5ADPH

Crystal structure of the a.17 antibody fab fragment - light chain s35r mutant
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
222
structure length
211
Chain Sequence
VQLQESGPGLVKPSETLSLTCAVSGYSISSGYYWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAGLTANWGQGTLTTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords FAB A.17
publication title Robotic Qm/Mm-Driven Maturation of Antibody Combining Sites.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 211
sequence length 222
ec nomenclature
pdb deposition date 2015-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5adpH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5adpH01
2XWBB 2GK2A 4WU7A 1XT5A 3EYFB 3ZZ1A 5D2LF 1FGNL 4LPXA 3PXJA 4PTTB 4BKLB 3LKRA 3QYCA 4WHYG 2HJKB 2NLJB 1MJ7H 4TSAH 1ZEAH 4LGPB 4PJEF 2Y7QB 3HNSL 1FCGA 1TZIA 3P11H 3NPZB 3TA3D 2CR3A 2AABH 1FLRH 2E9JA 3SO5A 3FN9A 4FG6D 1AP2A 2FEEL 4EN3D 1MI5A 4AEHH 2W9EH 4Z7QF 3ARXA 1VACB 3MODL 3K7UA 4DGYL 2V2XA 3EOYG 4X0KA 2BRQA 3O2DL 5A2FA 4MJIA 3EAKA 3ZYOA 4DKFH 1Z3GH 1ZA6A 4EUPG 2F19L 3KR3H 2AJYL 3MV9E 1OGTA 4HZLB 4M1GH 4OF6A 5IBUG 2MPAH 4Y88A 3SKJL 4JFFA 2R2BA 4JFPB 4JZJB 1IGIH 2P8MA 4UOJA 3MZTA 3KLAA 2IBBA 2RFXA 3RDTD 2VLKE 1YPZB 5KVGH 4YBLB 3QJHB 2IPKB 4JY5H 1VADB 2JJSA 2DQFB 3RZCB 4MJ6B 3H9YA 5B39A 3HMWL 5C0FA 5IFJB 1FYTB 1PKQB 4JPVL 5FYKH 5IEHB 2V2WA 1EMTL 5IW1A 4GBXA 3T1FA 1S78D 4OZFH 4OAWA 3UTQA 1HQ4B 1X5LA 5JUEH 1EO8L 2A9ML 4WTZA 5IHUH 3D48R 1OW0C 3KAAA 4JEGB 4P46A 3F7YB 5CZXD 3IKCB 4QLRA 2ZJSL 2XYCA 4JANA 3Q5OA 2X4QA 2I9TB 2IGFH 1HSBA 4LHUG 5T3XD 1CT8B 3BDYL 3ESVF 3QT2A 1KEMH 5ESAB 2AJSH 1U3ZA 2E7HA 3NA9H 1Z9LA 1H15A 1SEQL 4TVSa 4ZUSB 4JR9H 2DB8A 1YNLH 3UTOA 5HI3D 1NDGA 5KAQG 2HRPL 4DVBB 5HHNA 2DD8H 2ZCLH 1AR1D 3TN0C 2HWZL 4R90H 3G6AB 4K7FA 2COQA 5DD6B 3ZYIA 1PZ5A 3QXAA 1UM6L 3I3DA 3MLZH 3UAJD 1SJHA 3O9WD 4PJHF 5EWIH 4KRPD 3O6FA 4QHKJ 4HWBA 3RA7H 4Y8DC 4ELMB 3H7BA 4GOSA 1EAJA 3X3GL 5SWZB 3LQAH 1JK8B 4IHOA 3N0PB 1UT9A 3ALWA 3E2HB 3R06B 3MA7B 3U46A 1EVTC 1AH1A 3O4LA 2HH0H 5HHPA 3DSFH 4AENB 3IKKA 5CHNA 5DMYA 3MV7D 1FORH 4IJ3B 2NY1B 2VKXA 3WFBH 2AK4A 3IJHB 3T2PA 1BVLB 1B0WA 4S2SB 4M48L 3MCLL 5KW9L 1RULH 4Y2DC 5I74C 3OAYH 4MXQD 4FG6C 4EN3C 1LE5B 3F5WA 2VDPH 4PB9L 4DUXA 3RUGE 2QR0A 4ZS6C 2VXSL 1N0XL 2E7BA 4QHUA 5C0AB 3WFCL 4PGEA 5CLWA 1D6EA 1Q9KA 2J88L 2B5IB 1AE6L 1MFDL 1JGVL 2VC2L 3HMXH 4ODTH 3IDUA 4I18C 4NN5C 2R0LL 4DK6A 4OB5H 4UT7L 4FTVD 2CIIB 5D1XA 4LHQB 4HHAB 4P3WA 5HBBA 3BT2H 3HE7A 3HE6B 4Y1AA 5DUBB 4UI2A 4QRPA 1KIPB 4K3JH 2PYEE 4MD4B 4D3CH 1CGUA 3FFCB 1IARB 5F7DB 4I3GA 4WCYH 1A47A 4L3CA 1UVQB 4N5ED 1WAAF 1YEIL 5DK0B 4Y4HB 5FK9A 4UV4H 5CD3B 4ZTPH 4UIMA 1NAML 5T1DH 4CW1A 1FO0B 4XHJD 1C16B 1IAIL 2Q8BL 3L7EB 2JF1A 4NQDE 3K2UL 2JELL 4XRCA 1MUJA 1N8ZB 4JFFD 3QZWA 1NMAL 2JB5L 1F00I 3SE4A 2FX8H 2VZTA 1MFEH 1OCWH 4Y5XC 2CRIA 4HF5H 1XF5A 3BWAB 1IGJB 4W4OC 1HWGB 1CN4A 1JF1B 1CZ8L 5D70H 2E5EA 4GW1A 2BNRB 3L7FB 1UZ8B 3FAWA 4QO1A 4JLRB 3W82A 1EFXA 2ENYA 5A40E 5CWSA 5FEBA 4GBXD 1T2JA 1Q9OB 2AW2A 1QBLL 5HI3C 4EQ2A 1HYSD 3M45A 4XP9H 4PLKD 3GJFH 3OSKA 3TWCL 1AR1C 5SV3A 2DAVA 5DJ2A 3GMMA 4JKWA 4D94A 1F3DH 3T4AB 1YNTB 3MROB 5BOZG 1AIFB 2GFBA 4XBGA 4CVWA 1UWEH 4U6VH 3EW3B 4M43L 4M8QA 1GGBL 1NGQH 4OV5A 5DQ9A 1AXSB 3TIEA 1T0MB 3O81A 3I84A 2XXCB 4TYUA 5GRXG 1KN4H 1G7MB 2ZCKL 3JWDH 5DJDA 1LD9A 3D9AH 3TNMA 2UV3A 4QXGH 3B6SB 1RUPH 5GRUH 4PJ5B 3T8XB 2O5YH 4FQ1H 3MBXH 1J0KA 1AQDA 2GJ6D 4OZIA 5FA3B 1C5BL 3ZE1F 4PJDB 2CKBA 2GAZA 2I5YH 3NFNB 4O02H 1AGCA 4MXQC 4XMLL 2EDYA 4JQXC 4RFEB 5C08B 3MO1A 4PJ9B 4ELME 4QY8A 1FAIL 2NX5A 5SWZE 2FDBP 3QUKB 4FOMA 4LBEB 4OGAD 4A6YB 1GZPB 3O4LD 5JOPE 3H6JA 4KK8D 3DYPA 1YC8A 2AEPL 2A1WH 1A7PH 2RR3A 4Z0BL 4PGCA 4XCFL 1JYWA 3IFOB 2D0HA 4X98B 1EHLH 4M5YH 4OCNC 1HSAB 1JV5B 3FL7A 1TJGH 4ZOAA 4JDVB 1BGXL 1CFSA 5C71A 4UQ2B 1DVFD 1M6OB 1AO7A 2C9AA 4J3XA 4G7YH 4G6JH 5ADPL 3IFLH 5DS8B 6CGTA 2GEEA 5JHDA 3QFJE 1RVFH 1NGWA 2WIIA 5TF0A 4M4PA 4HG4K 3FZUD 3TH2T 32C2A 5KZCD 1KJVA 3NIGF 4LCWA 1HI6B 5I1HH 2ICWB 2XWBA 2R9HC 4N5EC 3IGAB 5HGHA 4PTTA 2B0SH 4BKLA 3QUMH 3VGAC 3NIFE 4X8JB 1GAFH 1TJHH 3P73B 2EDXA 3IAPA 4TULH 4OQTA 2C3XA 1AY1L 3GM8A 2D7TL 4H20H 5A2IH 1OOAA 5BZWA 3HE7D 3PP3H 1GHFH 1MREH 3RWIB 1W2KT 1J10A 4CVZB 5DR5H 4J3UA 4XNYH 5KANG 3FFCE 5KSAD 1LEKA 3OGCA 3DLQR 2JJSC 3VRJA 5DMIH 4J2XA 2CH8A 4KDVA 3CXHJ 3VU2A 3RUGF 3SGJA 4GBXC 1RZKH 3VFPB 4U1JA 3RIFK 3V7AG 2RGSA 4F37K 3X11B 2V9TA 1X5IA 4HZLA 2JK5B 2X9WA 1WBYA 4FFYH 4P46C 3V52H 4AEIH 1UXWB 1T21B 2OBGA 4JFPA 3VD9A 3HZVA 1G9MC 4GXUN 5DJ8A 2NY0B 1VGKA 4ODBD 5I1AB 3O41B 4I9WE 2BNRE 4PYGA 2VLKD 5INCB 1J9CT 3O11A 1YPZA 3RVTC 3JUYA 4X6DB 2Q1EA 1EFXD 3QJHA 4WUKH 3KPMB 5I8CA 2QSVA 4XPTH 1VADA 2EXYD 2DQFA 3BGAA 3RTQB 4MJ6A 5JMOC 5C07E 1G6VK 1FYTA 1PKQA 1C12B 3GMRA 1PAMA 3S9DB 1QFUL 5IEHA 3O2DA 4RMQA 1RZ7L 5DD1L 2BNQA 1HQ4A 3U1SL 3MCKB 3ZYJA 4X9FA 5J9PB 3O6FC 1NCCH 4Q9QL 4YHNA 2NY4D 1IEAB 1KXTB 1XGPB 3OAZH 3S36L 2Q7NA 3QXDB 2VDNL 4R2GC 1ULVA 3IKCA 2G2RB 4UUJB 2XFXB 4YNYA 2AJXH 2IG2L 4NKMA 5D7LB 5HYSB 2I9TA 1CD8A 1HH9B 1EJOL 1OARL 1XCTB 2A83B 1V7NH 4E41B 5E6IB 2NY6D 2DKMA 5CJ5A 1LEIA 3U36A 4D0CA 4RBPK 1BP3B 1I8MB 3FB7B 5KSBB 4L4TB 1CI5A 4OT1L 2Y06L 2YBRB 3BPLC 3G6AA 3VH8B 3ISWA 3VFOA 4PRAB 1GGYA 1RUKL 15C8H 1UCTA 1I1YB 1MH5B 3CFCL 3UTZB 2XKSA 1RHFA 3WJJA 4PJAF 3B5GA 4XP6H 3R06A 4X8XA 2DQJL 3L5IA 3ZDYE 3BRGC 1I9RH 1SYSB 4DJMA 5IB5A 4Z7VB 1B3JA 2F8XC 1CICB 1H3WM 3V6ZA 5D1XC 3PWUB 3ZL4L 1AO7D 3IJHA 3M8OL 1BVLA 2MQ3A 3HE7C 4NDMB 4NNXB 2Y36L 5DMKA 1S9KC 4K71C 1T1YA 4JAMB 3LKOB 5DYOA 1LE5A 4HEME 2AERT 3RJDA 3GI8H 1J1XH 4PBVC 4ODSH 3CZJA 2VH5L 3NAAH 1DBJH 1F4HA 5MEQB 5M95B 2CKNA 2DQTL 5C0AA 3CU7A 5TE7L 1CS6A 4K94H 2GITB 2I07B 3SE8L 4NBYB 3IDXL 1NFDE 5TPWL 4BQ8A 1UKTA 2WUBL 3RWDA 4MDIA 3SE4C 1N0LA 5J6GB 4C4KT 4X83A 2NYYD 3K81A 3AS1A 4G8EA 2CUIA 3HKFA 1U36A 4HHAA 5BS0E 1B2WH 3PXHA 5EOCL 3CSYB 1SBSL 3MJ6A 5F7MC 3S6CA 1DQLH 1S7QB 1E4XI 4H8WL 5CEZL 3SKNB 1TPXB 2AXFA 5FGBA 4NJAH 1UVQA 1OL0A 3I6KA 5EUKB 4UQ3B 1CGVA 2J6EL 4KU1A 1MCRA 5E2TL 1FO0A 3SDXB 5HD8C 3L7EA 1URLA 4FMKA 1LO0L 4CDGC 5D1ZA 4WI5A 3LHPL 2ICES 3I9GL 4L9DA 4TUJA 5JW3L 4R97C 1MCPH 1YA5A 3RVWD 1BOYA 4X6BB 1O7VA 2ITDB 4X6DE 1RURH 4HJGA 5ILTH 3L7FA 2O5ZH 3RZCD 1UM4L 1HHHA 1FYTD 5GISL 2AEQH 4XPHH 3PWPB 4TSBL 1B0RB 1DP0A 2NZ9D 2GY5A 3MRHB 5DJYB 1XF1A 5DJZA 5DMJB 1DBKH 5EZOL 4XP1L 3H42H 4LL9A 3MROA 4PJXB 3VDBA 2GIYA 1ADQL 4YX2H 4GAJH 1QTYT 2B1AL 2SEBA 2EH8H 5HY9B 3FN3A 4AIZA 3TH4T 5D7LE 4JO3H 1F4XL 3FRUB 5I19L 1BOGA 5JMRA 1AXSA 1P84K 2V5MA 3BMWA 3DECA 2Z8WC 1F90L 3WFHB 1GC1C 1UWXK 1G7MA 2KQMA 5DHVA 4G6AC 5M94B 1CFQB 1KBGH 1JGUL 5IW6A 3D0VA 2YR3A 3B3IA 1CDCA 5JXEA 1IGYB 2YPVL 1PDKA 2PW1B 4G6ML 4KFZC 4Y4KA 5FA3A 1CE6B 4UINL 3DUHA 4PJDA 1QNZL 1FZOA 1B4RA 5SWQB 4O2CA 3SEPA 5C08A 1DLFH 3OKYA 4PJ9A 5SWZD 2E8YA 2FJFB 4MX7A 1DBBL 1RU9H 4LBEA 4LLMB 5DWUL 2DQGL 3V6FB 5CINL 4JZNB 2CMRL 2L0DA 2XZAH 4KK9D 1T83A 2NY1D 4X98A 4GAYB 3BRFA 4XVUC 2FNBA 4Z8FH 3DJ9A 4X7TB 4AIOA 5T3ZE 3WE6A 4ONFL 2AXGB 25C8H 3QPQD 5F1NA 4UTAL 1U8PB 2NYYC 1YEDA 4JHWH 2BX5A 5EIIA 1X4XA 3RVVC 4MJ4A 1R5IA 1A1OA 4J7RA 3W0WE 4YDKH 4XC3H 3P9LA 5HGDA 5I2IB 2AEIT 5FYLL 3SGJC 3GM0A 4LNVA 2ICWA 5C0AD 4DFIA 5FAAA 5JIKA 4RAHA 3LMJL 4N0CD 2ARJA 2EIDA 2NR6C 4TPRL 2HA1A 3V5KB 1ZTXH 3LV3A 5EU6B 4X8JA 5SX5H 4WWKB 1UB6B 4AT6B 2EC9T 2H26B 2X4PB 3RI5K 3VGHA 1JMXA 1A6UH 3HE6D 3RVWC 4W81A 2DLFL 3BEVA 2C1PB 4F57H 5K9OA 1HK6A 3FFCD 3N85H 2VXTH 1I1AA 5ICYB 4OTXH 5J56B 3ULVE 2HKHL 5CBEA 2F5BH 1N4XL 4Y4HD 1S7XB 5HDBF 3EGSB 4JKMA 5E95B 2QADB 4U1IA 1FFNB 1I3GH 1MRDH 1TQBC 4DTGH 1NBZB 4XBEL 3SKMB 1U95A 2DF3A 2Y07H 1T22A 1QYGL 3X11A 1UC6A 1NFDF 5EU4A 5IVNA 3R8QA 1SJVA 4Z5RB 4PJGB 1T21A 5F3BB 1CTOA 2Y1VA 4X99B 3RGVD 3G9VA 2BNRD 3FB8A 3O41A 4KC3B 4WI7A 5INCA 5HYFA 3KPMA 2FX7L 3RVUD 1CDBA 3MRIB 2IBZX 4BM7A 4IDLA 4QHNB 2DTMH 2WLZA 1C5CH 4GRLB 2ADJB 3B2VL 1XCQB 4X7DC 5E4EC 3BJ91 3BI9X 5HSFA 1JHLL 4PJXE 4R0LB 4JVUA 3CK0H 4CGTA 4HIHB 2J8OA 5FA4A 3OPZL 3WJJC 2ZKHH 3QXDA 4FXGB 3DROB 1A1MA 4PJ7B 1FIGL 2G2RA 2JKXA 3GEWB 5HYSA 3EYOB 4H0IA 4KK9C 4GKNB 3C2AH 1HH9A 3U7WL 4X6DF 1XCTA 1S8DA 2A83A 4N0YH 4YXKL 4E41A 4TUKL 4PJ5D 1AI1L 2JJUA 3S4SG 3GI9H 4JO2H 1I8IB 1QFHA 2GT9A 4OLWH 4F7MB 3INUH 3QPQC 1BZ9A 4GXVL 4LF3A 2VJXA 3QRGL 3OGOE 4J23A 3FB7A 3GKZA 1MOEA 4L4TA 1YYMH 4XI5D 1Z0MA 5C0CB 5KSBA 1A4JB 1V05A 5F3HB 5C08D 2YBRA 3VDAA 2PCPA 4PJ9D 4NJ9L 5J13B 4PJIE 3PWJA 4HGKC 4KQ4H 1IC1A 1Y6KR 3IJYB 3UTZA 1DN2A 3AS2A 5DC9B 1INDH 3VJ6A 4DN3L 3OZ9L 3WSQH 3QDMB 2BK8A 1SYSA 4K7PH 4Z7VA 1KCUL 1Q94B 1S9XA 1BVKB 2IPUG 4ZSOB 3IDYC 5ACZB 4MA3B 1FL5B 2AQ2A 4E0RB 2JCCB 3E6HA 3FKUS 2L7UA 4RMWA 1RIVL 4JAMA 4R96B 1YUHB 3LKOA 4OZ4A 3T04D 5FGBC 2CGRH 4PS4H 4ZTOH 1M4KA 1MCQA 4OM1H 2X09A 3N1MC 3JUZA 1MCKA 5T1MA 5FV1L 5EO9B 5CEYA 3ZHLA 1Q1JL 4LASH 4HV8B 4Q9RH 1DBMH 1U8LA 2I07A 5D1ZC 4M9OA 1DANU 5TFSH 3DUSB 4OGXL 5J6GA 1ZGLP 1CXEA 3MJ8B 2PN5A 5I73B 4XBPA 5KVFL 3DVNB 4G5ZL 3WHXA 5ID0A 5CKAA 1N5AA 4PJCA 3VGGA 3QWOA 3QG7L 1U8NB 1VESA 3HI1B 1Q0XH 4XH2B 4RSVA 3HR6A 2BMKB 3KPTA 4ODHL 4LPTA 4OLZL 1U8IB 2M26A 5EUKA 4WTXA 1S7SB 3WNOA 3O45B 3SDXA 4GKZB 3KPSA 5CEXB 1PEZA 4PJGE 2ED8A 4ELKB 1B90A 1WC7B 2NY0D 3OHXB 4NHUB 1W0VB 5IWLA 5HYJB 4H5SA 2HJLA 1MLBA 1GGCH 1YY9D 1W0WB 2ITDA 1TTGA 4I3SH 1LE9B 3RTQD 4C56E 4LPYA 3KJ6L 3ULVF 4KMQA 4YHML 5JXEC 1MQKH 3PWPA 4Y4KC 4DQOH 1YMME 4R26L 1D5XA 4JFHE 1OQXA 2D0FA 1S9WB 2J6EA 2K7QA 3PDDA 4PJ9C 1D9KB 2X7LB 1EEZA 4OM0L 1O7SA 3BAEH 3WKMH 1BQUA 2VXUH 1E0OB 5TQ2H 4LSVH 5HY9A 1DCLA 5D7LD 2JJVA 1T83C 1JCKA 2VLLA 2DYPA 3FMGL 4E41D 3OB0H 5AZEL 1JYVA 5JPMB 5E6ID 4MJIE 5SWSB 5C0BA 3C5JA 1NEZB 2XT1B 5C09B 2BHYA 3OQ3B 4EKXA 4L4TD 5EZIL 1IGYA 3HCVA 5C0CE 4CVUA 2VAAB 1CE6A 4L8CB 4FHBD 2QHRL 1P7HL 1YEEH 2UZIH 3C6LB 4OCWL 5I15L 4P9HH 5IVZB 2CQVA 3U4EA 1OAZH 1ERNA 3VG0H 2CLZB 2FJFA 1ADQA 1QBMH 4OUUB 4LLMA 5IHZB 5L88H 2DWEA 1U8QB 2AV1B 3V6FA 2VZSA 4JZNA 4LARL 3HAEB 2C3VB 4CBPA 3LDBC 4L1DA 1CICD 3MLXL 5E2WH 1SJEB 2IAMB 2AGJL 2GW5A 4YDIL 2QQLH 3QIBA 1H3XA 5T3ZD 1EVUA 4GQPH 2AXGA 1G6RB 1W72H 2YMXH 1U8PA 1IC7H 2ZOKA 3VFUA 3CDGA 4WEUD 2ZUSA 1I1AC 4C59B 4FQQB 2QEJA 4NQVB 2MOVA 1TMCB 4YXHL 4LKCA 5TF1L 1F6AA 3PGFH 5BVPL 5I2IA 3O3AA 4WFHE 2R56L 3L3DB 2BVTA 3GSQA 4KHTH 3QO0B 4PJIF 5JW4M 4HC1H 2C4XA 3A67H 3G5YA 4OCSH 3V5KA 3EZ8A 5EU6A 2OR8A 4S1QH 4XB8A 4BZ2L 2VZUA 3RWEB 4J3WA 4WWKA 5D7JA 1NCAH 3I85A 4FQ2L 1MNUH 3IU3A 4KTYA 2NY0C 1WZKA 5CAYB 4XP5H 1A3RH 4OGYH 5BMFH 1S5HB 5MI0B 4HH8A 5ICYA 1MF2H 2XZQH 1MCFA 5LXGH 3GZKA 1JNNH 4FQIH 1NGPL 3NFPB 2P8LB 1G1YA 3MLRH 2FR4A 3EGSA 5F9DC 1FFNA 1ZHLB 3DRQB 3QJFB 3CPLA 3QUYA 1A6WL 3RPKA 3VFNB 4F3FA 3ULVH 1UB5B 4KVNL 1A02N 3QCVH 4KMTL 4PBXA 4WV1B 3B83A 4EUPB 1KLGB 4Y5VA 5E8PA 3WDHA 4Z5RA 1S7RA 3MBEB 4PR5B 4X99A 5T5NG 4Y4FB 5IVXB 3NH7L 4M3JA 4PRHB 3N9GL 5DJ6B 1JYNA 2VB5A 3PWPD 4Q74A 3MRIA 3GFUA 4XGZB 1SY6L 4QHNA 3DGGB 5GS0L 1FZMB 2ADJA 3NBNA 4U4BA 3MRBB 3DRTA 2R4RH 3GNML 5DQJB 3BH8B 4DN4L 3WFEH 3QULB 1JN6B 7FABH 4Z7UF 1YQ2A 3V4PH 1U8MB 1K8DB 4XPAL 5GRWA 4HK0B 4LVNC 5D96B 5IG7B 3N1QC 2QQKL 5JW5B 2OTUA 1ZS8B 4PJGF 4FXGA 3U0WL 5TH2A 3PQYB 3DROA 4PJ7A 3QEUB 3ARBA 2FH8A 3DO3A 4MA1B 3IDNB 3BXNA 1QO3B 2DRUA 4HS8H 1B88A 4GKNA 1FL6B 4HUWA 4MA7H 2DICA 5C09E 1L9NA 3UX9B 2HLFD 4LHUB 3L95A 1T5XB 4RFNC 5ESQB 4S1RL 4YHLL 5DFTA 1RHHA 3R1GH 1A4JA 4PRNB 3QXTA 2UVEA 3OKKA 5FUCE 5MP6L 3GMOA 3TV3H 2VO5A 4GRWB 1XH3A 4PB0L 1LDSA 1A6VH 1A4KB 4QXTB 1Z3GL 3ZTNH 1QLRB 1K4CA 1OPGH 3QDMA 2IANB 3BKJL 5GXBB 3NCBB 1A7RH 5BJTB 5L8KB 5EA0L 2E27L 2BERA 5D7SL 4X4ZA 2A77H 4RIRA 4UDTB 4ZSOA 2VOTA 2IFFL 2DJSA 1FL5A 3WXVH 5F88A 4JRXA 2JCCA 3PP4L 1NC2A 2G9HA 3E6FB 3MRCB 1SM3H 5CKGA 2CO6B 3BKMH 3RL1B 1CF8H 1RUQL 1LNUA 1IQDB 4LLQB 3SDDC 5I0DA 4I0PB 1BQLH 1VGEH 3CU1A 5EU6D 2W0LA 5DRXB 5DUPH 2NW3B 1EUTA 2DI8A 2R23B 4WWKD 3CZFA 4M5ZH 3JBG7 1LO4H 1JGLH 1R3IL 2ORBL 5DDHA 2GKIA 3DUSA 5JQ6H 4RMVA 1ZLUK 5GRVK 5IWLC 2VE6B 2XN9E 5LCVL 3BKCL 5T3XH 3SN6N 1MWAL 2NX5E 2CD0A 4XPFH 4OJFL 2VDKL 2YA2A 2VZ3A 1EGJH 5C2BL 5CFHA 5L7XH 4JFEB 3G5XB 3HI1A 4XH2A 1P4LA 2QADD 2VDLH 4DUVA 5B22A 4G6KL 2G60H 4X4XB 4RGNC 1U8IA 2ED7A 1NGYB 1S7SA 3NCYP 5IUSA 2WBJA 4U3CA 2DQUH 4M7LH 3CCHB 1P5UA 4XXCA 5I76B 5CEXA 1CGWA 5E99H 4ELKA 1K4DB 4UDUB 1AHWB 3N50A 5F93C 3RHWK 2OXHA 3MLSL 5HYJA 3OF6A 3KLHC 5IVXE 3GSUB 5H35A 4XNXH 4NSKB 4PRHE 3BW9B 2J3SA 4JFDB 4X7CC 3LPFA 5D7IA 1LE9A 1TNMA 2VNCA 1NMBL 4YQXL 3EHBD 2MHAB 2HLFC 5FUZH 3TT1H 3WIIH 5HYQB 3ULUE 3DXAA 4GRLD 4JFQB 1RJLB 1OD9A 3LVEA 5C1MB 1U92B 4JVPA 3VFWB 4PY8I 1S9WA 3U83A 5F7YC 1FRGH 4I1NB 5HHOB 5TQ0L 1NH6A 1D9KA 3K1DA 2X7LA 4KKNA 4OFIA 3FQWB 3H9SB 3MNVA 1K5NB 3HI5L 4ONHA 3TNNB 5I71B 5EOQH 3D25B 4YEEA 3PQYE 3UPAA 3K8MA 4XP4L 1BX2B 4JDTL 3EO1A 4FP8L 3SGEH 3LS4L 3EOTH 1F11A 5EZJA 2XACC 5FDYA 4WFGE 5JPMA 3QIBC 5IFAH 5SWSA 3C6SB 1NEZA 4Q6IB 1S3KL 3SDAA 2KL6A 4P9MH 2N7AA 1MLCB 1WGOA 5C0EA 5E24E 1AXIB 1CLYL 3NCJL 2H8PA 2HKFH 1I4FA 2WWMD 3HS0B 1R0AL 5IJKA 4U31A 4TOYL 2CLZA 4YBQD 3FAXA 2I26N 1Q38A 3P0VL 5IHZA 2AV1A 3QDMD 4QXUL 3HAEA 2C3VA 1LHZA 5D93C 1LO5B 2ITCA 2V2TB 4KI1A 1NLBH 4WWKC 1WICA 5D7JC 2FIKB 1KGCD 1ORQB 4NZDA 2X41A 2IAMA 1VEPA 2ZUYA 5HJ3A 2VXQH 2GTWA 4P4KA 1WTLA 2VDQL 5C0RH 1KCRH 1G6RA 1VFUA 3HC4H 1IBGH 2BRRH 2XPGB 3MUZ1 4C58B 1I8KA 1DQDH 1WJ3A 3HNTH 2JB6B 3GRWH 3RPIB 5EORL 4MB4A 4LLVB 4WFHD 2BC4B 5DJCB 5EOTB 3L3DA 4Q6YA 4GMSH 3EOAB 3QO0A 2GK0B 2CRMA 3HUJB 3QUYC 4TNWF 4JM2B 4WRLA 3TPKA 3O6KH 4HIJB 3RWEA 5ADOH 4Y5VC 2GSIB 1G9MH 2OTPA 4WHCA 1E4WL 5HVHC 4U6VL 5FGCB 1A7NH 3QXVA 4Z9KB 4YO0A 3TYFB 1MY7A 2Z31A 5EU7C 1S5HA 3RAJH 3U6RA 4YK4B 4MVBC 1CWVA 4P48A 4OLXL 3UBXI 1RZFH 4ODXB 1UZ6E 3DV6A 3EHBC 3SQBA 3NFPA 4UIKL 1AJ7H 2BY3A 3WFDH 4HUUA 1BLNB 4ZUVB 4HWBH 2ARJQ 3H3PH 4K7PX 1LO3H 2ZUUA 4MS8D 5BZDB 1PBYA 3HNVH 4RMUA 2NXYC 5F7FA 3NGBB 4OZIF 1CU4L 3L3OB 5HYJD 2NXZB 3OF6D 3I50H 5DA4A 1II4E 3ARBC 4PR5A 4JFDE 1QOKA 3K46A 5IKCB 5IW3A 3D39B 4OIIH 3U9PH 1H3PL 3CUPB 4KAQH 1KG0B 3CIQA 2D7QA 4CRPA 5DK3A 3DXAD 5FKAB 2ZSWA 3SHSA 4NQUA 5ITFB 4YAQA 2APBA 4XGZA 3DGGA 1FZMA 1XR8A 4NNYB 5HHOE 1D9KD 3MRBA 3GSNB 4Y19B 3OL2A 2X70A 3BH8A 2H32B 2WWMC 2R0ZL 4YBQC 2XA8L 1JMZA 1R3HA 1C08B 2D2OA 4HZAA 1VERA 3EDKA 2ERJC 1NCBH 1UFUA 5J7CC 4DGVH 4TUOB 3IDNA 3QR2A 4P3DA 4BFBD 3GUTA 1QO3A 5SWSD 2ZWLT 4NPYA 4YDJB 1U6AL 4HXAH 3WS3B 1BJ8A 5C09D 1MRFH 4K07A 5MEOB 3IFPB 5I8KH 3VG9B 1QSFB 1MREL 3JZ7A 1XMWA 3ULUF 1SY6A 5DR5L 3P0GB 3C6LD 1A6TA 3H7LA 5ENWB 3AGVA 3IB4A 1J05B 2NY5C 2CRZA 4CJ0A 4N0UB 5MEPA 3TBYB 1YYLH 2VDOH 3STZB 1A4KA 1K8IB 4Z76A 3GHEL 1FIEA 1NBYA 1CXHA 2IAMD 4YZFE 3MX0A 2FB4L 4OFYA 2A6IB 1T66D 3O3BA 2D3VA 4WFFE 5L2JB 2YN5A 1NFKA 3MLWH 2EIZB 3I6LE 3C09C 1BFSA 4U0RB 1LQSR 3QNXA 5JZ7D 2IMMA 4POZC 2VL4A 1P6FA 3T65B 3E6FA 2EKJA 4ZUWB 3MLYH 1OSZB 4LLQA 3TBSB 2LU7A 3FO1B 2WQ8A 1I7ZB 5FXCH 4I0PA 1N26A 3QWRA 4F58H 1CLOL 5AG8A 1G9NL 5FDWB 2LAGB 1KIUA 4G7VH 2PXYA 2WBJC 1O0VA 4FFVD 5DRXA 1BM3L 4ERSH 3MXWH 4KXZH 2NW3A 1ZKAA 4XXCC 2PR4L 4MS8C 2OSLA 4D2NA 3MUGB 1V3JA 4UMGA 3ZKSD 5D9SB 3S5LB 1JRHL 2P4AB 3BKYL 5FYKU 2VE6A 5DD0H 3MV8B 3BPOC 5IOPA 4KUZL 4W6YB 2G5BB 2OP4H 5GSVB 2AJXL 2YPLE 3L5XH 3DTXA 4XZUA 2APVA 4WW1B 1OP9A 1WWBX 3PNWB 1DL7L 1JHTA 1G7IB 4NM4L 1KCSH 4JDZA 4JFEA 2UY6A 4OLVH 12E8L 2PYFB 4PFEA 4JFZL 3GK8L 2CKBH 2HJFB 5IBTL 4D8PB 4ZFFA 4X4XA 2DWDB 1F42A 4NZRL 1NGYA 1PZUB 3QDJE 4G8GB 4OD1H 1QHOA 5CJOL 3NN8B 1D9KC 3V7AE 1IVLA 1YEHL 1FZJA 4XNMB 3THMH 3UTSA 4L8BB 4DEPB 5ICZA 2QKIA 3MBED 4KH2A 1IQWL 2Y5EA 5J1AB 1MCEA 1AHWA 3D39E 4Y4FD 1GC1H 1PD6A 2LTQB 2ZG1A 4X7SH 4Y16A 1MWAA 4NSKA 4PRHD 5H2BB 3QEGH 3UO1L 2QQNH 4EJ1C 4F8TA 5I66B 5EDXA 1RFDH 1OB1A 1DFBH 1TVBA 3WBDA 3SDAC 4NM8H 3SO3C 1DN0A 1UZ6F 1A7QL 4FQLH 4V2CB 2H6PB 4CMMB 5IGXL 5LBSH 1J1OH 3MJ7A 3FQRB 3HLAA 1AD0B 5AZ2L 3QUXA 5EH1A 3VMNA 2A2QT 4Y19E 4XWGL 3GMNB 3MLPA 5CZVL 5I8OL 1XGRA 5IJKC 3FQWA 3H9SA 3TNNA 4LRIA 2VQ1A 3D25A 3D85B 3PQYD 3ULUH 2P47B 4U2YA 5IB4B 1BX2A 1BF8A 3T4YA 1TTUA 1NMCB 5E2UL 1JGEB 3OJMB 4NQCA 1Q0YH 4H88L 4IMLB 1YN7A 1XIWB 3SJVB 3LKSB 2FHCA 1YC7A 4DK3A 1CR9H 2CRYA 2XRAH 3QNZB 2BCKA 4LHUD 43C9A 4P4KC 4TTGA 3W11C 4FQXB 3UJJL 2YD3A 2BXZA 4M6MH 3FONA 3GIZH 5GS0D 1XF2A 1FQ9C 5FHAL 2X1PA 1MLCA 2QSQA 5JZ7C 3ZKND 1DQLL 4OKVB 1IAOB 4LU5L 4TVPL 1KXVC 3VI4E 5DHYB 4ZS7L 1K3ZA 3HS0A 4O9HL 1FGNH 1CQYA 1I3RB 1BZQK 4KJQC 1OAXL 3D6GA 3WNKA 3B9KB 3KPRE 1XGQA 4UILL 2MJWA 3E3QE 3MOBL 5L2KB 2IAND 4U1SA 4DZBB 3F12B 4KDWA 4P5MB 2EYTA 1O5DT 3HNSH 5E8NB 4OZHB 3TO2B 2CLRA 2F53B 2F54E 2J8UB 5ISZE 3RWCA 2Z31C 1IRAY 2XPGA 3GMPB 5B3JE 3EYUL 5GRVL 4MSWA 4XXDA 4Y8AA 2C3WA 3MODH 4DGYH 3PV6A 2X1WL 1ZV5A 3RPIA 1MSPA 4I0PD 3QWRD 4NRYB 3O2DH 2UZYB 4QRTB 3TF7C 2BC4A 2F19H 3TZVB 2AJYH 1EHNA 2GK0A 3PWNB 5FB8A 3H9HB 2J4WL 4JG0H 4I0KA 3VRLF 4KGJA 3SKJH 5D8JH 2F5AL 1BREA 5E00A 4HIJA 4YZFF 3BGFC 2YPKB 5CJBA 3GMLA 3DX9B 3CC5B 5DMGD 3VXTA 4UOW0 4V1DB 3HMWH 4JFED 4LAJH 3CNKA 3JTSB 4WO4A 1L7IL 1PY9A 2DIBA 4AJ0A 4KTEL 4JPVH 4ODXA 1EMTH 1KTDB 2DM3A 5ABDE 3OKDA 4G8GE 3WKNA 1TCRB 2FD6L 1EO8H 1FNHA 2A9MH 3DMMA 1BLNA 4P4RB 3CFKB 3IT8D 5B4MD 2Y72A 4LRNH 4QHMB 5EBLB 5BZDA 2R29L 2E6PA 5D96C 2ZJSH 1M7IA 4EI5A 4GMTL 4ZOCA 5FCUL 5KSUB 2ICEB 1HHKA 3BDYH 4MA1C 4JFDD 3DOSA 4Y0GA 2XWJB 2EH7L 1SEQH 4QRQA 5I75C 5BV7L 2ID5A 3BIKB 1TVDA 1DJSA 3DVFA 5DD3L 4N9GB 4G6FB 2HRPH 3ZO0A 3UPRB 1BQSA 2HWZH 3HRZB 2VMFA 1KLFA 2G75B 43CAA 5GS0C 1UM6H 5HHMB 2HTLC 3FOLA 5HHOD 4NNYA 1VFMA 1MCWM 3STLB 3SKOA 3GSNA 3H9SD 3X3GH 4LLUB 5J8OA 3GSXB 1ITBB 2VISB 2YKLL 5L6YL 3BN9D 5F71A 4DFHA 1DLHB 5E8OB 1JNHB 5D7KE 1X5YA 4HKBB 5DRNB 1N2RB 1MELA 4MNQB 1MHCB 1WZ1L 3DX6B 4MQSB 4O4YL 2PTTA 4M48H 3MCLH 5KW9H 2HLAB 1WCBB 3Q6GL 4NHCL 1PG7W 4YXLH 5JA9A 2UY7A 5KOVC 3IFPA 4PJBA 1QSFA 3S4SB 1CGTA 3MLTB 4PB9H 2X4UB 5F7WC 2ICCA 4M6OL 3BX7C 2VXSH 1JPTL 1N0XH 2X42A 4XNQB 2ZPKL 4I0PC 1J05A 4ZXBB 4WY7L 3WFCH 2BHUA 3MACL 2J88H 1MJUL 3V4VL 5CP3A 1AE6H 5L2KE 1MFDH 4YHOL 1JGVH 2VC2H 2PXYC 3MRNB 4J3VA 4WDIA 4HGWB 2R0LH 1Q9LA 5DZLA 4UT7H 4LSDA 4OZHE 1A21A 2A6IA 2F53E 4WFFD 4N8VB 5L2JA 3I6LD 2EIZA 5EBGA 5IMOA 2BOCB 4RFOL 4NWTL 4PRIE 2M2DA 3AM8A 1EZVY 5DJXA 5DMGC 1AXTL 4JM4H 2P42B 5EZLB 3ES6A 3T65A 3DUUB 1PYWB 1YEIH 3QA3B 1CK0L 2UYLB 1OSZA 2BVUA 3FO1A 1I7ZA 1NAMH 4RAVA 2P7TA 3EO0B 3VI4F 2Q8BH 3REVB 5FDWA 2DTML 4JM2D 3K2UH 5FYJE 2JELH 4IRJB 3V0WL 2R0KL 1NMAH 2JB5H 1E6JL 1RIHL 2MSPA 3V6OA 2FECI 2RB8A 1ZT4A 3MRRB 3UCRA 1U8JB 3WLWC 4Y7MA 3VFVB 1AHWC 3S5LA 1CZ8H 3CX2A 2W0FB 3MV8A 5DHVH 2XTJB 4Y16C 1QKZL 1QRNA 2G5BA 4DOHB 2BOBB 1WBZA 4KJWD 1KPUB 1G7IA 3B5TA 4M7KL 1QBLH 4F7PA 4KK6D 1AGEA 3TWCH 4YDVA 4OF8A 1CG9B 2HJFA 3FOMA 5ERWA 1J11A 2DWDA 3DMMD 1LMKA 3MNZA 3QUXC 2X05A 3CAFA 4YEFA 2D31A 4X6CA 1PQZB 3NN8A 2P45B 4PJFB 3Q6FB 4N0FB 1ZHNA 2NPLX 1FCCA 4LKXB 2GY7B 4LRIC 2GJJA 4M43H 5I6XB 5I71C 2NXZD 1GGBH 3BN9C 4L8BA 4DWHA 1T7VA 5J1AA 3D39D 3ROLB 2ZCKH 2HRLA 1KENL 1QLEL 3B9VA 3FQNB 4JPIA 3C5ZB 5F6IB 5H2BA 1D3CA 4P3CL 3TCLA 1YY8A 1NBVL 1NLDL 2IMNA 2MNUA 1G7LA 3OJDB 1C5BH 2DTSA 2GJZA 1OD7A 1WSST 4M6AA 4Z0XB 1QFOA 5HHME 1F8TL 4XMLH 1KB5B 3QI9A 1KCVH 4JN1L 2QQQA 1FAIH 1JBJA 4Y19D 1BFOB 3GMNA 3NCYS 1F4AA 3ILPB 2GUOB 2AQ1A 2AEPH 2GSGB 4Z0BH 4HPOL 4XCFH 5C8JB 5IB4A 3S96A 1T4KB 1UWGL 5BW7A 2VQTA 4U6HB 4GAGL 1XIWA 3SJVA 3LKSA 2ZUQB 1BGXH 3T0EB 4HKZB 3UYPA 1ROWA 3BPNB 5MERA 4FQXA 1QSFD 5ADPH 1MFNA 2BVOB 3ZKXB 4YHIA 3T3PE 1GYAA 4GSDL 3SDYL 4MHHI 4NQTA 4F8QA 3TC9A 1EAPB 4H25A 2RAMA 1IAOA 3DURA 4YHZL 1BHGA 3BYYA 1E4KA 1I3RA 3F58L 5TDPB 1T5WA 4KV5F 3QFDB 4PJCF 4NCC1 3PJSB 1AY1H 2C26A 5I30L 2D7TH 3DI2B 1U58B 1C1EL 1D5BB 4N8PA 4PLOB 4HFWB 3I2CL 3TO2A 4QGTA 1EBAA 4GG6B 2J8UA 5DTFB 1W8NA 1SYVB 4CVXB 4NO3B 2APTA 3B8YA 1N59A 4WO4C 5KN5B 1G7JA 4I2XB 2IEPA 4NRYA 5I0ZA 2ZP0T 2B39A 4CDHA 1IL1B 3ZKMC 1U93A 4V2BA 5D71L 1YDPA 4CNIA 3CLEL 5AD0A 2QSCL 1DUYB 3C8KB 3DMMC 1IGTA 3PWNA 4XPGL 1GSMA 2WQRA 1OAQL 3H9HA 3J7HA 5CJXA 4F15B 4QOKB 1YEJL 3LB6D 4NGHL 4FA8A 1X6NA 1TVHB 3KPNA 3QDHA 4OBRA 3D69B 4LNRA 2X4RB 2NXZC 4EI5C 4JN2B 4RX4A 3WKML 3MV8D 3DETC 2XTJE 5FUOL 3SGEI 3HN3A 1WWCA 4ZPVB 3CC5A 3BEWB 4U1GC 2A74B 5DRZA 1FV1B 3MFGB 4G8IA 1QEWB 3D18A 2AP2A 4NWUL 4P5KA 1QFUH 3EJYD 3EDJA 4BUGA 5I8EB 2DIAA 5E2JA 1RZ7H 5GGUB 5LGHL 1EA9C 4GKSB 5DD1H 2MKWA 5FO9B 4Q9QH 3V5HB 3KPPB 2MCG1 2YWZA 1JF5A 2E9IA 4Z7NE 4ZUUB 3CFKA 5E5MA 3S36H 3MRPA 1HE7A 2VDNH 2FGZA 4JY6B 4URTB 1ZLVH 1KCLA 1KPRB 5IQ7L 2IG2H 1GZQB 3QCTL 5FO7A 3HPJA 3EOBA 1JP5A 1EJOH 1OARH 4HK3J 3KDMA 4X7EC 3MRJB 1Z5LA 5E7BA 4KZDL 1RIUL 2QQLL 3ETBF 3EO9L 3UPRA 4OT1H 2Y06H 3HRZA 5BXFB 1N7ML 3HC3L 5JOFA 3FRPA 1X3DA 3CJJA 1KIQB 3WIFB 1B0GB 5B38A 1RUKH 3AMKA 5FGSA 2OQJB 3QNYB 3GDBA 5L9DL 2AQ3A 1Y18B 3CFDA 3CFCH 1HILB 3GSXA 3D85D 1FNSL 4QCIA 2DQJH 1TNNA 5EIQA 4Z7WB 2VWEC 4HKBA 4HC1L 5DRNA 1FJ1B 5HVFB 1FZKA 2RIKA 1XIWD 1NKRA 4XC1L 1XGTA 1MHCA 4MNQA 3SJVD 4QRRA 2IH3B 4KROB 4PGZA 3ZL4H 5FFLA 1KT2B 3IXAB 4FQXD 3M8OH 2Y36H 4FZEL 1WCBA 3LRSB 2FBOJ 1ES0B 2VR5A 5JIHA 4XTRC 4QNPE 3MA9L 2ZNWA 3LH2L 3AM8C 4NKOB 2XICA 3TLRA 5H94A 3OKMB 1U8OB 2VH5H 1LEGB 4MQ7A 3OKEA 2XZQL 4H0HB 1NFIB 4LPWA 5IMMA 2R2HB 2DQTH 3B9KD 1A7OL 3CH1A 3DHJA 5TE7H 5L2KD 2H9GB 3SE8H 3ILQC 4LSQL 3GSRA 4XX1G 1KC5L 3IDXH 5TPWH 3DX8B 4U1NB 1QFWM 4BFIB 4BZ1L 1WT5A 3V6OC 2WUBH 3QRFM 4HGWA 4ZUTB 1CIUA 1M71B 4JZOB 1ZAGA 3CFEB 2EYSB 3NIDE 2F53D 4PRPE 5C0GA 3RJQB 4HDIB 4N8VA 4YDLC 5EOCH 2C3GA 1SBSH 4QF1A 4H8WH 5CEZH 2IBZY 2BOCA 4NC1C 1LDPL 5EZLA 4LSPL 5MENE 5ID1A 5KOMC 5CGYC 3TZVD 2J6EH 1G9NC 1GOGA 5E2TH 4RGMC 2M1KA 1P4BL 2Z8SA 3REVA 4N1HB 1LO0H 3U4BL 5FYJD 3MR9B 2DDQL 3LHPH 4LFHD 1EIBA 2PTVA 4QOKE 3I9GH 1R5VB 5JW3H 1ZT1B 4KDTA 4S1DC 3HR5B 2FWOA 4HJ0D 4J4PA 4P23B 5EU3A 1BF2A 3VFVA 4NQSB 2VLJB 2W0FA 2NTFA 3FQXA 3NCMA 4V1DD 1ZVHA 1UM4H 2BOBA 5GISH 1T1WB 4TSBH 4W70A 2IPTL 2R4SL 3E8UL 4MCZB 4ODUA 5D2NB 1V8HA 4P57B 3CH8A 3FO9A 4XVTL 1CG9A 3DVGA 3QI9C 1JYXA 5EZOH 4R4BB 4XP1H 3DO7B 3SY0B 3P30H 1ADQH 3ZSSA 4JKPL 2B1AH 5AAMA 4U1KA 4N0FA 1UGNA 1KSRA 4G43B 4LKXA 2XNAB 3TBTA 3O2WL 1F4XH 5I19H 3B2UD 4N8CL 1OF2B 1F90H 4X4YB 3FTGB 4NRZA 1NMCC 1A0QL 1J0HA 5BW7C 1U9KA 4I5BA 4JQVA 4TQEL 1XIWC 3FQNA 1JGUH 3C5ZA 5F96L 3G08A 4OZGA 4G6FD 1OGAE 5TDNA 2YPVH 1R5WA 4G6MH 4UINH 4N0RA 4GFTB 4MAYA 1QNZH 5HHMD 4Z0XA 4QWWD 1UM5L 1UG9A 2WBKA 1KB5A 4FFWD 5T1KB 2CLVB 2YD6A 1IM3A 4Q2ZA 4HKXA 4Z77A 3CMOL 3VXSA 5KS9B 1DBBH 5DWUH 4YGAB 1E4KC 4Z7NF 1ZOXA 2R15A 5CINH 3ILPA 4Z7WE 2CMRH 2GUOA 5FIEA 4JPWL 2QBWA 5TE4L 4BYHA 4KXZI 4MNQD 4KKBD 5J11B 1IZJA 5JQHC 2DLGA 3FQUB 3U2SA 4UTAH 5IIEB 2VXVL 1LO4L 4ONFH 4UTBL 3UJIL 5KTEL 5EUOB 3LQZA 1OP3K 3T0EA 4HKZA 4H1LG 3L5HA 1GXEA 1ZLWK 3H3KA 1MHEB 4OZFB 4LLYA 5T3XL 4GUPA 2Y9RT 3LKQB 4BQCA 4M93B 5FYLH 1BWWA 1EAPA 5CIPA 4ZXBD 4M62L 4FQHB 1ZWIB 3CVHL 4M1DL 3LMJH 4O2FA 5HDQL 1DUZB 1A9EA 4YPGB 3VXRE 4TPRH 2EZ0D 1CGSL 3VXME 3EFDL 3QFDA 1I7UA 5CJXC 1BIIB 3ZDZE 1UENA 1A6AA 2Q76B 3PJSA 5IB1A 1U58A 3QEHA 4P2QE 1UEYA 4HJ0C 2GCYA 2Z4QB 4LLDB 2DLFH 4OI9A 4RMTA 1CIDA 3HC0B 3S98A 3RWGB 4WHTB 3V2AR 2HKHH 1SYVA 4QNPF 4CVXA 5C0DB 5CCKH 1R3KA 3EYSL 2LU4A 1N4XH 3BSZL 5KN5A 4JFOA 4PREA 5C0JA 1CLCA 2OL3L 1EV2E 4MJ2A 4F37F 3L3KA 2X4NB 1IL1A 5ETUA 4XBEH 3TT1L 2MFNA 5J6HB 5A3ID 4HIIB 4IRJD 2R39A 2HT2C 3VW3L 1QYGH 3M07A 5D7IF 2P5WA 3MYJB 3RNQB 4XAWL 2DQIL 1F2QA 1HOCB 3S34L 1TVHA 2HFFB 4L29B 5D2LB 3TVMB 5GS3A 2X4RA 3VGFA 1C7SA 2VLJE 2XTJD 4LCYA 3DI3B 5F9JB 4EOWL 3OKOB 3RQ3A 2ATPA 4ZPVA 3FT4B 2FX7H 2HTKD 2IC2A 4PJEB 5AYUL 3BEWA 3C9NB 1AQKL 2I9LB 1QEWA 3PL6B 4M61B 2MKLC 1QSZA 3B2VH 3FB6B 1ND0B 4LCUA 4I13B 1JHKL 4GKSA 3OR7B 3U79A 1FNAA 1JHLH 5FO9A 3V5HA 3OPZH 1LP9E 3N06B 1FVCB 1R3LB 2X9YA 3NCEB 3MREB 3SGDI 4NCC2 4JY6A 1FIGH 1S5IL 1PLGH 3L5WB 4MHHG 1GZQA 2AJ3B 1SEBA 3U7WH 3C5ZD 1OTTC 4YXKH 4TUKH 1AI1H 3MRJA 1MAML 4YBHA 1V3MA 4GXVH 2FSEB 3U0PB 2K3TA 5IMLB 3QRGH 2FEEI 5E1AB 3DSNA 2P48B 4F7EB 1VPOL 2BP3A 5BXFA 4K8RL 1JVKA 1FH5L 4IOIB 4KKAD 2I25N 4NJ9H 5KS9E 3WIFA 1A2YB 3TFKD 3KXFA 1HILA 1WF5A 4QRUB 5HYIA 4M7ZB 4DN3H 3OZ9H 2B1HL 4GS7C 1NJ9B 4WU5B 3BVNB 1JFQL 3U82B 1KCUH 1TITA 5EUOE 3T0ED 4OCMC 3KLDA 3VMOA 5BRZB 3K2MC 3O4OB 3W81A 5T5NF 4IRSB 2C7UB 4U1LA 4P59L 4PV9A 4L9LA 4WW2A 1ES0A 2XY1A 3GJFB 1RIVH 3KPQA 5LGKA 3QDGB 4QXWA 4XVSL 5KVEL 3S8WA 3KYMB 3OKMA 3SCMB 3Q5YA 1P7KA 1LEGA 1QP1A 1OM3L 1NFIA 2R2HA 1KOAA 1QSEB 4L4VB 2EE9A 4OKDA 3U30B 3UEZA 1Q1JH 3VFTA 2H9GA 4Z7WF 5A3IC 4GO6B 4HX1A 4U1NA 2J5LB 2KUTA 4JY4A 4LPVA 4ZUTA 5GJSL 4MNGB 4OGXH 4J4PC 5HGBB 1M71A 2WMPA 2HMID 3VCLA 1YECL 4RNRA 5KVFH 4G5ZH 4IEFB 1L0XA 2EKSB 3BUTA 3QG7H 1RK1B 1BJ1J 4FZ8L 3DNKA 1GJIA 3BOVA 4ODHH 3WV0A 1MCJA 3WEXA 2HYMA 4OLZH 5I17A 1M05B 4DCQB 3F7QA 3EKCA 2HN7B 3MMEB 1YN6A 1A6ZA 4QOKD 3VXUE 4RAUB 1R5VA 2X89D 1UCBL 3RX5A 3ZDZF 3P4NB 1ZT1A 3MNWB 3HR5A 4BZYA 5B39G 1FC1A 5CUSL 2PW2B 4JFXB 5EU5B 2WWKO 4NQSA 1ETZA 4JQVC 4L8SA 1S9YB 4KY1H 3T2OA 2ILLA 3W39B 3C5ZC 3KJ6H 3LN4B 3QSKB 4YHMH 5KVDL 3RX8A 1A7BA 4HUVA 3VXNB 3BQUC 2FYYB 4R26H 2J8HA 4L5FH 1L6ZA 4MAYC 5D2NA 5F6HI 4Z7QE 4EXKA 3QUMB 2WP3T 5TE6L 1FC2D 3LSOB 1V3LA 1ORSB 2AJUL 4OM0H 4H1LA 4XCNB 3KLSA 3LD8C 3TFKC 1MJ8L 2BJML 2C4FU 2XNAA 1TZHB 2WINB 1OF2A 3FMGH 5AZEH 3NZ8A 4JREC 4MCYA 4ZYKB 3T0EC 1CD1B 1X5JA 3DX7B 3KYNB 3TA3A 3FFDB 5JNYA 3HTLX 5LGJA 2I24N 2QHRH 3L3HA 4OCWH 5I15H 4R7DA 4PY7B 5T1KA 4JFYB 1CXLA 1JZ2A 2CXGA 4LLWA 3BRDA 3MLYL 1KJ2L 4M00A 4YHYC 2YD4A 3V79C 1LP9F 2CUHA 4LARH 4RQQA 1A3LL 2PTUA 5H37H 5DSCB 3MLXH 3MV9B 2AGJH 4YDIH 2FZ3A 5IMKB 4X5XA 3FQUA 3BUYB 2XOTA 4X5WB 1SVCP 2HMIC 5D6DA 1CGYA 4JCMA 1T04B 5J12B 5DGQA 4OZFA 1MHEA 3RDTA 2GTZB 4NN6C 3UROR 4YXHH 4ODWB 5TF1H 3LKQA 5BVPH 2R56H 2W9LA 3S36X 5HPOA 1QSEE 4L4VE 1S9VA 1ZWIA 3PG2A 4OLVL 4ZDHB 1A22B 1L9MA 4YPGA 3OB0K 3RI5F 4QHLA 3QUZB 1FL3A 3B5HA 5I1DB 4EVNB 5F8QC 4BZ2H 4PP2A 4FQ2H 4GW4B 5IROA 1BIIA 1D5IL 4GKOA 2Q76A 2QV2A 3TIDB 3ARZA 3QQ9D 1BQHG 2X6MA 1NDMA 5C0ND 2R1XA 4EEEA 4U6TA 3EDFA 1HQRA 2A0LC 4WHTA 4LCCB 4P2CG 5DUML 2Q87A 5FECB 2YRLA 1NGPH 4LIQH 5EC2B 3QZWG 4ENED 3CVHA 4TRPL 3WNLA 1A6WH 4NQEB 2VLRE 4HIIA 3P4OB 2ICWI 4KVNH 5CMAA 4KMTH 3TYGL 3WIHL 2QTEA 3DBXB 4OD2A 4P23D 3MYJA 1EO5A 3MRQB 3O9WA 4MDJB 2BFVL 2RHEA 3ALPA 1RK0A 5J3HD 4KUCD 5C6TL 1HOCA 4L29A 5D2LA 3OG6B 3GSOA 2VLJD 1WLHA 1ONQA 5EO1B 1MIEL 3NH7H 5F9JA 3OKOA 3N9GH 4OQTL 1FLTX 4NBZB 5HGGS 4IIQC 5TDOB 4BH7A 4XNZB 4PJEA 1UWXH 3MOAL 3MV7A 5DJ0B 3C9NA 2VZOA 2I9LA 3TH3T 1SY6H 2OL3A 5GS0H 1H3GA 2EXWC 4E42B 3FB6A 4M9PA 4QTHB 2WZPD 2BVPA 3GNMH 4J8RA 3BFOA 3HMXA 4DN4H 1WAAE 3LEVL 3SDCC 4JO4L 4KI5C 4XPAH 3RUGB 2QQKH 5HPMA 1M7DB 1BBDL 3IDJB 1CQKA 3U0WH 3MREA 1NUGA 1XAUA 4ZOBA 3ARFB 3WO4B 1TZGL 4LVHC 1FSKC 1ZHBA 1N64L 2ESVE 4IDJL 1EBPA 2RJMA 4F80A 3MRLA 2VAJA 4MD5B 3O8XB 2FSEA 4FTVA 5IMLA 2VZVA 3U0PA 4S1RH 4YHLH 5E5RB 5E1AA 4L9LC 4WW2C 1LK3L 3UZVB 2H2PD 2UWEA 1KFAL 3QHFL 1NANI 5T1KD 5F1OB 2PYEB 5MP6H 1T2XA 35C8L 1AGFB 4HMEA 4RCAA 1A2YA 4M3KB 5DT1L 4PB0H 4UAOC 4WHDA 1X7QA 3GIVB 1T0NB 2HT4C 4U7KA 4LSSL 3BKJH 1Y0LA 2H41A 3BVNA 3G6JA 3FO2B 4NQDB 3L1OL 1ZSDB 5EA0H 2E27H 3IXTA 4JG0L 5D7SH 1I1RA 3I75B 5D8JL 1KIRB 1SQ2N 5BRZA 1ZA3A 3BZFB 2IFFH 3ZLQC 5FYKD 4QRSB 1JWUB 2X4OB 5F21B 5CILL 2C7UA 1EXUB 5C0NC 3ET9F 3PP4H 3QIWB 1QR4A 4HLJA 1JUFB 4LVOC 2VKWA 2AJVL 3QDGA 1RUQH 1F3DJ 4S0TD 4LPCA 3KYMA 5EC1A 3SCMA 3K8LA 4QTIL 5JW4Q 3ZE1E 4ENEC 4O2EB 3Q0HA 1UJ3B 2HVJA 3MUHL 3EYQC 4HS3B 4P5TB 1MPAL 2BY2A 1G7PB 1AGBA 1R3IH 3KHOA 2ORBH 4PJHA 3WHE1 1IM9B 1D5MB 3BH9A 4U6YB 4MNGA 4LRNL 2BSED 5DEZA 4PJAB 5LCVH 3UBXB 3OAUL 3BKCH 5IBLC 5FGRA 4P2OB 1MWAH 4OJFH 2VDKH 4L8SC 2BSSB 2EKSA 2E9BA 5ANMB 3BO8B 5C2BH 1QVOA 3BP6B 4NZUL 4OCYL 4PLJD 4G6KH 3TPUB 2Z93A 4R8WL 2AI0L 5GS1A 3VXOA 1X4ZA 4NQEE 2NY3B 4ZPTA 4BSVB 4EIGB 4CMHB 2GJ6A 3D3VE 5E6ZA 4AM0A 4DCQA 3NIGE 1CXKA 3AVEA 4YH6A 2BZDA 2HN7A 3MMEA 3RY5A 5F1IA 4HS6B 1QFWL 3TVMD 4ONGH 1F3JA 3MNWA 3MLSH 4DW2L 4NOFA 2PW2A 2V7NB 5EU5A 3NCFB 5HHQA 4HIXL 1NGXA 3W39A 1S9YA 2YSSB 1KJMA 1NMBH 1X5FA 1XF3B 4YQXH 3OXRA 2DLHA 3PL6D 2VIRB 3CFIC 2FYYA 3TA3C 5DJAA 4YXLL 1DVFA 1R24B 5T1LB 4EDXB 2D03L 2H2PC 5TQ0H 3RWFA 3QFJB 1JPGA 1VHPA 2ZNXA 1ORSA 1CL7L 1TIUA 3BMVA 3HI5H 5JO5B 2NW2B 4XCNA 2A73A 4XP4H 4DKEL 4JDTH 4FP8H 2HFEB 3VGEA 1FO0L 3MGAA 4OCXL 3LS4H 3OR6B 5EFIB 4KTDL 4WUUE 3DHMA 5D6CB 1U2HA 1ZVSB 1DSFL 3AREB 1RZGA 4ZYKA 3HG1B 3T77B 4KKCD 5D6DC 1CD1A 5I1CL 1S3KH 1HXYB 1S7WB 5HVWA 1NCTA 3DX7A 3KYNA 4HWZA 4C55A 3V0VB 4HCRL 3RDTC 1CLYH 3HZMB 3NCJH 5KSAA 1BQHA 3ZDXE 4M93C 1I85A 4JM4L 1J8HB 1R0AH 4TOYH 3P0VH 4XCEB 4NC2B 4QXUH 2O5XL 1EEYB 2W65B 3GSVB 1S78C 1KPVA 5IROC 4I77L 3MV9A 1DZBA 2K9UA 5BRZD 4AZ8A 2DS4A 2VDQH 3BUYA 4IRSD 3O3DB 7CGTA 3GBLA 4X5WA 1A1NB 5E8DL 5DVLA 5CZXC 2W1NA 4K8RD 1T04A 2J2ZA 5C3LD 3Q3GB 3MRMB 3QDGD 2VLKA 1P4IL 1YEKL 2GTZA 3V8OA 3SCMD 5EORH 5DD5L 1QSED 4L4VD 2A6KB 4PLJC 4RDQG 2F74B 5C07B 1KJ2A 2X4TA 1N6UA 3G04B 1IGML 1K2DB 3QUZA 5CLTA 4EVNA 5GS2H 3LEXB 3H2WA 1UA6L 1QPXA 3UAJC 3O9WC 1HINL 5C9JB 4KRPC 2CSPA 1E4WH 1FFOB 3TIDA 4PJAE 3GB7A 4A6YL 2W9DL 1VFOA 4MB5A 2B2XL 2D7MA 1P9MA 5C7XL 4P2RE 1R3JB 1IAKA 4OUOA 5F7EL 3CSGA 3MUJA 5DEGA 5ANME 3S3SA 1F45A 4LCCA 2BSTA 4Z78B 4X6CF 1D5ZA 3EJZD 4OLXH 5EN2B 1DEEA 4B41A 5AUMA 2EDNA 2YOCA 4UIKH 4ZD3L 5EC2A 1BPVA 1H8NA 5C86A 2AKRA 4KHXL 2NY2B 1WK0A 1EDQA 1TQCB 3AUVA 4X9GA 4NO2A 1DQQA 3P4OA 2WK2A 1KCVL 4I4WA 3LPGA 3MV01 3DBXA 3AXLA 1CU4H 4MDJA 4CN1A 4FQPA 3FCTB 3FJTA 3MGOA 2CK2A 3ARTA 1H3PH 5K9KA 3ROOA 2ZOLA 4HUXB 3PDOB 3AAZA 1MCOH 5TDOA 4PY8J 3C60B 4K23L 5JORB 3GGWB 5GGSA 3FB5B 3LS5H 4G9FB 1KULA 5JXAL 4QTHA 4U3XA 4XMPL 1S7TA 1DQJB 3O3EA 3WIHA 4I8DA 1AGDB 5JDSA 4E5XA 4K3GA 4LHJB 3QIUB 1L4IA 2R0ZH 1ZLSL 3RUGA 4ZNEE 2XA8H 1M7DA 1MJJB 5GRZA 3EYFA 1LO2L 3KJ4B 2EIBA 3ARFA 4M03A 1KNOB 3UPCA 4M8VA 2HJKA 2FLRT 2NLJA 4XHJC 5DFVD 1CFVL 5KSVB 1U6AH 1NFDB 3HG1E 8CGTA 5J57B 4NYLB 3MLUL 2Y7QA 3O4OC 1KTLB 2Z91B 1V5JA 4MD5A 3WN5B 5J06A 1JPFB 3IDMB 4IBLT 3QEQB 4ZAKB 4KK5D 4K8RC 5BS0B 4RMRA 1HXMB 2PYEA 1VACA 3GMQB 1J8HE 3SCMC 4GH7B 5F9OL 4F9LA 4G9DB 1KV3A 5ALBL 5E2VL 3REWB 3QO1B 1K3IA 1HYSC 2LVCA 4PLKC 1T0NA 3NACL 5I1EL 3MV9D 3GHEH 1VFBB 4U1MB 2FB4H 4PIRF 4NQDA 1KIRA 4JZJA 1JWUA 2X4OA 4IOSD 4JRYE 1ZANL 5KJRL 1EX0A 1JUFA 2WUCL 2IPKA 4CAGA 3L3IB 2EYRB 3EJZC 4CJ1A 1CFTB 3RZCA 4YGVB 1CLOH 3ZDXF 1G9NH 5IFJA 4N90E 4M6NL 4HEPG 3VRIB 5GS1C 3R4DA 3QUZD 3L3GB 1DR9A 4O2EA 1BM3H 5JR1L 1QG3A 5EPMB 3GBNL 4HS3A 2Y5TB 3CX5J 1G7PA 2PR4H 4JKLA 1MY5A 5J1SC 5HI4D 1D5MA 4U6XB 1J8KA 4XNUL 4JHAL 4U6YA 5INDB 5C9KA 1JRHH 3BKYH 3UTTB 4OGAC 3F7YA 3AROA 4HUKB 4KUZH 5FF6B 4P2OA 1T3FB 4KK8C 4CKVX 5H8DA 1DL7H 5F7LB 1CT8A 5ESAA 4NM4H 5DC0A 4CADB 12E8H 2DQHL 4JFZH 4ZUSA 5LQBH 3GK8H 5IBTH 3KS0J 5T3ZL 3TPUA 1GGIL 1DVFC 2Z92B 4NZRH 4DVBA 2FJGB 4NQED 4BSVA 4EI6B 5CJOH 5DD6A 2R8SL 1JWMB 1YEHH 5E4IA 4MJ5B 2XIDA 3FZUC 1P2CB 4TNWK 4HS6A 4ZFZB 3UZQA 4ELMA 2Q86B 3P0YL 1IQWH 2QJDA 3PWVB 1J1PL 5SWZA 4XCYB 1JK8A 1W72B 2DLEA 4NN7B 3MA7A 5HHXL 2HG5B 4LP4A 3UO1H 1EUUA 4HT1L 4AENA 3M17B 3DYOA 3IJSB 1A7QH 4G9FE 4S2SA 5IEKB 5IGXH 5DO2D 3LIZL 4WJ5B 1CXFA 2CR6A 5AZ2H 5KSAC 1HHIB 2XV6B 4XWGH 3NFSL 3QFJA 1I85C 5CZVH 5HDBE 3M1BB 3S37L 3W0WB 5HYSG 5I8OH 1PY4A 1DQML 5JO5A 3ARFD 1P7QB 4FRWA 5E2UH 2XQYG 4H88H 3X13B 2FBJL 2DKUA 3OR6A 4ETYA 1IAMA 3JSSA 2W07A 3PHQB 1ZVSA 4WFEE 2CK0L 3VH8G 5E9DB 3UJJH 5K9QI 3O8XD 1RJZB 2CIIA 5JIPA 1KB9K 4HQQL 3QEQE 5FHAH 3HE6A 1QBBA 5DUBA 1T2QL 1KIPA 2PYED 4MD4A 1RZIB 2ENSA 2HVKB 3FFCA 4LU5H 3MXVL 4TVPH 5F7DA 3O6LL 3VE0B 4ZS7H 4O9HH 2EXYC 1FHGA 1OAXH 2JIXB 4UILH 5DK0A 1I9JL 4Y4HA 3IAQA 4XCEA 1X5AA 3MOBH 5CD3A 1WIPA 3QUZC 3OKLB 5IB3B 2W65A 3GSVA 1C16A 4NQDD 1WBXB 1FN4B 3O6ML 1N8ZA 5HI4C 2NY4C 4XPBL 1HWHB 3FT3B 4A2LA 4XAKE 1F4WL 3TN0B 1P9MC 1EEUA 3EYUH 3QIWD 4OQ1A 1HHJB 3LN9A 1ZLUH 1QLFB 1OP5K 1JI1A 2VL5B 1IGJA 3BWAA 3Q3GA 1JF1A 4GG8B 2EECA 4HCRA 5E08L 1I9IL 2BNRA 2A6DB 1UZ8A 1PX4A 4JLRA 2E7MA 2IQAB 2NY6C 1VENA 1IAIM 5IK3B 2A6KA 1MCWW 5C07A 1Q9OA 4HH9B 4P5TD 1J7VR 2J4WH 4ETQB 4PUBL 3UC0L 1HIML 3JV6B 3LEXA 2OI9C 2FL5B 4PGBB 2F5AH 3T4AA 1M1SA 4XX1E 1YNTA 3IDGB 3A6OA 4FQCL 5IQ9B 1AIFA 3P30L 3UTTE 3MC0A 2KBGA 1FFOA 4N1CA 5AEAA 4P2OD 1BBJB 1T7WA 4Y2DB 5I74B 2F9BT 2KZWA 2W0PA 3CLFH 4EN3B 2AXJA 1R3JA 3A6CL 1T0MA 3I6GB 1U8KB 5D5MB 4KI5E 3PGDB 3GKWL 1L7IH 3TJHD 4KTEH 3B6SA 5EN2A 4ISVB 3SE3A 4PJ5A 3T8XA 4PD4J 4OFDA 1OAKL 2CDEB 2NY3D 3KG5A 2BDNL 1QQDB 4HKJB 4YR6B 2FD6H 4X4ME 4P49A 1MCLA 5DO2C 3NFNA 1IZKA 4I18B 4NN5B 5ALCL 4JGUA 4RFEA 4OZGF 3KS0H 4ALAL 4KVCL 2R29H 5EBWB 4O51B 1HZHL 4P99A 3QUKA 4NKIL 4NO5B 4PJIB 4GMTH 4A6YA 5FCUH 3VD5A 2DJUA 1GZPA 5JOPD 4NRXB 1XR9B 2EH7H 1B9ZA 4NP4L 4D0DB 5BV7H 5CBAB 4HUXA 3IFOA 4MGXA 5HGAB 5DD3H 4OLYL 3RBSA 1HSAA 4OLUL 1J0JA 1JV5A 4F33B 2YD8A 3P4LA 4JDVA 4UQ2A 1M6OA 2EDOA 2PUQT 5T1LD 5JORA 5FKPB 3FB5A 1WZLA 3TCXA 5DS8A 1WIUA 1TCMA 3QFJD 4F9LC 1DQJA 4OI8A 2YKLH 3AB0B 5L6YH 1HI6A 1AGDA 4N1EA 1I8LA 4HGMA 3QIUA 4JO1L 3LCYA 3IGAA 3WDIA 2OCFD 1U91B 3JV0A 1BD2E 4DVRL 3ULSB 1KNOA 1WZ1H 4TTDD 4F2MB 3ECBB 4O4YH 3V6BR 3P73A 1N6QL 2DBLL 3ARED 5E9DE 3RGVB 5CZKA 3HG1D 5KSVA 1NFDA 1AC6A 2H45A 1U3HB 2YD9A 5JW4N 3Q6GH 1NL0H 4NHCH 4JZJC 1IEBB 4A2MA 1CXIA 3WN5A 1H0DB 1F58L 1NAKH 3RWIA 1UQSB 4R7NB 4Q7DA 4CVZA 4ZAKA 5IESL 4M6OH 4YBLC 5BS0A 3SE9L 3KYAA 1JPTH 4PRDB 3PHOB 4XCCH 3AY4A 5CCKL 2ZPKH 3GMQA 3RZCC 4WY7H 3U0TB 5JPNB 3MACH 4K2UL 1MJUH 2ADGB 3V4VH 3CFBB 4KWUA 4L3EE 2V6HA 4YHOH 2P5EE 2NZ9C 3VFPA 5D72L 3VXQB 3ZE2E 2N1KA 3BZ4B 1JGDB 2JK5A 4Z7UB 2F58L 4KPHL 3BHBB 2WBWB 1UXWA 5JDSB 4RFOH 4NWTH 4I9WD 5I1AA 1AXTH 1CDHA 4NFBA 5E8EB 4X6DA 1CK0H 1GH7A 2E7CA 4WU7B 1WQVT 2EYRA 3CDCA 3RTQA 4C56B 5C07D 3LKRB 3KYOB 1C12A 2ZCHL 5DVKA 3L3GA 1YMMB 4LP5A 3SBWA 3V0WH 2R0KH 2WLYA 4EIZC 1E6JH 1RIHH 5EPMA 5LKNA 3MCKA 5J9PA 1IEAA 4KRLB 1XGPA 4JJ5B 1MFBL 1FDLL 2H3NB 4LDOB 3BZDA 2V9RA 3E2HC 4OSUL 1MI5B 1QKZH 4UUJA 2XFXA 4WTWA 5D5ME 5C6WH 1PLGL 2FO4B 5D7LA 5FHBL 4PGJA 1KELL 4RRPA 2V2XB 4X0KB 4IJ3C 4M7KH 2NY1C 4CADA 1NSNL 5E6IA 2AK1L 4MJIB 5DVMA 2NY2D 2IWGA 1IT9L 1A14L 2AAVA 1BVZA 4G8FB 2Z92A 1I8MA 2FJGA 1OGTB 3JWNC 3S97C 3VFGL 1LWRA 3T2NL 3VH8A 3IRZA 1JZ8A 1SBBA 2R2BB 5J89A 4PRAA 5LWYL 3RIAF 4MJ5A 4KZEL 2NY5L 3OKNB 1P2CA 2Q86A 3KLAB 1I1YA 1MH5A 2OZ4L 2RFXB 4MQTB 1WZMA 5DGRA 4GLRH 1RUML 2B5IC 1KENH 4N0CC 1QLEH 2DIJA 4JGJA 4P3CH 5B39B 3QXWA 1EK3A 3FN0L 1NBVH 1CICA 1NLDH 4XMKL 4KI5F 2F15A 3PWUA 2GYSA 5IW1B 3T1FB 5J0BA 1F8TH 4G9FD 4GQ9L 4NNXA 4NDMA 1VEOA 2A9NL 3HE6C 3UTQB 3WUWB 3ZHKA 5IEKA 1JTTA 1TETL 4JN1H 3WMSA 1MRCH 1MCIA 1HEZB 4WJ5A 1VDGA 5CIPH 4RA0C 3W0WA 1NCWL 4P46B 3QIUD 2ZSVB 4M1CD 1X4YA 4Y4HC 5MEQA 3BD3A 4WW2F 4HPOH 2LVEA 1HSBB 1RD6A 4XHQA 5T3XE 1P53A 1UWGH 1Q8MA 3H8NA 2GITA 4GAGH 2FLBT 3I3EA 3PHQA 1P5VA 1RJZA 4PP1D 4HULB 4AEFA 3QEQD 4OFVA 4ZAKD 1REIA 4LSTL 5BS0D 4GSDH 3QXAB 2EDBA 3RGVC 3SDYH 1EPFA 1SJHB 3CSYA 3O6FB 1ZXQA 2H2SD 1S7QA 1RZIA 3H7BB 4OV6F 5EB9A 3SKNA 4UZGA 4YHZH 3RVUC 3VE0A 3F58H 4R2GB 4QKXB 4UQ3A 1F5WA 3PF2A 5GZOD 5IB3A 5I30H 3MV7E 1C1EH 2AK4B 4Z7UE 1WBXA 3I2CH 4OD3H 1G7QB 1FE8L 4XAKD 4YFDB 3BWUC 3F8UB 1HHJA 3K1KC 4X6BA 1QLFA 1Z9MA 3U4AA 5A1AA 2QR0B 4KY1L 3SE3C 4QHUB 4PGEB 1S7UB 2IQAA 5D71H 1D6EB 1Q9KB 3CLEH 3WO3B 4MXWL 1B0RA 2QSCH 2NY2C 3MRHA 2FGWL 4L5FL 4MA8L 5DJYA 4JHZA 3T0VA 3U9UB 1HYRC 4XPGH 1OAQH 4XI5C 4ETQA 3BP4B 5FYJU 1YEJH 1DQTA 3IETB 1X5GA 4NGHH 5D1XB 2XKUA 3ZE2F 4XWOD 3WS6A 3A6BL 1G0YR 4PJXA 2DJ4A 3UTTD 4B5EA 1U0QA 2IADB 2UWEE 2ZG3A 1MI5E 4Y1AB 5FUOH 5DRWB 1BFTA 4QRPB 5HI5D 1BBJA 4K71B 2BSRB 3QQ4B 3FRUA 5JHLH 3I6GA 1U8KA 1VA9A 3WFHA 4FN0A 5T5FL 4L3CB 4AQOA 5FM5O 5FK9B 4NWUH 1CFQA 1PG7L 1G6RL 2YRZA 4ISVA 4UIMB 4PTUB 4CW1B 1IKFL 5LGHH 3G6JE 4C4KO 1QQDA 2PW1A 4HKJA 4YR6A 4M7JL 4HUMB 4BSWB 3BP5B 3QZWB 4JFFE 1NCNA 2EC9U 5K9QG 5SWQA 2CDGB 4K9EL 4WVRA 3F6LA 1I8LC 5EBWA 3QIUC 2YK1L 4M1CC 5DVNA 5IQ7H 4O58L 4PJIA 3QCTH 4GW1B 1SMOA 1XR9A 2N4IA 2KH2B 2AS5M 5GGVY 5D5MF 1DBAL 4KZDH 5CWSB 1RIUH 4GAYA 1BAFL 3EO9H 3PABB 4X7TA 4F33A 1N7MH 3WN5C 2WW8A 4PP1C 3BGMB 3HC3H 5GPRA 3KNBB 4JG1L 4WNQB 2FEDD 3L5JA 4ZAKC 5D1QB 3UP1A 4PPTA 3WL9B 1B4JL 3W0WD 3LZFL 2GFBB 3AY4C 4XBGB 1FPTL 5L9DH 1OAUL 4HLZH 1ITCA 2MCPL 5IVOA 4R97B 1FNSH 4M8QB 2EE3A 5B8CB 4OV5B 4ZODA 3TIEB 4M4RA 4Z7OE 1NEZG 1U91A 4EXPX 4XC1H 1PGRB 1LD9B 4NO0B 3ULSA 5GZOC 3TBVB 4F2MA 3ECBA 4HFUL 4RMSA 5E9DD 5IHBA 1UB6A 4AT6A 4OCRL 2H26A 1AQDB 4HBQA 2X4PA 4FZEH 1U3HA 3WLBB 4OZIB 1CYGA 1WEJL 5I9QB 3MA9H 1JZ3A 1RV6X 2CKBB 2GAZB 5AYQA 3LH2H 1H0DA 1AGCB 2XN9B 2C1PA 3MO1B 4FQJL 2B8OT 5DQDL 1YY9C 4QY8B 1RUAL 2NX5B 3OV6A 3ULVD 4YHPB 3HAEG 3PHOA 3OWEA 4X80L 4NFCA 3RTQC 2JIXD 1A7OH 5JPNA 4LIQL 1S7XA 3O4LE 3T1WA 5E1HB 2ADGA 4LSQH 3SBWC 1KC5H 1WFTA 3HPLB 1MFAL 4PGCB 4BZ1H 1NBZA 3G9AB 2AK4E 3SKMA 4IRZL 2RBLA 4XWOC 5ITBL 4G3YL 1A3QA 3TN0D 1FNLA 3BHBA 2VR9A 4PJGA 5F3BA 2Z9TA 5IBUB 5IF0B 5JHDB 2LABA 3QQ3B 2WIIB 3TJEL 3HFML 4I3RL 3NZHL 32C2B 1KJVB 4LCWB 1LDPH 2YWYA 3T0DA 4LSPH 2JJTA 5E6IC 4P9HC 3RX7A 5H37G 4C56A 5HGHB 2OK0L 1WVZA 2APFA 1P4BH 3KYOA 3VD7A 3U4BH 1HKLL 3WCYA 5K59F 4GRLA 1YMMA 5JA8B 2DDQH 1CGXA 1XCQA 4H1LH 3T0BA 1TJIL 1EFQA 5BZWB 4R0LA 4Y1AE 4HIHA 4QRPE 4Y2DD 4JJ5A 2H3NA 2OMBA 1LEKB 3OGCB 4YFEA 4APQB 4NN7C 3VRJB 4S1SL 5HHVL 2EDQA 5K9JL 2FO4A 2NY7L 3EYOA 3N1PC 4ZS6D 4LDLB 1CICC 5I1KL 1JF6A 2IPTH 2R4SH 3E8UH 1P69B 2DQDL 1I8IA 4F7MA 4XVTH 4U1JB 2DLTA 1L0QA 1VFAB 2XKNB 4G8FA 2FEDC 2OMNA 1CD0A 5DF0A 5C0CA 5F3HA 3B9DA 1WBYB 4JKPH 3STBA 4WENB 3N1FC 3O2WH 3HZVB 3OKNA 5DJ8B 1VGKB 5DLML 4N8CH 1FAKT 1Z6JT 1NUDA 3ME0A 3IJYA 3O11B 1OWRM 2UWEF 1A0QH 2YXFA 3B9EA 5I8CB 3C08L 1PW3A 4TQEH 4LCIL 5F96H 2X5PA 3DPBA 3GRWA 4HXBL 3GMRB 1Q94A 4EQ3A 1BVKA 5GGVL 1EHAA 4UB0L 1NUNB 1TQBB 5ACZA 4MA3A 1UM5H 3QG6B 4MMXC 4U05A 2BNQB 3WUWA 4E0RA 3BP7B 3G6JF 3WXWL 1HEZA 4YHNB 4R96A 1TPXC 4S10A 1YUHA 3CMOH 1U42A 3ULVC 4QYOB 5EIVA 1ACYL 2HFGL 1RAMA 2ZSVA 4JPWH 4YNYB 3B9AA 5TE4H 4NKMB 5F70A 2OZ4A 5F8RC 3MLVL 5EO9A 4HV8A 3V8CA 2VXVH 4UTBH 1U3HD 3UJIH 5KTEH 3HZYB 5GGQL 1QACA 4O00A 3U36B 1LEIB 4OZIE 4D0CB 1EH9A 1JRHI 2DQEL 3CXDL 2HAZA 3MJ8A 3VFOB 3DVNA 5E4EB 4M62H 1U8NA 3CVHH 4M1DH 4NZJA 4HIEB 5HDQH 1CE1L 2BMKA 5L0QB 1CGSH 2UUDK 1MEXL 4IS6B 3EFDH 5CJQL 5IB5B 4Z7OF 5AWNL 2Y25A 3O45A 2EEDA 3V6ZB 4GKZA 4RGOL 3I3BA 1AO7E 3WS6C 4OLEA 3OMZA 2C1OB 5DMKB 2XG5A 1G7QA 5JHDE 2KDGA 1WC7A 4ONGL 1T1YB 3OHXA 4NHUA 1W0VA 2EICA 2V5RA 4BUHA 1OT2A 5DYOB 4LCWE 4R4FH 4OF7A 1W0WA 3EYSH 4W6WB 4L8DB 1J5OL 3BSZH 3GHBL 5ELIA 4BK5A 4C56D 2OL3H 2XI9A 4TNVK 3UZEA 3W2DL 2R1YB 1S7UA 1YMMD 5C70A 1KEGL 4JFHD 2W92A 3VW3H 2ZZUT 3U9UA 3RWDB 1SJXA 3BP4A 4MDIB 4XAWH 4Z6AT 2DQIH 1IKNA 3IETA 2EDDA 4G8EB 3S34H 3IDYB 1DDHB 5A2JH 1MI5D 2IADA 5DRWA 4EOWH 3VA2C 2BSRA 3QQ4A 3QHZL 2AXFB 4RWHA 5AYUH 2A6JB 2R9HD 1AQKH 5HYEA 2YD2A 2RQ8A 4MJID 3I6KB 2VDRL 1F4YL 2E8ZA 1JNJA 4DKAA 5C09A 4PTUA 4AL8L 3JVGA 3S35L 1JHKH 5C0CD 6FABL 2FO1A 3TT3L 3QCUL 4PLNC 2VAAA 1FNGB 5D1ZB 4BSWA 3BP5A 2XG4A 4L8CA 3C6LA 1IGFL 1UACL 4TUJB 3AB0C 2IQ9L 2CDGA 5IVZA 1S5IH 1YPZE 4OUUA 2IFGA 4JGMA 4HJGB 1U8QA 1CFNB 5KG9B 1HHHB 1FYTE 1PKQE 1MAMH 2JTDA 1SJEA 1U3HC 3PABA 1VPOH 2IPUK 4LEOB 2BNQE 1NAMB 4K8RH 3BGMA 3KNBA 1X9QA 4WNQA 5DJZB 1FH5H 1K6QL 3ZKQD 5D1QA 4ZG1A 4FQQA 4HBCL 4NQVA 5IT2L 3WL9A 3ABZA 4P46D 4AMKH 2SEBB 3K80A 1JJUA 3TGXA 2D4DA 2FX9L 1MAKA 4AIZB 4WI2A 2QADC 4UNUA 5B8CA 1BOGB 2B1HH 1INEL 3RVTD 2B7DT 1JFQH 3KYKL 1MVUB 3QAZB 5DHVB 4NO0A 3TBVA 5IW6B 3D0VB 3B3IB 1N6VA 5DZNA 4NNPL 1WITA 4Y4KB 1CD9B 3WLBA 4P59H 3VWJB 3OTTA 4PV8B 3O2VL 1FZOB 1RJYB 3MRDB 4O2CB 3O6FD 2XN9A 4XVSH 5KVEH 1KB9J 2JJTC 2YPLB 4MX7B 4YHPA 4ODVH 1OM3H 4R2GD 1HNFA 5GGRY 1A5FL 3QHTC 2P8LA 2PNDA 1L7TL 2QL1A 4GRLC 3EDEA 3DRQA 1ZHLA 1OVZA 3HPLA 1IGCL 3QJFA 5E6YA 2AK4D 3QDJB 5GJSH 3GSNL 1XGUB 4ZOEA 3VFNA 3D0LB 5F1NB 5DZOA 3WE6B 4R0LC 1UB5A 1YEDB 4WV1A 4EUPA 5EIIB 1KLGA 3S7GA 3HZKB 1YECH 2W38A 1R5IB 2EDRA 1A1OB 5GSRB 5IF0A 3MBEA 5BO1L 3QQ3A 2Z8RA 4FZ8H 4U3HA 3P9LB 4Y4FA 3ORJA 5HGDB 5IVXA 3GO1L 1NBQA 5GRJL 1WWWX 1KJ3L 4PRHA 5DJ6A 1MCOL 1FG9C 5C0AE 1H3TA 4NFDA 3OB8A 2DBJA 2ARJB 3P2TA 4YIQB 4K3EL 2NTSP 3LV3B 4HPYL 2NZIA 3ZE0E 3N1GC 1Y6NR 4MZ3A 3LS5L 3LDBB 3O3UN 2EDWA 5D1XD 3MGTB 1UCBH 5J13C 5DQJA 3QULA 4Y1AD 1JN6A 5CUSH 4QRPD 1U8MA 1K8DA 3BEVB 3PGCB 4HK0A 4LEXL 5IG7A 5K9OB 5JW5A 1ZS8A 3ZT7A 1I1AB 3PQYA 4D9LL 4APQA 3QEUA 5IHLB 5CBEB 5KVDH 3E0GA 5GHWL 4CN6A 4JKKA 1FL6A 4MXVE 4LMQE 4U1IB 2P24B 4LHUA 1T5XA 3VDCA 5ESQA 4BQBA 5TE6H 1W0YT 1VFAA 2XKNA 1U95B 2AJUH 1T22B 2LU3A 5DA0B 2Y6SD 4PRNA 5EU4B 3R8BB 1KUMA 1MJ8H 2BJMH 5C3TA 4KRMB 2XQBL 3CGTA 1BWMA 3FB8B 1H5BB 3KPRB 5GGTL 3V5DB 3VRLE 4HAGA 4QXTA 1QLRA 2WM0A 2IANA 4KRNA 3ARYA 2CPCA 3S3PA 1EZVX 5BJTA 3BESR 2D9CA 4UDTA 1MHHB 3BYTA 5HD8D 2F54B 4F9PA 5D1QD 5I73C 3QG6A 5ISZB 1GPOL 3BP7A 1V7ML 3VA6A 3C8HA 4DKDC 5FA4B 3MRCA 4J6RL 3RL1A 3DVIA 1KJ2H 1QR1B 3NTCL 1IQDA 4QYOA 2W59A 1A1MB 1T20B 1A3LH 2VDML 4X5LA 3K4AA 2ATKB 3RWHB 4N5UA 4NO0D 1YPZF 1S8DB 4MAUL 3TO4B 2DQCL 2R23A 2LFGA 4PJ5E 2YA1A 4KQ3L 2GT9B 2D0GA 4Y5YB 4NQXB 3HZYA 1BZ9B 1LGVA 4LF3B 4MLSA 4PJDE 4R6UA 4YWGL 3VFMB 3WD5L 2XN9D 5C08E 2PCPB 2DM7A 2NX5D 5E56A 5K93A 5DEFB 3PWJB 1I1FB 3G5XA 4S11A 4LVNB 4HIEA 5LQBL 3F7VB 4TSCL 4PG2A 3VJ6B 1YEGH 4IS6A 1XFPA 4G6AD 2B4CL 1IKNC 1D5IH 1S9XB 3CCHA 3F65A 3ARSA 3W9EB 4RFNB 5I76A 2C1OA 3WNPA 4GLRI 2FJHB 5JHDD 3E6HB 1K4DA 4UDUA 4U2ZA 1T7ZA 4OZ4B