5ADPH

Crystal structure of the a.17 antibody fab fragment - light chain s35r mutant
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
222
structure length
211
Chain Sequence
b'VQLQESGPGLVKPSETLSLTCAVSGYSISSGYYWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAGLTANWGQGTLTTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB A.17
publication title Robotic Qm/Mm-Driven Maturation of Antibody Combining Sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 211
sequence length 222
ec nomenclature
pdb deposition date 2015-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5adpH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5adpH01
3BIBX 4FQCH 1F11B 5ETUA 4PJGA 4L8SC 1AE6H 1KULA 3CZJA 4LVOB 2VABB 4CVZB 1UJ3A 3Q6GL 4Z7UB 2Y36L 4F7EA 1OTUC 4JPWL 1CFNA 2DJSA 4HJ0C 3E3QC 1CICB 5DC9B 3RQ3A 3MMEB 4UIMB 4C58B 3G5VA 1NCBH 1CD9B 4XP6H 4LAQL 2PXYC 1FV1B 1S5IH 1HHHB 1MCBA 4RFNC 4Y5VB 1R5WA 2HTKC 2P5EE 4NQDE 4XNYL 3FOMB 2IH3B 4FQ1L 3LAFA 3EOTH 1NAKL 1SM3H 1TZHB 3FTGA 1OAXL 4OD2A 2J4WL 2GSIA 1I8MB 1U2CA 3TVMB 2IAMC 3O3BB 3QR2A 3T3PF 3U1SL 1CF8L 1HSBA 3HUJA 2UY6A 3C09B 2CLVA 1F3DH 5JOFB 2AV7A 1DSFL 3STZA 4L8SB 1SJVA 4OKVA 3PHOA 3QUKA 3ULUF 1FZOB 4LCUA 3HE7D 4LDLB 1A5FH 1FFOA 2COQA 4JCLA 5I1LA 1A6WL 1K4DA 4HLJA 4AG4L 5FYLL 1MCLA 3C2AL 1EMTL 3EKCA 3UJJL 4Y4HD 2X6MA 1CZ8H 4WV1A 2PXYB 4RFNB 2EEDA 3KLAA 5FKPA 5EORL 1PZ5B 4XBEL 5HXMA 7FABH 1OTSC 2OK0H 2DQTL 2DIJA 4IIQA 1ZS8B 4HUNB 3TBYB 5CD5D 2Q87A 5DK3A 1BVLA 4XZUB 1EUTA 3IJSB 4XAWL 3KPNA 4IRSA 3V0WL 4CVWA 5DXWA 2RQ8A 3HR5B 4TULH 3BAEH 1QBMH 2ATPB 4PY7A 4LL9A 1AGEB 1EEZB 1IM3B 1OAKH 5DHXB 2HKHH 1H3PH 3SDCD 5I1CH 3DRTA 3LHPL 2FX7H 3O8XC 1S9YA 3D3VA 3P4OB 5JDJA 1KIUA 4OD3L 3K8LA 4G9FA 4Z76A 1G9ML 4JKPL 1U8LB 3TA3A 3CSYB 3MRKB 4YHKL 4HJ0D 2ZCHL 5IMKB 1B2WH 5T1DL 3DUSA 3KYOB 4G6ML 1ZLWH 2VLRE 3GJEA 3I2CH 5F3BA 4GUPA 3QUYA 4L4VB 5EUOB 1IT9H 1TZGL 4HUKB 2HFFA 2YZ8A 3T0VA 1XH3A 3V6FA 4ENEC 1GH7A 2VXUL 2HAZA 5GRUH 2VITB 1HIMH 5FCUL 2BK8A 1KJMA 2Y36H 4QRPD 3T2PA 3T65A 5FM5O 2ZUXA 2IAMD 3HNSL 5D5MB 4PB0H 4HWUA 3VFSA 1S7UA 3O8XB 3VH8G 1PLGL 5CKAA 3ETBF 1IFHL 5GS2H 4WU5B 1CL7H 1YEDA 2Z93A 4TUJB 5DD5L 3ARQA 2OSLB 1AHWA 5ITBL 3OJDA 4FQ1H 5I75C 5HHPA 1MHEA 3JBG7 1NAKH 2YPKB 2Z8RA 5C2UB 2XWTB 2CUHA 1OAXH 1I7TA 2J4WH 3V6OA 1FAIL 4M48L 1MJJB 1S7RB 1SMOA 2P5WD 3VD5A 3MNVA 5AWNL 5T1LD 2VUYA 1LDPH 3QJFB 4W4OA 4HIHB 1KTLA 1G9NL 4RGNC 4HS3B 2YRPA 4K3JH 5EZJB 4RRPG 2OX5A 3LIZH 1D3CA 4PJ5B 3MV7E 3ZMRA 3GBLA 2EICA 1G7IB 3BSZH 1HH6B 3FO9B 4DGYL 1DBKH 5D2LB 4V2CB 1FL6A 4AG4H 4XXCA 5B38G 4PJ9C 2FR4B 5GXBB 4J4PC 4LLMA 3IDIB 5IF0B 1GGBL 5KN5B 5A2KH 1S9VB 3BXNB 3MBED 4LLVB 3MLPA 2DMBA 4XBEH 3G04A 4WTXA 1NGQL 4U0QB 1X5LA 3EZJB 2A73A 1NAMB 3E8UH 3ET9F 1IC4H 2ICES 3IDNA 5JPMA 3UTTA 2ICCA 4GXUM 4AIZB 3VGAC 3B2UC 4RGNB 2WM0A 3EFFB 5FGSA 2HMIC 4C56A 3FB5A 1ZAGA 2CLZA 4Z7OF 4UQ3A 5CP3A 4ENED 4WHCA 3QT2A 4FFZL 3CMOL 1X5JA 4JKPH 1NEZG 1FC2D 1W8OA 3WHXB 4HKJB 1CL7I 1A9EB 4V1DD 3L3DB 2GCYB 4PJ9B 1WVZA 1KJ2A 2ZCHH 4G6MH 1OL0A 3HZVB 4JN2A 1A6PA 5FF6A 5EOCH 3DYMA 4PTUB 3V4PH 4KMLB 3WLBB 2EC9U 1TZGH 3PIQB 1S7WB 5BVJB 4TTGA 4JG0L 3ZE2E 2ED7A 1L6ZA 1ZHNB 3HMXL 4BFGA 2OL3L 1PQZA 5DVLA 5EOQL 3DETC 1IZJA 1CTNA 5F7HA 1X7QB 5FCUH 2ICWI 3N85L 3VGAB 3RIFF 1FC1A 1ITBB 2GJJA 4UTAL 3HLAA 3EYVA 4XH2A 3VH8B 4HZLB 4JE4B 2H32A 4UBDC 4ZOEA 3OKOB 1RUML 2OYPA 4YHLL 3UTSB 1TTGA 2N1KA 3ZKNC 1NSNL 1FNAA 4O4YH 4TTDD 4M48H 4U0RC 5C8JB 5CIPH 3PE9A 1UWEH 4J4PD 3JV6B 2XZAH 5TDNB 3RY5A 2NY5L 3JUYA 4P4KC 1DZBA 3CH8A 1D5ZA 2R29L 3NCJL 5IKCB 1ADQL 1RZGB 1CE6A 3ILPA 5C2BH 2R69H 1FVDA 5CCKL 4NN5C 5SWZB 4KDTC 2WWMC 3N1MC 1D5BA 4I0PD 1BLNB 5KJRL 5DVNA 12E8L 5B38B 3TBSA 3B2UD 1J05A 3PGCA 2JELL 1L9MA 1JGEA 1P53A 5I1EL 2DAVA 3VWJA 1RIHL 2NY4C 2X4RB 1QSFA 1GGBH 4D9RE 4HKXA 5A2IH 1BFOA 2ZWLT 3OKKA 5DK0A 1Z3GL 3QWRA 4WEUD 5I2IA 1MCPH 4IOFC 3LKRA 4BZ2L 4YHYB 4FQHA 1RUQL 1R3KA 4MD0B 3BH9B 2Z91A 4UNUA 1EIBA 5I1KH 1AXSA 2VDQH 1YN7A 4P4KB 4FQXA 3FQWB 4XPHH 1WAAA 4K3GA 1U3ZA 1K8IA 4TPRH 2QKIA 4PJ7E 1JV5B 1X4YA 2CJUH 4L3EB 3P9MA 1T6VN 4MA3B 5J3HD 4NN5B 1UZ6F 1E4KA 1NEZB 3VXUE 1AGDB 3DETD 4DAGL 4LSTL 3SGJC 2DLTA 1WZ1L 3JTSA 3RHWK 5J9PA 4RWYL 5FHAL 4MJ2A 1YEGL 1QLRB 2Z9TA 3CC5A 4ZUTB 3CFDA 2G9HB 3RP1A 3WNMA 2R23B 4JFEA 4D94A 2VXQH 1VACA 4PRHD 2E9WA 3MJ9L 2PYFA 5FK9A 4FMFA 3WLWD 4P5KA 3ZKND 3I02B 4QXUL 4S2SA 5DJYA 5F7LB 5K9QI 1L7TL 5EC2A 4YQXH 3PQYD 4ZS6C 4BZ1H 3L6FA 4UTAH 2D0FA 4X7TB 1UB6B 3BGAA 1NJ9B 5I1AB 4AEIL 3WXWH 1X44A 1T3FA 1JN6B 2QADC 4KKAC 5C0IA 2BC4A 4HXBL 1UM6H 5GRVL 3VMNA 3DMMC 3H9SD 4LFHD 5IB4B 4NNYA 3LZFH 3E6FA 4NQEE 5DTFB 5IQ7L 5ISZB 3PF2A 5TE6H 3FQNB 3GK8H 2HJKA 2IBGA 3VG0H 1YQ2A 4I77L 2NY4D 2PNDA 5TFSL 9CGTA 4TVPD 3U46B 5IMMB 2FHCA 1VADB 4GG8B 4N0UE 4PUBL 4JGMA 4G8GE 5ICZB 3BESR 1BQLH 1F97A 1EUUA 2Q3ZA 4KJYA 1C7TA 4PJXA 3FQXB 3NMEA 1MHHB 4JPVH 4N1EA 5KJRH 4LLDA 1HHGA 12E8H 2GW5A 3MTRA 2GJ6A 4QTIL 3WFEL 5CJOL 5FA4B 5DFWH 4XRCA 4YC2C 1E6OL 3PJSA 1ROWA 2QADB 1KXVC 3P0VL 2VLJB 3GBNH 4HWBL 1E28A 5J1TC 1T2QL 3DMMB 5HY9A 3IJHA 3V7MA 4UNVA 5IJVB 1MFCH 2BVQB 1OQOA 3BWAA 4L4JA 1RUQH 4DTGH 5JW4N 4PJIE 2AEQH 1Z0MA 4JRYB 3VXRD 1RK0A 4PJCE 3VCLA 5KSUB 1QA9B 3RNQA 5EWIH 2WUCL 4UU9A 2OS7A 3T77A 3D18A 3HAEA 3RIAK 5HDLA 2WIIA 3DV4A 5JHDB 4JDVB 4LQFL 4RMSA 3M07A 4HFWA 3DO7B 1WZ1H 3QEQE 3CGTA 3PNWB 3C9NB 1YEGH 4YC2B 3D85D 4LLWB 3KPMA 1QD0A 5JXED 4CNIA 1J87A 4DVRL 3GKZA 2YHGA 3GSNL 4K7FA 4O5LL 3RRQA 5FECB 4M61B 2EC8A 1QTYT 5ANMB 2GHWB 2VKWA 3OV6A 3QDJA 1FIGH 1FO0B 3CVHB 1RULL 3L9RB 3MRQB 1MHPL 1CDCA 4XP9L 3S5LB 2J8UE 5ACMA 3LV3A 1IAIM 3VFWA 4AEIH 1RJYB 1NBVL 5FV2A 4NZDA 1CU4H 3IU4L 4O51A 4OLWH 3SDDD 4HG4J 4HWZA 3QDGE 4G80A 4P2YA 2P8PB 2BVOB 3U82B 1LEIA 3D6GA 5EA0L 3KS0J 4OCMC 5F7DB 4HS8H 1DUZA 2Q1EA 4QHKJ 1PY4A 1CFSA 4I77H 4F7PB 5I0DA 2HA1A 2NR6C 2YK1H 3I6LD 1W0VB 3SE9L 5L8KB 4L8DA 2ADJB 4JY6B 3N1PC 43CAA 3EDFA 4EDXA 1MCWW 3RTQB 1KNOA 3IGAA 4M03A 1OAUL 4R4NC 4GRWH 1A3LH 2P7TB 2P8MA 4YR6A 3RVVD 4M6NH 3NACL 1ZKAA 3WFEH 1JTOA 3L1OL 3K4DA 3GRWA 1A4JB 5TGBA 1CTOA 4NKMB 4G42A 1IGJA 3RY6A 3QXUA 1RZFH 3KNBA 3P0VH 3DGCR 5E99H 5IBUG 4HWBH 4I3SL 1M7IB 1QVOA 1YJDC 1FH5H 4YHZL 2NY6B 1KACB 3SJVD 4Y1AB 1INDH 4IMLA 1MEXH 1QG3A 5E8PB 4LEOA 3BRDA 1XF3A 4RQQB 3FB6B 1U8JA 2AK4D 5D6CB 5T3ZL 4ODVL 2WUCH 2V7HA 2AJUH 4R9HA 5D7LA 3BP4A 3MFFA 5C0AD 4Z0BH 3EYFB 5F7KC 3FFCD 2EIDA 2XQYK 3FN0L 1P2CA 3NVQA 1IJ9A 1RURH 5L9DL 2LU3A 2PW1A 1BVZA 1NC2B 4K94C 1G7PA 2Z8WC 3CXHJ 1P7HL 4UB0L 5FO7A 3ECBB 3LOWA 1FE8L 2HJLA 3WKML 1HHIB 2OM5A 2V2XB 1RUAH 3QO0A 3HI1B 2FL5B 1OSPH 3K4ZA 4X8XA 3C5ZC 4OFYA 2CR6A 4YH6A 3HZMB 5DVMA 4QRPE 1N26A 1GZQA 4D8PA 3NZ8B 1W2KT 4R6UA 2X4PB 3HI5L 1X9QA 2NXZD 2HFTA 3DXAA 1XGTB 5E5MA 2DQGL 4XP9H 4X7FC 2Y7QA 1EA9C 2R2CA 3DJ9A 4B50A 5CGTA 4X6CF 3IFPA 1B6DA 4I1NB 4U7MA 5GGRA 3TBTA 1YECH 1LE9B 1DN0A 1PY9A 2W0KA 2Y5TB 3MV8D 4WEMB 3HR6A 1IKNC 4NJ9L 1KIPB 3LEVL 1B0RB 2P5WE 4PRNA 3SGEH 2ZUQB 5D93C 5H94A 4MLSA 3RWDA 1H9VA 2HRLA 2DMKA 1XCTA 1VFMA 4Y89A 5EBLA 1DANT 3ZYZA 1HILB 3C5ZB 3F7RA 2X1XR 4OD1L 3OKNA 5E6ZA 3O11A 2UWEB 4JHWH 1DQDL 4KPHL 3EO1B 2F53D 2O5ZH 2VLRA 4XWGL 4NBZB 5HDBE 5IT2L 3NACH 5CJ5A 4MGXA 1EEYA 4P23D 4E5XB 3L1OH 2XPGA 3ZE2F 2X4OA 3FZUD 1DBJH 4MNHB 5C0RL 3RUGA 1C5BH 2EIBA 5DS8A 4I3SH 4NPYA 2IANB 4E0RA 4HPOL 5EZIH 4YHZH 5ACZB 1BQHG 2GEEA 1QFPA 3QCVH 3RWJA 4U2ZA 4ODVH 4R0LA 2N4IA 4LLYB 1NAML 4KZDH 4F8TA 5HBBA 3LD8C 4J6RH 4DQOL 3FN0H 3NCMA 3ARVA 1CS6A 5K9JL 3MGAA 5L9DH 1KIQB 4JM2F 4V1DE 4OIAA 1U92B 3AAZB 4D3CL 5J11C 5EU6A 1JBJA 2FRGP 2P42B 5KANG 1P4BL 3RKDC 4APQC 4U1JA 3C5SA 1F6FB 3MV7A 3SGEI 5IMOB 2D4DA 5EU3B 2J5LC 3U7WL 1EZVX 3RWCB 4XC1L 5BZDA 1JGDB 3QJHA 1HKLL 2OZ4H 1OOAA 2OQJB 4E41D 5JR1H 4Q6IC 3BKYL 2X42A 3GHBL 1U91B 2YPLA 4XPBH 3G5XA 5IMLB 2DQGH 5B39G 4MSWA 4PJ8C 4MJ5A 3FO1A 3S36H 3MLSL 4KFZC 3T09A 1EV2E 2AP2A 5GZNC 2DQCL 3F7VA 1BIHA 5J11B 4NJ9H 3LEVH 4RAUB 4WI8A 3GZKA 5F7MC 1WWBX 2BOBB 2VUOA 5DJDA 1AR1D 5J1AA 1BFTA 4PJ7F 4JFXA 2J5LB 1HQRB 4UT9L 4JDZB 5DC0A 3DVIA 3L3OB 2XRAL 4G3YL 4Q6IB 1RMFL 5I30H 1W72H 3WDJA 2HLFD 4I9WD 1SJHA 2H8PB 1K8DB 5FGBC 3V5DB 3IAGC 3VGDA 4DGIH 4QWWC 4PJ8B 1ZVYA 2GI7A 1KYOJ 3GMNB 5E8NB 3N1FC 1Y6NR 3LKSB 3WL9B 3ZKSD 5HDQL 1QRNA 2XTJC 2BJML 4KTDH 3IVKA 2EYTB 5D70L 1MAKA 4MAYC 1Y6MR 1XF5A 3SQBA 3H0TA 3IXTB 1NGYB 3QH3A 3QCUL 4HHAA 5IG7A 2FEDD 5C07B 4ONFL 2YD5A 5KZCB 5GGSA 4OLYH 4MWFA 5D7SL 1MFDL 3RKDD 4APQD 4PRPB 4LAJH 3EO0A 2Y07H 3TZVC 3S37L 3VD3A 1TDQA 3LVEA 1ZGLM 1QLFB 1TCRA 5CJXA 1WUNT 1YC8A 3T0WA 4EDWH 1T80A 4M7KH 3X12B 2DDQL 3HMXA 2J12B 2OL3A 3S35X 3BH8B 4AENB 2B4CC 1KXTB 4FMKA 2WUBL 4YGVA 1LQSR 4F9LA 4HKBA 4PRHE 3X14B 4HUWB 1VERA 2AXFA 4DGVL 5KVFL 3TIEB 3GM8A 4MAYB 3EGSB 5HHOA 3U7WH 1AJ7L 1FPTL 3MUGB 5JOPD 2ZUYA 4WW1B 3ARFB 3CFBA 3LKQB 3T0XA 1JRHL 4LPTA 1GGCL 3PQYE 3AFLA 1KB9K 5DMJB 5C07D 3GHBH 4Z7WA 1VESA 4PJFB 3TZVB 1OWRM 1M6OB 3C6LA 3OKYA 1IEAA 3ARSA 2UUDH 3SDYH 4ELMB 4ZAKC 1F6LL 3EYUL 3MLSH 1YMMB 5HI4C 3B43A 1ADQA 4GMTL 4P2OC 3MRGA 3H9SE 1I4FB 3C6SA 4PJIF 4X7SH 2R4RH 1QQDA 1XR9B 4PJCF 4EN3D 4QWWD 2VDRL 4ZOAA 3STLB 4MNGE 5HPMB 2HWZL 1I1FA 3BKCH 4LSUL 4IM8A 2XTJD 4WENB 2APVA 4ZTPL 4UT9H 2DBJA 1M7XA 1FHGA 4YAQB 1NDGA 3QIUA 5MP6H 1VEMA 1RMFH 3E6HA 1QPPA 4FQQA 3WHE1 4L4TD 1RU9L 2VISA 1OM3L 3BP5B 5KVDL 4P9ML 3BRFA 1Q9WB 3WUWA 3LS5L 5F1IB 3JVGA 3H8NA 2VQ1A 1BWWA 4CDGC 2R15A 5F96L 4WRLA 4ZAKB 3VD7A 5HDQH 1YEIH 1GSMA 5J06A 2BJMH 4WY7L 3VRIB 1I8IA 4FABL 4KZEL 3PWLB 3VFOA 3QUZC 2CMRH 4EXPX 3D39B 1F45A 4O58L 1SY6L 2ZSVB 1LO3L 3VXRE 3AGVA 3O9WC 2AGJH 5DRWB 3GKWL 4ONFH 4NO5A 2J8UF 1MFDH 1A2YA 1IQWH 1TVHA 5B3NA 2VLKB 3S37H 2BSSA 3MJ9A 3DRQB 1QFWL 2P43B 3OGCA 5T1MA 1IQDA 3SBWA 8FABB 4ZO8A 4Z77B 1WISA 4JKLA 5F9JA 2WLZA 2DDQH 1PKQA 3BZFA 4NQEA 5JHLL 3TN0C 5DD0L 2ZUWA 1GOFA 5D7KD 3LH2H 3MNWA 3WFCH 3BQUD 2EH7H 5IVXE 1MCOH 1A47A 4Z7VB 1BZ9B 2VDLH 4JFZH 4Z78A 1NFIB 4N0UA 4JO2H 2DM2A 3FRUB 5EN2B 2FECL 3QUZB 5CHNB 5HI4D 4YDKL 4PJHE 5TF1L 4P2OD 3W5NA 1FPTH 2BP3A 2LU7A 1HOCA 5DRNA 5SWQA 2NNAB 3S8WA 5F88A 5C0JB 3O9WB 4U1KB 1MCNA 1JRHH 4CJ1A 5KOVC 1U3YA 5DLMH 4JRYE 4JKWA 1UM4L 5LCVL 3BPOB 3S3PA 4YNYB 5DJ6B 1OP5H 1QSEB 5E2UH 1V05A 3O4OC 4U1LB 4TUKL 1RJZA 4Y2DD 1M71B 5C0BB 4NC1C 4QKXB 3H7BA 1FO0L 3CVHL 4GMTH 1LHZA 4XVTL 3KPOB 5IB1A 4J8RA 4PJIA 4BH7A 1N5YH 1G0YR 1FZKB 1NGZA 4PJCA 3ULVC 3L7FB 5DJ2A 1B0WA 2YBRA 5DJ0B 5LWYH 5L2JB 3MRRB 2DF3A 2HWZH 3I6LE 2EYRA 5JA9A 2FHFA 3FQUA 2CQVA 4EUPA 5SX5H 4WVRA 2GY5A 5JW5B 1ED3A 4LF3A 3MRDB 2ARJB 2AK1H 3D2UD 4PBVC 4PJDB 3BZEB 3B9VA 4NP4L 4MD4B 3O9WD 5CJQL 3QEQA 3OGOE 2I9TB 3RDTB 1GCFA 1ZT1B 1DEEA 3O4OB 1MWAB 4LP4A 5CLWA 1J0JA 1G7HB 1PGRB 2NY1C 4WY7H 3LQAH 1NL0L 4PG9A 3KLHC 5IBLD 4FFVD 3SJVE 2FWOB 1UH4A 4QF1B 2ZJSL 3ZTNL 3B2VL 4D0BB 3TN0D 1LO3H 3FKUS 1OGTB 2AK4E 1AO7A 1JL8A 2DYPB 1OLLA 4ZUUA 3Q1SL 3GJFK 1JRHI 32C2A 3HFML 2PKDA 3FFCE 5DHVB 4Y5XB 4F7MA 2XXCB 3GSNA 1LE5B 5SWSA 1A7RL 1JFQL 2JE8A 4XB7A 4PRBA 1QFWH 1KEGL 3QDGA 1QR1A 2EDFA 1RVFL 1HNFA 2A6DA 5DC4B 2RB8A 5E8OA 5JO5A 5JHLH 1CXLA 4MZ2A 4MDIA 5B22A 3RL2B 2HT2C 3MR9B 3D9AL 2H2PD 1R3HA 3EYQC 4Z7QE 2FYYA 2G5RA 2NY1B 1OT1A 2VL5B 4N5UA 4NBXB 3F7QA 1XZ0B 1F11A 5GJSH 2VABA 5TF1H 3HE7A 4Z7UA 3GSOB 4S1SL 3MCLL 1ZHKB 1P4IL 5DFTA 1CICA 5HDBF 3P9WB 1EFXD 5HHMB 1SHMA 3MMEA 5TPWL 4UIMA 3VD9A 1GRWA 1H3VA 5LCVH 4G7YL 5C0GB 1FV1A 2BNRB 3KPTA 4Y5VA 1BJ1J 3FOMA 4JGJA 2IH3A 4TUKH 3MV8E 1TZHA 3P4NB 2BSTB 3HC3H 5C0CD 4OB5L 4XVJH 1FO0H 1KB5B 1TPXC 4NN6C 4WTZA 1I8MA 4KQ4H 3T08A 3TVMA 4MCZA 3O3BA 4PBXA 3O6MH 4PBWD 3SDCA 3VRJB 1J1OL 1W0WB 4HJGB 3T4YB 3ZYOA 1JWUB 3KPSB 5JOFA 5CEZD 1BVKB 4JFFD 4L8SA 3THML 3CK0L 2NY1D 3T4AB 5I9QC 2QHRH 4K94L 3LY6A 3MRPA 1FZOA 3CDGB 1T0PB 3G9AB 3RWEB 1MCQA 2B1AH 1FNHA 2F53E 3MUY1 1D7FA 5D1ZC 1QFWI 2PXYA 3FB8A 2Y1VA 4LIQH 5JQ6H 1JE6A 1PZ5A 2CLRB 2WBWB 5K93A 4WDIB 1KT2A 2E8YA 1ZS8A 3WCYA 3TBYA 1JVKA 3CFKB 2D03H 3WFBH 3B9KD 1MVUB 4NN6B 1U8NA 4M5ZH 4XZUA 3QUMH 3W0WD 4S11A 5FYJL 1OY3B 4NQCD 2IAMA 5GQBA 3BJ91 1S78C 2ZJSH 3BX7C 2K7QA 3HR5A 1JHTB 2ATPA 2FECI 1J12A 3CIQA 5FM5M 1AGEA 1EEZA 4G6KL 4JM4L 3EYQD 3VMOA 4P4RB 3P4OA 4C83A 5I9QB 4GW1A 1JJUA 4CKVX 4AQ1B 2NZ9C 3H42L 2W9DL 1U8LA 1JFQH 2HFEB 5DVKA 3MYJB 3CSYA 1KEGH 3H9YA 2PR4L 3MRKA 4JO4L 5D1ZB 1LGVA 5IMKA 4ORGB 1HHJA 3KYOA 4K55A 4RNRB 3BE1H 4JQXC 4KJPC 4NWUL 2F5AH 3SGDH 1Y18B 1MHCB 5EUOA 3EO9H 4NZRH 4NYLB 4S1RL 4OZFG 5GGTL 3KJ4C 1N0LA 1KTKE 4PG2C 1U95B 1XR8B 1TQCB 4PIRF 3WIIL 4DEPC 5I8OL 4E41E 5D7JC 2DL2A 3PUCA 2DQFB 3SHSA 3GSVB 1CDUA 4S1SH 3MCLH 3DWTA 4LSSH 1I3RB 5FDWB 4JPKL 1Q1JL 1OGAD 1EXUB 2P47B 3O8XA 4CU6A 5TPWH 4XB8A 3PHQA 5T3XD 4LNRB 4G7YH 4WU5A 3INUH 3M1BB 2OSLA 4OGXL 2RAMA 3VA6A 5ESQB 2DQUH 2Y06L 5F3HB 2YPKA 1MFEL 4U6HB 4OB5H 5GHWL 3AB0C 2C26A 1CDGA 4Q0XL 1RZIB 1LO4H 4DUXA 4UINL 4MJ4A 1KN4L 2R8SL 4HIHA 1CGTA 2YWYA 4HS3A 1J1OH 3KJ4B 5EZJA 1I3GH 1D5IH 5ADOL 3BP7A 3THMH 1GIGH 5D7JB 3FO9A 1HH6A 5GGVH 5E03A 1F42A 1RIUL 4OCXH 4I9WE 5F44A 4AEHL 1GVIA 5D2LA 1S78D 4RMQA 4HUUB 2VLLB 4MA8L 4DK3A 1AFVH 3DLQR 5K9OB 2QQKH 3MRBB 2PO6C 5IF0A 5KSBB 4NT6A 4QT5B 5KN5A 5EO9B 1S9VA 2R0ZH 3BXNA 4LLVA 1JZ6A 3OXSB 2VQTA 4P9HC 4F37K 1NAMA 4ONGH 3SGDI 1XT5A 2IPKB 2YMXH 3TT3H 3BT2L 1XEDA 4NKOB 4HS6B 3TPUB 4AIZA 2AJSH 4HG4K 3EFFA 1EVUA 2XTLA 4POZD 4XWOD 3NPZB 1SYVA 3M17B 5GSRB 3B9AA 4JM4H 3KR3L 2NXYD 4JAMA 3NABH 2H2SD 1IL1B 3BUYB 4TRPL 5I8EB 5CFHA 4OJFL 5D7JD 4JFDB 3WHXA 1KC5H 4HKJA 1XFPA 1A9EA 5DJZB 3DSFL 2GCYA 4NC0B 4PJ9A 1L9NA 4R8WH 3MA9L 1MFAL 2PO6B 3P0YL 5AAMA 2N7AA 3HZVA 3WLBA 4X5LA 5I76B 4AH2B 5GGTH 3PIQA 1S7WA 3MODH 5BVJA 5HTSA 3PWNB 4Q7DA 1SJXA 3OWEA 1ZHNA 4IDJH 5L6YL 3TO4D 1X7QA 5HGAB 2QQLL 1YEFL 4NHCH 3BKMH 4YO0B 5C07E 4UNTA 1TJHH 3NTCL 3V0AC 3VH8A 4JPKH 4HZLA 3PWUB 1FBIL 5HYJD 1T2XA 4BZYA 4GFTB 2IBZX 2OR9L 4LHUG 3RWFB 3UTSA 2PYED 3S34L 3MOQA 2Y06H 2IG2L 4OZHE 1J8HD 3HG1D 3NCCB 2BVEA 5C8JA 4Q0XH 4XX1G 2OTPA 3WS6C 5DO2C 5TDNA 2FBJL 3OL2A 4JLRB 2XTJE 2V2TB 5I0ZA 4KDWA 2X7LB 4M6OH 2VXTH 3CXHK 5IKCA 1RZGA 1TIUA 2B4CL 5SWZA 1AQDB 2AVGA 3OKEB 5CKGA 1JZ7A 4L4TE 1BLNA 4OLZL 1DQJB 2DLIA 4BM7A 4O2CA 4XNQB 4KKBD 5IVXF 3MLTB 4PYGA 4PRHA 5ALCL 2X4RA 1A6UH 4PJHF 1P84J 1CGVA 1CIUA 2XOTA 2Q8AL 4LCWB 3PQYA 3CFCH 1IGTB 5D1QC 4MD0A 4KJWC 4ZXBB 3MZTA 4LGPB 2ENSA 1F02I 2ADGB 4HK3N 4P4KA 5I15L 3FQWA 4H1LG 2VZTA 2EDJA 5FDYA 1JV5A 4L3EA 1N7MH 3HNVH 4MA3A 4G6AD 4KDTA 4G7VL 4Z18A 4PJAE 2GITA 5DRZB 3U9PH 5IFAH 1GC1C 1XGRB 4A2MA 2VZ3A 1IAMA 3RVUC 5D7KE 5I1JL 1QLRA 2B2XL 4PD4J 3MA9H 4G5ZH 2G9HA 1I7ZB 5JOEA 2R23A 2B8OT 4NM4L 5EBWB 4U31A 1MUJA 1J0HA 1U3HB 2F15A 3I02A 4E42B 3ARBD 2XI9A 3UJTH 5D1QB 3I50L 1F4YL 4P2RB 4JHZA 4OGAD 5D6DA 1D5MB 4OCSL 3GMMA 3NTCH 4MB4A 3EYSH 1UB6A 4JFQA 4X7TA 3DURB 5I1AA 4NNXB 3F5WB 5LGJB 1FBIH 3MROB 1DBAH 1JGVL 1JN6A 4P3DB 4HMDA 2IJ0C 1CDBA 2I27N 3IKCB 2ILLA 4LHUB 4WWKD 1S9KC 2OR9H 3NCFB 3O6FB 2HN7B 2BRRH 2H3NB 1ZV5A 5EUKA 3ZDZE 3VXRA 3GI8L 2NTFB 4OIIL 1YEHL 5DTFA 4CADB 4H0GA 4Q9BA 1IGFH 4M3JA 1QFUL 3MFGB 5CUSL 4GO6B 3LB6C 3MYZA 2I5YL 2HFGL 4MQXC 3NGBC 2OJZL 3U46A 5IMMA 1RD6A 1VADA 3QDMB 1G7JA 4GG8A 4M1GL 5DK2A 2DI9A 2F58L 5ICZA 2Z0BA 2ZUUA 1BZQK 2FZ3B 3KYMB 4AJ0A 2B4CH 1JIBA 3FQXA 4WIQA 3RVXC 1MHHA 1GHFL 2DICA 1SY6A 4JCMA 1KTRL 4OLZH 5DEFA 1U36A 4R7DB 5IVXA 5C9JA 4XT1C 3RZCC 1OARH 2VLJA 2XWJB 4K9EC 4FXGB 5HHNB 4RAHA 1GGYA 3VDCA 4ZUVB 3U0WL 2UVFA 3DMMA 2CIIB 4I3RL 5IJVA 2BVQA 2Q8AH 3HZYA 3FN3A 3RVUD 4X9IA 2EZ0C 3U4BL 4JRYA 1BGXH 4PJBE 1MWAL 5KSUA 1QA9A 2HH0L 4PLJC 1FLRL 2ENYA 2IMNA 5KANI 1HYRC 4GKSB 3JWOC 5JHDA 4MA7L 2YS4A 4QNPE 3OG4B 3KAAA 3BEWB 3M45A 2MOVA 3ULVL 3DO7A 2YD9A 1BJMA 1YEJH 2OP4H 3PNWA 3TJHD 5I1JH 1FG2B 4MQ7B 4LLWA 2B2XH 1T1WB 3NFNB 3RZCB 4ZG1A 1N4XL 1NFDB 1NEUA 3ZHDA 4I0KA 4NC1E 3QEGH 3QQ9C 4M61A 2D7TL 1A6VL 1KYOK 5FYKU 2VKXA 5E9DD 1MI5D 3CVHA 3PWPD 1S7XB 2CO6B 1N6QH 3MRQA 4AT6B 4OCSH 1JUFB 3ALPA 1K5NB 4KJQC 3S5LA 3LB6D 4L3AA 1RJYA 3P0GB 5I1GL 1UZ8B 4Z95H 3O2DH 4O9HL 3SJVA 2DOCA 2P8PA 2BVOA 1Q94B 3RVXD 3T8XB 3PWVB 1DR9A 3LKPB 5F7DA 3NN8A 4NHUB 1YEHH 3RWIB 1DFBH 3L5WB 2JIXD 5BRZB 5CEZE 4F7PA 2HFGH 3WE6B 1W0VA 2OJZH 3OF6D 1XMWA 4LCYB 4UTBL 4JY6A 5JNYB 1KB5L 2R1YA 4LEXL 4U7KA 2WQRA 2V17L 1GHFH 4QGYA 1T5XA 4UOJA 2J7LA 4PLJD 4LSPH 4EI5D 1FCGA 1A4JA 4NKMA 2YXFA 3HS0B 4H26B 2I26N 4K2UH 2F8VA 1ACZA 4KXZH 1T03H 3UPAA 3LRSB 5EU7C 1M7IA 1YUHA 5BOPA 1NH6A 1MCSA 3WIHL 1TQBC 1WFTA 3W0WE 4NQCE 1MJ7H 3QRFM 5H8DA 3MLXH 5E8PA 2B1HL 3QIBC 4YE4L 1JPFB 3FB6A 3D0VB 5D6CA 1MWAH 3KPSE 1FLRH 2BNUB 3QQ9D 3EYFA 4UUJB 1PG7X 1AC6A 1GZPB 4GG6B 4PGDB 2UVEA 1H0DB 2M1KA 3PP3K 4LARL 1YYMH 2YD2A 4PGCB 1KPVB 3V0VA 4BSWB 1O0VA 1NC2A 2MCPL 3CLEH 2APWA 1JHLL 2A6KB 3AM8C 3ARWA 1UEMA 3ECBA 4NKIL 4JFPA 1CD1A 1T66D 2QR0B 2XA8L 1J86A 1I1AC 2V2XA 5DHVH 5EO1B 4NJAL 5L8LB 5LQBL 3HI1A 2FL5A 1UG9A 4JHAH 2UZXB 3REVB 4G6FB 3S3JA 4LDOB 3MJGX 1N64H 4FXLA 4OF8A 1YEKL 3QIBB 5JIHA 2FATH 5KS9B 2H1PH 1ZA3B 3IFLL 4NFDA 1VA9A 2YPVH 4MDJB 1OGAE 2GFBB 2A77L 2X4PA 2VOTA 5T33H 5GS0C 5HGBB 5T3XE 3CXDL 5L2KD 2YXMA 2FLRT 4YBQC 3OG6B 5FM8A 1CBVH 2YWZA 2DRUA 2Y5TA 3R0MA 1AKJB 2KKQA 4P57B 1KIPA 2XQBL 1S7VB 4KY1L 4KXZI 4RGOH 4M5YL 4N8CH 1I1AB 3ES6A 4KWUA 35C8H 4X6EB 1E4XL 5C7XL 4IIQC 1HILA 3C5ZA 4HZAA 2VDPL 4KAQL 5J0BA 1JZ4A 3ZSTA 3MOAL 2UWEA 3IXAB 3IS0X 3EO1A 5FO8A 1CXHA 4MQSB 2AEPL 3QSKB 4UOW1 2VMFA 1DQQB 3MV11 4F15C 1HYSC 4E5XA 5AD0B 1C5DA 1FL3B 5IB2B 4IBLT 5D7IF 4MNHA 3W39B 1BX2B 4I18C 3A0OA 1IKNA 1YQVL 3WIHH 3N1GC 4LMQE 2IQ9H 5ACZA 3I84A 2B1HH 3PWJB 4QGTA 5JQHC 3GFUA 3MLVL 1EZVY 3EFDL 2VQUA 5BVPL 3UBXG 3O4LB 1VFAB 3VU2A 3VXQA 4X80H 2JJSA 1MIML 4LLYA 3EJZC 5GGTA 1XGQB 2GYSA 3RAJH 5CD3B 5D8JH 4OZHF 5KSAC 1BIIB 3MREB 2P8LA 1KIQA 1EO8L 4ZO6A 1U92A 1T1XB 3WSQL 3PV7A 3AAZA 5JZ7D 3GGWB 2MCPH 5DUBB 1MIEL 1F6AB 1RHHB 5DR5L 5BS0D 4KK8D 4CGTA 1KCRL 4F15B 5KVMC 5J57B 4G9DB 2AXJA 4NKIH 4Y4FC 1UA6L 2UZYB 4KQ3L 5IMOA 1DP0A 3BPLC 3RWCA 3SCMC 4KRPD 5DFVC 1JGDA 3RHWF 4LRNH 3W11C 2ZOLB 4R97B 2OQJA 2BFVL 3OPZH 1YEKH 2IADB 3FMGL 3SDXB 1J18A 1U91A 5DMKB 2A77H 2PTTB 5IMLA 3PDGA 5HYJE 1NGPL 3EOBB 3KWWB 1P5VA 2PYEE 3VWKB 5KSAB 3O41B 1A7QH 4JFDE 2C7UB 1J8HE 4D9QD 2OXGA 2XQBH 4KI5C 4RAUA 5AZEH 5E6IC 4KY1H 3CZFB 1CFTB 4YFLI 2BOBA 1V3MA 3D3VD 4KHTL 4OLUH 5C08B 1J1PH 2DJ4A 4G9FD 3OSKA 1QHOA 1HQRA 4JDZA 3SCMB 5C7XH 5MHSE 3ZT5A 2A1WL 4HIIB 4NNPH 3L3OA 4PJAF 3TA3D 2YD6A 2GSGB 3K74B 1DDHA 5D71H 4KAQH 5TE7L 4Q6IA 1DQLL 5E08H 1M05B 1JPGB 1TTUA 1IM9B 1S5HB 3CD4A 3WNLA 1K8DA 3V5DA 5HVHC 3WIFB 3CVIL 1AGBB 4PJ8A 3F8UB 3OKDB 5E8NA 3LKSA 3WL9A 5EC1A 4HC1L 2AKRB 1WBYB 4J2XA 1CLZL 1A1NB 1WCBA 4KC3B 2EYTA 1F4WL 5IB3B 4X6DE 1KCUL 3IXTA 1Q72H 1NGYA 3I6KB 4QOKB 5E6IB 4MB5A 1YQVH 3LEYH 4OTXL 2IFFL 5C0DB 5C07A 3FAXA 4NQXB 3MUHL 4FNLH 3T0DA 2W9EH 4ZTOH 2I25N 5LVEA 3ARXA 4PRPA 4Y4FD 3IDMB 4HH8A 1S8DB 5D2NE 1QLFA 4OFDA 4KKCD 4ORZC 1X5YA 4KI1A 1UYWL 5I19H 3X12A 3ZDZF 4N0YH 5CSGA 5FGBA 2E9BA 4KRNA 5HVHB 1HZHL 4UT6L 3BH8A 5IHBA 3WSQH 4AENA 3MACL 2UYLB 4QRUB 5ELIA 1UFUA 2IF7A 4OGZA 3RIAF 5F21B 4FQ2L 4TSCL 1FN4B 3RZWA 1JGUL 4HUWA 2V5RA 3X14A 5ICYB 5TJWK 4JDTH 1N59B 3HE6B 3TIEA 4MAYA 3EGSA 2KZWA 5F9DC 3T0EC 1AC0A 4MD5B 4WW1A 2HLAA 4PLKC 3LKQA 2J6EL 3D25A 3HC0B 1MF2H 4LPUA 1OPGL 4QOKD 1E4XI 1BF8A 1UKSA 4WHDA 2YSSA 3MRMB 4JY5H 3V79C 5TE4H 3TZVA 4LDEB 4OZFH 3P11H 4HDIA 1KEML 1A7NH 3O3EB 1YY8B 4HEPG 5E2WL 4ELMA 2PW2B 2BVTA 4H8WC 1TNMA 1A64A 4P46C 1I4FA 1U41A 4XAKD 4PJBF 1XR9A 3T1WA 2BOCB 2HG5B 1RZ8B 4HKZB 3STLA 4KHXL 1G84A 3GIVA 3I3EA 5I16A 1XGUB 5KAQF 4ALAL 3S36X 1CCZA 4QNPF 3R8BB 1GC1L 2BZDA 4YAQA 3RA7H 3D0LB 4PJAA 1BEYH 4B0MM 3ARDC 4H88H 1II4E 4P2RE 1NMCC 3BP5A 1Q9WA 4YXLL 3C60C 4YX2L 5DQJB 1JMZA 4XCCL 4FQLH 3BP6A 1LO2L 4ZAKA 4OGYL 5IFHL 1JTPA 2CIKB 5L7XH 4M7JL 1CLZH 4P2OA 1E4KC 4K8RD 2NLJB 3ABZA 3VRIA 3HKFA 4RAVB 4WFED 4P46B 3PWLA 2C3VB 4LSQL 15C8H 4MA1C 5CBEB 4PLOB 2ZSVA 5H37G 4OM0L 4OTXH 2IFFH 1XIWC 3C5JB 3UTPD 5DRWA 4QRQA 3RFZC 1HXYB 3DHJA 5F8RC 3DVGB 3VD4A 1YNTB 2VLKA 3QDME 4RA3A 1EDQA 4PRID 2DLFH 2R1XB 5C0FB 2FHBA 3DRQA 4ODXB 2FGZA 3T0ED 4PLKD 2QLVB 3GIZL 4Z77A 1NMCB 4X7CC 3QPXH 3FAWA 3DBXA 4XPAL 2XNAB 3C60B 1HZHH 4UT6H 4QEGA 2LAGB 4CU7A 3MACH 1PSKL 4AMKH 4AL8L 2XIDA 1OD7A 4Z7VA 3F6IA 1BZ9A 4UI2A 2NQCA 3G6JE 4EBQL 1NFIA 3FFDB 3FRUA 4MLIA 5EN2A 3QUZA 1B4RA 3N0PB 1JPTL 2VH5L 3RWHB 2VR5A 1WCQA 4NQSB 5E9DE 2NNAA 1MI5E 1JK8B 5C0JA 3O9WA 1XIWB 3PWPE 2J6EH 3HC4L 1OPGH 3O45B 1LD9B 4M1DL 2QQNH 2XQYG 2GT9B 2DS4A 3V52H 3VWJD 4K9EL 1ETZA 1QSFD 4YNYA 5DJ6A 1MCJA 1QSEA 3EJYC 1KEMH 5LAXB 1M71A 5E8DL 5E2WH 2I24N 2R0WH 3ARTA 5GRXG 3ARDD 1GGTA 3W9DA 4TVPH 5J7CC 3TN0A 4WJ5B 4XVUC 3KPOA 5D72H 4LCIL 4L5FL 1ZT7B 4FQXD 1QLEL 3ZE0E 4O02L 3EZ8A 2NY2C 3L7FA 1Q9LB 3JWOL 5DJ0A 2V9RA 3GHEL 5L2JA 3MRRA 2VXVL 2RBLA 4XMPL 2NY7L 3PABB 3MBXL 1U58A 5JW5A 3MRDA 2ARJA 4YHIB 3QAZC 2F54D 4MD4A 1E6JL 1FJ1B 2DD8L 3QA3B 4UZGA 4JFED 4YDJA 2YC1A 2I9TA 3QEUB 1U8IB 2A9NH 1ZT1A 1JPSL 5DRXB 5KSVA 1RZKC 1SBSL 1NBZB 4HEME 4XHJD 1G7HA 4JGUA 4OGYH 3EIFA 3TBWB 4K7PH 1VENA 2FWOA 4QF1A 1KLFA 4D0BA 4WEBL 2NW3A 3A6BL 3KVQA 1EFXA 5H2BB 1OGTA 1WEJL 2DYPA 1GPOL 1D6EB 1JNLL 3ZKMD 1OD9A 2W60A 1KSRA 2V9QA 2BERA 5DHVA 1JYVA 1LE5A 4Q2ZA 2NY3C 5FUCC 2DQDL 4GRMA 3EJJX 4HQQL 5C6TL 1J8KA 4KMTH 1VFBB 1FNSH 4M7ZC 1EO7A 4H1LH 1WT5C 3MR9A 1PSKH 2MPAL 3PV6B 4G6JL 1E0OB 4OBRA 2VL5A 4EBQH 4YXHL 3IDJB 3OB0H 1CGSL 3GSQB 2DKSA 1JPTH 1Y0LA 1MRCL 3GSOA 1FORL 5GRVK 3WN5B 1ZHKA 4JO1H 2GJ6D 2AI0L 1P84K 4M1DH 5DD6B 1TTFA 2HVJB 3ALWA 1MLCB 2NY2D 3IJYB 4U1GC 3CH1B 5IIEB 4DOHE 5C0GA 2BNRA 3V4UH 1NCTA 3VXMB 5JW4R 5E6YA 1WIPA 2NY3B 3E2HC 1FFNB 1U8QB 1EEQA 2RFXB 3MLZL 5E8DH 3P4NA 5FIEA 2BSTA 1MPAH 1G7LB 1KB5A 1BMGA 4MMZC 4KVCL 4M7ZB 3RNKB 2IGFH 2HP4A 1PDKA 3MLRL 4L5FH 4JRXB 1QLEH 2VNCA 5IM7B 3VRJA 1W0WA 4HJGA 5TQ0L 3T4YA 1JWUA 3KPSA 2VDKL 1YY9C 5LBSL 5ILTL 3GHEH 4LHQB 5E70A 1BVKA 2NMSA 2BHZA 3QRGL 2VXVH 5EU7E 5C70A 2ZPKL 3T4AA 3R06B 2FEEL 3D5OF 3QIWC 4IRZH 3OAZH 2D3VA 1U8HB 5FGCB 5CBAB 3CDGA 3RWEA 1DANU 4U1GB 4NUGH 2K1MA 1CR9H 4GRLB 5DMIL 4X98A 2CLRA 3E2HB 4BSVB 1KN2L 3WMSA 5F1OB 2D2OA 3SDAC 1A7PL 4NFCA 1MJUL 3QDJD 1MVUA 1DBML 5DURD 3OAYK 5GS0L 1N3NB 1D9KC 4XP4H 4IMKC 4JRWA 4WEBH 7CGTA 2D7NA 3F7YB 1A9BB 1GPOH 1H8OA 2XFXB 3D48R 2NX5B 4P4RA 2EXWC 5FHBL 1IC7L 4X7EC 3QIWB 2CDFB 3MCKA 4LPVA 1INQB 1RK1B 3N9GL 3BDBA 4PV9B 3S35L 5HSFA 4OQTH 2HFEA 1CQYA 3MYJA 4XNXL 4YFEA 2DQDH 5H35B 4P2QB 3IDYC 1AD0B 5D1ZA 5BS0E 4ORGA 1EEUA 4G8FB 1MCHA 5C09B 2ZCLL 3NA9H 1IGCL 3PGDB 1H8NA 1Y18A 1MHCA 1QZ1A 4NYLA 3SDAB 1J5OH 1ZSDB 1U95A 4N8PA 2K7PA 3ZYIA 3FRPG 2P49B 4PV8B 4BUHA 1CGSH 1HN1A 2V5YA 1D9KB 5ENWA 3RPIB 4HUVA 2DQFA 1FORH 4N0RA 3GSVA 3PDOB 4S0SD 4ZDHA 6FABH 1NANI 2AI0H 1I3RA 5A3ID 4JVPA 5D9SB 5FDWA 1CK0L 1EXUA 4Z5RB 4PGJA 4LNRA 1E4JA 5MEQB 1CG9B 4X6DF 4IRJC 4HAGA 1MAMH 5ESQA 2PCPB 3S7GA 4ELKB 5F3HA 4JVUA 4D9QE 5GRJH 3BW9B 4JFHD 4U6HA 4BKLB 1A3RL 4ODSL 5E1HB 4KVCH 4JQXA 1RZIA 3KXFB 4KROC 3D3VE 5LGHL 3BWUC 5D7LD 4AZ8A 4G9FE 4HCRL 2CDGB 4PG2A 5B3JE 5LBSH 4UDUA 1K6QH 2DM4A 5D7JA 2ICEB 1R5VB 1G6RH 3MOBL 5HI3C 4HUUA 4OFIA 2UY7A 1ZLVK 2VLLA 2EDOA 3P30H 2E6QA 3BZDA 5K9OA 5C71A 1TLKA 1MCDA 4WGWB 5J12B 5KSBA 2EXWD 4QT5A 5EO9A 4I13B 2VWEC 4IRJB 4OFYD 3OXSA 1VFUA 1A7PH 4MX7B 1IBGL 2IPKA 4KROB 4NKOA 5D1XC 3DXAD 4XBGB 4U1IB 5I66A 2VE6B 4LPXA 3TPUA 3GBMH 2CXGA 4U33A 5MI0B 3M17A 4NOFA 4PJEB 5GSRA 2CO7B 1C16B 2AJVL 3BUYA 5CMAB 3V6OE 5T5FL 5I8EA 1CD0A 4JFDA 4PTTB 2V7NB 3KHQA 4LOUC 4XP1L 3MV01 2NW2A 5DJZA 3LSOB 5FYLD 2FGWL 5GGQL 2PO6A 2IBZY 2ZZUT 4L8BA 1Q0XH 4X0KB 3KYAA 4HULB 1IGCH 4NQTA 3TEUA 3WNPA 3SE8L 2MMXA 1AY1H 3VDAA 4AH2A 4YHPB 3PWNA 5DJCB 5AUMB 4PFEA 1BWMA 2ARWA 1VKXB 3GO1H 3O0RL 2E7HA 4KI5E 4QOKE 2ZG1A 4YO0A 4FTVB 2VLRD 4M6AA 2BVYA 3VFPA 3TYFB 1HXMB 3SE4C 4OZIB 2EEAA 2FEEI 5IV2B 1YYLL 3PWUA 1XF1A 2DQJL 2X1PA 1BZ7B 4WUKL 3IFOA 3RWFA 4M7LL 2W0FB 5JLZA 3DVFA 5CIPB 1KCSL 1W8NA 1A3RH 4ODSH 2BSED 1BD2B 1MREL 4M8VA 3K0WA 3QEHA 4EQ3A 3S4SG 1MRDL 4JLRA 2FH8A 3W5MA 2G2RB 2V2TA 1BFVH 3I3DA 2X7LA 4J3VA 4F7CB 1BOGB 4HC1A 1P6FA 4LP5A 1AQDA 4DWHA 2C4XA 3OKEA 5EULV 4NWTL 5A2LH 3U36B 5D1XD 1SVCP 1H8SA 4H0IA 5EU6D 5JW3H 5LXGH 1UXSA 4XNQA 4IHOB 4FG6D 3G6JF 1PEWA 4DCQA 1AD9A 2X10A 3NIFE 3G6AA 5K33A 4ACPA 1JHKH 3QDHA 4OF3A 4WFEE 1GGIL 2XKSA 3UTPE 2YPLD 5JUEL 3WS6A 4HT1L 2FSEB 4AEFA 4WGVB 2ADGA 3BYYA 1TJGL 5KTEH 4H8WL 3RVTC 3VGFA 4PRIE 4Y19B 4DVBA 5CSBA 3NIGE 3T0EE 3GSUB 2ITCA 2XICA 5T5FH 1T7WA 5DRZA 1KPRB 4GBXC 5AYUL 1XGRA 2E6PA 3NFPB 3ZE0F 2MCG1 1LP9B 3HB3D 4GQ9H 1CT8B 3C6LC 1I7ZA 1YNKH 2LU4A 5EBWA 1KFAL 1VPOL 4YHOL 1X3DA 4BK5A 5FUOH 4E42A 1UXWB 2FJFB 5F70A 3HCVB 4RDQG 5D1QA 3ZKXC 1DE4B 4P2RA 2CRMA 3KG5A 3GDBA 4YHMH 1D5MA 2DBLL 1QSFE 3ARGB 1QRND 3DURA 2DKMA 1YYLH 4NNXA 3F5WA 1B3JA 1QHPA 2R0LL 5LGJA 3MROA 1KCLA 4P3DA 3VI3E 2DL9A 4MMXC 4GBXB 2X4NB 4JY4B 2R4SL 4M7LH 1PD6A 2WBJC 1SEQL 2H3NA 4IS6B 1DLHB 2LE9A 1WAAE 2NTFA 4CU8A 4L3CB 4PP1D 4CADA 1L7IL 3HMWL 2JJTA 1UVQA 4RZCB 4KU1A 1U6AL 1KPUB 4XC3L 2Y5EA 3QDMA 5FEBA 1NC4B 1HK6A 1EHLH 1DBBL 3X13B 4YWGL 4J3SA 3B3IB 2FZ3A 4P48A 1KJ3L 1AGCB 3ZKXB 2F54E 5F6IC 4A6YA 3FL7A 4R7DA 1X4XA 3DV6B 3KPRB 4XCNB 3RVTD 3DNKA 5HHOD 5A2FA 2XWJA 4FXGA 1NCAH 4HF5L 5HHNA 4JR9L 4U2YA 2R39A 2WBJB 4ZUVA 1T5WB 3UBXI 1I8KB 3HNTH 1DEDA 2B5IC 3O3AB 2CIIA 3QQNA 4RIRA 1C12B 1MI5A 2FLBT 4NFBA 1NCDL 2Q3AA 5JUEH 3C6LD 4UIKL 3H3PL 3MQIA 5E5RB 3V95A 1NUFA 3Q6FB 4H8WH 2E7LC 4GKSA 4Q6YA 3V7AG 1OAQL 2AQ1A 5F6IB 5IEHB 3BEWA 1IGYB 1I85C 2BX5A 3L3JB 4XNUL 4BFIA 3BHBB 2ZCKL 1RJLB 3UYPA 1FDLH 4LASH 1OP3K 3NFNA 1T1WA 3RZCA 1XCQB 4MNQB 4RBPK 4X4XB 1UT9A 3UTZB 3OF6A 3V4VL 1V3JA 4GXVH 3VGHA 1KFAH 3STBA 2OCFD 2B5IB 5KVEL 4AQOA 4PJXE 5GSVB 3ILQD 1G7QB 3D1MC 2IALB 3ULSB 2RR3A 3TF7C 4D2NA 1UB5B 1RZKL 1S7XA 1UACL 1RZJH 1FRGH 4KK9D 4AT6A 3AREC 3K1DA 1K5NA 4LPCA 4FQCL 1EAJA 2DN7A 2NY0C 1AE6L 3OZ9L 4DKFH 4LBEB 3RGVC 5E2TL 3EUUA 3V6ZB 2IEPA 1DQML 1D6VL 3WFHA 4D9LL 5F93C 2Z4QB 3GMPB 4XCEB 3SQOH 1Q94A 2AEWA 4HAFA 3T8XA 3ZZ1A 5JW4Q 3PWVA 3RVWD 1B6UA 5FO9B 1S5IL 2EECA 3LKPA 2L7JA 2IWGA 3WBDA 4NHUA 1U8KB 4NKQB 1MH5A 5J4MA 1L7IH 3RWIA 3HMWH 3U79A 1SM3L 3L5WA 4NO0B 2WK2A 3U2SB 1U6AH 2OTUB 3WE6A 2DKUA 4LCYA 4EKXA 2Z92A 1UJTA 4LPWA 4POUB 5BO1H 4NQED 4OKDA 2XN9B 2Z31B 2XZQH 5I74C 2Z8SA 3AREB 2IH1B 4GAFB 1X4ZA 3HPLB 4QRRB 2NY0B 1IGML 2CKBB 3FONA 3RGVB 1BP3B 2WINB 3B9DA 3HS0A 4H26A 2APXA 1A5FL 5FUCE 3QDJE 3LRSA 3K8KA 5DJ8B 1I7UB 1K2DB 1QSZA 1MQKL 3EYOB 4Y4KC 1CZ8L 4ZD3H 2J8HA 1I7RB 4PREB 1AQKH 4DZ8B 4JZOB 2GUOB 3CX2A 5EPMB 4JRXE 4ZS7H 1JPFA 7FABL 3D0VA 2OK0L 1LEGB 3NCBB 4ZOCA 2BNUA 4ODHH 3S3SA 2FD6H 1GZPA 4AY0A 4PGDA 4GG6A 1LILA 3RJDA 2F74B 4RX4D 4TULL 3BAEL 1H0DA 1QBML 5I74B 4PGCA 1KPVA 1OAKL 4XNUH 3W82A 1H3PL 2FX7L 2DTSA 3L3HB 2ZUVA 2A6KA 5DWUH 2QR0A 5EO1A 4I4WB 1C1EH 1G1CA 1ZHLB 3V8OA 1B0GB 4Y4KB 4LU5H 5KVEH 2OBGA 1B2WL 3I2CL 3QEQD 3QIBA 3GUTA 5KS9A 5CGYC 1ZA3A 4HXAH 3MXVL 3K3QA 1IT9L 4MDJA 4HWEH 5HGBA 3QG6B 2ZG2A 5E1AB 3OZ9H 5GRUL 1HIML 3K1KC 4YDVB 5E2TH 4WCYH 1S9WB 3P73B 1FZMB 3HRZB 1DQMH 1D6VH 4JFHE 2M26A 4D9LH 1AKJA 4P57A 4PB0L 3OAUH 1S7VA 2A83A 1AO7D 3LDBC 5GISL 4DZBB 3AM8A 3LPGA 1EX0A 1CL7L 5D7LE 3K81A 4GKNA 4KK6D 5I17B 1I1AA 2BHUA 1T4KB 4X6EA 3IF1B 5SWSD 4B7LA 2JJUA 2XZCH 3QDGD 5DD3H 3UYRH 1BQUA 1UEYA 1LDPL 3QZWA 5C0NC 3GI9H 3IXAA 2YD4A 4K3JL 1CYGA 5BS0A 3LIZL 2VN7A 5DA0B 5DHYB 5MEOB 4MJIB 2AV1A 4NCDA 1IGMH 5AD0A 3BSZL 4Q9QH 1FL3A 5IB2A 1DBKL 3BD4A 5D4QA 4TYUA 3W39A 5BQ7B 1BX2A 2AV7B 1MQKH 2C1PB 3LDBB 1CICD 2P45B 3DXAE 4PY8J 1J7VR 3GMLB 1WTGT 3PHOB 3QUKB 4P5TC 3GSWB 3PWJA 2A6JB 4QHUB 2WAHA 1K4DB 1KB9J 3E8UL 3O4LA 1IC4L 3CLFH 1XGQA 5CD3A 3KLAB 5FYKL 4YXKH 1BIIA 2GTZB 3MREA 3TVMD 1FFPA 5FYLE 5CGYD 1T1XA 3GGWA 2WANA 1F6AA 1RHHA 3KPNB 3JSSA 4G9DA 3LMJL 1ZLSH 1AR2A 4NM8L 4I18A 1OTUD 4ZSOB 2FH6A 1DUYB 5T3XH 1OF2B 1A02N 2ZOLA 4Z76B 4P5TB 1UC6A 1JZ3A 1A0QL 4FZEL 2IADA 2PXYD 5EOCL 1DCLA 2J2ZA 3SDXA 2QSCL 2HTKD 2K3TA 3V4PL 3MXVH 1KV3A 5DMKA 1PAMA 2C3GA 2P44B 2PTTA 2ZUSA 4NQUA 5T3ZD 3NIFF 3BOVA 4HCRA 3RUGE 3NCYP 1UKQA 3EOBA 3KWWA 3QUYB 5KSAA 3O41A 4O2EA 1WGOA 5C0ND 2C7UA 3CU7A 3V6FB 2CK2A 2YD7A 3F6LA 4Z9KB 2HT3C 2IPUG 5GISH 4GH7B 1GYAA 4Y4FA 4YBLC 5C08A 2VWEE 4D0CB 3NIGF 4O4YL 3SCMA 4HJJH 4HIIA 1W72B 2GSGA 2BNQB 4ZQKB 1UWEL 1M05A 4XXDA 4K3HA 1JPGA 5EU6E 2XZAL 1S5HA 3OJDB 5HHPB 3MRHB 4FTVE 2YEZB 1OCWH 4L4VD 1OTSD 2ZNWA 4OZIE 3OX8B 3OKDA 5C2BL 2R69L 3MNVB 2AKRA 4XBPB 1A1NA 2CDEB 3SKMA 1X6LA 5CZVH 3RWGB 3M8OH 4QOKA 3HZKB 5E6IA 1ZGLB 1WIUA 4U6YB 1MQ8A 3DHMA 2YPLE 4NC2B 4NQXA 3O8XD 4YBLB 4R4BB 4X8JB 1Z9MA 2ESVB 2MFNA 3LN4B 3IDMA 1MCPL 3VI3F 1S8DA 5DZOA 1NPUA 1PW3A 4TNWK 2ORBL 2OJEB 2WQ8A 5I1KL 1KTDA 5FYKH 2VDQL 1S7QA 2HKFH 3G04B 4YGAB 1VHPA 1WAAF 4XPHL 4J12A 2AJYH 1A1MB 4TPRL 3ROOB 4NRZB 2CJUL 1I1RA 2UYLA 4QRUA 4OQ1A 4PJ5D 1FN4A 3LMJH 3TH2T 5ICYA 1N59A 2EDKA 2P46B 4NM8H 2SEBB 4U3HA 3HN3A 2NCMA 4C56B 2R2BB 3EHBC 4GAYB 4MD5A 4UQ3B 1F4AA 5F9WB 4XPFL 3HC0A 2XKNB 5EBGA 5TDPB 2HT3D 4U4BA 1A0QH 4FZEH 2VXQL 3MRMA 5F1KC 5MEPB 1QRNE 2QSCH 4QTHB 2ZKHL 1I9JH 4R2GB 1IEHA 3O3EA 4HFUH 1YY8A 2P4AB 4ETQB 2PW2A 4PS4H 4YQXL 4FXKB 4BZ1L 1T7XA 4M9PA 4RGND 1LP9E 3O3DB 3WXWL 2BOCA 2HG5A 1RZ8A 1PQZB 4HKZA 5J1SC 1NCCH 4OM1H 1X5HA 3BO8B 2EE3A 5HHQA 2E5EA 4HIXH 4P49A 1UM6L 4PRIA 1FFQA 3EYVB 4TSBH 3T0EA 4QLRA 4BH8B 3ZL4H 3LZFL 3TGXA 3D0LA 2DQEH 4YHYC 4JEGB 3V6BR 4PJ9D 4R90H 5TE6L 3GK8L 3QYCA 4GW4A 3JWNC 3VG0L 4HIEB 4K71B 1MNUH 5GIRB 4W81A 1P69B 5HHVH 4ZYKB 5KOMC 3VXSB 2A74B 3VXNB 5DQJA 5CS7A 1DLFL 4YDIH 1BQLL 5HHOE 3P4LA 4PRDB 4QHMB 2CIKA 4PJXF 1G6VK 2NLJA 4Y8AA 4JPVL 4RAVA 2LTQB 4P46A 2C3VA 1M1SA 1ZHBB 4XCYB 3ILPB 1CE6B 1U8PB 4Z7WE 2HMID 4GAGH 3C5JA 3KPQB 3IFNH 3GBNL 1A22B 2R2HB 3SKOB 1D5BB 2ERJB 1PG7L 5C3LD 3DUHA 3ZKQD 1Z9SA 3UTSD 1YNTA 1MFCL 2R1XA 1BPVA 4ODXA 3ARDA 2ORBH 4DTGL 2AEQL 1NLDH 4MS8C 4MXQC 3I3BA 4NKDB 4EQ2A 5I8CB 4ONHB 5IQ9B 4LLUB 5EWIL 2XNAA 5D6DC 5FKAB 3C60A 1WJ3A 3GMQB 1GJIA 5I2IB 1HHKB 3SO3C 2IPTL 3LKRB 1MY7A 5DUPH 4FQHB 2D0GA 1R3IH 3KPRE 3QDAA 4ZNCD 1BAFH 2CUMA 3OB8A 4EOWH 5SWZD 2EE6A 3RWHA 4NQSA 2F54A 2GAZB 1CIDA 1XIWA 4XPFH 1JWSB 3O45A 2X4TB 3LN9A 3JV4B 4UBDD 2GT9A 1RUKH 1XF4B 1T03L 3P9LB 5J9PB 2ZKHH 1R5IB 1VDGA 1FIGL 5LAXA 1IAIL 3LQAC 5DD1H 4DFIA 5FK9B 5HGGS 3SO3B 1QYGH 1MCCA 3L3GB 3G9VA 4FQPA 4P4KD 1ZLUH 1ZT7A 5DDHB 1CU4L 3O6LH 4OLWL 1QSVA 4KRMB 1Q9LA 4L3ED 1LK2B 4JG1H 3H2WA 4CVUA 1NMAH 3L6FB 4RFOH 4JREB 2WWMD 3PABA 2A6IB 1PKQE 1QEWA 4HS8L 1A7OL 4WHTA 4YHIA 5EU4B 3MNZB 1R3LA 4LSVL 3QCTH 2BC4B 1CD8A 3KJ6H 5L0QC 1A4KB 3QA3A 1VCAA 2YK1L 1S7TA 3AMKA 1VGKA 4N9GB 3QO1B 1QBLH 1U8IA 3QEUA 2AJXH 2OLDA 5DRXA 1CFBA 1DLFH 1NBZA 4IOFD 5HYIA 1P7KB 4HUXB 4HH9B 1QNZL 4LKCB 4MXQD 1H3GA 1A3LL 1IC5H 3MO1A 3NCYS 4M6NL 3FCTB 3U4EB 3UO1H 2W65B 3MLYL 1CE1H 5H2BA 4KJYB 2ARJQ 2CKBL 6CGTA 1ACYH 1RZFL 1V8HA 3PP4H 1ZA6B 5E99L 1X5IA 1T7ZA 1RFDH 1FH5L 1PG7H 2YKLL 1JF6A 5ICXB 3UPCA 3TH4T 1IEBB 1INDL 1MEXL 1FZJB 3CAFA 4JHBA 5ESAB 3I85A 4GRWE 5L0QB 2ATKA 3QXVA 3CPLB 5ISZD 2DQHH 2AJUL 3PL6C 5I18H 5HY9B 4S1DC 4Z0BL 4QRRE 2IPTH 3DYOA 3L3KA 3PV6A 2IC2A 4N5EC 1RURL 3B5TA 1N2RB 1RK0B 1V7MH 1H3WM 2CRYA 5EZLB 4M93B 3MGTB 3IDJA 4ZS6D 3GSQA 4OBSA 1NGXB 1WBZB 4KUZL 2WIIB 3WN5A 3LEXB 1S7SB 3NZHH 3MUZ1 2BY0A 1F90H 1NDMB 4JPIA 3WO3B 5DD6A 2HVJA 3H6JA 1MLCA 3IJYA 2EH8L 1RUAL 3QFJB 3QUXC 2QADD 1OSPL 2H41A 3CH1A 4KKAD 1YPZE 2VLJD 3DIFB 5IIEA 1WLHA 3TV3H 2JTDA 3QI9C 5MENB 3P77B 3BIAX 3DMMD 1FFNA 1U8QA 2RFXA 1IAIH 2WP3O 3GJFH 3RTQC 2OTWB 2XG5A 1G7LA 1AO7E 4ODWB 3PL6B 4JRYD 4LKXB 4TUOB 3RNKA 4XCFL 5CZXC 4HLZG 1WT5A 4JQIL 4JRXA 4DN4H 3MGOB 4HBCL 2Q76B 2A0LC 3RBSA 5IM7A 1YECL 1VEPA 4GKZA 1DQTA 4WUUB 5SWSE 5JHDD 4LCCC 1MLBB 3DARA 3R06A 3LV3B 2NY6C 5IB5B 5EBMB 1U8HA 5CBAA 1A7OH 4U1SB 4FFYH 1I3VA 2R9HC 1ZWIB 1Q9OB 4LSVH 4WO4C 4ETYA 1IAKB 3QUXB 5F7FA 4XTRC 4G80B 4GRLA 4UQ2A 1LEIB 3QI9B 1YC7A 1F4XH 1F8TL 2VR4A 3O6KH 4BSVA 4YHNB 2GQHA 4JHWL 1JZ8A 4Z7UE 3QUMB 3OTTA 1CFSB 1AP2B 1NCWH 1Q8MA 1QNZH 2O5ZL 5GZOC 1TVDA 2EDDA 1N3NA 3DX8B 4UILH 5ALBL 4S1DD 4L29B 3MV9B 3MLYH 2CKBH 4M62H 1DBJL 4JFYA 3RUGF 4LCCB 2XFXA 2NX5A 4UV4L 1C5BL 5DVOA 2P8MB 1MOEA 1XGPB 2YKLH 3QIWA 2CDFA 5EZIL 1FGVL 4K7PX 1INQA 1RK1A 1RSFA 3UC0L 1HDMA 4Q9CA 2BY3A 4WO4B 5H35A 4P2QA 5IGXH 5E24E 4U6VH 3QCVL 1AD0A 3CSPA 3TO2B 1Y6KR 4G8FA 1IAII 4J7RA 5C09A 4KZDL 2M2DA 1K3ZA 3QP3A 3PGDA 5EOTB 4J6RL 4XNMB 3SDAA 5HD8C 1ZSDA 3X3FL 3K4AA 5CP7B 3E3QE 2V7HB 4PV8A 2P5EB 3MFFB 3RTQD 3UMTA 4NQDB 5JMOC 1D9KA 2R2EA 3RPIA 3RX5A 2ZUQC 4IMKA 4KUZH 3SKJH 5CZXD 1P2CB 4OZIF 1AGFA 5DSCB 5GJTH 1FIEA 5D9SA 4TN9A 1QOKA 5T3ZE 4HIJB 2EH8H 3QWQB 4QHLA 4Z5RA 5MERB 2OZ4L 5CJ8A 4F80A 5MEQA 1CG9A 5FO7B 5JR1L 1UWGH 2NY6D 2PCPA 4Y1AD 4ELKA 1EPFA 4BELD 4XPBL 2EDEA 2R9HD 3L95B 4BKLA 2PTUA 3OKMB 5I71C 4XCFH 3KXFA 4XVSH 4JQIH 5CEYB 2NR6D 2BRQA 4HBCH 4L1HA 3S36L 2ICWA 2CDGA 3AU1B 2Q8BH 5E5MB 3VGEA 1FFRA 2R0KH 3GSXB 2QEJA 3BEVB 2XY1A 5CWSB 1X5ZA 2ICEA 4R4ND 5K9QG 4HV8B 1NC2D 4LVNC 1F5WA 1A8JH 4QXGH 2RCSH 4Y5YB 2YOCA 4L4VE 5EUOE 4OI9A 5F89B 1ND0B 4KRLB 5F7EH 2JJSC 5F97E 5I30L 1F8TH 1W72L 4IRJA 1BBJA 1XCTB 2PF6A 3TT1L 2XY2A 4MX7A 4YUEL 5I71B 4DGIL 4P0DA 5GRZA 1K3IA 5D5ME 3B83A 4XBGA 2VE6A 3O11B 5ALBH 4XMLH 4KTDL 4R4FH 4PJEA 5JPNA 5IBUB 3VJ6B 4XNZC 4UV4H 1H3UA 1C16A 4DK6A 1FGVH 1HQ4B 4LVNB 5CMAA 4NDMB 4PTTA 2V7NA 4OLYL 1LP9F 3UC0H 1ZTXH 3PGFH 3AY4C 4A2LA 2Y07L 4NPYB 4E0RB 4X0KA 4PJ5E 4TOYL 1KGCE 3C5ZD 4EDWL 2VLME 1UWXH 2EKSB 4M7KL 2BDNH 1PFCA 4YHPA 5DJCA 3X3FH 2W59A 3FRPA 5AUMA 5D2LE 1FYTB 3JTTB 4X5WB 5TQ2H 1VKXA 1TENA 2VDOH 5D1XA 3ARRA 5FYJD 3BZ4A 3C08H 4FTVA 3VDBA 1ORQB 2VJXA 3TYFA 4OZIA 4BFBD 5F7YC 4TSAL 3VFTB 4XNZB 5CILH 1OB1A 1FNLA 1BZ7A 1J88A 1QFHA 3FO2B 3QQ4B 4OLVL 2IAND 2W0FA 3MV7B 5B21A 1F3JB 4Z7WF 4OCRH 2FB4H 3TYGH 3KS0H 4RGNE 5CIPA 2O93L 4X6FB 1EHAA 1AXTH 3VFMB 5ID0B 1BD2A 1HH9A 3SDYL 4F33B 5IJKC 5GGVY 5F6HJ 1HEZB 3RX7A 4WFFE 4ZNEA 2HJFA 5FCSH 1NGWB 3GB7B 1MCKA 4F7CA 1BOGA 1OTTC 3G5XB 3RU8H 1JF5A 2DQIL 2G5BB 4X7SL 2R4RL 3TIDA 4NQVB 4X6CB 4RA0C 3U36A 3SE4A 3BKCL 5EZOL 3UTQB 1J11A 4IHOA 1MJ8H 2PETA 5HVFB 5MP6L 5DJDB 5J1AB 4L9DA 2DI7A 4ZFGL 5JORB 2X1WL 3TT1H 4YBHA 3U9UB 2I60H 4ODBD 4YUEH 1T20B 4NUJB 2YA1A 3S88L 4W6XB 1TXKA 2FSEA 1YEIL 5T1KB 4DFHA 3UTSE 1U9KA 4Y19A 2CMRL 4JM2C 3GSUA 1ERNA 4URTB 3ARFC 2YUVA 2BY1A 2AGJL 5FUZH 1KPRA 1BQHB 2R56H 3T2NH 2H26B 3NFPA 1LP9A 4NZTL 3QB7C 1XF5B 2B7DT 1IQWL 4QRTA 1CT8A 2MJWA 5F9OH 3ULUH 3IB4A 4TOYH 4XMKH 3KLDA 5SWZE 4QHKI 3C8KB 2OXHA 2FJFA 3LH2L 2BY2A 3EDDA 3G08B 4IDLA 3WFCL 2EH7L 3AS2A 1DE4A 5F1NB 2OR7A 1MCOL 1EJOH 4PJ8D 2VDLL 4JFZL 3L5XH 4JO2L 3ARGA 5L88L 2H9GB 1KELL 4JM2B 4TSAH 3KHOA 5T1KD 5GZND 4YGVB 1OTTD 3R0NA 1BHGA 4GBXA 2X4NA 4OLVH 4JY4A 3FQRB 5DLML 3ZE1E 4JN1L 4IS6A 1DLHA 1URLA 5KZCD 5B39B 5E2UL 4OT1H 4L3CA 4PRPD 2G60L 4R26L 4XI5C 4L3EE 4JFOA 1KJ2H 4MJ6B 4OSUH 1LEKA 1CFVH 1KPUA 4UAOC 3F12B 1PG7W 3E1F1 3X13A 4BK4A 1IEAB 3B3IA 2DQIH 1AGCA 4GRWF 1N5YL 4KTEL 2MWCA 1JI1A 2W0PA 2VC2L 4QYOB 4K8RH 5LWYL 1Z6JT 3DROB 3J7HA 2Q86A 5EZOH 1JZ2A 5IESL 5F72S 3DV6A 3KPRA 4HX1B 5DUMH 4MAYD 2AK1L 5DJXB 5EU5B 2H32H 3ARFD 2WBJA 1T5WA 4ZFGH 1I8KA 4PJ7B 1C12A 4IOSD 3GEWB 4KV5E 4EUPG 1TNNA 2VAAA 1HCVA 3VXUB 3TZVD 4IJ3B 3S88H 1YPZF 1OP9A 1T22A 3WXVH 1U8OB 2YR3A 5TDOB 3LQAL 4UAOB 4KVNH 4BQ6A 1YMMD 1T7VA 4Y16C 1EERB 1F3DJ 1DN2A 1AH1A 2V5TA 5IEHA 1IGYA 5ISZE 3L3JA 1QRKA 1RJLA 1UM5L 3BD5A 5EIVA 4NZTH 2ADFH 3BPOC 2W38A 1ZOXA 1XCQA 4MNQA 2PN5A 4X4XA 1T83C 3UTZA 2NTSP 2KDGA 5GSVA 2X4QB 1ZMYA 2BSSB 3T2QA 4LSRL 5HI5C 2IALA 3ULSA 1UB5A 5FV1L 1Q38A 2BMKA 5J6GB 1B90A 2VLJE 4ZAKD 5L88H 2E7LA 5GJSL 1KELH 4LBEA 4Y16B 1TVBB 3LN5B 4Z7UF 3V6ZA 4B41A 5B4MC 5D96C 3SPVA 3D39D 5I1HH 3T0BA 1I85A 4BQ8A 2ED9A 4Z78B 2Z4QA 4H25B 3GMPA 3BMWA 4XCEA 4G8GB 4JN1H 5FO9A 2HTLC 3RDTC 1CLCA 4X9FA 1H15B 1U8KA 5F88B 2G60H 4R26H 2VB5A 1WWWX 5HDOA 4NO0A 2VLKD 1I9IL 4UDTB 5JHDE 4OZ4B 3U2SA 3HC3L 1WICA 2OTUA 4XVJL 4RX4A 3TM6A 4KQ4L 5KVGH 1QPXA 4TQEL 3O6ML 1V5JA 2XN9A 4KTEH 1BECA 2BSRA 3NFSH 2D7PA 2YUZA 3AREA 1P7QB 2VC2H 3H7BB 2IH1A 2B0SL 4P2CG 3HPLA 3U0PB 4QRRA 3MZGB 5JMRA 5IHZB 5IESH 2CKBA 4OAWA 2QHRL 4BJLA 3RGVA 4PLNC 4PJIB 2WINA 3MJ7B 3QUZD 4Y5XC 5LJYH 5MENE 1I8LA 3FT2A 4HWBA 1NGZB 4HMCA 1FVEB 4N8VG 4PJCB 5CJBA 5D96B 5ANME 4K3EH 5DJ2B 5DJ8A 1I7UA 1K2DA 2B1AL 3EYOA 5KW9H 3AS0A 1I9EA 3DX7B 1G7MB 4PREA 4R7NB 3WHE0 4DZ8A 4JZOA 1A14L 3VXPB 4LIQL 2C4FT 3K80A 2GUOA 5JQ6L 5EPMA 1NLBH 1QSED 1LEGA 1WV7T 4KUCD 1I3UA 1YPZA 1KIRB 2D03L 1ZANH 1SMAA 3WFBL 3UEZA 5C0BD 4CUCA 4M5ZL 3QUML 5IROC 4XGZB 2F74A 2ICWJ 1C7SA 2QHLA 1IGIL 1WZLA 1LO0L 1DJSA 5CEXB 1ZVHA 3TFKC 1UM5H 2DIAA 4J3XA 1ES0B 3RJQB 4Y4HC 5HYFA 3QNXB 3TC9A 4ZUUB 3QISA 1B0GA 2J8UB 4Y4KA 2VSDA 4TNVK 32C2B 2VZUA 1CWVA 2YN5A 1NKOA 3BE1L 2F5AL 4GQPH 1T7YA 1KG0A 4U3XA 4P99A 1EH9A 4J1UB 4KDVA 4LSRH 5EUOF 3RDTD 3RL1B 5CD5C 3EO9L 4NCC1 4NZRL 2E7CA 4J3WA 3QG6A 5E1AA 1RIVH 4OF6A 4HSQA 4CVZA 1XF2B 5EIQA 2VIRB 3P73A 4Y1AE 1SYSB 2JB6B 3HRZA 1YEEL 3HAEH 4LSSL 5D5MF 1RAMA 5DEGB 3ULVD 3MLWL 4F2MB 1JGLL 3VI4E 3A67H 4DZBA 1AI1H 2DYPD 3HE7B 3INUL 1HHHA 1NMBH 3PP3H 5I17A 4Y4HB 5DJAB 1T4KA 2DQUL 1I9IH 3IF1A 4CVXB 3EOAB 1G0DA 5EOCJ 2MQCA 1LO4L 4OF7A 1NCUA 2VDNH 4TQEH 5CSZB 4JJ5B 5I8KH 3WFZA 1CXEA 3QBTB 1I3GL 3TPKA 2WW8A 2B0SH 5DHYA 1D5IL 2P24B 5MEOA 4MJIA 5ID1B 1GIGL 4RFEB 4MCZB 4O00A 5GGVL 3KLHD 3PG2A 4N8VB 4OCXL 5D2LF 3SDCB 5BQ7A 1X5KA 4M02A 4RMVA 2VTFA 5T5NF 4BYHA 2C1PA 2PUQT 5HYQB 2YD1A 1AFVL 1UCBH 2QQKL 3MCG1 1CLYH 3GMLA 5HHMD 5BV7H 4QCIB 3VG9C 5KBNC 1A14H 3X17A 1O7SA 3TFKD 3GSWA 2R0ZL 3MRPB 2A6JA 2X41A 4QHUA 2BNRD 3U7YH 5IHUL 4ONGL 2YMXL 5FFLA 5T5NG 3TT3L 1TQCC 3IJSA 3FB8B 4NSKB 1WFUA 2AJSL 1IGIH 3GMOB 1LO0H 2GTZA 1KT2B 2HT2D 3JZ7A 2AERT 4MAUL 1IM3A 1OLZA 1U8NB 4QRPB 4S0TD 3KPSD 2LVEA 2F9BT 3WFDH 2IAMB 3NABL 3OR6B 3EAKA 4NGHH 1KC5L 5E00B 4ZSOA 2OZ4A 1YN6B 2UWEE 1R6VA 2XACC 2WSKA 3GRWH 1YDPB 3ELAT 4HGMA 1DUYA 4R8WL 4C83B 1OF2A 1EBPA 5FYJE 3GM0A 3MBEC 4G43B 4GW1B 4P5TA 3VG9B 2Y9RT 2EDNA 4L4VA 1QUNA 3MODL 3W9EB 2P5WB 5T1LB 4I48B 4K23L 1HHJB 4IDJL 2EIZB 1MCWM 1MCEA 2VITA 2IANE 4NHCL 3BKML 2EO9A 1GAFH 1TJHL 1ZEAH 1YEEH 5I1DB 5D5MA 2Q7YB 3MLWH 1D5XB 1JGLH 1O7VA 4H5SB 1J9CT 5EB9A 4TUJA 3Q6GH 3MRNB 4F9PC 4JPWH 4S1QL 4D0CA 1ORSB 2QSVA 2XWTA 3LQMA 2V2WB 1HWHB 1QBBA 3PHQB 3T04D 2AEIT 1W72A 2BNQA 4ZQKA 1MJJA 3MBEB 1S7RA 1FYTE 3QNYB 4LAQH 3WKNA 1G9EA 3QJFA 5D1ZD 1WBXB 4XNYH 2C5DC 4HLZH 1KENL 3MRHA 2YEZA 1CVRA 4M6OL 4PJ5A 2VXTL 3OX8A 4OF5A 3OXRB 5E2VL 1G7IA 3FQTB 2CD0A 1T0MB 2G75B 4XBPA 2GIYA 3U1SH 2CDEA 1CF8H 2FJGB 1TFHA 3ZYJA 3RWGA 3WEXB 1DSFH 3HZKA 3BP7B 1ZGLA 4U6YA 2FR4A 1EGJL 3TCXA 3IDIA 1A6UL 4QXTB 1DTUA 1PYWB 4R4BA 4RSVA 4V1DB 4X8JA 4TTDC 1KCKA 3FOLB 1X5AA 2ESVA 3IT8D 2EXYC 4LPYA 3LN4A 1A6WH 1OWWA 1S9XB 2NZ9D 5FYLH 2GKIA 3C2AH 1EMTH 4KGLA 5IHUH 3UJJH 4M6ML 3CFCL 3KDMB 4I3GA 3NCEB 1G0XA 3BKJL 3ZE1F 5C0EB 4NT6B 2OJEA 5EORH 5I75B 4X6CE 4KJPD 1JWMB 2DQTH 1JF1B 4MAUH 1A1MA 3ROOA 3W2DL 4NRZA 1N7ML 4XAWH 3HNVL 3V0WH 1ZT4B 4I0PC 1H5BC 3IRZA 3UX9B 3A6CL 1Z2KA 5C6PB 3U9PL 4RMTA 5IFAL 2WP3T 4P3WA 5EFIB 2SEBA 1SYVB 3VRLE 2R2BA 3L3DA 4GAYA 3LHPH 1EVTC 1WC7B 3UTOA 4JAMB 1UGNA 4OD3H 3SE3C 5IVNA 2XKNA 4G5ZL 1G9MH 5TDPA 2CPCA 2X44D 3VXOB 5MEPA 3CFIC 4LFHG 4OZFB 4PTUA 2WZPD 4QTHA 4YHKH 1FYHB 1BJ1H 4K23H 5T1DH 3CSGA 3UJTL 5FA3B 4ETQA 1YMHB 4FXKA 4KV5F 4OIBA 3G5ZB 3EYSL 3ZTJG 1QO3B 5J3HC 2VXUH 3O3DA 4IEFB 2EDYA 4PRPE 1DBAL 4I0PB 1H5BB 3OKOA 4NRXB 2O61B 3REWB 3BO8A 4S1QH 3HNSH 2BRRL 4M4RA 4JFDD 2YUWA 4YFDB 4BH8A 1PLGH 5EDXA 1A6AB 1GL4B 1IFHH 1HI6B 2P1YA 1IGFL 5DD5H 4ZXBC 3JV6A 5ITBH 5E95B 3WLWC 4HIEA 2PO6D 5EIIB 1KENH 4RRPA 5GIRA 3BDYL 4ZYKA 3VXSA 3SKNB 2A74A 3VXNA 2EXYD 4ERSL 4C59B 1FAIH 5MHSD 3JWDL 5AWNH 5E2VH 3UAJC 4EZMA 4PRDA 4QHMA 1N8ZB 2H45A 1G9NH 5B38A 1ZHBA 4HUMB 1KJVB 2XA3A 1WK0A 4XCYA 1U8PA 3S9DB 3CCHB 4PJFE 4N1HB 3KPQA 1EGJH 5FOBB 4MXWL 4DGYH 1OARL 3SKOA 2R2HA 4ELME 1EO5A 3KYNB 4O2CB 4KK5C 2EE9A 1YMME 2E3VA 1U3HC 4U3CA 1KLGB 4M6MH 1BOYA 1X5FA 4PRHB 3MRIB 3BKJH 5INCB 1BGXL 3BH9A 4NKDA 1V3LA 5I8CA 3Q2CA 4ONHA 5IQ9A 4LLUA 4WU7B 1NGQH 5FKAA 3GMQA 1HHKA 3W2DH 4U0RB 3PQYB 4LGSB 3S96B 3A6CH 1NEZA 2GY7B 4J3OC 1AGDA 2V9TA 5IR1B 3O6FC 5IW6B 1VSCA 1YEJL 4HGWB 2OP4L 4ZUSB 2GAZA 4MCYB 4R96B 4ZUTA 1JWSA 4FFZH 2X4TA 3WV0A 3CMOH 3OBAA 4CDHA 2GITB 3H9SB 3JV4A 1XF4A 2JJTC 3MXWL 3QEGL 3P9LA 1R5IA 3H9HB 5ITFB 2NY4B 4MNGB 3D39E 1MELA 3TNMB 4LCWD 5IOPB 4M1CC 1N6QL 2NPLX 4ZFFB 1MUJB 1WSST 4ZXBD 5DO2D 4JG0H 3L3GA 1NJ9A 1RI8A 3HMXH 4ZO9A 5DDHA 2OL3H 5EOQH 4Z95L 2VLKE 1WIOA 3O2DL 3N85H 3CMGA 1LK2A 3UAJD 3GMMB 4JFQB 3S5LG 3C8HA 4L9LC 5M95B 2A6IA 3QPQC 5JXEC 5IB4A 3EBAA 2Z35B 5ISZA 5EU4A 1RUMH 3MNZA 3ZT6A 4YHLH 1CGUA 3FQNA 1DFBL 4JO3L 1FNGB 5E8EB 1A4KA 1NSNH 4Z7VE 2I07B 3BDYH 3QO1A 4N9GA 5EUKB 3VXRB 4ERSH 4KK5D 1U3HD 3JWDH 1P7KA 4HUXA 4HH9A 2NY5H 5D1QD 4LKCA 4KJWD 4HK0B 4P2RD 1G7JB 1SEBB 5GS3A 3GMRB 2R29H 3NCJH 5DK2B 3FCTA 1ADQH 4KKLC 4LSPL 5FA4A 4L1DA 3SDDC 4Z7QF 3WJJC 3U4EA 2W65A 4K2UL 1QSEE 5CCKH 4MXWH 1A6ZB 4CN4A 1ZA6A 1NQBA 5C0BE 4LHUD 3D85B 4L9LB 5DEFB 2MQ0A 3IYLW 5ICXA 2JELH 1IEBA 1MJ7L 3O6FD 5IVXB 1FZJA 3MLXL 5C9JB 3DO3A 5I1EH 5ESAA 1RIHH 4HPYL 3VI4F 4EIGB 3CPLA 4PJHB 4H1LB 4BQBA 1Z3GH 2Y25A 4WI2A 3F58L 1CXIA 3HZYB 4BZ2H 2X70B 2D31B 2GTWB 4LHJB 3QDMD