5JA 3FQTA 4MNGE 4QT5A 5C0AE 4ODHH 1VACA 3QWRA 3SN6N 1CN4A 4ESKA 4Z7NE 3W11D 1GPOL 1T0PB 3FQXA 5E7FA 4UV4L 43C9A 3EYOA 1JGLH 1XR9B 4K7FA 4CMMB 2XA8L 1JWSA 3O9WC 1G6VK 4Y4KC 3VXME 1NMCB 1Z0MA 4U1HA 4U6VH 3BKYL 4X6CB 5CZKA 4P46C 4HWEL 3RPIA 5FO8A 3QCVH 4HT1L 2AXFB 3WFBH 4F8QA 1H8OA 4JANA 1F90H 1JPGA 3FZUC 4NKOA 4ZTOH 5CLWA 1G9ML 2HFGH 3IDUA 1I8KB 2VDKL 1IAIM 4BZ1L 2K3TA 4PJ5A 4ZPVB 4AL8H 3OB8A 4AEIL 5C0IA 2CKBA 1PVHA 3MUHL 4HFUL 3JV0A 4PR5A 2D9CA 1BVZA 4BKLA 3CVHB 4OZGF 1GZQB 1F4YL 5M94B 5EZLB 2E7LA 5JUEL 3CDGB 3W9DB 3V52L 4Z78B 1QLFB 1FL3B 4NHUE 1F6AA 1BM3L 4RFEA 3GMRB 1XF4B 3IFNL 2AEPL 2EIDA 3RWHB 1DBKH 3MFFA 4JZNB 2GJ6E 4JPWH 4NT6B 1MH5A 1YY8B 1U92A 3MRFA 3HE7B 3WUWB 3PUCA 4MZ2A 1PY9A 3LD8B 4XZUB 5H37G 3P77B 3V5DB 2PW2A 3G6DH 4P4KC 3QH3A 2VB5A 5EOCJ 4G5ZL 4HWZA 3QUXD 3FAWA 1W2KT 5ERWA 2VMFA 3D5OF 3OKLB 4WI2A 4PJFB 5D71L 5GZNC 4YHOL 1ZVHA 1Q38A 4X5LA 1BZQK 1HYSD 3KYKH 3GMPB 3HLAB 5MEQA 1J1XH 3OKMB 5MENB 4XHQA 5D2LB 1GCFA 2B20A 4FMKA 4JFDE 3RP1A 4OIAA 1Q0XH 4GRLB 4LHUG 3M17B 4JFEE 5DGQA 4HXBH 1AXTH 1LDSA 3JBG7 4RMVA 4WU7B 3OJMB 1HZHL 3QXWA 4V1DD 3EDKA 4BFEA 1I1AA 1MQ8A 2IPUK 4TUKL 2PO6B 1ZTXL 4G6JL 2W9EH 3KR3H 4OI7A 4M7KH 4OFKA 2BY1A 1FNSH 1PYWA 2BNQD 5I75C 2F74B 3NIDE 3QUYB 5DVKA 5I2IB 3VMPA 4QXTA 3TC9A 2HRPL 3ROOA 1EUTA 1D6EA 2BX5A 1F4AA 4HUXA 4XB7A 3EYUL 3GGWA 2VR4A 4FOMA 4YE4H 4Z77B 1F8TH 1R5WB 4B0MM 4PP8C 1QBBA 4PJEF 1G7MA 4ZYKB 1I3RA 1RJZB 4WFEE 5DYOA 3D0VB 3V4PL 2GITA 4XWGH 4AEFA 3UPRB 4OZHF 5C08A 2M26A 1MREH 4J3TA 4U0QB 1LEGA 1T1ZA 5J6HB 4IOIA 1NGXB 3DPBA 2HT3C 3V8OA 5LGKA 1CFSA 4HWBH 2MKWA 4MXWH 5HHQB 3L5XH 5JMRA 1BQSA 3BQUB 2XZZA 1Q94B 3C6LC 4NP4H 2YOCA 1NCBL 3TEUA 5TFSH 2VLJB 2QQQA 1RIVL 4U3CA 3B3IA 1OAKH 5IV2A 1A7QH 3PP3K 2I9TA 4WFFD 3RGVB 3O3DA 3J7HA 1F6LL 4YXHH 3U36A 1YDPA 3GMLB 4NO3B 4U6XA 2XXMB 3RWDA 3FMGH 1A7RL 4NC1C 4O5LH 3T0DA 2GSIB 3ZSTA 2IQAB 5F1KC 3TCLB 2RAMA 3Q6FA 5ANMA 1B0RB 4R3SB 3VFTB 1KJ3L 1Q9LA 1UWGH 3PF2A 5D9SB 5GGUA 2PTVA 2WWMC 4LLDA 5FYLD 1WQVT 1EHLL 4UDUA 5JNYB 3OV6A 1PD6A 4HKBA 4WENB 3NACL 3RZCC 3GJEA 3X12A 2G75A 1SBSL 1JZ2A 4HJ0C 4NUJA 3QAZB 2ICWA 2H2PD 1KB5A 4Z7WE 5C71A 5EOQH 3TIDA 3TFKC 1R3JB 2JTDA 3JWOH 4OF7A 5F7NC 4FABH 2BOCA 4QHNA 3R8QA 4DQOH 3KPNA 3WIHL 2UZXB 1LEKA 4QTIH 2GSGB 1JV5A 3E1F1 4G80B 3FRPG 3MCKA 2HLAB 2AJUH 3VGBA 1I85A 3L3HB 1WFNA 1AQKL 4WFGD 1TVHB 2R29H 1NDMA 1FH5L 5GPRA 2R0LH 1NFDF 2MQ3A 4LSUL 4Z5RB 5C0DB 3QUZB 3WFHA 1BGXH 4IDJH 2R4SH 2XYCA 4H25B 1KLUA 5IROC 1D3CA 1RHFA 1HDMB 1FLTX 5ETUA 3HA0A 2WBJA 4HUWB 5GJTL 1S7RB 4HUVB 2VDPL 4ODWB 1U8LB 5FCUL 4ZG1A 1MLCA 3MJ7B 1H3VA 4ZD3H 1C08A 1UKTA 2PYEB 3OZ9L 5EORL 5BZWB 4WW2C 3UEZA 4CADA 5EB9A 2DI9A 4QRUA 4LSTL 2A74B 2IC2A 2EYRB 3DYMA 5IEHA 1H0DB 3TESA 5TE4L 1TIUA 4PS4L 2PYFB 3L3DA 2D03L 2BY0A 4G43A 4YHKH 2ARJQ 3B8YA 4YQXH 3VU2A 2V9QA 4JFQA 2DYPB 1X4XA 4G42A 3B6SA 1T03L 4Z6AT 3D18A 3T0AA 4BFGA 2FO1A 1X5FA 1EFXD 2RCSL 1G0XA 3FHAA 3HAEG 1YMHB 5GHWL 3QDJD 1RJCA 3NIGE 2K7QA 4G8EA 2IBZX 2YRPA 4MCZA 4LBEA 3V7AG 4ODSH 1TENA 3CJJA 3ZKSD 5BRZE 5IW6B 3D6GA 2OXHA 3HE7D 4D9RD 3OKOA 2Q7YA 1G6RL 3JTTA 3H9SE 5I66B 1PJ9A 4TVPL 1E4JA 1IGFL 2FGZA 2V5SA 4MX7B 2NW2A 4WUUD 1WAAA 1VPOH 3ZE1F 4XMKL 4N0RA 2DQGH 3BE1H 3GHBL 4QRPE 5DMKB 1XF3A 4X5XA 2IANE 3L9RA 4OB5L 5KSBF 1UC6A 4Z7VF 1QFPA 1BWMA 3P0VH 3VXPA 3B43A 4X7FC 1EAPB 4PJXA 4WDIB 2Q8BL 2KZ1B 4TNVF 3W2DH 4WWKC 1YJDC 5CIPA 2UVFA 1FNEA 4PRPB 1AHWC 2AK4D 4UDTB 2YD4A 1HXYA 2FB4H 1AXIB 4U6YA 1JYNA 3U4EA 5DJ2B 4F7EA 5B38G 1RUPH 3KPOA 4O9HL 2CKBH 4HW6A 2H2SC 4N9GA 3TJEL 1I8MA 4YK4B 3HB3C 1I7RB 1MCLA 2OMNA 3HE6A 1AE6H 3MBEC 5ESAB 1NAMA 2Z93B 3UYRH 5HYFA 5GGQL 1C8PA 5I8CB 7FABH 2FYYB 2HH0H 4KJYA 2CXKA 4QHUB 3QUYD 4XVTL 1IGJB 1RZKL 4P5MA 2IBZY 3VFMB 1OY3B 2OCFD 4M7JH 1U3JA 3UBXB 2P42B 1BF8A 3VFOB 3CU7A 1F6FB 4H5SB 3AVEA 2XTJB 4XC3H 4OT1L 2XWBB 3QUXA 5DQDL 3EUUA 1GRWA 3WFEH 5DEFB 1ZHBB 4G7VL 2AABL 1IEBB 1OAUH 2OI9B 1W0YT 1LHZA 2VZTA 1UM4L 3ARXA 4PJGE 4FN0A 2D9QB 3T0BA 5LG1A 4TVSa 2NW3A 1LILA 4N9OB 4H20H 2N7AA 5D6CA 4UUJB 1MCWW 1TJGL 4FQQA 3U0PB 5E2WH 1B9ZA 1P6FA 3H7BB 4PRNB 3OJVC 3RAJH 1BF2A 1U42A 3BQUD 3TO4B 2Y07H 1QBML 2XI9A 5J0BA 5DFWH 4UT7H 2VLJD 3RVUC 4LIQE 2BC4B 1RZ8B 2RBLA 4MAUH 4BK4A 3N0PB 1WICA 2FECL 5IF0B 3OXRA 4L4JA 4RFNB 2G5RA 1RZIB 3HRZB 1CG9A 2VXQH 4KZEL 5E99L 4Y5YB 2I25N 5E00A 1LQVA 3KYNA 4L8SA 1C5CH 5IK3A 1XH3A 25C8L 1TPXC 1B3JA 2VLME 1HHGA 4DN3H 1L7IH 3BGMB 4IMLA 4GKOA 2J8OA 1KCKA 2O61B 1Q9OB 3T3MF 4PJDF 1P7QA 5IUSA 3EFFA 4UTAL 1DUYB 2DLFL 2EE2A 2Z31C 1CD9B 4ZFGH 5JHLL 1CF8L 3BMWA 5IB1A 4BQ9A 1IEAB 2FJGB 1CE1L 1MFDH 4UILH 5D70L 5E6ID 5E8PA 3SDDC 2NXYB 3RIFK 3VFPB 2NCMA 3QFDA 4DUXA 3QXUA 5C8JB 5L8KB 3AMKA 3ILQD 1ZLVH 3DGGA 3C5JB 3OKKA 3LIZH 4L4VB 3HMWL 3IU4L 3KXFA 3NAAH 5A43C 2VLLA 3ARSA 2ZUWA 3N06B 4L4TA 3FQXB 3BIAX 5DR5H 3ZL4H 43C9B 2A6KA 1KPRA 4LLQA 5F8QC 3ULVL 3DVNA 2F8OA 4K7FB 3VI4F 2R8SH 5IB5A 1JFQH 3C5SB 3CD4A 3WJLC 1JWSB 1FNHA 1WFTA 3L6FA 4RGOH 5L2KA 4WI7A 1U9KA 4X6FA 2VQTA 3Q5OA 4JDVB 5B4MC 3RPIB 5FO8B 2DOCA 3QUZD 4TSBH 1J05B 4WO4B 1A0QL 1D9KD 4L9LC 3ES6A 1MCIA 5D5MB 4XAWL 1JPGB 3QHZL 1Q72H 2OZ4L 5K9OA 1NUNB 1QFWL 1O0VA 1DQMH 1BD2E 1KCSL 4I18C 4GW4A 5C0IB 4Z7UA 1YPZA 5T1KB 2EEDA 4PGBB 4RNRA 5E8EB 3TJHD 4PV9A 3NCBB 5CHNA 1IGIL 1ZHLA 4OCYL 1RQ5A 1QKZH 3GBLA 1F6AB 1I9RL 4RFEB 5E1HB 3TV3L 3GBNL 1BAFL 2AERT 3SDCC 3ZKQD 4FTVE 3MFFB 5EPMB 1MH5B 1MHPL 1KB5H 3LQAH 5CKAA 1U92B 3HZVB 5FYJL 2P5EE 4HQQL 4F57H 1HHKA 1YEHH 1ZA6A 2EH8L 1OP9A 3MODH 2PW2B 5F6IB 3LRGA 3WUZA 1S7SA 3QH3B 1P4BH 4HWZB 2PCPA 3GM0A 4MVBD 2HT4D 5ERWB 3WLBB 1JHLL 4G9FE 1AGBB 5LCVL 5I9QB 4ETQB 1NC4B 5JPNA 2IF7A 3WDHA 3G6JB 2QSVA 1MCJA 3VMOA 1OPGL 1IC5H 5J11B 1QFWI 1VB9A 1KIPA 2NTFB 5E08L 1XIWC 2PTTA 5KG9A 4ZTPH 1FVEB 1RAMA 4FHBD 2AEWA 5AD0A 1NEZG 5FDWB 4JY4B 3TVMB 2DAVA 5IMOA 4ZUVA 4KKCC 4HKJA 1K4DA 3JUYA 3S37H 2OR9H 4WI3A 5BW7C 3NZHL 3RVWD 4B41A 4K9EH 2BDNL 4JJ5A 3QISA 1JPFA 4LRNH 2J2ZA 1H8NA 5DD0L 4R6UA 3CFIC 3MLYH 4KXZI 4X9BA 5FM4A 4BSVA 1LP9F 1RFDL 3FQUA 3NCJL 1PYWB 1HIML 4DN4H 3B9KC 3QFJE 1CT8B 1WSST 3B5GA 4FXGA 1QLRB 4H1LH 4PJ5E 4M03A 1GXEA 2XRAH 3UDWA 2H6PA 3QHFH 3TBWA 3CXHJ 3FFCA 3T8XA 3DROB 1D6EB 1EFXA 2DKMA 2E7LE 2EDNA 1MY5A 3HI1A 5GZOC 5EFIA 1QO3A 5I74B 1G7MB 1RZFH 1I3RB 2MOVA 4ZOBA 3IU3A 4UTBH 4GAFB 1P4IH 2J8UA 1G7JA 3GRWL 2ED7A 4X7SH 4Y16A 4EDWH 1FO0A 4J7RA 2GITB 2QADD 1LD9A 1MJJA 1G9NH 5C08B 4JB9L 3KPSE 3LKQA 1RUKH 1LEGB 5T1MA 4JFZH 3MNVB 4LPWA 4UOW1 4XTRC 2BXZA 4WUUA 1MCHA 3AAZA 3D0LA 1CFSB 2DLIA 3PP4L 2CSPA 4KK8C 1NCWH 1DUZA 2VLRD 3CGTA 3SKJH 5KJRL 5MERA 1CS6A 4TSAH 1OSZA 3T0WA 3I84A 4X6DE 1A9BB 5F88A 3FB6A 5C0CA 1QBLL 3B3IB 3BSZL 5IV2B 1XF1A 2W0KA 2I9TB 2WLZA 3O3DB 3RWFA 1IT9H 5DS8A 2VTFA 1R5VB 1YDPB 1I3VA 2JF1A 3ZO0A 2VDLL 3RWDB 1VENA 1OB1B 4JN2A 3X3GH 4G6FB 3UTSA 4Y4FD 5CIPH 4Z8FH 3Q6FB 5ANMB 3BVNA 3O8XA 1BQUA 3UC0H 3C6LA 1FZJA 2ED8A 4JFFE 3KYMB 1Q9LB 2J5LC 3LKPA 4JM2F 2OR7A 3QXAA 1H3GA 4LLDB 2IPKB 4TSCH 1EO8L 4UDUB 4A6YL 1AKJD 1PG7X 1TZGH 3IJHA 1NAMH 35C8L 4K3JH 4POZC 3F7YA 2R0WL 3DVIA 3D9AL 4QRQB 3X12B 2G75B 2DB8A 3CLFL 2ICWB 1KB5B 5B39A 3TA3C 3BN3B 5C09E 3TIDB 3WS6A 5ELIA 4XNXH 4GW5A 2X7LA 2BOCB 5TQ2L 4P3CL 4QHNB 3W0WD 2QSQA 3KPNB 4MD5B 1UACL 2DQJL 4XNYL 4YH6A 4GMSL 3PV6A 1JV5B 4M1CD 3BT2L 3MCKB 1ADQA 4MSWB 2CDEB 3DX9A 1S8DB 1NAKL 4Y0GA 3LH2L 1MFCH 3GIZH 5FEBA 4Z7OF 3C08H 1XGPB 5HHME 1FBIH 2EDFA 2J88H 4DGYH 2KL6A 1H8SA 1KJVA 4L4VD 4S10A 1A6UH 2CQVA 3SE9L 1PBYA 5ISZA 2C4FT 3CIQA 2ZUSA 3WD5H 1S7VB 2VABA 2A77H 3VGAC 3BRFA 2DICA 5ESQA 3DUSB 5FHAH 4PD4J 1FZOB 3CFDB 4JQVC 4OIIH 1R24A 1DBJL 1MLCB 1T7YA 2A1WL 1KLGA 1YECH 4HS8H 3UTQA 1C08B 4BQ8A 5D6DC 4O58L 2I5YH 4C4KO 2B39A 4WO4D 4BZ2L 2YPVH 1QNZL 4EEEA 1DVFB 4H1LB 4JHBA 4QWWC 3L3DB 3RNQA 1KENL 4G43B 5D7IE 3W82A 1E0OB 2FX8H 3BEWA 5EG6C 5T1KD 4JFQB 3KPRD 1X7QA 2SEBA 4G42B 2O26U 2ESVA 1AGCA 4G6AD 3D18B 1NBQA 3HC3L 2O5XL 3HNSL 1RVFL 3VRLF 3T77A 4BM7A 1YYLL 2ZCHL 5D4QA 1FORH 4IIQA 4XCFH 3KNBA 1DN2A 3D2UD 3LN4A 2P5WB 1XFPA 2VXSL 2YPKA 4B7IA 1T2QH 1DBML 3PQYD 4ZO6A 4M6OL 5CEZL 3P4MB 4NGHH 3OKOB 3KJ4C 3AMLA 3JTTB 4S1RH 4YAQA 4OLXL 4HCRA 5F7KC 3BPOC 2NW2B 1WZ1L 3REVB 3DOSA 4WEMB 5IM7B 2COQA 1MJ8H 5AZEH 3D25A 3MUGA 5DUBA 1XF3B 2AQ3A 3L9RB 4L1DA 1NC4D 5L2JA 1Z5LA 1YEFH 3EYVA 3VXPB 4YPJA 3BUYA 1NLBH 4EQ3A 2FL5A 1G0DA 2CKNA 1QRND 3ARDC 2YPLD 4MJIA 1FNEB 1C5DA 2XFXA 5F7UA 4YZFF 3TVMD 1YYML 3MUJA 4RGMC 3U4EB 1E4KA 4OCRL 3KPOB 4FQXC 4N9GB 4NNPL 1MNUH 1VEMA 3HE6B 3LSOB 2BVOA 1NAMB 3IKCA 5MEPB 1CE6A 5C92A 4MA8H 1B0WA 3J8F7 4PJHF 3WFCH 3Q2CA 4KJYB 5EZJA 5D1ZD 4JZOA 2G2RA 5IR1B 2W07A 2P47B 2IADA 1TETL 3HUJA 1BQHA 3FHQA 4LCYA 4JG0L 1N8ZA 3ZKXB 2V2XA 1E4WL 1I7UB 3WFDL 1KNOB 4FZ8H 1FJ1A 3LPWA 5EBLB 5EUOA 4GLRI 4YDJA 4KDTA 1F11A 3V5HA 4I2XA 3RVXD 3EYFA 4ELMA 3ALWA 5CMAA 3DETC 3RA7H 2XKNA 3BDYH 5DWUL 3TGXA 3NCYS 2NW3B 1WF5A 1WLHA 3OKDA 2OYPA 5D6CB 1PZ5A 4FQQB 2ADFH 4HEME 3V79C 4HAGA 3BN9C 4N5EC 1HK6A 2Y7QA 3QIWC 4N1EA 4X8XA 3SJVD 5I19H 2C4FU 4MA3B 1I3GH 1QQDA 3BAEH 4QHMA 5F7LB 1PLGL 1Q9KB 1H9VA 4HF5H 4R90H 5JW4N 5GGRY 5GSVA 4ODXA 4PRDB 4H88H 4LCWB 3BD5A 4PJXE 1IAOA 1CG9B 1GIGH 3ZYZA 5SWQA 4WW1B 4G3YH 2WK2A 5E00B 5LBSH 1N0XH 3K8LA 3KYNB 5E95B 5IK3B 1XH3B 1MIEL 3P4OB 2DQDL 1KACB 5BO1L 4MDIA 4IMLB 1N4XH 3QDMA 3U1SH 1K6QL 3MLWH 1IQWH 1P7QB 5FUZH 3AGVA 3EFFB 2DQIH 5EBWA 4KKLD 5ALCL 3PL6D 3NTCL 2BSSB 3N1QC 3O3BB 3DHJA 5IIEB 4PP2A 3R8BB 3T1WA 1CZ8L 1SJEB 1MPAH 4X7DC 4JKPH 4KTDL 1FO0H 2UUDH 3OJDB 3QFDB 1X5GA 3B2VL 4OCXL 3O4LD 4WTZA 2VLRA 3DGGB 5ENWA 3OKKB 4JRYA 2DWEA 5IVXA 3KXFB 4R4BA 3RI5F 5L88H 4RCAA 2ICCA 2BJMH 2VLLB 4WUKH 4JQIH 2V17H 3VXTB 1LQSR 4UIKL 1EEUA 4UB0H 1KPRB 5D7LA 4HBCL 1WT5C 2HMID 1N2RB 3MV11 4QHLA 5DRXA 5IB5B 1WZLA 4HMEA 4Z0BL 5EU6D 1T21B 1OW0C 3L6FB 3RWJA 4OD2A 5C9KA 5E24E 5BZDA 2NY3D 1MAMH 3JUZA 4Y4FA 5L2KB 2E3VA 5HSFA 4W4NA 5KZCD 3QRGL 2VUOA 1BLNA 5DJ8A 2VITA 3S7GA 2OM5A 4LKXB 3ES6B 2VXVL 4V1DE 1UH2A 5TQ0H 5K9OB 1AGDA 3U0TB 3QIUD 4O02L 2DMCA 1GOGA 3U48A 4GW4B 2BRQA 2BNQE 2R0ZL 3O9WB 1OCWL 1JRHH 4NKMA 4RNRB 4KI5F 4P2OA 5CHNB 4LSQH 1RULH 1FVCB 1ZHLB 4FFYL 3UTTA 4C57C 1B4JL 3GUTB 5JQ6H 4L9LA 2DQTH 2VNCA 4Y5XA 4LIQL 4GBXA 3W0WA 1FGVL 1YNLH 1BFOA 4ODUA 3VXQB 3OB0H 1HHKB 2CO6B 1KN4H 5HYQB 5C9JA 1P7KA 4J6RL 2ZZUT 5FXCH 5DRNA 3CFEA 1QEWA 3FTGA 2NY7L 2Q6WA 3V4VH 1ADQH 2PCPB 4IS6A 1JNJA 2B8OT 4JPKH 1EHNA 1W8NA 2DLEA 5FGBA 4JM2C 4CW1A 5JPNB 1J8HA 1HQ4A 2IH1A 1A1MB 4FFVC 3S5LA 4N8CL 3KXFE 1LWRA 1KIPB 4LDOB 2PTTB 3VA2C 4L4TE 3KLHD 2Z4QA 3EO9H 1FYTA 5AD0B 3T2OA 4WFFE 3U4AA 4HJJL 1CLYH 5ACLA 2L7JA 4EI6A 1P6AB 4HKJB 5BVPH 4MNHA 4FABL 1K4DB 2ZOLA 3S36X 1MFBL 4KRPC 4U0RB 3FL7A 4JJ5B 1S7XA 4XPBH 1JPFB 4NJAL 4U6HA 3BP5A 1RUAH 2R1YA 3VXUA 3QUKA 5B8CA 1ACZA 4BSVB 5BXFB 2WP3O 1FSKC 4UV7H 4FS0A 5IQ7H 5JXED 2B7DT 3MV01 3TF7A 5T3ZD 2GK0B 3VGDA 4FXGB 4BFBD 5FYLE 4F58H 2H6PB 2HTLD 4Z7UE 3LEYH 3FFCB 1YPZE 3T8XB 2NY1B 5AEAA 1F97A 1HE7A 2R4SL 4K7PX 5IP4A 4HS6A 4DGIL 3DNKA 4NQED 3KJ6H 4P0DA 5GS0L 2R23A 4FFZH 1N59A 2LAAA 5H35B 2L7UA 1JGDA 4YIQA 4H8WC 3O4OC 3UJTL 4OLWL 4O2EA 4GAGL 3MRLB 5A1AA 1K8DA 4Y16B 1IKNA 1KCUL 1FO0B 2DKSA 4P5TA 3SOBH 4YDLC 4U1NA 3MBXL 3HHRB 1MJJB 1CD8A 4ZD3L 3LKQB 2G60H 4B5EA 2UY6A 3ZYOA 4GRWH 1OARH 5F9JA 1CXHA 3MR9A 3N1MC 2YZ1A 3AAZB 3D0LB 4NUGL 4Y2OA 3IS0X 1U8NB 4WFGE 1G7IA 5JIKA 1QYGL 1Y0LB 1OSZB 5KVFL 2NY4D 1GAFH 1DE4A 3FCTA 4HCRH 2YBRA 5F1OB 5F88B 1YMMA 1QFOA 3JTSA 5HYSA 4NKIL 4NWUL 5M7QA 4RGNB 3TPUA 5C0CB 4XH2A 5EC2A 2A9NH 3QQ4B 3RWFB 3S4SG 4M3JA 5DS8B 2P8PB 4Q58C 2R2HA 1KCVH 5AWNH 1JGVH 4JN2B 4OCMC 3UTSB 3WKNA 3BVNB 3O8XB 5J8OA 3OAZH 3BPNC 3C6LB 2AV1A 1A4JA 5E6YA 4X80H 4AG4H 2BSRB 3LKPB 4RBPK 3VWJC 4LCWD 2LTQC 4P2QA 3QXAB 4V2CB 4EBQL 4AIXA 4I5BB 1KUMA 3K3QA 3EDDA 5J1AA 3ZTNL 2FIRT 3PWNA 2OSLA 2CK0L 3F7YB 1DEDA 1MCPL 2C3GA 3V5KA 5GRUH 3BPLC 1CTOA 4BQCA 3CAFA 4RWYL 3LZFL 1AJ7L 1WUNT 3W81A 3IGAA 3GSWB 4YO0A 3QDJE 3ZKND 2VRAA 2EDJA 4QKXB 3UO1L 1WTLA 5FYJU 3I02A 1HINL 1R3HA 2AVGA 4HIXH 3F12B 2J8UE 2DJSA 3DX9B 1Z3GH 3G5ZA 3RZCB 5EO9A 4KTEH 4QGTA 4EI5D 3I50H 4C4KT 5DSCA 5E4EC 4PRHA 3L3KB 4JN1L 4I3RH 1KEMH 4WUUE 4PGCA 3I3DA 4N8VG 3SKMB 4IRSC 4Q74A 1JHKH 3O41A 3U0WL 5ISZB 1HQRA 4FQIL 1N64H 2VABB 3THML 4Z7NF 3OXSB 2CDFB 2OS7A 3VXRB 5FFLA 5ESQB 4OQ1A 3WHE0 2X40A 4MB5A 4PJIF 1H5BA 4NO2A 4OM1H 1R24B 2YC1A 4I0PA 3QP3A 3FQWB 1KLGB 4YXKH 3UTQB 4YFLI 5DJDA 3IDYC 2XZAH 1CFVH 2R0KL 5GS1C 4GG6A 5H94A 4IRJC 4ERSH 1LO3H 3WXVH 3PL6A 1U8QA 2VC2H 1IVLA 5I30L 3QEHA 5DMJB 3BEWB 5IG7A 3T2NH 4KH2A 2Z8VC 5T1DL 1X7QB 1VA9A 3N9GH 3PWLB 4Y4KD 2ESVB 4JGUA 1AGCB 3BHBA 3V6FA 4JFXA 1S7WA 3R06A 4Y5VA 4KPHL 4WW2B 3RU8L 3T77B 4P46D 2QTEA 4DCQB 2BMKA 5TDOA 1J0KA 3O4LA 3VXSA 1KB9K 1WV7T 4IIQB 4M00A 3O6ML 1NCDH 3KNBB 5J1SC 1SHMA 3DI3B 2YPKB 4HKZB 3X11A 4KHTH 3P3YA 4GRWB 1PAMA 4MJ2A 1TCMA 4KROC 1OT1A 4YAQB 5EU6A 4JHAL 4PJ7E 5KVDL 1A6ZB 1L8JA 4OJFL 1H3UA 2MPAH 1T1XA 2AJSL 2VERN 3MUGB 5DUBB 1U3ZA 2VR5A 5LWYH 2EYTB 4NKDB 3C8KB 5ITBL 4MNQB 3JSSA 3EYVB 4HXAL 5I8OH 4Q6IA 5BOZG 3G9AB 2FEEI 1JNLL 5CSGA 3ECBA 4RAUA 1RUQL 1MCCA 5EU4B 4P4RB 2E6PA 4UT9H 1E4XH 1ITCA 3AREA 1N5AA 2H9GB 4ZFOA 4P4KD 3VI3E 1A1NA 1FG9C 4Y8DC 2AI0L 3GK8H 5DUPH 1MCEA 4R4FH 2XV6B 4QHKI 5GZND 3HKFA 3NFSL 1TQCC 4P57B 1A6AA 3IAPA 5AZ2H 5DR5L 2D7NA 4BH8A 1K4CA 1X4ZA 3IKCB 1CE6B 2YMXH 2EE3A 3S3SA 4G7YL 2L4OA 4WWKB 2B4CL 5DZLA 4HZLA 3S3PA 2EDYA 4JO2H 1A14L 5EZJB 4LCCC 5TDPA 2IADB 3I9GH 2P24A 3NIDF 3HUJB 3KS0H 1UXWA 2ZP0T 4LCYB 4R7DA 1J0YA 1N8ZB 2Z8SA 4HLZG 3QUMA 2G5BB 5LJYH 3NZ8A 1FJ1B 1XGYL 4V2BA 1F11B 2MWCA 3MBEB 1AR1C 1SY6A 3O6FC 3ZDZE 4ELMB 1U8JA 5CMAB 2NNAB 4NN6B 2XKNB 5FO9A 2MCG1 4DK3A 3CXDH 5LGHH 1RZKC 5I16B 5EOCL 1R5IA 4KI5C 3JV5A 3OKDB 1S9YA 3O2DL 1PX4A 2Y7QB 1VGKA 4XPFH 4NHCL 2Y5EA 1QSFB 4NQCD 3RWEA 4QHMB 1XGRB 5C7XL 2JE8A 2VH5L 3TLRA 5CGYC 5I1CL 5GSVB 4OZIE 2W92A 4MQ7A 4PJFF 5E9DA 4Y1AA 1EK3A 4CGTA 5SWQB 5EU5B 3WNOA 1PX3A 3P30H 5D1QC 1RZJC 4MJIE 4X6BA 2HT3D 4ZXBC 3LY6A 3T0EA 3O45A 4J4PA 3QDMB 4TTDC 2QHRH 1DSFL 2AV7A 4QCIA 3CFKA 3GM8A 1JZ8A 5B3JE 5BS0B 3HC4H 1S78C 5D7JC 4F15C 3D48R 3RY6C 4NZDA 2FJFB 4OLYL 4ZAKA 5E7BA 4OD3H 5GGRA 3TBYA 5D8JH 1NCAL 1TPXB 3HUJE 4LRIC 4K55A 3F8UB 3ARVA 4U1JA 4Z7WF 1HEZB 5ENWB 5EUOE 4DN4L 4JRYB 5IVXB 2BNRA 4R4BB 3OL2A 5I1LA 1YEEH 4I2XE 2Z31B 3D3VD 3OSKA 1A9EA 2WWMD 2HTKC 4KKAC 4X0KB 5D7LB 2EXYC 3PDOA 1QLEL 4F9PC 1A7NH 4QHLB 5DRXB 5FUCE 5KW9H 3SDDB 4HJ0D 2Y36H 5C6TH 4OD2B 5EOTA 1V7MH 1BVKA 4MWFA 4NZUL 4PRIB 3IDNA 1EGJA 1BLNB 1NGWA 4XVJH 1OQOA 3RY5A 4NO0A 4JCMA 4KQ4H 2O5YH 4YDKL 4X4MA 2XNAA 1JP5A 1MEXH 4P23C 4PB0L 2H45A 1EX0A 1IFHH 4LLVB 4XPTL 2UWEE 1U8KA 3N85L 2IGFL 1BHGA 4NQSA 1KCGC 3QIBC 4N0FB 5SWZA 1LDPL 5T5FH 1T4KA 1JWUA 5DQJA 3X3FH 2NTSP 3ARFA 3GO1H 5IHLB 2XICA 2ZKHH 4L9LB 5LXGH 4Y5XB 4OZHB 1AFVH 2FO4B 2ADJA 4GBXB 5FOJA 5FA4B 2CRIA 2I26N 3C6SA 2B1HL 3C87A 3ARYA 3GZKA 1BFOB 4ODUB 1MCDA 4N1HB 5JIPA 3DJ9A 1OAZH 1P7KB 4I9WE 5C9JB 4YWGL 3MXWL 3SKOA 4GG8A 3CFEB 1QEWB 3AXLA 3FTGB 4EI5A 1N5YL 2Q6WB 5T1LD 5DJ6A 1AXSA 1M7DA 4YFEA 1VKXA 3VH8B 2B1AL 1X4YA 4NJ9H 5BJTA 3BDXA 5GRJL 1HH6B 4CW1B 3QDGD 3SDCB 1J8HB 2VLRE 4XWOC 1HQ4B 1N6QL 1N26A 3TBVA 5DMIH 4HIJB 5SV3A 1KTKE 4Y7MA 1J1PH 1IAIL 3INUH 5ESVB 2OK0L 2Z4QB 2A38A 3QEGH 3OAYK 4QYOB 1AI1H 5D2NA 5ICYA 3S97C 3VG9C 1NBVH 4EI6B 2GAZA 4MNHB 3U9PH 2ZOLB 3B2UC 3T09A 3V2AR 3O6LH 2KH2B 5GISH 4MNQD 4WFHD 3RX8A 1TVDA 4U6HB 3BP5B 4EN3A 2R1YB 2ITDA 3ULUE 3GMNA 3AM8C 4Q6YA 2HKHL 4WY7L 4BK5A 2ATPB 3GSQA 5E1AA 1JPSL 3MLVL 1I7ZA 4JEGB 4B50A 3MJ8A 1OHQA 4S0SD 5JOEA 1CBVL 1A6UL 3CU1A 4JPVH 1YEIH 4YHLL 1IAKB 4YNYA 3UTTE 4R96A 1N59B 4XCNA 1L0XA 2E7CA 1JGDB 4GOSA 4YIQB 1GH7A 1IM3A 4LMQI 2VUYA 4XCEA 4E41D 5I1EH 4WWKD 5ID0B 4P5TB 4Q0XL 3W0WE 4U1NB 4ZSOA 4IM8A 1IAII 1YECL 2VDRL 3TT3L 1VFBA 2DBJA 3HRPA 2W0FB 4JR9H 3U7WL 1NFDB 1M7XA 2FJHB 3MV7A 1MRCH 5DVLA 4AZ8A 4OM0L 4U2YA 2H2SD 2Y5TA 3TO2A 4Y8AA 1G7IB 1AH1A 4ZDHA 3FOMA 3HB3D 4MJ5B 5GGTL 4JG1L 1DE4B 2P49B 2YBRB 4OZFB 3PP3H 5HYSB 3TPUB 1DFBL 3L3IA 5EC2B 1P1ZA 5F7WC 2ARJA 1MFNA 2DDQH 2JELL 4R26H 5ID1A 1CIDA 2R2HB 1CLCA 4F7MB 4X9IA 4O2FB 1FYTE 3MNWA 3LDBC 5FYKD 3I6KA 3REWB 1QSFD 3QG7H 2FX7H 1OAYL 4KTYA 3BESR 5IJVB 3RDTA 3D39B 5TF0A 2LE9A 2AV1B 2ZG2A 1ZT1A 2ATKA 5ECJE 1WIUA 2HFEA 4S1RL 4EOWH 2HWZH 3T2PA 3VXUE 4P2QB 3FN0H 5EZIL 1RZ7L 3DXAD 3CMOH 1BJ1J 4KAQH 4MAYC 1S7TA 2VWEE 5F7MC 5BVJA 3PWNB 2OSLB 3H9ZA 1F58H 1HWHB 2EDDA 3V5KB 3KPRE 2BRRL 1U36A 3SDAA 1QSEA 4N0UA 4E9LA 2X1PA 3PHQB 1FG2A 5DUML 1MHHA 5E5MA 3ESUF 3H3PL 5F89A 4YO0B 5DJ0A 2MCPL 5BS0D 1BQLL 3QUMH 1PG7W 1QFWM 1JNNL 3I02B 2PR4H 1R3HB 3SE8L 1AO7B 2X6MA 1M4KA 3E2HA 1CD1A 5GIRA 3PQYE 1SY6H 5FYLL 4JM4L 4X9HA 3G5ZB 5IQ9B 4WHYG 1J0ZA 4LHUD 4JHZA 32C2B 5EBMB 2DMBA 5DSCB 2C4XA 5KSBB 4Z7VB 4PRHB 4D3CL 1DQLH 1NMCC 2ID5A 4NQCA 3M1BB 4ONOA 5CD5C 5K59E 4OV5A 1YEDA 3RWGA 5DMGD 2FRGP 5F9OH 1HSBB 4JLRA 4LLYB 4B53A 1CQYA 1QP1A 2Z31D 1HQRB 2XQYK 4KMTL 4W4OA 1YMME 2MFNA 5EC1A 2G9HA 4KJWC 1FQ9C 3WIFB 1QRNE 1UB5B 1ORQB 1N3NA 3SDDD 1F4XH 2YPLE 4R7NB 3F58L 4I0PB 2NY6B 4PLJD 1I8IB 1NBZA 4GKSA 2J3SA 3L5WB 4PRID 4IBLT 2X9YA 3MA9L 3HNVL 3BDYL 4IRSA 3IXTA 4F7PA 5H94B 3OPZH 3WIHA 1GVIA 4FP8L 2A83A 2DI8A 5GSRA 4WU5A 1WIOA 1D5BB 5HYIA 2CPCA 3VGAB 4ZQKB 2BY3A 3QEHB 4KY1H 4P2QE 3CH1A 5IG7B 4MLIA 3VXNA 4NZTH 3DX7A 3C5ZD 4DGVH 2DD8H 4V3EB 3BHBB 2P8LA 2I27N 2XZQL 4Y5VB 4I0CC 4WV1A 5B4MD 4NSKA 5F1SA 2BMKB 5TDOB 4ZNEE 4H88L 1U8PA 1CR9L 4Y4HA 3VXSB 4NQVA 3SDXA 4OUUB 3O6KL 4MJ4A 5JR1H 3K7UA 4ZFFA 3PDGA 5MEOA 3X11B 1RIHH 2E7BA 3BKML 3LHPH 3HC0B 4LSSL 3LS5H 4LOUC 4HGMA 4NBYB 1FIEA 1HH9A 1BBDH 1CDCA 1FDLH 1U2HA 1YN6A 3FT2A 4FZEL 1T66C 1J1OL 3TBSA 1CGTA 3S6CA 4YC2C 4GRLC 3ETBF 5FUOH 4APQC 3KAAA 4AJ0A 1D6VH 3OKEA 4R2GD 1OTSC 2IFFL 3DI2B 1T1XB 1FL6A 4KUZH 1WBXA 4LSRL 5FKAB 3LMJL 3SDCD 3SJVE 3VDCA 2AJ3A 3A67H 4IMKA 2YS4A 2RR3A 1SYVB 1VGEH 1PKOA 1KXQE 1VESA 4YEFA 1J18A 4JKPL 2JJWA 1EGJH 4OLVL 3KJ4B 3CVIL 4JO1L 3G6AA 3AREB 1AD0A 1J9CT 4YJZL 3B4NA 1AIFB 2QQKL 2XA3A 2OJZL 3H6JA 1A1NB 5CUSH 5I76A 4M61A 1W72L 1NMBH 1YY9C 2UZIH 3T08A 1EXUA 3DRTA 1A6AB 5DJYB 5KTEL 1J10A 4MB3A 1YEJL 4BH8B 4M9PA 4GG6E 5ADPH 1UWEH 1XIWD 4NM8L 2PXYC 1LO4H 4M7LL 1QVOA 1G6RA 2O5ZL 2X4UA 4Z76A 4N0CA 5TDPB 4BA8A 1X5JA 1XGQA 2P24B 1Q1JL 4UT6L 3R1GL 1GPOH 4KKCD 1UXWB 4FQ2L 2JCCA 1GL4B 4LQ1A 4NQDD 3QUMB 3HPLA 5T1LA 3Q6GL 5K9JL 4FQXB 3BZFA 3MO1B 1JF5A 3H0TA 3GMOB 4KQ3L 3VRJB 1S7QA 4J1UA 3O4LE 1HCVA 5T5NG 3SO5A 3BKYH 5L8LB 4MA1C 4HWEH 3UJJL 3B9KD 4HT1H 1MOEA 5FO9B 3QNXA 3L1OL 4QRRB 3VCLA 3O3EA 1R5IB 4X5WA 1JUFA 4PY8J 1S9YB 1KG0A 1ZVSB 1G9MH 5SWSD 2VDKH 4BZ1H 4FQLL 3WS3A 4FG6C 1VGKB 4D0CB 4AEIH 5EU6E 4HFUH 2DM3A 1MCNA 3RWEB 1D5ZA 5DHXB 5F9DC 1F4YH 1T1WB 4OZ4A 4L8BB 5JUEH 3V52H 3MV8A 3IJSA 1DN0A 5E9DB 3PNWB 4MQ7B 3UYOD 4ENEC 3EOAA 1S9VA 5J56B 1BM3H 2VZSA 4Y1AB 2NYYC 3IFNH 2AEPH 1K3IA 3VA6A 2YEZA 3V4VL 1CDHA 2OXGA 4XTRD 4LHQB 3QIWB 3QQNA 4KK8D 1U3HA 3T0EB 3O45B 5IJKC 3V6OE 4QOKA 1RD6A 2AV7B 2C3VA 2JJTC 4AEHL 5LKNA 4QCIB 3CFKB 4X6EA 1Y6NR 5HGDA 4G5ZH 4D9QE 5DJAB 1TNNA 3BUTA 5D71H 4YHOH 2HFTA 4ZUSA 3FO9A 4KZDL 1QR4A 3BGFB 3TBYB 5L8JB 3ARPA 3NCFB 1T89A 5EIIA 3BD4A 4OUOA 5F71A 2VAAA 3V0VA 5TDNA 1IL1B 5SX4I 2WNGA 4CU7A 2FX9L 4R4ND 5CJQL 3MYJA 2WINA 1HI6A 2W65A 4CU6A 4IRZH 2BVQA 2NY5H 1HZHH 3DUUA 5IFAL 4UQ3B 5E03A 4TUKH 1NDGB 1ZTXH 4G6JH 3PDOB 4POZD 4K8RD 1I4FA 2EDXA 1JYWA 1KPUB 4HJGA 3C60C 4XNMB 2BVUA 3F5WB 3O2VL 4LRIA 5I1AA 4PJAE 5EOTB 4NFBA 3TA3D 1BPVA 4MWFB 1H3PL 3U4BL 3IDNB 2OTWA 4P49A 4G8IA 4LVNB 2HRPH 1NANH 4NO0B 1I8LC 1MCBA 4YDVA 3EYUH 5HD8C 2FZ3A 4U1LB 2XNAB 4MS8D 2CLRA 4ACPA 4TOYH 3KYOB 4XP5L 3NFPA 4F9PA 3NMEA 4Y1AE 1W0VA 4MXVE 1U8KB 1RJLB 5T3ZE 1CXLA 2ADGA 1OAQL 4PJCE 1FN4B 3AU1B 3V4PH 4POYA 3O11A 1T4KB 1JWUB 1OTTD 1U58A 5CAYB 3ARFB 3MNZB 2R39A 2DMKA 4NQEE 3BKJH 4UOJA 2APVA 4J3WA 3EW3B 5K9QG 3DMMA 3BWAB 1S5IL 4QNPE 4DFHA 1CICC 2VLKD 1NCBH 5EULV 3MLUL 5F7HA 1RIVH 3V0AC 4J3OC 3QJFA 2CIIA 3QI9C 3SKOB 1JN6A 3AXLB 1K9TA 3LEXA 4X80L 3MLRL 3IFOA 1VKXB 5BJTB 2RB8A 2HA1A 1A7RH 1HXMA 4LK4A 3VD5A 3LEVL 2OZ4A 4QWWD 1ZS8B 1HHIA 4HX1A 3TBVB 1AC6A 2APXA 2EIEA 2BNRE 5I8KL 3LN5A 3LKNA 4JE4B 1MELA 3SE4C 5A16A 1KJ3H 5EU7E 5ICYB 3SCMA 3OTTA 3UZVB 1EHLH 1L6XA 3U6RA 4U3HA 5HDBE 1T7VA 3UP1A 1PKQA 3NACH 1UT9A 5JW4Q 1U91A 1SBSH 4K3DL 1LO5B 3BD3A 4EN3B 2GTZA 4YHNA 2ITDB 4W6XB 4CDHA 4LCUA 3GMNB 5FB8A 5DK3A 1JZ4A 2VKWA 1BIHA 4ORZC 3GSQB 5KSAD 5E1AB 2EDRA 1J0JA 4J3XA 3RBSA 4U1KA 3WIHH 1A7OL 3C5ZA 5E8DL 3E3QA 4CN4A 1JPST 5CBAB 4NCDA 1FL5A 2JB5L 5SWZE 2D7MA 4KRPB 3OGCB 2DRUA 1T2XA 1AQKH 1XZ0A 2AJVL 4R96B 4XCNB 4YNYB 1FH5H 2HAZA 4JDZA 3VGFA 5J1TC 4LSUH 3RL2A 1FSKB 4YHYB 4GJTB 3ARDD 3NOIA 2ZCLL 4HLJA 4QLRA 1HSAB 4ZSOB 1NCTA 5LGJA 1B4RA 3K2MC 5DD3L 2BVPA 3MV7B 4G6ML 3QEQA 5GJTH 3GSUA 5C0JA 2VDPH 1ZWIB 3BIBX 4MNGA 5FCUH 4EDXB 3TO4C 3WHXA 3ARGA 4O51A 3OZ9H 5D7SL 5EORH 4H1LG 1J11A 4LLWA 3L3IB 4YDLB 2VKXA 1P1ZB 4I1NB 5FGSA 4QRRD 2Y06L 1GHFL 3GKWL 1IAMA 1UM5L 1ZA3A 5IFHL 5TE4H 4MD4A 2XN9A 4XMPL 2DQUL 4PS4H 2YK1L 4G8GB 2D03H 1P5UA 4KRNA 5D2NE 3I6KB 5F7EL 3ERYA 1IGCL 1NMAL 3EYQC 5EA0L 1T03H 3RDTB 5EWIL 2C1OB 4JFYA 4WJ5B 1WAAF 2XG5A 1ZT1B 3KLAB 3DETD 4WIQA 1XGUA 2HFEB 2RCSH 4GAYB 4F9LA 4JFHE 1A47A 3OKYA 5GHWH 3NFNA 5EZOL 1A2YA 4XAKD 4TPRL 4PJXF 3ISWA 1X5AA 3BN9D 4N5ED 3GMMA 3QIWD 3I6LD 3FB5A 2NXYC 3SDAB 1QSEB 4Q9BA 1G6RH 4KMLB 4OBSA 3BPNB 3ARWA 4HK3N 1TVBA 4N0UB 4TVPH 5DEGA 1FG2B 1IGFH 1MHHB 3MCG1 2P4AB 2Z35A 2W91A 4HV8A 3ZT7A 1T0MA 4LF3A 4EQ2A 1JF1A 5F89B 3GFUA 2PF6A 3WLWC 3ULUL 2D3VA 4XMKH 3O3UN 4FQPA 1V7NL 1Z0NA 2EIZA 2LTQB 3GHBH 1IGTB 2NX5D 4OB5H 3E2HB 3SBWA 1CD1B 5GIRB 2KZWA 4EUPB 5DK0A 2Q8BH 3SY0A 4LNRA 5HHNB 5SWSA 2WV3A 4C55A 1SEQL 1IGYA 5C6WH 4OV5B 1YEDB 4X7CC 3G5XB 3EAKA 3H8NA 4O9HH 2YD6A 4UQ2A 5DT1L 3TJEH 4PV8A 3P9WB 3QZWB 4A6YA 2R2BB 5EC1B 2G9HB 4A2MA 3VWKA 1CFQA 4XPGL 1PSKL 5GGQH 5F93C 2H32A 1CDJA 3MRMA 4XVTH 1GZPA 4U6TA 1RZKH 4L3CA 2E7LC 4GKSB 3EO1B 3P4NA 3HAEA 1GC1L 2CD0A 1IZJA 4S11A 4XHJD 2HN7A 2DTSA 2F53D 4PJHB 4IRSB 3IXTB 3CXDL 4X7TB 2EE6A 2OLDA 4PTTA 4OT1H 5GSRB 4HIHB 3JWNC 3OG6B 5DQDH 5JDSB 4C83A 4G7VH 4S1SL 2AABH 3GSOA 1VFOA 2V2WB 4DKEH 1UM4H 5FGCE 2F54A 3IF1B 5F7YC 1H3XA 2P8LB 3ILPB 4WV1B 5CILL 5EIVA 1YNTB 2YA1A 4AENA 1TJGH 1AD9A 4Y4HB 3SDXB 5GS1B 1ZANL 4IRJB 4XI5C 5MEOB 1GSMA 3FO2A 4PYHA 1K5NA 3K8MA 4ZS7L 5J11C 1QBMH 4U1SA 1HH9B 1CGSL 1YN6B 4JHWL 3FT2B 2AJXL 2R1XA 1KYOJ 5B38A 1CGVA 1MJ7L 4LASL 4F37K 4KZEH 5E99H 3OKEB 1TITA 4NKQB 1FL6B 25C8H 4NQCE 1FNLA 1I1AC 3ALPA 1JI1A 1MCFA 1W0WA 2N4IA 3S35X 2M2DA 5BOPA 1OT2A 4UTAH 1JE6A 4MS8A 1CU4L 1FE8L 3DUHA 4F8TA 3SGKA 3G6AB 1AD0B 5JHDD 1HHJB 1T6WA 1KELL 1VFAA 2CO7B 2DLFH 5JHLH 1CF8H 5FECB 5I76B 4M61B 3UPCA 2AK1L 4NBXB 3CXHK 3DTXA 1CE1H 3DRQ