5ADPH

Crystal structure of the a.17 antibody fab fragment - light chain s35r mutant
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
222
structure length
211
Chain Sequence
VQLQESGPGLVKPSETLSLTCAVSGYSISSGYYWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAGLTANWGQGTLTTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB A.17
publication title Robotic Qm/Mm-Driven Maturation of Antibody Combining Sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 211
sequence length 222
ec nomenclature
pdb deposition date 2015-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5adpH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5adpH01
1PZ5B 5DTFB 3ROLA 1KELL 1Q1JH 4OD2B 2NW3B 4ORZC 2CPCA 4PJCA 4U2ZA 1FBIL 4WI3A 5C86A 4E41B 5JOPE 3M8OH 1N6QL 5DO2D 3LKNA 1J18A 3C08H 3FQNB 4LCIL 2O5YH 3V4PH 3NPSB 5HGHA 1BF2A 2ADGA 4Q9RH 1PBYA 4X6CF 4MDJA 1YYML 2GCYA 2YD4A 1YEEH 1B2WH 4LSUL 3PGFH 1JYWA 3MLYH 3KLSA 4RAVB 4XNMA 4F7CA 25C8L 2X4OA 4EIGB 4X6EB 4P2QE 4Y16D 5C0DA 5T1KA 3QUXD 1DR9A 1NEZA 3QCUH 4PG9B 5FFLA 3OF6D 3EJZC 3WYRA 5JOEA 1WISA 1BZ9A 5CWSA 1VGKA 1UM4L 3QDGB 4WDIA 3DYPA 2ICWJ 4IMLA 4MB3A 1OP3K 2H2PC 4LLVB 4V1DE 3TA3D 4YX2H 3E1F1 1HSBA 1U3HA 1FIEA 2VDKL 3MC0A 1LEGB 4M1GL 2FO4B 1IZJA 2D7OA 3GMOB 5HHVL 3WHXA 1MFCH 4YFEA 3H9ZA 5C0RL 1AP2B 4JO2H 2HLFC 2R2HB 4I9WE 1LD9A 2Q76A 4QTIH 5C3TA 5TE6H 4N0UB 1JV5B 1R5WA 3H9SB 1AE6L 2BNQB 4FQXC 2Q8AL 2YD8A 2R9HD 2HTLC 5IQ9B 2YMXL 2ORBH 1E6JH 2A83B 1MRFL 2NR6D 5T33H 3SCMA 2AXJA 4HQQH 3HE7B 1CGTA 1DVFC 1S7WB 1T89C 5D2NE 1RFDH 2FCBA 3KYMB 3BDBA 2WBWB 4N5UA 4Y5XA 3U2SA 1RSFA 4YHOL 1A02N 6CGTA 4C57C 3UJIH 3U7YH 4GRWE 2BNRB 5IVOA 4O2CA 5D2LE 3RVXD 1RV6X 4ZTPL 4JAMA 5CAYB 5K9KB 3ARGB 5KZCD 2CIKA 1WCQA 1NGYA 5F93C 1M7DB 5KVFL 3WKNA 4PRAB 4OI9A 3B2VL 4YHKL 3GO1L 4P3CH 4GRLD 4MHHG 1Q1JL 1F11B 4LEOB 4DVRL 1QBMH 1LNUB 5JO5A 3MO1B 3O45B 3FB8B 5DVMA 5IVZA 3RKDD 3RVUD 2NY3B 2HFEB 1BJ1H 2J8HA 3R0NA 3QPXL 2XTJB 4OZGA 4GQ9H 2O26U 1MCNA 1QBBA 5HHMD 1IGIL 1U8LA 1W0WB 4HWBH 5DEGA 4L29B 4N0FA 3DGGA 5F9OL 4HXBH 1RIHH 4UV4H 5LGHL 1UJ3B 3PGFL 4WHYH 1AJ7L 1A6TB 3I3EA 1FC1A 4NYLB 5CSGA 3DSFH 3BVNA 5AYUH 3TJHC 1ZWIA 3RVWD 4ZFOB 5I1JH 4F7EA 4Z77A 1YYLH 1DN2A 4N8VB 3TYFA 4RIRB 1E28A 4W4OC 1ETZA 4EQ2A 4ZSOA 2ZOKA 4JHBA 2JIXB 4L3CB 2R2CA 4X5XA 5JQHC 2Z9TA 1IM9D 3PP3K 5AG9A 4JQIL 4Y4HB 5ITFA 1G7HB 5AD0A 1YUHB 3ZKXC 4UB0L 1ZLVH 2GFBA 4BFGA 1DQJB 1UXSA 1CFTA 3MCKA 4KRLB 1MQKH 2R2BB 4LHUB 4Y8DC 1ULVA 4J8RA 2HT3C 4QRUB 3P9LA 5F9JB 5IB3B 2UZIH 1HOCA 2H1PH 1KYOK 2ZSVA 2R23B 2UY7A 2BSSA 2ORBL 2CDFA 3MGOB 1VHPA 2VDRH 4HQQL 3NVQA 3CNKA 5FUCC 1U8PA 4EUPB 1OCWL 1I1AC 1I9JL 4F7MA 1MCIA 5F1KC 4J3UA 3UTQB 5JA8B 5H94A 2IALA 4ZPVB 4P57A 5KVDL 3IU3B 2P5ED 4YHMH 4PTTB 5KSBE 5FUOH 3GI9H 3IJHA 3DARA 4MX7B 2CLRB 1MCSA 5GRWA 3SHSA 1F45A 1ROWA 1W2KT 3TIEA 4JFXA 4KQ4H 4PGZA 4H8WL 3RQ3A 4Y5VC 4FS0A 1X5IA 3VD7A 4XHQA 3SQBA 4LF3A 5D7LB 1NLDH 5IK3A 2BVYA 1E4XH 1X5ZA 3LDBC 4P3DB 4Z7UB 1DFBL 3I75B 4UNUA 3GMMB 4OLVH 2HFFA 3QEUB 4X6FA 5I8EB 5MEOA 2V6HA 1WZ1L 4OFDA 1R3HA 1A22B 3OR6B 4NWTL 3UTPD 4KMLB 1QR4A 4AG4L 2ARWA 5IROA 1QNZH 4Z78A 3OWEA 3UPRB 3GHEH 3K1KC 2GTWB 3BKCH 2YZ1A 1FZMA 3LVEA 4BQ6A 3AY4C 2PW1A 4P59H 3S4SG 4D0BA 3P4MB 3QEHA 4WVRA 3MRFA 4JN1H 1QRNA 2BRRL 5I1JL 4XZUA 4J3SA 5HHNA 1QSED 1YYLL 4LRIA 2XZAL 4X4ME 2WWMC 1DLFH 1BFVH 4MD4A 3D0VB 4ZQKA 2YPVH 2XI9A 2AQ2A 3FMGL 1JGLL 3OKLA 4GMTL 2C5DC 4YDVA 3T4AB 3IFOA 3U1SL 3WFHA 5HGAB 4Z7WB 1TQBB 1A5FH 5KSAD 4GO6B 3ARFD 2VC2H 5HVFB 5E9DD 3WLWC 3G08A 4LSSH 4DFIA 2E7MA 1LP9A 4FXKA 4P2OC 4FQLH 4HUKB 1IJ9A 1QYGH 3CLFL 5CGYC 4G6KH 5SWSB 4L4TE 4PRPB 3NGBC 2AEQH 5D1QB 2X1OA 1P69B 4Y0GA 2H32H 2Y5EA 3RIFF 4Z7OF 3K4AA 3QEQD 2QQNH 2D31A 3OJMB 1AFVH 1WBXB 5TE7H 1B9ZA 4Z5RB 2Q6WA 1M71B 2AKRA 1YEHH 2YPLE 2C7UA 2PO6B 3V8OA 4DZ8B 5DURD 1XGUA 3WXWL 3MV7A 1JVKA 4MA8L 1A9BA 4KXZI 4RBPH 4WHTB 5DUMH 4YHML 4WFHE 4YZFF 3WO3B 1UG9A 4NBZB 1ORSA 1OPGH 3D18A 3QO1B 2OM5A 1I7ZB 1UB6A 4DFHA 2R1YA 1N5AB 4M1DL 3WEXB 4U3CA 2XNAB 5L8LB 2JELH 1MFBL 5ACZB 1UXWB 1G6RH 2Q1EA 3NFSH 2VLKD 1XF2B 1S7SB 4WI2A 1U41A 1AD0A 1LHZA 1BJ1J 4L3AA 1SBBA 1MJ7H 2HWZL 1WTLA 4UQ2A 3LEYL 3QG7H 3BJ91 4XVJL 5I1CH 4JRYA 3RDTD 2NTFB 1FL5A 3GEWB 4YR6B 5ISZD 5H35A 1O7SA 2R4RL 3QAZB 5K9OA 1TZHB 5D7IF 3KXFD 1UWGL 3QIBC 4CDGC 4YBQD 1AGFB 4M62L 5IKCA 1S8DB 3MXVL 1BM3L 4JDZB 2Q3ZA 4P9MH 5HD8C 4BQCA 4LNVA 1XCQB 1SYSB 3DHJA 1G0XA 3U0PB 3MSPA 3GM8A 2WQ8A 3PP4H 3U36A 1S7QA 2CDEA 5D5MA 4YXKH 1J05A 1RMFL 1BF8A 4YPJA 1IQWH 3P40A 4Q74A 1IC1A 4OIIH 2VL5A 5K9JL 3WFBH 3RWGA 5F6HJ 3RA7L 3CU7A 3LKQB 5DUPH 2XQYK 1MI5B 4CU6A 4G8GD 2Y1VA 4H20L 4IIQB 3NCFB 3QQNA 3F7VA 5D8JL 2DKMA 1ZLUK 4LSSL 2Z31C 3HNSH 1J1PH 2ZSWB 5AYQA 2Z92B 9CGTA 1KGCE 1EA9C 4HDIB 5BS0D 2AEQL 1CL7H 2QQKH 1HYSC 5IBLD 3HRZB 5LBSL 4QRPE 4M7ZC 3HC4L 4LLUA 1FYTD 4DQOL 1RZ7H 4JY6A 1ONQB 4D3CL 3DROA 2H41A 3SOBL 5D71H 5ALBL 1KIRB 3AREC 4Q6IA 4IHOA 4AMKH 3IJSB 3L95B 4HWNA 3C9NB 4OQ1A 3JTSA 2ICES 4HK0A 4ZUUB 4L4VB 1JTTA 2HVJB 5B4MC 4NWUH 2LVCA 3GZKA 4WU5A 5HYQA 2A6KA 2VE6B 4XPBL 2CKBB 1Z9LA 1Q9LA 2D0GA 4MA7H 4KVCH 3RX8A 3SDCD 3VI4E 4FQCH 5DZOA 1JF1A 1FV1B 2VZVA 3ARRA 3BP7B 3BSZH 5C0BA 2EIZA 4ESKA 3J8F7 3MFFA 5EO0B 4FQ1H 1FLTX 2FATH 3ES6B 4JPIA 4K7FB 4MSWA 3TT1H 1I4FB 1RUPH 4AIZA 2AJ3A 3HMXA 4I3RL 4I0PB 2XOTA 4H1LB 4YLQT 3UZQA 1OAQH 3OKMB 4B41A 1SM3L 5IESL 2G9HA 3WLWD 1NGPL 4E42A 5DK2B 5KOMC 1CGVA 3DUUA 3EDKA 3IFLL 3QFJB 3T09A 1QA9B 3VFNA 3ZYZA 4L9LC 2E5EA 3DXAA 3P77B 3GSVA 1DQQB 2ICWB 4P4RA 2EYTB 1REIA 4IRZH 2KH2B 3O2WH 3UJTL 2XACC 4YBHA 1IGYB 1QKZH 1VESA 4P46D 3QIWD 2E6PA 3LMJH 3JTTA 3AS1A 4OF6A 1ZTXH 4P9ML 3DOSA 3NCYS 1JNLL 4H5SB 2JKXA 1HEZB 5EBWA 1MIMH 1LK3L 1C1EL 1T1WB 5T5FL 1UZ8A 1P4BL 2VABA 5FEBA 3GSQA 1XF3B 4U6YA 4FA8A 2OCFD 2DIBA 2HMIC 4P23D 1U8IB 5DUPL 1T1YB 4X9GA 3P4LA 1HNGA 5JNYA 1H0DA 4YDKH 3MLVL 5ITBL 2CUMA 3DVGA 4PG2A 1NCUA 2NXYC 5F7YC 4R7DA 1ZE3C 1EHAA 2X40A 3QUYB 2EYSA 2KQMA 3UTSE 5B38G 4M43H 5ESQA 4NQCA 3QNZA 5DI8A 1H5BA 4MAYC 4ZUTA 5T1LB 1Z0MA 1EPFA 4C56D 3BGFB 4R97C 3S96B 1MWAA 5GGRA 5C09D 2R56L 3T77A 3PWUA 4KDWA 1JGEA 1BECA 2MFNA 4K8RD 4UOW1 3O3BB 1JNNH 3OR7A 5D71L 2NY0C 2NY6C 5J3HD 1UA6L 2OL3A 2AJSL 1NBYA 5KANG 4HBQA 3MRGA 4DN4H 3QDJE 5I66B 3BO8A 2F74B 4X9BA 4P9HL 4JCLA 3VG0H 4Y19B 4JGJA 3EYOB 5MERB 4HKBA 3MV8E 4I3SH 1T66C 3QG6A 5F6HI 5BVJA 2Y07H 4UT7H 3Q6GL 1IEAB 2MWCA 2OMBA 4ZFFA 4HWEL 5F7LB 3BSZL 3HZYA 3SDYL 4HZLA 1EHLH 3V5HB 1N2RB 1NC2D 4BM7A 4JPWH 5D6CA 4MXWL 3KJ6L 3QIUA 4OFYD 4NNPH 3VI3E 4Y4KC 4OUUA 2EDEA 5DRWB 1XH3A 2EH8H 2V9QA 1HXMA 2BMKA 5FYJD 1INDL 2XZQL 3TO2A 4JZOA 2X7LB 2D03H 3BQUB 3QRGH 4HLZG 4PP1C 3GM0A 3FB6A 2VDPL 4LCWD 5MENE 1IL1B 4CJ1A 4ZMAT 5CINH 2P48B 3CX5J 3MLRH 4PBXA 3GGWB 2B1AH 3QNYA 1YEJL 4K8RL 1ZHBA 4Y4FC 5I19H 5I1EL 3W11D 4J2XA 4MLSA 3SCMD 3QQ9C 4LCUA 3Q6FA 4L4JA 3O3AA 3RAJL 1ES0A 3SO3B 5I8CB 1VSCA 4WW2F 3KYOB 5B39A 4X99A 3U82B 4M9OA 3ZDZF 3QEGH 1JZ7A 2JCCA 5FDWB 5FKPB 5INCB 4I2XA 4WU7B 1Z5LB 4AYFA 4GKNB 3TNMB 3QUML 1DE4B 5EDXA 2DI9A 1R5IA 4PJAF 3B3IB 2AJYH 1E4XI 2BJML 3KPMA 4NQXA 3MPCA 2ENYA 5AUMB 5E4EB 4Y5YB 3U46A 4K3DH 2D9CA 4Y16B 3TZVB 7FABH 2WUCH 5TGBB 4YDKL 5FYJL 1MVFA 1QUNA 3EDDA 3G9AB 1RZJH 5I74B 2X09A 4PJIB 4F3FB 1KENL 4F7TB 5T1MA 1T04A 2XA8H 1Q94B 3R8QA 1NDGA 2Z91A 2IAMB 2FIKB 1BFOB 4YQXH 1IAIL 3EIFA 3CH1A 2EEBA 4O2EA 4ZAKA 4XVUD 5F89A 4PRIA 1A6WH 4UUJB 4ZUWA 2V5TA 2W60B 4N8CH 1JNNL 4GW1A 3S35L 1AO7E 1EEZA 4K94C 2CR3A 1HINL 4WWKC 5EUOA 5F7FA 1HHGB 4FTVE 5LG1A 4Z7NE 4MJ5A 1H3GA 3Q5TA 2OSLB 2YPKB 3H3KA 5F9DC 1BGXL 5IFAH 5EOCH 5ETUA 3T1FB 5SX4H 2AJVL 3O2DA 2QSTA 2EDYA 1QACA 4S1DC 5FA4A 5A2JH 3DETD 3KWWA 4FQHB 4JFFA 2J8UF 1BQHA 2GY7B 2VAJA 5BZDA 2JB5H 3RI5K 2C4XA 4YEEA 2EH7H 3L3GA 3N1FC 1HHIA 2DMKA 1FNSH 1U8KA 2V2XA 3GSWB 2VLMD 15C8H 3EFFA 3QHFL 4NNPL 3ARZA 2AJZB 4X5WA 5T3XD 2IQAA 1RUQH 4QT5B 3UXFA 5FB8A 1UH2A 4OCNC 3QRGL 4OKVA 2D4DA 2DQEL 4U1MB 3X14B 3IDJA 1PYWB 2GJ6A 3F5WA 1A7OH 5FO9A 4PRHE 3STBA 4OGAC 1U95A 4K23H 4I5BA 4MD0A 2V5RA 4PGJA 4XCNB 4GKZB 4XPHH 4IJ3B 1MAKA 3QYCA 3AS3A 5E00A 3O6FB 4DCQB 3L3JB 4TRPH 4PJXB 3HZMB 3W0WE 5B8CC 3WLBB 5M94B 2J3SA 2Q3AA 3RIAK 3WIFB 4MXVE 4YXHH 1OSZA 4LQFL 4KPHH 1D6VH 1L7IH 2DWEA 4S0TD 1YPZB 1XEDA 1ZS8A 5HHMB 5HXMA 2I27N 3SDDC 2DD8L 1FL6B 2ED9A 1MFEH 1U2CA 1DVFA 1UVQB 2G2RB 5E8DH 1NLBL 5HHOD 2AJYL 3TT3L 1T89A 2BY1A 3X12B 2C4FT 2YC1B 2P5WA 3HNTL 2VAAA 4IRSB 4N0YH 3TPUB 3NIFE 4OBSA 4J4PA 4UOW0 3ARWA 3HPJA 5T3XL 3B9AA 2NX5A 5IQ7L 3NIDE 4LSRL 4FQIH 4P2RD 2EXWC 4XC3H 1G9MH 4RRPG 4PJHB 2BXYA 4OCRL 1A1NB 3MRHB 2D2OA 5KTEH 1MCOL 2BERA 3UDWC 2X70B 3QQ3A 2PUQT 4L8BA 4NQUA 1BQUA 1OSPH 1T22B 3PABB 4GAJL 5HPMB 1D9KC 3T0ED 1KNOB 4P0DA 2UWEB 4Q0XL 3ZKND 3O4OC 3IDUA 4G80A 5IT2H 3QNXA 3C5ZB 1FGVL 3U9UA 3P30H 5I71B 2DLFH 2RFXA 5E94B 1JF5A 2VXTH 3AXLA 1G7JA 3STLA 3QFDB 3FRPA 5DD6B 5KS9F 3E2HC 4YFLI 5IBTL 1PKQB 1PZUB 1X44A 3LQAC 3RGVD 2JB5L 1N59A 4JFEA 2X42A 3KPPB 3VXME 1X5GA 4JFDD 4IDJH 2VLJB 3L3IA 5IB1B 15C8L 1JNJA 3WUWB 2YA2A 5I1DB 1CL7I 4NJ9H 4FFVC 1NGZA 2HA1A 1FP5A 4W4OA 3MBEB 4P5MB 1RUQL 3L6FB 1FNGA 2R0KH 4KAQH 2X1WL 2FEEI 1AY1L 4LCYB 1UGNA 32C2B 3OV6A 5HHXL 4TUKH 3NACL 3BKJH 5GSRA 4AQOA 4M3JA 3UZVB 35C8H 1KTLA 1N3NA 2CK0L 1U58B 5JORA 2PKDA 2DIAA 4WUUE 3GJEB 4XMKL 4EEEA 3BN9C 3MLZL 3BW9B 3MRCA 3PNWA 4TRPL 3TH4T 2IG2H 2R4SL 1F4AA 1NC4D 1ZT7A 3C09C 4E41E 3UTTA 1XGQA 1BOYA 1H3PH 2OR8A 4GT7A 3SQOL 4KPHL 5IFHH 1UADC 1SVCP 1ZEAH 3GJFK 1L7IL 3VFUA 3BPCB 2J6EA 1ACZA 5ECJE 3CDFA 5C0CE 3DMMA 4G5ZL 3V0WH 2I24N 1T3FB 2NY1D 1XT5A 4IOFC 3LHPL 4D9QE 1MH5A 3BKMH 4LARH 2HT4C 4QRSA 3G6DH 1Z6JT 1VKXB 3SKOB 2DQTL 3EOTL 4NCDA 1Q0XH 5DJCB 3X13A 2VNCA 3B2UD 3RU8L 5L2JB 5DHVA 1ZA6A 1P7QD 5HYJA 5DR5L 1QLRA 5EIVA 3HS0A 3GHBH 2Y36H 3VWKB 5GS1C 5C08A 4G6AD 5FK9B 12E8H 1WAAF 5AZ2L 5FOBB 4R4FH 4NN5B 4OLUH 5KOVC 4JO3L 1C5DA 1G9ML 4JRXD 1EGJH 3BZEA 5IV2A 3LS5H 5CUSH 4LSQH 4XWOD 4Y5VA 3ARFB 2A6IB 3K8LA 1NJ9A 4MLIA 4OZHE 2E8ZA 5JMOC 3SKNB 2EDOA 2FNBA 3OXSB 5EOCJ 5I6XC 4PGCA 5IBUG 3A0OA 3U0TB 3VG9C 3QDME 1JNHB 3ULUC 3T2OA 4EZMA 1RPQA 3RUGB 5JOFA 1NFDB 4I13B 4D0DA 3IDNA 4Z7VF 4YHIA 1FZOB 1WZKA 3PG2A 3QEQB 5F1NB 4GMSH 4L8SB 2J7LA 5DSCA 4KKLC 3AY4A 3CFJA 3E6HA 4HX1B 3TBTB 4NQSB 1J10A 4JQXC 3JWOL 1FFNA 1T7ZA 3HI6H 1KC5H 4JZJC 5IW6A 3EYFA 1P4IH 2EIDA 1RQ5A 1IGMH 3Q0HA 2EE6A 5F6IB 1RUAL 4N1EA 2BNRE 3P4OB 5FDYA 4JHWL 2ZP0T 4XP6L 5SV4A 4QRRA 1CZ8H 4QNPF 4HPOH 5ENWB 2PTUA 5DJYB 2Q7YA 3WS6A 2ADIB 4FQ2H 4M7JH 2C9AA 4PTUA 1T6WA 3BKJL 1TLKA 3VFMA 2KUTA 4M7KL 4MD5B 1CLZL 4QGTA 3ARBD 2R0LH 4NDMB 5EC1A 1AHWC 4RWYL 1FORL 5BZWA 3L1OL 2UZYB 1FFPA 2VLKB 1RJZA 4Q97A 2FWOB 4P2OA 2YRZA 3EBAA 3BIKB 3FO0H 3MOAH 4MB5A 3MRNA 5GGUB 1VEMA 1TXKA 5TDNB 4CRPA 1CE6B 4GAYA 2H32B 3UJJL 4JKKA 3KXFB 3UYPA 2NY5C 3Q48A 4QF1A 4LARL 2F58L 5DMKA 1IZKA 1JZ8A 5DJDA 5J1AA 3KAAA 4OM1L 4OZIB 3MV9A 4LVEA 4ELMF 1RUKH 1KJ3H 2DQIH 4HMEA 4LCCB 3HB3C 2VXUL 5DDHB 3RX5A 3J7HA 2DQUH 2I5YH 4P4KD 1B90A 2PCPA 1A3LH 2EDLA 4HD9A 3PQYD 5HYSB 3EYQC 4GKSB 5EO1B 2BVQB 2NY7H 1ZLSH 3QHTC 3PUCA 4D8PB 2F53A 4X6DE 5CUSL 4P99A 1NFIB 3DXAD 4JGMA 4KKCC 1S9XB 3NIGE 4QHMB 4WI9A 4AEFA 1JTPA 3O6LL 4R96B 3RI5F 4CMHB 1BVKA 1MJUL 4JDVB 4QY8B 4K9EH 2YXMA 4NZUL 1G6RB 5F7EL 3T2NH 2OL3H 2P43B 2NYYC 4ONFL 5TF0A 1HIMH 1ZSDB 2DM7A 4ODWA 5E2TH 1RJCA 3HZVA 1MHHA 4JFOB 5BS0B 5D2NC 1WIOA 1S7VB 5LCVH 4QKXB 1H8NA 3ZT7A 4M3KB 2DM4A 2P4AB 4HS3B 1NGXA 2M8XA 5HI5C 1M7IB 2AVGA 3TO4D 1VACA 2NLJB 2AK4D 1FNFA 1HQ4B 1JRHH 3L9RA 4W6YB 4XMLL 5E5UB 4LPXA 2A1WH 5EU5A 1L9MA 4Y1AA 3HMXL 1TPXC 2YWYA 1FIGH 1J0HA 2AGJL 5FCUH 3MJ9L 1ZANH 3HHRB 4OCYH 3VFOB 1OP3H 3S6CA 4N0CC 3SDCB 1MHEB 5ICZA 3VXSA 4G3YL 2W9DL 5DRXA 4IOIB 4M7JL 4H1LG 4HUXB 4JR9L 2B4CH 4TNWK 1CXLA 4M7LH 2PXYC 2YEZB 1HWHB 4KHXH 2YUXA 5I8OH 2WZPD 2F8XC 3L3KA 4PJDA 5SX4I 5D7LE 2F5BL 4C83A 4QEGA 2Z31A 4KRMB 4ODXB 5BVPH 5E1AA 1IT9L 3A6BH 3B5GA 4KROB 4H0IA 4ZPTA 2FGWH 3U7WH 2OTWA 2DTSA 4QHNB 1RHHA 4KRPD 3NA9L 2CMRL 3MREB 3E6FA 2A9NH 2OP4L 4YO0B 1B6UA 5SWZA 4OLZH 5JLZA 2X1XR 2J5LC 3UBXI 4L1DA 5KN5A 3S4SA 1WJ3A 1NCAL 4HK3J 1HKLL 1OB1A 3ZDYF 3KJ4B 2DQIL 4NBXB 4PBVC 1BFTA 3QIUD 4HS6B 3ZKMC 2BZDA 4KJYB 4WO4C 4OT1H 1A3LL 2BSTA 4HWZB 1V8HA 2EDTA 1P9MC 3INUH 3I85A 4KKBC 1I8MB 4KK9C 4U1GB 3RTQD 1JHTB 3SJVA 3UEZA 4FQPA 3QUZA 3V4UL 5I2IB 4P23B 4G6JH 1MWAL 1BQSA 2EDKA 1U8HB 1HXYB 1UM5L 3AU1A 5GGVY 4J12A 4LKXB 4I0CC 2I60H 1HIML 2ZZUT 3B5HA 3ROLB 3MXWH 4ENEC 3FHQA 4PJCB 3ZKQD 4Z76A 3TESA 4PREA 5E2TL 2OJEA 2VXVH 3HUJA 3DO7A 3ARDA 3LKNB 3O4LD 3WIHL 1ZT4A 5J11C 5HGHB 4Q7DA 4KZEH 4NQDD 2ADGB 4MDJB 3K2UL 2GCYB 2WIIA 3ZSSA 1QBLL 1I9IL 1TJGL 4LSTH 4M1CC 1P2CA 4XNMB 4F7CB 1NCCL 2A6DA 4TVSa 5IIEA 2X4OB 3MJGX 5FGRA 5CEYA 2K3TA 4GG6A 2Q8BH 5T1KB 1AXTH 2DQFA 1QFWL 1NEZB 2X2YA 1RU9L 3BKYH 4EI5C 4G43A 5EZIL 4NQEE 2PYEE 4HGKC 5CWSB 1VGKB 1KPVA 3PP3H 1CLCA 4J3WA 4WDIB 5F96L 4MA1C 4IMLB 3DI3B 4RMSA 2XT1B 1IAIM 1JIBA 4QXTA 1QO3A 1I3RA 2GJJA 4ZAKD 4HCRA 1S78D 1HSBB 1U3HB 3SE3C 2WMPA 3X3GH 1JE6A 3WHXB 1FNLA 3FZUC 5IMKB 3MODH 3A6BL 1LD9B 2Q76B 1GGBL 1OGAA 2YWZA 1R5WB 2OI9C 4UTAH 3KPSA 1NCBH 2ADJA 5F8RC 2YD6A 1CFVH 2QADB 5C7XH 3T3PF 2XXMB 1I1RA 3FFCA 4OV5A 2OBGA 3SCMB 5FHAH 5HDBE 3MCG1 4LLYA 5FGBC 1VA9A 3O6MH 5E56A 3O9WA 5HI5D 4C4KO 1KCRL 3WE6A 1DN0A 3A6CL 3CMGA 3H9YA 4Y5XB 1G9EA 2X5PA 3U2SB 4F80A 3LN5A 1U6AL 1BBDH 3LS4H 4JFPA 1MF2H 4M5ZL 3C8KA 2QJDA 3PL6A 4O2CB 1JHKH 1WZMA 5E2WL 1Z9MA 3DVNA 4ODUA 4JAMB 1WFTA 3QBTB 1JGDA 4BQBA 4PUBH 2CIKB 3MA9H 5CJQH 4YHZL 4ZNCD 5FA3A 3RWEA 3BJLA 4PJGA 1NGYB 4G7YL 3LAFA 5I17A 3P0VH 1OAZL 1MNUL 3FO1A 3KLHD 3P0YL 3OKKA 1T2JA 3S98A 5ADOH 4OF5A 2ZCKL 4PLKD 1LDPH 2D4FA 5JO5B 1AKJD 2ZUXA 1SYVA 5IVZB 1UCTA 3TIDA 3D1MC 3O2DL 1AR1D 1G9NH 2RHEA 4OZGB 1KB5L 4Y4FA 4MMXC 1X6LA 1U8LB 5DEGB 2HH0L 5JQ6H 4N0FB 4A6YL 5GJTH 1EFXD 2BNUA 1TZIA 2ZWLT 5IJVA 3FT2A 4L4VE 5DC9B 1RZIA 3HE6C 3LEVH 5E6IB 4J4PD 3BVNB 1ZLWK 1FRGH 5D6DA 1ZWIB 5CGMA 1S9WA 5BRZA 4Z77B 3TYFB 1E28B 1NSNH 4OD3L 1ETZB 1UWEH 4NP4L 4ZSOB 4P5TD 5FYLD 2ZOKB 3MA7A 3BRFA 4NBYB 5TQ2L 4X5XB 3SE9L 2WBJC 5GS3A 2VDNL 3U30B 2ZNXA 3CVIL 3D39E 1A3RL 4F37K 1BHGA 4JB9H 5ITFB 5AD0B 2OTUA 1Q38A 4J6RH 3JZ7A 4L5FH 1EAPA 2GFBB 4JFHE 1CFQA 1UXSB 1CFTB 2C3HA 3MCKB 2XFXA 2EDQA 3WFEH 4J8RB 5FIEA 2MPAL 3VXTA 4U3XA 2OJZL 3P9LB 3RY4A 4UTAL 5KW9L 1G7MA 4EXPX 1HOCB 1DQLL 2ZSVB 1Y18A 4R0LC 1OW0A 2BSSB 3VMOA 2CDFB 2DBLH 2IBZY 3CPLA 4ODTH 2IPUG 5GZOC 1F58H 3DX7B 2ESVA 1U8PB 5DHVH 4Z0BL 1FH5H 4UDTA 5CJOH 4F7MB 3UTOA 1W8NA 1QZ1A 2IPKA 1KIQB 1MF2L 1QG3A 5H94B 3TEUA 2IALB 5IUSA 3GI8H 4KMTL 4FFWD 4P57B 5FUZL 1LE9A 5FYLL 1EAJA 3R8BB 4YDIH 3IJHB 1DZBA 1CLYH 3QI9C 2WIMA 2DQGL 5HI3D 2XN9D 5D70H 3ZL4H 4OSUL 5JR1H 3TIEB 4JFXB 5EBLB 3SDXA 3W39A 5MI0B 3CXHJ 3P0VL 2Y25A 3GBLA 3HNVH 1NCNA 1UCBH 4XC1H 5JDSA 4P3WA 1C5BH 1FCGA 5GRVK 1X3DA 4LF3B 4H26A 4OFIA 5IK3B 4NKQB 5J06A 2HFFB 4X6FB 5B38A 5MEOB 3T08A 1R3HB 4FG6D 3UTTD 4MCYA 2VISA 1NMBL 1EHXA 2ZUUA 5EZLA 5SWQA 4Z78B 2DKUA 3DMMD 4TNWF 1FZMB 3G6JF 3U83A 3M1BA 1D6EB 3P9WB 2PW1B 3DBXA 1ZVYA 4FZ8L 4D0BB 3QEHB 2WANA 3MRFB 3LEVL 1JK8A 4WI6A 1GAFL 3QCVL 4CU7A 1CGXA 1U42A 3SGJC 1F4XH 1QRNB 3G5XA 3SKJL 4PJ7A 4LIQL 1CICD 1I1YA 1X4XA 3MLXL 4IBLT 4XZUB 4R7NA 1X7QB 3VGBA 3VWJC 3QUKA 1CG9A 3SDDA 1LO2L 4MD4B 4U1NA 3FL7A 3CLEH 4ZQKB 3QRFM 4KDTC 4Q2ZA 4JFQA 2WV3A 5CCKL 1G1YA 5AG8A 2CDGA 3DTXA 4PGDA 3OKLB 2P8PA 3M45A 4YDVB 3SDAC 2APWA 1JYVA 3BAEH 3IFOB 1JL8A 4PD4K 3WFHB 4XVTH 1P84K 3K8KA 1LGVA 2X9YA 3K7UA 3DYOA 3MYJA 1BD2E 1JPTL 1YNLH 1KYOJ 2C1PA 2MCG1 1B3JA 1KJVA 1YEFL 3G08B 2O5ZL 1AD9A 1LP9B 4FXKB 3SBWC 5IVXA 1MEXL 1CGSH 3QHZH 1MSPA 4I1NB 5L0QC 3UTZA 4X8JA 5L2KD 3Q1SL 1JRHI 2N7BA 3UPAA 1T5WA 3ZYIA 2J6EL 4OD2A 3UDWA 3HG1E 4FP8L 1EJ6A 4DGYL 1INEL 2D31B 2P42B 2Z4QA 4G7VH 2Q6WB 4LMQE 1F58L 3CSYA 2AKRB 1D9KA 3TVMA 4POYA 2JJUA 2V9RA 2VR5A 3FT3A 3P3YA 2C7UB 3U4BH 1DBBL 4TPRH 3VGHA 5IB5A 1WIUA 1XGUB 2NY2B 3MOBH 1IGTA 3MV7B 2AXHA 2X4SA 1A9BB 4JM2C 1FSKB 4YDIL 1G84A 1QSZA 1ORSB 1KIPA 2DLTA 5IM7A 3D18B 4UTBH 4I77H 1FE8H 3H2WA 1UB6B 5SV3A 5DMGC 2IANA 1T7WA 3F7YA 1KOAA 3HI5L 2R1YB 3RJQB 3EO0A 2AP2A 1UCBL 1G6VK 1J5OH 4HH9A 1KTKE 1U8JA 1MJJA 1Y6KR 2AJXL 3CDYA 4LRNH 1EJOH 4FZEH 4Z7OE 3RWHA 3TBVA 4XHJD 4DTGH 1IRAY 3D3VD 1AD0B 2FO4A 1OOAA 4MAUL 4PP2A 3VE0A 5KVEH 4WFED 3T8XA 4UQ2B 4JRYB 4XI5D 1FL5B 4YFDB 5I8KH 3EYUL 1YEGH 5H35B 5HDQH 2R2HA 3N85H 5F70A 4Z0XA 5D7JC 4BELD 5GISL 5K9OB 4N0UA 1JV5A 1I3VA 3DRQB 1CTOA 1OAKL 2R0WH 2BNQA 2ZG2A 1OTUD 4XH2A 5IQ9A 5IKCB 4KU1A 1OD7A 4WY7L 4PB0L 3DX6A 4B7IA 2DM3A 1JFQL 1X6NA 4KY1L 3AM8C 3U36B 3CLEL 1S7QB 2CDEB 5D5MB 3O2VH 1J05B 5DFWH 1T21A 4NM4L 3GIZH 2VL5B 4R6UA 1TETH 4UDUA 4N9GA 3RWGB 4XVTL 2F53D 4HIJA 5GS1A 4FNLH 3F7VB 4ONHA 1YNLL 1UYWL 1F42A 1V3MA 2VO5A 2MQCA 5D7IE 2IH3A 1H9VA 1CBVL 4IRJD 2QSVA 4JM4H 1LNUA 2F54A 4BH7B 1TDQA 2E8YA 3CX2A 4LLUB 3QQ4A 4MMZC 5CKAA 4JY6B 5JHDA 4ODVL 3DROB 4PJXE 1S9VB 1IGFH 4IHOB 3CXDL 5J13B 3JTSB 4HK0B 5DVLA 4TPRL 1OM3H 4DKFH 5BV7C 4Y1AD 5HHME 3MOBL 4NO3A 1CDYA 4WU5B 3VGAB 5HYQB 2D7PA 2A6KB 5GRUH 5EOQL 3O8XD 1BREA 1Q9LB 3FB7A 4L9DA 4RGOH 2XWTA 4XNYH 4OLWH 2B1HL 4JQXA 5BOPA 1JF1B 5IG7A 1X4ZA 5C0BB 1R3LA 2EIZB 3JVGC 3MFFB 1X5AA 3D85A 4JPIB 4MSWB 4U31A 3WNLA 1L0YA 5GJSH 4KK8D 5FV2A 4AIZB 2VYRE 2AJ3B 3EO9H 4APQD 3BPLB 3TWCH 3ZSTA 3QXAA 1D5BB 2G9HB 4M93B 5T3ZH 2FBJL 4N1CA 4E42B 3AB0C 4V2BA 3DUUB 2E9WA 3VFWA 5EU6D 3VFNB 4XXCC 3DXAB 5I8KL 2DJSA 2Y7QA 3GSVB 3OAZK 4P4RB 1AHWA 4ZXBD 5E2VL 1KTRL 2FIRT 3B9VA 4JY5H 2FZ3A 4BQ8A 2CJUH 1AI1L 3JTTB 5ESAA 5HYEA 2AS5M 4LVHB 1Q0YL 3OAUL 4U7KA 5EBWB 2DQHL 4LLMB 2YSSA 3C5SA 4P2QA 3H42L 5BMFH 3ISWA 4MNQD 5CILL 1UZ8B 2KDGA 2VABB 1WFOA 1GVIA 3GSQB 4U6YB 1OQOA 5DJ0A 3L5JA 3E3QE 4HT1H 3QUZD 5LKNA 1X5YA 2FSEA 4PJEF 1DBJH 4HCRH 2IADA 4NFBA 4TOYH 3ZHLA 1RULL 5JNYB 1CDBA 4YHYB 2P5EE 1AQKL 1SQ2N 5FHBL 1CD8A 3DVGB 4HFWA 4R7DB 1V7MH 2EYSB 1IC4L 5ESQB 4NQCB 1DTUA 1H5BB 4GW5A 5DI8B 5KSUA 4ZUTB 2ZKHL 5C1MB 3ARDD 3QEUA 3WCYA 1MWAB 5GGRB 3T77B 3PWUB 1JGEB 2IMNA 3IDYB 5DJ2A 3IVKA 1PEZA 5BW7A 1CD1A 3OR7B 3LPWA 2Y23A 2OL3B 1ODAA 1NBYB 1QVOA 4WI8A 3MRGB 4M5YL 3L5HA 3UTPE 5I73B 1I1FA 3BO8B 3DNKA 1H3WM 4HBCL 5D2NA 2X4QA 3GFUA 4NO5A 3DV4A 1WFNA 4JLRA 5IOPA 3SKMA 3QG6B 4RGOL 1QFWM 5BVJB 3VFVA 5ESVA 4OJFL 4UIKL 1GGIH 5GRJH 5D2LA 4TTDD 4ZFFB 1IKFL 2H26A 3HZYB 1T7XA 3D0VA 3ZKSD 4HZLB 1F4YL 5HY9A 4WI7A 5D6CB 2NY4C 1QSEE 1A3QA 3T4YA 2AERT 4AT6A 2Q20A 5IHZA 4OUUB 1XH3B 1HXMB 2BMKB 5A2LH 3TO2B 2HT2D 5F9WB 2FLRT 4JZOB 1ZGLA 3VRJA 3QISA 4OZ4A 5C0AD 3GSXA 4JO1L 4O00A 4XPFL 1BLNA 4GSDH 1PY9A 3KPSD 1DL7H 4FRWA 1BVZA 4HMCA 3QNYB 1ADQL 4WEBH 1ZHBB 5E9DE 1XFPA 1PSKH 3FN0H 1ZAGA 3B9KC 3OKDA 5CZXD 5D1QA 4JY5L 4F33B 5D9SA 3CGTA 3O9WD 3Q6FB 4LCUB 3O3AB 1ES0B 3V6OE 4KKAC 4XAKD 1NFDE 1QPXA 4X99B 5B39B 3BH8A 3QCTH 1ZV5A 2IBBA 2JCCB 2PO6A 3QEQE 1QLEH 2V17L 4I2XB 3PDGA 3PL6D 3BMWA 4KC3B 1R5IB 1XIWD 4L1HA 2V2WA 3I3DA 2NPLX 4NQXB 3KPMB 2J4WL 2ZUVA 1OAXH 5T1DL 1TZGH 1XAUA 3V52H 3U46B 2IQ9L 4HUUA 4JVUA 5HI4C 1MCDA 4WO4A 2ZJSH 3GNMH 1KPUA 1TNNA 2WK2A 3LSOA 4JFYA 1YC8A 2Q86A 5EWIH 5T1MB 1RURH 1T04B 1AIFA 5FO8A 4UT9H 4NKIL 1NDGB 2Z91B 5JW3L 4PJ9D 3GSNA 3CH1B 2VQUA 5DMIL 4O2EB 5F89B 4PRIB 3CD4A 4ZUWB 4K94H 2VLKE 3NPSC 5CBEA 4GW1B 1OTTC 1EEZB 5EUOB 2YK1L 1RZKC 3ZE1F 5GPRA 4LPTA 4MJ5B 4PJAE 4GXVL 4HKZA 4PFEA 5ETUB 5ISZE 1KFAH 4W6WB 1KF9B 5ILTL 3DO3A 2EEAA 3KXFE 4AEHH 5FA4B 3S34L 1J1OL 3KWWB 4JFFB 1BQHB 1J11A 1SYSA 5DFVC 5GRJL 5BZDB 3FOLA 5KSBA 4MHHI 2UYLA 3SE8L 4C4KT 4NRZA 1XF5A 2BFVH 3L3GB 3WBDA 4BZYA 4D94A 4ZTOH 1U8KB 2V2XB 4HS8L 3EFFB 4ONGH 3E0GA 2EDJA 2GQHA 4X5WB 2IQAB 1K6QH 5FB8B 2E7LC 4I18C 1HZHL 1GC1C 1LDSA 3VI4F 4C55A 4YEFA 3IDJB 4S1SH 2GJ6B 3F5WB 2VXSL 4G9FD 3TBYA 1DL7L 3HPLA 4I5BB 4MD0B 5I1GH 2BDNH 4G8GE 4NO2A 4TULH 3S97C 3JUYA 1R3JA 3RBSA 1PSKL 5E00B 4LPVA 5J6GA 1VPOL 2MSPA 2X4PA 3GJFH 1AGCA 3HE7C 2ESVD 1ONQA 2J8UE 5BS0E 5TQ0L 1DBKH 3IT8D 4F57L 1OSZB 1KIRA 4QXWA 4CADA 2DWEB 1FYTE 1ZS8B 4FXLA 3MMEA 4JFZH 3DVFA 3MNZA 5FGBA 1DVFB 4BA8A 4XCEA 3VRLF 4MA3A 1J0YA 4GBXD 2P5WB 4YAQA 1QLFA 2P1YA 2VAAB 5AEAA 3HMWH 4Q6YA 3ARGC 3LKSA 4UBDD 1FJ1A 3RL2A 2D7TH 5I18L 4P2YA 1NCDH 3HPJB 2NX5B 1O5DT 1P5VA 4K7FA 2ZCLH 4HC1A 4HLZH 3WDHA 5I30L 1YJDC 1JZ2A 1NDMA 4H1LA 5CKGA 4K07A 4N90D 4L4TA 1EFQA 1TJHL 4WUKH 3QQ3B 4LPUA 4L8BB 4OFPA 4LLQA 2F19L 4M6NL 4M48L 3P77A 4OQTA 4HEPG 1A7PH 1IFHH 2GTZA 4KZDH 4NZTH 3OKOA 1VEPA 5E0QA 3G5YA 1FPTL 4HJJL 2YPLA 3I9GH 1LO5A 2OR9L 3QNXB 1KEGH 3VRIB 2RFXB 5GS0C 2LU7A 4BQ9A 3AXLB 1G7JB 3STLB 1MVUA 2P8MA 3F65A 1Z2KA 3LQAH 2AEPH 4NJAL 3VXRD 5TPWH 3ETBF 5L8KB 3P11H 1A7NH 3P9MA 1SEQH 1N59B 1CXFA 1T1WA 4JFEB 1W72A 4JGUA 3HE6A 1S7UA 2JLLA 4ERSH 1L7TH 3GMLA 5EA0L 2EKJA 3L3IB 3NCMA 3DUHA 4F9LC 2VZTA 5H37H 2PR4H 3ZTNL 1SJVA 2ITDA 4Y4HC 1WEJL 4KTDH 3W9DA 2HRPL 2EZ0D 2M26A 1K6QL 2VLRD 3GSRA 3FRUA 4F15B 5TE4H 1QFUH 5AAMA 1KN4L 3B6SA 4S2SA 1VFOA 5IWLC 1CIDA 4KK6C 5DXWA 5GSRB 3L3HA 4KGJA 3UBXG 5E8EA 1KTLB 2ARJA 5MHSD 1N3NB 1EXUA 5JORB 1V3KA 4ZUVA 4MS8C 3ZKXB 1A7RH 3VI3F 3CZFA 4GOSA 1LE5A 1JP5A 3REWA 3PNWB 4HIHA 5DRZA 1CGWA 4KTYA 3A67L 3TVMD 3NH7L 1ZT7B 4R8WH 1NBZA 1OL0A 1Y6MR 5DVNA 3UTTB 4C56E 1XGQB 2G60L 3VFUB 1MJ8L 5C09E 3HC3H 5C07A 1TJIL 1PG7H 4NO0A 4K7PH 3DMMB 3FONA 2EXYD 5MEPA 1MH5B 4S0SD 2C3WA 4ZOEA 1MQ8A 3GRWA 3X13B 4HKJA 1I1AB 5DHVB 1ZA6B 4HGWA 2IAND 4D0CA 5HYJB 2FL5A 1QLRB 3BUYA 3HS0B 4X7SH 1NCDL 2APXA 1JWSA 3QDGD 5FYKH 4QWWD 1N4XL 5C08B 2NXZD 1CXKA 3QI9A 5GGQL 3BI9X 5L9DL 1C5DB 2X05A 4AH2A 4NNYA 3BIBX 4GXUN 5IV2B 3BZEB 2OK0L 2VB5A 3MRLA 4Y5VB 5DD5L 4DWHA 3EJYD 5FYJE 4MZ2A 4R4ND 3H9SD 1NJ9B 4UQ3A 2BNQD 5IFJA 1JGVH 5IGXL 1A7PL 4LCWE 1IFHL 2D3VA 2DICA 3GMRA 3ULUH 3BWAA 1UM6L 4PGCB 4BH8A 1A6PA 1WV7T 5JOFB 4D0DB 4YWGH 1GHFL 3IDNB 5ERWA 3HCVB 4YHIB 2A6JA 2YBRA 2QL1A 1T7VA 2EO1A 5I8CA 5DSCB 3MR9A 2AEPL 2ZPKH 2VZUA 3CFJB 1A4KA 3E6HB 1SEQL 1D5XA 1FFNB 1B0RA 4OFKA 3V5DA 5DJAA 3QP3A 1MOEA 3EYFB 5IW6B 1S3KH 3S36L 4KJWD 3B3IA 3BPOB 4EBQH 3C6LC 1F6AA 4N5ED 3TJEL 4GUPA 3VWJA 1P4LA 4KTDL 1N7MH 1ORQA 4OBRA 4QRRB 3U6RA 2Q7YB 4LPYA 4FFZH 4PTUB 4JVPA 1VB9A 4PJBA 4PJIA 3UAJD 3VFMB 2UY6A 3MACH 2IAMA 5EC1B 2NY3D 3QWRD 5D93C 5D72H 5BZWB 1FFPB 2XTJD 3PDDA 4P2OB 3SBWA 3UP1A 4U6XA 2ZUTA 1B4RA 2WUBH 4NCC2 3MRNB 4KHTL 4ORGA 1F97A 4XBPA 4LEXL 3Q5OA 4OZGE 2VDLH 4RMTA 5JDJA 2EC8A 4GAYB 4W70A 2NY5H 1L0QA 2VTFA 1TVBA 1S5IH 4ODHH 2Z8SA 2EE9A 4JKWA 5DMKB 3H6JA 5DJDB 5J1AB 1YECH 5EIIA 1NAMA 3MV9B 4PJFB 4FQHA 3JV4B 4QNPE 2BRQA 1MFAL 3OPZH 4MXVF 1TCRA 1KCUH 2JIXD 3SGEH 4JM2A 2PCPB 3X3FH 4LLAA 4BZ2L 1NCWH 2JJSA 1XGYL 4QHKJ 4CBPA 4HLJA 3S88L 3UMTA 3ULSA 3OAYK 4JANA 3T3MF 2CXKA 1FL3A 4AEIL 2F53B 1WTGT 3NIFF 2VLME 4LHUD 1AQDA 1DSFH 1IAOA 1OAYH 1BVKB 5T3XE 4PS4L 5CP7A 1KCKA 2Y06H 1QPPA 2VQTA 4IS6A 4JZNA 4NM8L 4NUJB 1T2QH 4ODWB 4YHLH 3HZVB 5EORH 1MHHB 3B83A 4HUNB 2BVPA 4AIXA 3HZMA 2DJ4A 3QDJA 4OD1L 4R2GC 4GXUM 4GRWH 1I9RH 5EG6C 1NGXB 3MV8A 3QIBB 5FM8A 5GS2H 1VACB 5DQDL 3L9RB 4GAGH 1QSFA 4NT6A 2VL4A 5IW1A 2Y6SC 5ANME 4YHPA 1Q72H 1IC7L 4FFYH 1A14H 1Z3GL 1F8TL 2AXGA 1E0OB 5HHOE 3RVTC 4IIQC 2KBGA 5ICZB 3L3OA 3VXSB 1B88A 4JJHA 5DRXB 4NQVB 4G6FB 1KN2H 2DBJA 3IDIA 4KJQD 5TFSL 5MENA 3L3KB 4PJDB 4S1QH 4QTHB 4AK1A 1VDGA 4LASL 2BY2A 4C83B 2Z31B 3NCJH 5FKAA 3NAAH 4XVSH 1FNEA 4P2RE 5E1AB 4XPTL 2C3VA 3RVVD 3TYGH 1SY6A 4JN2A 4ZPTB 5DJXA 2OTWB 3OKNA 2WINA 5IB2A 4M7ZB 1RHHB 1KPRA 2P8LA 5F1IA 4DW2H 3E6FB 3T0EE 43C9B 4DEPC 3GB7A 5SWZB 5JLZB 4RMUA 2OTPA 4TSBL 3S4SB 1OB1B 1MRDL 2CRYA 4LGPB 2NZ9C 2DQJH 4KJPC 4MNHA 1CF8H 1VGEH 2BSTB 3JUZA 4NGHH 5ADPH 4EXKA 2X4NA 3SJVB 1OLZA 4JFDE 5DQJA 3JVGA 2R0ZL 3QUZB 4XXDA 5KANI 5KJRH 1UEYA 5EBMA 1TCMA 3BISA 2Z35A 3DX8A 1YY9C 5SWSD 4PRPD 2E6JA 4KVNL 1LK2A 3AU1B 2HKFH 5I15H 1N5YH 1CR9L 3ZYOA 5I0ZA 1BEYL 4GRMA 5D1QD 1CE1L 2XRAH 4DAGL 4UU9A 3OB0K 3NZ8A 1T2QL 4Z76B 1AO7A 3GKWH 4PREB 4OIBA 2OJEB 1B0WA 3HUJB 3OHXA 3DO7B 1A7BA 4FTVA 3O0RL 3PHQA 3ARDB 2D7NA 4XXCA 4X7DC 4OB5H 1UZ6F 3ZHKA 2DF3A 1R0AL 2PO6D 4HFUL 2GITA 1G7LA 2VSDA 1EMTL 1NKRA 1KSRA 5K9QG 2WIIB 1ZLWH 4ACPA 2QQLH 3DRTA 1D5IL 1P2CB 2A6DB 5IIEB 4G8FA 5EULV 5CEYB 3M17A 4OTXL 4GG6B 1A7QL 3EJJX 2DQFB 3VFTB 1R3IH 3D9AH 1A2YA 4YDLC 5J4MA 4WI4A 3I6GA 5GZNC 4G43B 4K55A 1OD9A 3DX9A 3MUJA 4NQTA 5IMOA 1KPVB 1HH9A 4TSCL 5E8NA 2FJFA 1U0QA 1PLGH 4NKOA 4PPTA 4QXTB 3BT2H 1QO3B 1UT9A 2HVKA 1NANH 4X4XA 4PRHA 1LMKA 6FABH 3H0TA 2QR0A 2NXYB 2G5BA 5DJ6B 4XMPH 1V7NL 2ICEB 4MAYB 1OLLA 3TBSA 4PLJD 4JRXE 3LZFL 1OGAB 2KPNA 4Y2DA 1Q9KB 2X4RA 1CD9B 4R97B 3U9PL 1WUNT 3SGDI 1CK0H 3FFCB 4OV5B 4LLYB 3S5LG 2CRIA 3LH2L 2NY0B 2NY6B 2E27H 3MTRA 3O9WB 3QULA 2X1PA 3NA4A 3C60A 2J12B 2FX9H 3RZCC 1JN6A 3WE6B 5DWUL 1DN0B 3LN5B 3WHE1 3TFKC 4JFPB 1FDLH 1FLRH 1SBSL 4O5LL 3C8KB 2V7NA 3PL6B 3BPNC 4HC1H 3GDBA 3ULVD 3TCXA 1MI5D 3DVNB 4ODUB 3S3PA 4AY0A 3GSNL 3ZE0E 1JGDB 4OCSH 1NMAH 5KJRL 5FA3B 1KACB 3MLSH 3RWEB 4PJGB 4HF5L 5I17B 2FHCA 1F2XK 3KLAA 1A6VH 1GPOH 1SJHA 3FO1B 5E99H 2J2ZA 4Y4KB 3OKKB 4LOUD 2FYYA 4ZDHA 4AL8H 4OQTH 2ATPA 4CU8A 1I3GH 1PG7X 4MWFA 3PWNA 4K7PX 1SYVB 1ITCA 3TIDB 3F62A 1DLHA 3IB4A 5EZOH 4PV9A 5DJ8A 3WJJC 1JHLH 1Q8MA 3EHBD 4ALAH 5DQ9A 1KCVL 4X6DF 5DO2C 1WK0A 3NIGF 1I85C 4Y4FB 2AJUH 3MLWL 3N0PB 1HI6A 1HKFA 1J1XH 1DQMH 1TZIB 2BNUB 5IJVB 2DLEA 1W72H 1QOKA 2LVEA 5IHUL 1RZIB 5I75C 2WLZA 4X98A 2VITA 1RUMH 3ROOB 1B4JH 1GGCH 3VXMA 1RIVH 3EZ8A 1R3IL 5E4EC 2RIKA 4Y5YC 1S9WB 5BRZB 1F90L 4Y16C 3WXVH 3FFDA 3S37H 3ULVL 5EU4A 3QUXC 2D7MA 1F6FB 4PJ8A 1F3JA 2LTQC 3PWLA 1IC5H 3MA7B 4K3JH 5I1HH 5I1AA 4I0PD 1LO0L 5CHNA 2B5IC 1MREL 3STZA 3VH8G 1AXSA 2GW5A 2SEBA 3TA3C 2OTUB 3PWJA 2YN5A 4WCYH 3QFJD 3PQYE 2ADFH 1OQXA 1CFQB 1ACYL 5DD3L 2XFXB 5DD1H 4JDVA 3BUTA 2IMMA 5B22A 1A1OA 4TQEL 3VXTB 2W9EH 1WZLA 3DXAE 1G7MB 2ZCHH 1AGBA 4XCCH 1FO0A 1Y18B 1IAMA 5FM5O 1H8OA 2R9HC 3CPLB 3QSKB 5C0CA 4WWKB 1CGUA 2CKBL 1T03L 2NR6C 4Z7UF 3GRWH 3C2AL 1FCCA 1JGUH 1TTFA 2ESVB 5C70A 4PY8I 4UDTB 3VGDA 4YDJA 2IPKB 3MLPA 4JJ5A 2VZ1A 1OAUL 3QZWG 4UOJA 3NABH 1LE9B 1JWUA 4HC1L 2O61A 1N8ZA 1I8LC 2AK4E 4MQSB 1XGRA 3RVXC 5F7HA 4CGTA 5CD5D 1V3JA 3VFOA 3MRRA 5LJYH 2FDBP 3QUYD 3SDXB 5FECA 4ZS7L 4DGIH 4WIQA 4IOIA 2E9BA 3JWDL 5T1LD 5IJKC 5JDSB 5DRNA 4H26B 2JB6B 4FQQB 2E7LA 1KG0A 4I18A 3WNNA 4ZS6D 1I3GL 4GRLC 1MY7A 5B38B 4OZHA 5LXGH 4JG1H 2A74A 5EZOL 4MCYB 3RKDC 5C0FA 3RVUC 2VISB 1WCBA 4Z7WF 5DLML 5AZEH 5EZLB 5SWQB 3QDMA 5C07D 4O02L 3T0XA 3K4ZA 4Y19D 2FD6L 3M1BB 5E4IA 3PIQA 3O3EA 1W72L 5B8CB 3DBXB 2IFFH 1M4KA 4CUCA 3CCHA 1JK8B 5HGDA 2AI0H 4XCFH 3LD8C 4CVZA 3D2UA 5D96B 1ITBB 3G5XB 4PJ7B 2E6QA 5MEQA 1I1YB 3ARYA 1U8NA 4M7LT 3IF1A 4XP9L 3RVWC 3QUKB 4XPAL 3MFGB 1CG9B 4NPYA 4U1NB 3SDDB 5F72S 1NAKL 1GOHA 4Q2ZB 4JFQB 3GK8L 1IC5L 1DUZA 4TN9A 2CDGB 3NN8A 3V0VA 3DTXB 4FOMA 4PGDB 5I1HL 5JW5A 1RIUH 4FN0A 3RIFK 3BQUD 4UINH 4Z8FH 4WCYL 4CVWA 1C16A 3RWJB 3BOVA 4H8WC 3UO1H 2C1PB 1KJVB 3KPNA 3DI2B 1A6UH 1AD9B 5IVXB 5C0EA 3CFCL 1HXYA 4AIOA 3UTZB 4X8JB 4CW1A 5E6ZA 2QSCH 4G6MH 1T5WB 2CRZA 1FC2D 2XY2A 1GZQA 4JE4B 2BVUA 5C0IA 4KI5D 4HIEA 5I71C 1ZA3A 5DA0B 4FMFA 1E6OL 2Z4QB 2DL2A 4P49A 5IB4B 5CZVH 2ZUWA 1OARH 3CSYB 1RJLA 1D9KB 1JGUL 4HPYL 3TVMB 3F58L 1NAMH 3FT3B 3B9EA 5J6HA 5I1LA 5FF6A 3O4LE 1K85A 2AV7A 3DYMA 5IB5B 1H8SA 4I2XE 3E3QC 1IGTB 4NQDE 1LO3H 2X4SB 4RGMC 3H7LA 1DQDH 3E2HB 5KG9A 1CLOL 1KJMB 1KIPB 3TZVD 5HDBF 5IM7B 3MBXH 2GK2A 4RA3A 4JO4H 4NFCA 2IANB 3F7YB 2HFGL 3EO0B 3D5OF 3BN3B 5DMYA 2YKLH 2X1QA 1TMCB 4F9LA 2IAMD 1NGQH 4HH9B 1U8JB 5F7MC 1MJJB 3IAGC 2NXZB 3HN3A 2XKNA 4OF8A 4QHLA 3RWHB 3TBVB 4H88H 2YA1A 3GBNL 5LXGL 4U6VL 4PP2B 3VE0B 2CUHA 3OAZH 2C3GA 5IWLA 3T8XB 3C6SA 2APTA 1DBML 3U4EA 5CEZD 5IMKA 5DA4A 4RQQA 2C26A 5DFTA 4RFOH 4RA0C 3G6AA 4Z0XB 1YQVH 5EN2A 2VDQL 3RX7A 4EDWL 3CVHA 3KPQB 4XH2B 1J8KA 1T20A 3N1PC 4DOHE 5E08L 4J23A 3TNNB 1JPFA 1Y0LA 4K3EH 4O51A 1X9QA 3VFGH 3AUVA 3DX6B 3QA3A 5LQBL 4JG0H 4K2UH 4QGYA 4TNVF 1KJ2A 4PD4J 4GS7C 4MJIB 1X5XA 3VWKC 4O9HH 2XKUA 2YD9A 5FCSH 1O0VA 1T21B 5C6TL 5CJXC 5I1IH 4DN3H 2VOTA 4XWGL 3VD4A 4UDUB 4N9GB 5C6PB 4PY7A 1WC7A 2BCKA 4JKLA 4HIJB 2XQYG 4TVPH 5GS1B 3PV6B 5KSAC 1CDUA 1GZPA 1QR1A 1BQLL 3ARFC 2V7HA 5CP3A 4ONHB 1J86A 3KPTA 4W6XB 3V7AG 2XWBB 3LRHA 4QOKA 1JPGA 4X7TB 2IH3B 3H3PH 1SY6H 5CEZL 3O6FD 1EEQA 3VA2C 5JW4N 4EKXA 3V6OC 2B0SH 2Y72A 4M00A 2F54B 5FGCB 3M8OL 3CUPA 3QPQD 3QQ4B 5JHDB 3C08L 4L8SC 2O5YL 4UAOC 3V4PL 1MHPH 1NAML 2XQBH 1QSFD 5I6XB 4Q9RL 2FECI 5BV7H 1YEEL 1B2WL 4WWID 3EGSA 2IPTH 4IRSD 3MLYL 4NO3B 1EEYA 5E6IA 3FB7B 4RNRA 1NANI 4HG4K 2BXZA 3MJ7A 2XWTB 4CN1A 5IG7B 3QCUL 4L3EA 4RISH 3V7MA 1R3LB 1BPVA 2GSGA 2QBWA 3D85B 2V5MA 1R6VA 2YKLL 2ID5A 4TVPD 4I0KA 5FYLE 4WW2C 4YX2L 3QXAB 1U8OA 3VXOA 3ZYJA 1MFCL 5L7XH 4JO2L 3VFWB 3V6FA 4Z7QF 2XZCH 2Y7QB 4QTIL 5TE6L 3RDTC 3P2TA 1AHWB 1NUFA 2DQDH 1YQVL 3T2PA 4EN3A 3C5ZD 5KVGH 3UPCA 2FZ3B 4UV7H 4YBQC 1E6JL 5T33L 1ED3A 1XCTA 5ESAB 4X4YA 5D1ZA 1A9EA 3DX7A 1RFDL 4S11A 4EI6A 1RZFH 4P2QB 2YSSB 3C5SB 4MVBD 1CFSA 3KPLA 2VLJD 1KIQA 3UJIL 3U7YL 5C9KA 4B0MM 1CQYA 1WVZA 3BESR 1VCAA 3MBED 5DJ0B 3S9DB 2Z8RA 2PYEA 1KV3A 1KEMH 2FSEB 4C58B 2IADB 2DYPA 4TVPL 3IAQA 4QCIA 4LIQE 1H3UA 4JQVC 4U49A 3MLUH 5EBLA 1NL0H 4HFWB 1GIGH 1SMAA 3FT4A 3D0LA 2XN9E 5KSUB 4GW5B 2BX5A 2MQ0A 2V5SA 3CFEA 4P3CL 3WFDH 4QXUH 4X6CA 3DUSA 1EHNA 1QBML 2AABH 4JPVH 3UBXA 1QRKA 3MROA 2A73A 3WNPA 3OGCA 3DVIA 2VSCA 5IBLC 3HAEG 1JWMB 5DJ2B 3IVKB 1CD1B 5CFHA 4GQ9L 2IH1A 4LSPH 4CVXA 1MCWW 4HWBL 3UTTE 1QVOB 1CFNA 3S37X 1I1FB 4HXBL 5D2NB 1D6EA 3TN0A 1RIHL 3WIIH 2X4QB 4UV4L 1IKNC 4NO5B 5JW4M 3CFDA 3DV4B 5HPOA 4JLRB 1FN4A 5IOPB 3SKMB 4PJEE 2Q87A 3DSFL 4HHAA 5AYUL 4DGVH 4GRWB 5JTWA 3VFVB 5ESVB 4HIXH 1MFNA 4Z95H 3TPKA 3VWKD 1HCVA 5D2LB 3RBGA 1X7QA 3SDCC 3KPRA 2H26B 4KI5F 3REVA 4OZFG 2EDHA 5HY9B 3T4YB 1TPXB 4AT6B 3LCYA 4I48A 4LNRA 5IHZB 1JYNA 3EYSH 4KI1A 5TDPA 1ZGLB 2Z93A 1BZ7A 3VRJB 4OZ4B 3QJHA 3GSXB 2APVA 1BLNB 2PXYB 4Y2DD 2PNDA 1MQKL 4DKEH 4XT1C 3ZMRA 3FQXB 1WWCA 2CLVA 3IXTA 1F3RB 1ZVHA 3Q3GA 2UZIL 3OKDB 2H1PL 5D9SB 1HE7A 1WT5A 3C60D 4LSVH 4X9HA 5L2KE 4P46C 3QIWC 4TSAH 2VDRL 1R5VA 1MRCH 5ICXA 5IBUB 5DHYA 3BH8B 3KJ4C 5AWNH 5I0DA 4WGVB 2DKSA 1CGYA 3LPFA 1H3TA 4P9HC 2G75A 4JREB 2J5LB 2V2WB 4M6MH 3VU2A 4YBLC 2J88H 3KYAA 5FUOL 3GI9L 4BJLA 4RBPK 3L5IA 3EOAA 5JXEA 3RWIA 5E2JA 4U1HA 3F12A 3GBMH 4HUUB 4P23C 4WO4B 3D39A 1YN7A 1KPUB 4KQ4L 3UYOD 3LSOB 4JFYB 2BVOA 4OI7A 2Q86B 1OF2B 1MPAH 1AIFB 1T7YA 5FO8B 1NLDL 2EDWA 3GSNB 1E4XL 2VRAA 4MQXD 5EFIA 1FO0H 3BZFA 1UEMA 4OLVL 2H9GA 1CFBA 3CK0H 3VGFA 4JKPH 4R26H 3QXDA 2LAAA 2VN7A 2ERJC 5CBEB 4K8RC 1JPSH 1QNZL 3D3VE 1RK0B 5CS7A 2XICA 3GHEL 3BKCL 4WFEE 3DRQA 5J3HC 4LU5H 4M6OH 3WIIL 4HKZB 4P59L 4XP5H 3QWQB 3HR6A 1WWAX 4XNUH 4MXQD 1YA5A 4JN1L 2CRMA 4PJ8D 1MCPH 4PJXF 3FOLB 1DLFL 2P24A 5KSBB 1BFVL 2UYLB 4NRZB 1PX4A 3WFCH 3FQTA 2YPVL 1XF5B 1EBPA 4OGYH 4HGMA 1YPZF 4MDIB 5AAWA 3A6OA 4OLYH 5BCAA 1A5FL 1GC1H 4BUHA 3KYKH 2I9LA 2VC2L 5JHLH 1JJUA 4Y88A 4MA1B 4JHAH 2F53E 2R1XA 3FTGA 3ZE1E 2NQCA 3TBYB 3HPLB 4FQLL 5D1XA 1OVZA 3IDMB 1QYGL 3CMOH 2IEPA 4G6KL 4NO2B 4NCC1 1R3JB 2J1KA 3R1GH 3C5JA 5JPMA 3QH3A 3WS3A 4BKLA 5J6GB 5CMAA 3W11C 2X4PB 3IKCA 4UIMA 1J9CT 4BH7A 4DK3A 1EGJA 3SCMC 1AGCB 2QQNL 1AFVL 5TE7L 2BHUA 1MRCL 1J87A 1H3XA 1S9VA 2BVEA 4PJHF 2OI9B 1YEHL 1M7XA 4CADB 5AWNL 1MIEH 1X4YA 2W0FA 5EUKA 1JZ5A 3MMEB 3MNZB 1NH6A 1A0QH 1A1MA 4XCEB 4MA3B 2XZZA 4YAQB 1QLFB 4OAWB 5DUML 3RZCA 2UWEF 2PF6A 2EIEA 4PYGA 1OPGL 4Y1AE 4OGZA 4YK4B 3LKSB 1TIUA 1FJ1B 3RL2B 1I8IA 3EW3B 1OT2A 2CXGA 1YJDH 2JELL 4ZYKA 1PX3A 2LU3A 1BD2A 1G6RL 3NFSL 4NSKA 2FLBT 4UNVA 1NDMB 1D5MA 2FX7H 1FO0L 3SGKC 1YC7A 3EFDH 2VDOH 1D5BA 4L4TB 3ZE2F 1MJ7L 4EVNA 4N0RA 4XVUC 3QG7L 5I1CL 4BZ1H 1NCTA 4KROD 4LLQB 1JPSL 3HG1A 1X5LA 1U91A 4YHNA 1DBAH 4U1KA 2GTZB 2FEDD 3OKOB 1NBVH 4XAWH 4CVUA 3BDYH 3G5YB 5EU6E 3VRLE 2R1WA 2YPLB 3D2UD 1LO5B 1VFUA 5GS0H 4RMWA 1JMZA 1T4KA 1I85A 1MVUB 2P8MB 4ELKA 2QEJA 4XPGH 5JZ7D 1MCPL 1KLGA 2YHGA 3P9MB 5JMRA 3DETC 4LLMA 3PP4L 4LQ1A 2EE2A 1W72B 3HE6B 4YXKL 1S7UB 3MNWA 4YC2C 4KTEH 5CJ5A 1BIIA 1IQWL 3GMLB 2COQA 4OIIL 3WFBL 1G7QA 3U30C 1GGTA 4MNQE 5GGSY 2ITDB 2YR3A 3QUXA 1MHCA 4R90H 3W9DB 4FABH 3GSRB 4XTRD 4ETQA 3FRUB 3OF6A 4XNQB 2VZ3A 3B6SB 4S2SB 1N0LA 3HNSL 1J1PL 3L3HB 5E8EB 3SPVA 4GFTB 1A6AA 2GI7A 1BBJA 2ARJB 3IGAA 1EXUB 1TQCC 5BO1H 4XP4H 3TA3A 1ZMYA 1SVZA 4ZUVB 3CVHH 4BK5A 1CL7L 2QQKL 1I7RB 3CZFB 1LE5B 3REWB 4YUEH 4HIHB 5DRZB 1UQSA 1NBZB 1RZ7L 3HUJE 2FEEL 4UMGA 2CQVA 4XBEH 4AMKL 5D7SH 1P7HL 1KJ2H 5C07B 5DD0H 4NO0B 1LQSR 3CFIC 4RGND 3S7GA 4WHDA 2WAHA 3FONB 4NWUL 2VXQH 5MEPB 3CJJA 3LKRA 5T1KD 1BOGA 1MAMH 4HKJB 4MA7L 7CGTA 4KVCL 5EC2A 4HGWB 4D0CB 2BOCA 5CLWA 4FQCL 5T5NF 2FL5B 1SJEA 3BUYB 3NCYP 1NFDF 3RUGF 4NRYA 4PRDA 1JWSB 5CP3H 2APFA 4DJMA 4FQ1L 3OAYH 3T1WA 3AS0A 2FATL 5A3ID 5I1KH 1I8LA 3K80A 3TT1L 1RUPL 3QI9B 5E5MA 1U3HD 2QSQA 2W9LA 5LGJA 5TDOA 1T0MA 2OLDA 4AH2B 1OAQL 5D7IA 3AAZA 4NNYB 3EFDL 4QXGH 3ILPA 3MRLB 5IJKA 5F97E 3TBWA 3PGCA 2X4UA 5IROC 3PWPA 4UQ3B 3LIZH 3ECBA 5IFJB 1EUUA 1DBAL 2QADD 4LBEA 4GRLA 5C0AE 1L0XA 4IRZL 3O2WL 4XAWL 3GMRB 3T0EC 2F8OA 3BWAB 4BH8B 4HIIA 1P7KA 4QHUA 2N4IA 3KPSE 1QKZL 3UCRA 4F33A 3LMJL 3ZKNC 4X83A 5ERWB 3MRBA 2A6JB 2CR6A 2YBRB 4X8XA 1ZTXL 2R8SH 3E8UH 1IBGH 3FAXA 3MNVA 4XPGL 3MR9B 2BHYA 1A4KB 3S5LA 3KNBA 4CN4A 1MIML 1D5XB 1B0RB 3V5DB 5DJAB 4G8IA 4XAKE 3RGVC 1WBYA 4FQJH 4LGSB 3F7QA 1F6AB 5F7WC 4GUPB 3VWJB 1P4LB 1XGPB 1ORQB 3OGOE 4KV5E 3V79C 1HHJA 2BHZA 5D4QA 1VADA 3BFOA 3VFPA 4QOKD 5H37G 3U6RB 3V9FA 3L7EA 2NTSP 4OZIF 2O5XH 4POZD 4PJBB 4NZDA 2L7JA 2OYPA 4M43L 5DC4B 3IFPA 5ALCH 1G9MC 1IM9A 2C1OA 3LB6D 1T0PB 2QKIA 3MRKA 1HNFA 4JDTH 4LP4A 5L0QB 3AMKA 4I4WA 4U6XB 4XBEL 1Z9SA 2X10A 4ORGB 5SX5K 5F8QC 4XBPB 3ZDXF 4DN4L 4EDXA 3RZWA 1MCLA 5E6ID 2Z8WC 3VG0L 1TVBB 1OP5K 2NY1C 1FSKC 4I3SL 2Y07L 4L3ED 4UT7L 5EIIB 1NAMB 5IF0A 3B2UC 3JWOC 5J9PA 3ORJA 1KIUA 1TCRB 1UKQA 2CGRH 1DANU 1EHLL 4HAFA 3KDMA 1WF5A 4JM2B 3LKOA 1ZT1A 4JPWL 4G6AC 4YE4H 5B3JE 5ACMA 3ULSB 4JANB 2EH8L 1FL3B 2WBKA 4IOSD 2D03L 4EOWH 3P0GB 4LKCA 3VH8A 1AQDB 1AGEA 3OB0H 1IAOB 4QLRA 4XWOC 4CMMA 5CINL 5CP7B 3MLRL 4EN3D 2X6MA 3LIZL 2B1AL 8FABB 2A0LD 4IS6B 4JZNB 4O4YH 5I19L 4OCWH 3L5XH 1PGRB 5IMMA 4G9FE 2OX5A 2BVPB 5D1ZD 2R69H 1YQ2A 3QDJB 5F3HA 5E70A 2RCSH 1MELA 5IR1A 3QEGL 4FQXA 5TH2A 3MV8B 2ZUYA 4OCXH 4OM0H 2ESVE 1NMCB 3K0WA 1QSFB 2HKHH 4NT6B 1GXEA 2OXGA 1HHHA 1UACH 2WLYA 4UILH 5IW1B 5TF1H 4YHPB 3T3ME 1D3CA 3N9GH 2AXGB 2GEEA 2FX8H 3QZWA 1QSEA 2CO7B 3NTCH 4K3DL 4WV1C 7FABL 2WUCL 3L3OB 5CJXA 1PY4A 3MCLH 1RZJL 4HJ0D 4U6HA 3SDXE 3IDIB 2Z0BA 3WV0A 2XA8L 5DGQA 5F7UA 5MENB 4HXAH 1YEDA 3M07A 5KSAA 5MP6H 4YQXL 1KTDA 3ARBC 1QHOA 5FKAB 5E9DA 2YZ8A 1A6WL 4NUGH 3BRGC 2RBLA 1FNEB 4H25A 4Q6IC 4N8CL 2C3VB 3U4AA 43CAA 3EYVB 4N90E 4JN2B 3TN0D 5DJXB 5HDOA 1IGCH 2HFTA 3OKNB 2WINB 4MNGE 5IB2B 3LY6A 1O7VA 1KPRB 2P8LB 5IFAL 5F1IB 4QRQA 5EOCL 4U0RC 1QRND 3LQMA 1EV2E 3VRIA 3GB7B 3GMQA 4V2CB 3WO4C 2NNAB 4PJCF 3KPRD 3VFRA 4Z6AT 4YXLH 1YY8A 5BV7B 2ICCA 4E0RA 4MNHB 2EH7L 2P44B 5A2IH 1YEKH 1FNSL 3KPOA 1I3UA 2B20A 3PDOA 4P4KC 3IDXH 3VXRE 4ZFGH 1Y6NR 4WFGD 4PR5A 1IEHA 2X4NB 4U33A 5K33A 5DQJB 3OG4B 1S7XA 4XXDB 1I8KA 1OHQA 1XGTA 1KBGH 5EBMB 4NHCH 2Z35B 3DX8B 4LDOB 2BOBA 2H2SD 1A7OL 1LK2B 3MGTA 2VLRE 1M6OA 3BZDA 4K23L 4GRMB 4WW2A 1F4WH 4UU9B 5EO9A 4NN6C 4XPHL 3NZ8B 3T0BA 3L5XL 1AO7B 3ESUF 3OHXB 5DZLA 3MRIA 4FTVB 2R29H 3PHQB 5MHSE 4PJAA 3IS1X 5M7QA 4G9DA 2RCSL 3RDTA 1VFAA 2GITB 1G7LB 5ISZA 4YXHL 1EO7A 1GGUA 1D6VL 3WL9A 2CSPA 2NY2D 4HMDA 1IILE 1C12A 3MV7D 2HKHL 3DRTB 3TO4C 4F2MA 1DUYA 5C71A 4ODSH 5IEKA 4AENA 1MFEL 5JXED 5E8DL 4G8FB 2X44D 1SEBA 2QTEA 3M17B 1CXEA 4N0YL 5DEFA 1I1AA 1NPUA 2EDFA 3HZKA 1A2YB 4NHUA 4X4ZA 5J7CC 3I6GB 1S7TA 3L7FB 3DX9B 3BGMA 4QO1A 5E5RB 1MUJA 5IMOB 2HTKD 1HH9B 2IANE 4D9RD 3F8UB 5E8NB 2FJFB 4NKOB 5DT1H 4DKDC 3QDGE 1G7PA 4FQIL 2HVKB 4M6AA 1BAFH 4X4XB 4PRHB 4XC3L 1II4E 3H0TB 3BIAX 1Q9WA 1T83C 2CK2A 2IGFH 3PHOA 3BWUC 2QR0B 1UZ6E 4G8GA 2MCPH 4JRYD 5KTEL 4ZNEE 1FGNH 3IDYC 1BZQK 1CU4H 2G5BB 3WSQH 4POUB 5GGVH 4W4NA 1IE5A 1U9KA 3TBSB 1KELH 1OSPL 1I7TA 3ARPA 3W0WB 1G1CA 1WGOA 1FBIH 3BP6A 4Y2DB 1IQDA 1IGCL 2X4RB 2J8UA 5E2UH 1F4HA 1N6QH 4MYWB 4N0UE 5A2FA 1ZKAA 3H9SE 4LCIH 5IT2L 2BNQE 4KRPC 1FYTA 3VXQA 3P30L 1MAJA 2DLFL 3HCVA 3BEWA 3QULB 2VXTL 3C60B 1YYMH 1JN6B 4LSUH 1T6VN 2CD0A 3W5NA 1IKNA 1VERA 1K8IA 25C8H 3P4NA 3WUZA 4PGBA 4OZGF 2ATKA 1FVDA 4RDQG 4BYHA 1C8PA 4R3SA 1AH1A 2V7NB 1HILA 4IDJL 2AEWA 3IDXL 3QIUC 3RWFB 4NJ9L 3B5TA 2HYMA 2R0KL 3RTQC 4KAQL 4C59B 1CN4A 3TP4A 3KLAB 4OUOA 4ZUSA 2FO1A 1SJHB 3ARUA 1PJ9A 2AW2A 4TUKL 2FYYB 4ZDHB 1EX0A 2VDKH 35C8L 4M1GH 2VH5H 2ATPB 5J1SC 5C0RH 4MWFB 3PWNB 3RPIA 1DLHB 4PV9B 2R29L 2IG2L 5DJ8B 2DS4A 1FAKT 3H8NA 5DQ9B 1CD0A 1AE6H 2Q8AH 1H3PL 5DZNA 1NKOA 5IFHL 1HI6B 2XTJE 4E5XA 1ZEAL 1KT2A 1IGJA 2YMXH 1GYAA 4M61A 1MRFH 3HRPA 3V0WL 4ODSL 4P46A 3QIWA 5C9JA 3BKML 4X98B 2VITB 5JPNA 1J8HA 3G6DL 5D7KD 5E6YA 1Q0XL 3VXMB 1FQ9C 4YHOH 5C0BD 4PJFA 3JV4A 2F9BT 3FFDB 4HWUA 4LDLB 5EU4B 3GHBL 4PJ8B 1F3JB 2Y36L 1U8MA 3PWLB 1CDHA 5JW4R 4DZBA 1PW3A 5JIKA 2UZXB 5E95B 3VFSA 5I1AB 4ZTPH 12E8L 3LRGA 5CHNB 2MKWA 4R4FL 3CH8A 1WBZA 4OLUL 3STZB 3DV6A 3OX8B 1AXSB 2DMCA 2SEBB 3H7BA 3BGAA 3EOBA 1KXTB 5KVFH 3PWJB 4ZAKC 1S78C 1EGJL 5ICYB 1FAIH 3LS5L 3JWNC 4LSQL 3B2VH 4YHKH 3WSQL 4JRWA 3GO1H 2B7DT 4DVRH 4LVOC 1A1OB 2I9TA 5KS9A 2NCMA 5E2UL 4NUJA 1AGBB 1FO0B 4C56A 2VLLA 1B0GA 3QPXH 4J1UA 5C09A 5EZJA 1IGIH 5C0CB 4WEUD 3QT2A 1ZGLP 1NBQA 5F9OH 4GMSL 5LGHH 3QIBA 1AJ7H 2V2TA 4YDJB 4JJ5B 3HI6L 1KC5L 2FJHA 4PJ5A 2HG5B 4I8DA 3ARSA 1GRWA 1P4IL 1JWUB 2OQJA 2O61B 1N8ZB 2HP4A 1IGML 2ZUQC 1XGRB 4K71C 3DLQR 3QUMA 5FM4A 2E3VA 3ALXA 3MRRB 2XWJA 1Z9OA 2WP3O 1CZ8L 1E27A 4AQ1B 4HPOL 5FECB 3NCBB 1NC2A 4NQCD 4KGLA 4NQVA 4FQ2L 4M8QA 3KHQA 4JQIH 3GSUA 5DRNB 1XZ0A 4OFYA 3KLHC 3I2CH 2VH5L 4UB0H 1KG0B 4I18B 2R0LL 4PLKC 4QTHA 4OZHB 2A74B 4Z7UE 4LCWA 5C0FB 4O2FA 1WCBB 4OCMC 1AR1C 3BE1H 3FO0L 3QDMB 5IW3A 3MOAL 3FQWA 3L5WA 3HAEA 1MCWM 1XF4A 1K4DA 3PIQB 3O3EB 5DS8A 1LP9F 2YUWA 3CCHB 4HUVA 4AZ8A 5HGDB 43C9A 3D2UB 3AREA 1OCWH 4CVZB 1I9JH 1WAAA 3OXRA 5MEQB 5C0ND 4J4PC 3RNQA 1U8NB 3RFZC 3IF1B 3S8WA 4HEME 3FOMA 1RUKL 1KJ3L 2MKLC 4NPYB 3MUGA 4NC1E 3IXAA 5KVDH 2DQUL 1DUZB 2I5YL 2ZUSA 3PJSA 4NNXA 3NN8B 4YGVB 3V0VB 4P5TC 5JW5B 3PE9A 4OZFA 1HSAA 2NY7L 1MLCA 1ZLSL 1T1XA 4WGWB 1IEBA 4H8WH 3QWOA 4Z7WE 1C16B 1FAIL 3PWPD 3ABZA 3KPNB 3TH2T 5KBNC 4Z7VA 1YN6B 5C0EB 1DFBH 4K9EL 4TTGA 3VW3H 1GSMA 3T2NL 2LAGB 3CXHK 4CW1B 3SGKA 4U1JA 2OL3L 1WZ1H 4OGXH 4IMKC 1GZQB 5SWSE 4NWTH 5C0IB 4PRPE 2M1KA 4HIEB 1G9NC 1ZA3B 4AG4H 4L9LA 5LCVL 3GKZA 3LN9A 1RJLB 1YEIH 5J6HB 4ZD3H 3PV7A 5HVHB 5I1LB 5FF6B 2AV7B 1JRHL 2PTTA 2PW2A 1UENA 5HBBA 2BRRH 4RGNB 3ARVA 2A1WL 4FFWC 2XZAH 5KG9B 3VFTA 1FIGL 2EC9T 5CGTA 5FCUL 4F15C 1ZANL 4OCYL 1EVTC 4RFNC 3FMGH 5HI3C 1JGLH 4GMTH 1CWVA 1XF1A 4LPCA 2HLAA 3U1SH 3DURA 1HH6A 2B4CL 4RX4A 4X6DB 3ZT5A 3FN9A 4M7LL 3I2CL 2XKNB 4KHXL 5D5MF 4QHLB 3B9DA 5I8OL 1A64A 4PRID 1UB5A 3ZE0F 3VJ6A 3C6SB 3CLFH 3U4EB 3MJ8A 4FG6C 4HSQA 3OZ9H 3HLAA 3BE1L 5BVPL 5DJ6A 4MAYA 2ICEA 4RQQB 3G6AB 5KAQF 3L3DA 1A4JB 2FGWL 5DUBA 5EN2B 3VDBA 1Q9KA 3DMMC 3U7WL 4ELMA 3CVHB 3CFBA 4DUXA 1T20B 1ZVSA 2VJXA 1JPFB 5IP4A 1Y0LB 2A9NL 4O51B 4JFFD 4OLZL 3QA3B 3T0DA 5GSVA 4KDVA 5ANMA 1KJ2B 4YPGA 1CICC 4GQPH 4MQ7A 4NRXB 5EH1A 3WXWH 2ICWI 5DVKA 4MA8H 3I6KA 4MB4A 5HHOA 5A16A 2GSIA 4OT1L 1EBAA 3EJZD 3K4DA 4PY7B 4P5KA 1WC7B 2BCKB 3INUL 2GJ6D 4M1DH 1GZPB 3LN4A 2H2PD 1QR1B 2V7HB 4G6JL 1MFBH 3ULVE 3K3QA 1MI5E 3KR3H 4QOKB 1JPGB 4XNZC 3RRQA 4Y4KA 3EDJA 3VW3L 3VXUA 4P2RA 3HI1A 2I60L 4OGXL 2HWZH 3MXWL 4WTWA 1WICA 3H9HA 5B21A 2HLFD 3LEYH 3QO0A 4XVJH 3WN5C 2VXVL 3RL1A 3CUPB 2R4RH 4FQXD 4XRCA 3CFKA 2HTLD 1UWGH 4KZEL 4HJGA 1YEIL 4ZD3L 3T0EA 4M62H 4PBWD 3D25A 3MXVH 1BM3H 1DVFD 3ILQC 1DCLA 3EGSB 4M03A 2GT9A 4LSTL 2P5WD 4YIQB 3BPOC 2OZ4A 1EEYB 3OSKA 1U93A 4RNRB 2Q8BL 4GJTB 3ROOA 5FV1L 3MJ7B 1CCZA 3EOYG 1AXTL 3LEXA 3B4NA 3IFNH 3BKYL 1RMFH 2RQ8A 4L3EB 3RGVA 2NX5D 2EYRA 2GSGB 3WS6C 5K9JH 1K2DA 5IVNA 1PD6A 3C6LB 4JFDA 3RA7H 2PETA 3I02A 1FFOA 5HGBB 4H20H 4UNTA 1ERNA 1P6AB 2FBOJ 5D8JH 1U8OB 2P7TA 3VXOB 3X3GL 4XHJC 1H3VA 3RWDA 1X5KA 3V6FB 3OZ9L 5INDA 1CVRA 1RI8A 3MODL 4OKDA 2YD2A 4XI5C 4GG8A 3QFJE 4H0HB 1PDKA 5D93B 5LBSH 3HC4H 1NCBL 4EN3B 4P48A 1JZ4A 4DQOH 2FHFA 4DUVA 1CFVL 1WWWX 5C7XL 4D3CH 1OTUC 3SOBH 5ALBH 2K7QA 1NC4A 1Q9OB 2NW2A 5FHAL 2W65A 1ED3B 1XCTB 4X4YB 3O6ML 4WWKA 1HQRA 4LL9A 1U8QA 2XPGA 5D1ZB 1A9EB 4EI6B 4JFED 3VGEA 1CFSB 3KPLB 1C7SA 1BBDL 4XPBH 3LS4L 1CXIA 1RY7B 3TJHD 2MHAA 4WFFD 5E8PA 5E8OA 4WTZG 4LMQI 3HA0A 1JHKL 4NQEB 2PYEB 1YMMA 1P7QA 2DYPB 1QFPA 3MLTA 4R9HA 4BFBD 4PUBL 2AEIT 3MA9L 4QCIB 5CJQL 3ZO0A 4Z7QE 3WDJA 3KR3L 4I3RH 3FQUA 3FT4B 3K2MC 3D0LB 3DGCR 3ESVF 5ADOL 1SM3H 3CFEB 5IESH 1W8OA 2JB6A 4FQQA 2VQ1B 1NGPH 4X6CB 1LDPL 3DUSB 4IRJC 1RD6A 3UBXB 4JRXA 5E7BA 3IFLH 3MROB 2A73B 3OGCB 3KLDA 2HT3D 5HYIA 1G9NL 4B7LA 1T0NA 4HK3N 2F5AH 1MLBA 2IH1B 3AGVA 1LVEA 4CVXB 3UJTH 3WFZA 4QRTA 4NKDA 5JQ6L 4HG4J 1CFNB 5GJTL 1I1CA 2ZOLB 3PWVA 2HJLA 3BXNA 3TN0B 4W81A 5C07E 5B8CA 4R2GB 3CFDB 3GJFA 1I1AD 1CDGA 1FN4B 1JNLH 1MCJA 1U3YA 4HHAB 4Y19E 5HYJD 1FRGL 1LK3H 2A38A 3O8XC 1C1EH 5T5FH 3IFNL 1YMHA 3CDGB 3R4DA 1P4BH 2LE9A 3KPRB 1NSNL 3OKEA 5C08D 3REVB 2O93L 1D7FA 1UWEL 2JCCF 4I48B