5ADPH

Crystal structure of the a.17 antibody fab fragment - light chain s35r mutant
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
222
structure length
211
Chain Sequence
VQLQESGPGLVKPSETLSLTCAVSGYSISSGYYWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAGLTANWGQGTLTTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB A.17
publication title Robotic Qm/Mm-Driven Maturation of Antibody Combining Sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 211
sequence length 222
ec nomenclature
pdb deposition date 2015-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5adpH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5adpH01
4DUVA 3FQTA 4FS0A 4JFYA 3HE7A 3QPQD 4YDLC 5ALBL 4HC1L 3Q6FB 4Q6YA 1U95A 1BVZA 1LO0H 5HI3C 1DQQB 1MWAB 4YR6B 3ORJA 2KZ1B 4GRWE 5T3ZL 1TQBC 2VN4A 4MLIA 1U8QA 3KPMA 5D2NE 5ICXA 1AIFA 1HWGB 4ODVH 3W5NA 5I8KL 1RUKH 4AZ8A 3PNWB 3CVIL 4KRPC 5DF0A 1T83C 3SO5A 3CX5K 3P9WB 3K46A 1UZ6F 3QIWD 4NQSA 1BP3B 3FB6A 4P3DB 2GIYA 5I19L 4Z7VE 1JZ2A 4FXGA 1T21B 4LRIC 4GBXD 1JF5A 3KLSA 2CRIA 5D1QC 4MZ3A 3BT2L 3O6LH 1MRDL 2ILLA 1YY9D 3HZVA 5EFIA 1NDMA 5EZJB 1MCWM 1CLOL 4U6XA 2H32B 4JVWA 2F53B 1IGFH 1HHJA 4QOKE 5EC2A 4LKXB 2EKSA 3U30C 2J4WH 2D7MA 4YPJA 1PSKL 4M8QB 4F33A 2VN7A 1DBKL 1FPTL 4JRYD 1F90H 3ULVF 4Y19B 5D71L 3QEQE 4IOIB 4Z7WA 4ZS7L 3VXPB 2HLFD 2AV7A 1G6RH 5MEPB 4X7FC 4UILH 4ELMA 1YN6A 2DL2A 3QPXL 4PJCA 2BNRD 1G7QB 1IKNA 3RL1A 2AJVL 3KLHC 3WV0A 4Y4KB 4KJWC 4NRXB 3QJHB 4ISVA 1I4FA 4LCYA 3SDCD 4C4KO 4N90E 3T3ME 2ZUQC 4HCRL 1CD0A 4XNQA 3MFGB 5K9KA 5F88B 1NANI 4CW1B 1VFUA 4DN4H 3ULVH 5IJKC 2DLHA 3CFCL 5DMGC 5T1MA 4L29B 4QT5B 1P4BL 3U1SH 5CEZH 1U41A 3LRSB 5DURB 3FFCE 5BVJA 1R24B 1BD2E 4KMQA 4U6VL 4X5XA 1AC0A 1E4XL 5DWUH 2ORBL 4HH8A 2NY5L 4M1CD 3TT3L 1D5IH 3IJHB 4M7JL 2FSEB 5DJAB 2VLJD 1AP2B 1WBZB 2A6DA 1OLZA 2HT3D 2X4RB 4I18C 4DOHE 3BSZH 4TPRH 4I77L 5FIEA 3PABA 3KYAA 4PJ5D 3LEXA 3F58L 3UTSB 5EU3A 4URTB 3X17A 1W72A 1MJUL 1EO8L 3FO2A 2V2WB 5E8NB 2DM7A 1NGQH 3I6LE 1DL7H 3UXFA 3V4PL 4J3OC 1CT8B 4OD2B 5IR1B 4K7PX 3QRGL 4UAOC 4ODTL 3W2DL 4RBPH 3DXAB 5KSAC 1DVFA 3QIBB 1KXTB 4NKMB 4E41B 3GMNA 4YQXH 1UM4L 1BZ9B 3ROLB 1U8IB 1U8HB 1ROWA 4M7LT 3RTQB 1JYWA 1IZJA 3HKFA 4LQFH 5FUOH 3LAFA 2VL4A 3OJVC 4E0RB 3OQ3B 5A3IC 2XXMB 3V0WH 1D5ZA 5GZNC 2CKBL 1A9BB 2DQJL 3KAAA 5F9JA 2B1HL 2AK4E 2DDQL 4NJAL 4FZEL 4PRBA 5F7MC 1A6WH 2JJVA 4EN3B 3P0YH 2J5LC 1ZWIB 1G9NL 4L8DA 3L1OL 1WBXA 3VMNA 3ZHKA 4FQXC 5FKAB 5DHVH 5CD3B 3NIFE 3TWCL 1P6AB 5D70L 4HBQA 3U0PB 2DIJA 3OHXB 1J12A 3OWEA 5IVNA 5ADOH 2J8UB 2DQGL 4MCYB 3T4YA 2MQ0A 1KUMA 4HGWA 1FFQA 3GI8L 4QHUB 1F4WL 2C7UA 1IC1A 3T2OA 1RHHB 2DMKA 3KR3L 5L8KB 3GMRB 2DQUH 2H2PC 4H8WL 2R4RH 3JWOL 3CAFA 4OKVB 1VSCA 4HGKC 4NO0D 4LLUA 1PW3A 3DBXB 3A6OA 3KNBA 5CILH 3VXUE 3H6JA 5JUEL 3X11A 2X4OA 4LSSH 5IFAL 3P77B 4HWBL 3O8XA 4LFHG 2ZPKL 1IJ9A 1HH6A 3BH8B 4JKPL 3QEGL 1YEHL 3OAYK 1RZJC 4NHUA 4QRSA 1JI2A 2VDPH 4K8RD 1GIGH 5BS0D 1RZIA 1SEQL 3QEUB 3VG9B 4EZMA 3JZ7A 2XTJD 4UU9A 4WUUE 2N7BA 3LQMA 4IIQA 3PL6D 5I1EH 1WUNT 3WIIL 4GLRI 4K3GA 7CGTA 1LQSR 4LOUD 5CKGA 2ZNWA 2GJ6A 3CMOL 3WJJA 4UDTB 1SY6H 1YEJH 4GKOA 4P5TD 3C9NA 2JCCB 1I1AB 4G7VL 4MDIA 1K85A 2JK5A 1JHLH 3NVQA 5C09A 1B6UA 4WHYH 3GSVB 4OFIA 3EZ8A 3ESUF 1FYTA 1VACA 5LGHH 4WTZG 2YD2A 4PJ9A 1NC2D 5E2WH 2ESVA 2FX9H 2HAZA 3U48A 4XBEL 3HI1A 3VXRD 2WWKT 4RFNB 1MQKH 4MNHA 2YPLD 1XF5A 4BKLB 2IH1B 2VXQL 2X5PA 5E6ID 4YHML 5DC4B 3L5XH 1OWWA 2CO6B 4S2SB 4PTUA 1U3HA 3BN3B 4JO4L 3WEXA 4OV5A 2ADFL 1T1XB 1AGBA 3UJIH 1S7WB 1OGTB 4LSUL 3HNVL 4Q9RH 4HW6A 1F11B 1U93A 4KUZH 2J6EL 2ZCLH 1ZS8B 2QQQA 1ORQA 1FNLA 4QWWC 4UTAH 1E6JH 5BMFH 4X6CA 2MKWA 4O51A 2KPNA 1U95B 2JKXA 4NNYA 1WFOA 1WC7A 2VMFA 5DRXA 5JW4Q 1TPXB 3LS4H 4S1SL 5IGXL 2L7UA 1QSVA 1IGTB 4XP5H 3EYOA 1U92A 5EU4A 4NC0B 1QSFD 4I0CC 4PJ7F 4XPAH 4APQA 1S7UB 4NQSB 3L3GB 2B1AL 3OSKA 4TUJB 4WHTB 3BW9A 3FB6B 5D9SA 3QUKA 1F3DH 4M3JA 3MLRL 5AUMA 4MWFB 3MNVA 2K7PA 1UEMA 4PRNA 3S6CA 5I18L 3U83A 2VKXA 3BIKA 1ZT1B 3GSWA 4U1MA 1UXSA 3RJQB 1WCQA 2R4SH 1VB9A 3F7VA 1NDMB 2CJUH 2J8OA 4NQEB 3VGGA 4QRPE 1HHJB 2ADJB 3I3DA 5EC2B 2AV1B 2ZKHH 3MRJB 4QY8B 4F33B 4GG6F 2XZCL 2AXGA 4Q9CA 2E8ZA 2FDBP 3SO3C 5TPWL 4XWGH 4HF5H 2HFTA 4JPVH 2AV7B 3NIGE 4OCWL 3PWNA 1NH6A 2XNAA 2E6QA 3DHJA 1A6AA 5IQ7L 2B4CC 2FEDC 2W9EH 4A6YL 4PY7B 3GEWB 2XACC 5IMKB 4IRZL 1BAFL 1MFBL 5D72H 4PJHF 4Y4HA 3RL1B 3JTTA 3GSNH 1LEIA 3ULVD 4D9RD 3NH7H 4ISVB 4LCYB 3U36A 2QSTA 1RK1B 5CEZD 4MZ2A 4GS7C 5JIKA 2FATH 3QHZL 2NY0B 4N0FA 5C8JB 2PO6A 3DX7B 4NQDA 5DUML 3SGEI 1XGTA 3BGAA 1NPUA 3P0VH 4F37K 3DGGB 1IGYB 2BK8A 3OPZL 2JB5L 3DECA 5JXEC 3CFKB 1UADC 4KVNL 1KNOA 3UAJD 4NRZA 5SWZA 5TFSH 2QKIB 5CLWA 3WIHL 5E5RB 2WUCL 3SGDH 5BVJB 1BQHG 5E94B 2HH0H 1S8DB 2VLMD 4GUPA 5JOPD 4ZTPL 5DD3L 2AJZA 5DR5L 4EXKA 4Z7UA 5L2JA 4R96B 3BP7B 1EHNA 1ZHKB 2IAND 3HRZA 2I60L 3EFFB 2XG5A 5SWSD 4LLYA 2EICA 2BOBB 2EEDA 1M6OB 4ZSOE 3G6JB 1OAXH 5H2BA 1A6VH 3WUWB 3LEXB 3U4BH 3EOTH 1NCBL 5T1KD 3C5ZA 4WI4A 5KJRL 1HNGA 4W81A 5EULV 3EZJB 1RULH 3IF1A 1Q9OA 1IEAB 2XFXA 3CDGA 5F7YC 5L6YH 1W0WB 5FYKE 3GSQA 1SMAA 1QACA 2HP4A 5KVDL 3EBAA 4MGXA 4M03A 3WFDH 2OL3H 5I71B 4JPKH 2FJGA 4MJIE 4X0KB 1VGKA 2D7NA 4EQ2A 1E27B 3SCMC 1F97A 1T4KA 1AD0A 1IAMA 3AB0B 4G6JH 3HR5A 3C5SB 4JN1L 4UBDC 1LP9E 3I75B 3ARUA 4GMTL 4Y2DD 1BOGB 5JW5A 3IAGC 1CFQA 5F9JB 3D85B 4P4KD 3W0WD 2FHFA 2XZAL 2BNQE 3Q48A 3G04A 3VCLA 1AJ7H 3ZE1F 4H1LH 1SYVB 3D0VA 4MD4A 3RWJA 4L8DB 5JO5B 1KT2B 2MQ3A 4MAYD 1H3TA 4U7MA 4ONHA 3MJ9H 1CG9B 35C8H 5T3XL 1S7XB 5CGYC 4JKWA 4TSCH 2VR4A 3EJJX 3V7AE 1XH3B 1L6XA 3VJ6B 5E4IA 5FB8B 4PD4J 4HGWB 1R3HA 4P9ML 1T5WA 1OM3H 1A4KA 3RWGA 2DKSA 3ARGA 4DGYL 2V9TA 4JVUA 1JMZA 3IDIB 4EVNA 5MENA 5GJSH 5F8RC 3AXLA 5KVFL 4IMLB 2AJ3A 1KJ2A 1UGNA 2HA1A 4LLUB 4NP4H 3RU8L 3KNBB 3OX8A 4P5MA 5KVGH 5JHDE 1HIML 2CLRB 1TJHL 4K7PY 4PRIE 2AQ1A 4NN7B 3RVVD 3O8XB 1HH6B 2P8PA 4R26H 4I18A 2J2ZA 4TQEH 4WO4C 1JZ4A 4XCYA 1S7TB 3OKLB 1KTDA 4IDJH 3SKMB 3RL2B 1T04A 3BUYA 3MV8A 1XGPB 3QCTH 4IIQB 3GMOB 3B9KB 5EU6E 1XZ0B 2EDYA 4KMTL 4GG8B 4OZFA 2D9QB 1RIUL 2LQRA 3IU4L 3RJDA 2V5YA 3ARBD 4L4TE 4MDIB 4DFIA 1QLRA 4TSBH 5FYLL 3LQAL 3DI3B 5JXAL 1Z5LB 4XC3L 4OUUA 4QXGL 5T1DH 3DYOA 4HJJL 4I8DA 1M05A 2GI7A 3BPLB 5F44A 5HSFA 3QBTB 3L3HA 3CVHL 2Q8AH 3GMQB 5BW7C 4OZGE 4BJLA 1QLFA 5CCKH 1UB5B 1CGWA 2AVGA 3B9DA 4OD3H 5EZOL 3FMGL 3GMPA 1F4HA 4QHLB 1ZLVH 4QNPE 4Z7OE 5I1KH 1BECA 4ENEC 4GXUN 2W65A 1LWRA 3HMXH 3LIZH 4ZUVA 3RZCC 2H3NB 5DXWA 1XF1A 3ROOA 3TH4T 2YD5A 3FRPA 4JQIL 1EXUA 2G5BA 2GCYB 4OLZH 5D7JB 1OLLA 3BISA 3BWAB 3MSPA 4GSDL 3FQWA 4NNYB 4H0GA 4KK5C 3T3PF 5D2LE 1A6UH 1NEZB 5EA0L 1QEWA 2D4FA 1D5BA 1P1ZA 1J1PL 4YDKH 1YEKH 3KGRA 5EU4B 3TO4C 4J6RH 4NO5A 4Z95L 3SOBH 4APQB 4XMLH 1KELH 4JQXC 2CDFA 4KROC 5KTEH 2E3VA 4PR5B 1R5VA 1YPZA 2FD6H 3X14A 2MMXA 5AEAA 4N0CD 2D9CA 4EI5B 3EO9H 4OSUH 3MV01 5D1ZD 3TJEH 1HHHA 1BGXH 3HI6L 1FVCB 3CFDB 3F7VB 5IWLA 3IGAA 2FIKA 4M1DL 5SV3A 1I8LA 1PG7H 1TZGH 1NLDL 1AHWC 5TF1H 1U8KA 4KTEH 4M1GH 1SEBA 1T7WA 5HTSA 1TQCC 3IJSA 2YPKA 3DVGB 1M71A 3LD8B 4LCIH 3RIFK 1RUMH 3IFLL 4X9HA 5D6DA 5FECA 1DBAL 1JRHH 3DV4B 1JGLL 3BZ4B 3LVEA 3VXQB 2XNAB 5IBLC 1FL6A 1RMFL 5EOCL 4CU8A 4YXLL 3PWUA 2EXYC 4CJ1A 1EVTC 4P2RB 5E03A 3JTTB 2ZCKL 2NXZC 4XXCA 3C6SB 4WU5A 5FFLA 4P2OA 4L8SA 3U36B 3CDFA 2X4QB 4PREB 1FL3B 3OGOE 4OBRA 4RZCA 3TYFA 4JRXA 1WT5C 4OM1H 4PJXB 4YUEH 2PO6B 3UTTB 2EH7L 4HFWB 3DRQA 1IAII 1HILB 1YMMD 3FTGA 3B5HA 3H3PH 3MRHB 4JFFD 2HFFA 1KNOB 2D0FA 3WIFA 1MAML 3BGMB 3DX9A 3BD5A 3TVMA 3ALWA 2P5WD 4O9HL 5C08D 2R0LH 5F1SA 4NQVB 1MFDL 3HE6A 1BM3H 4M6MH 4PGEA 3Q6GH 1KGCD 4XCCH 1KCUH 5J7CC 4NFDA 2OQJB 3P9MB 5CUSL 5EWIL 2VDNL 3QEHB 1KXQE 1IRAY 5DJ2B 1P4IL 2RR3A 3OL2A 3QFJD 2QQNH 5JPNB 5FCSH 5JHLL 4JY5L 1Q0YH 1KSRA 1Q9OB 2AXFB 4XNYH 4WRLA 2NNAA 3HFMH 3EGSA 5DMIH 2X9YA 1JGUH 1NBYB 1EK3A 1C5DA 1KPUA 4XP4L 2FGZA 4F3FB 1T03L 1LK3H 4XVSL 1JNLL 4POZD 1TNMA 2VIRA 4IJ3C 5EOTA 2R0ZL 4G9FB 5I76A 4KDTC 1VFAB 1PY4A 4JPWH 3RX7A 1OVZA 3LEVL 4NGHL 4MQ7A 4KGLA 3MYJA 1AD0B 2B39A 2UZYB 5DK2B 4JFOB 4GH7B 4HIIB 1KB5A 2IFGA 2A73B 5F89B 3V5HB 3DSFH 5D2NC 4BYHA 1KEGL 1QFOA 4LF3B 3VCLB 1U6AL 4V2BA 3D0VB 3MR9A 4G9DB 1FNFA 1RPQA 4DTGL 1D9KD 4MX7A 3LKRA 2ZZUT 2YD1A 2JIXA 5ITBH 3ZYOA 1H8SA 1FO0B 4XI5C 1Q72L 1R0AL 3RVTD 1FH5L 5CP3A 3O9WB 1U8PA 1P2CA 3RNKB 4FFZL 3QZWA 4I9WE 1A4KB 5EBLA 4L9LA 4WWKC 2UUDK 3OB8A 1RIVH 3MYZA 4GAGH 4LP4A 3KYNB 1IQDA 6CGTA 4JZJA 3FB5A 1Y6KR 4HMEA 4KTDH 3MOBH 3QT2A 1YECH 1KJ2B 3MLZL 1DBML 3C6LC 4PJBB 2OM5A 4UIMB 5I16A 2EDKA 4PRHE 1W8OA 5JQ6H 4ODHH 2GFBA 4UOW1 3MLYL 1IBGH 3EFDL 4CKVX 2WNGA 2VLKD 2EC8A 3AAZA 3VFTB 2X4NA 1ZLSL 1KCVH 2Z91A 4NKDA 2CGRH 5D7LA 1WTGT 4PLJD 1KIQA 1KTDB 4I13B 1MNUL 4HMCA 3NBNA 5IB3B 3U9PL 3D3VA 4PJ8C 5AG9A 5F6HJ 4LLWB 3NA9H 1URLA 2DTML 2XKSA 4H88H 5L9DL 1G1CA 3BPCA 2DS4A 1LDPH 1LHZA 3KXFA 2OZ4L 4IRJC 4TVPE 2E7MA 3ETBF 4QRQB 5BCAA 2AI0L 5CFHA 1F45A 3FOMA 3HC4L 1G7LA 3L3HB 3ME0A 2YUWA 5MEQB 3BDXA 3GSRA 4PJAA 5DFWH 2EDRA 2VC2H 3GI9L 2Y07H 3I9GH 1INEH 3UYOD 3ZKND 3TIEB 1U2CA 2HKFL 4RGNB 1TTFA 2CK0L 5IMOA 3GJFH 1EJOH 4P2CG 3UPRA 1NUGA 2V7NA 2GAZA 1YDPA 4X80H 3DETD 4L3CA 2AK1L 1BFVL 1EAJA 3QNZA 3EOAB 2FB4L 4I0KA 3IETB 1EXUB 2V2XA 4WHYG 3HUJE 1NCDH 5GISL 1WCBA 3U0WL 1PKQA 3BP5A 2XG4A 1IC4H 2O5ZL 3BWUC 4G6MH 4FP8L 1UYWL 2OSLA 4KI5E 5J4MA 4TULL 2CUHA 3BP4B 1PJ9A 2RFXB 3GKZA 5KSBA 4WW2B 2ITDB 5F6IC 3SDDA 4NN5C 1P1ZB 1ITCA 5GGTA 5IEHB 3WS3B 5CJOH 3ZKXB 5SX5K 5L7XL 2CDFB 5D7KE 4GRLC 4AMKH 2P24A 4YDVB 2BX5A 1BBDL 2VKWA 5C0AB 4F7MB 1V7ML 3X14B 4F57L 5C07E 5ALBH 4HC1H 3K1KC 1OTTD 3BGFC 2AGJL 1NGZB 5DZOA 3P0GB 4N0UA 1WFUA 5T3ZH 1T3FA 3DX6A 4C83A 5DJ8A 1CFNA 3RVWC 3ARTA 3ARPA 4WO4A 1UG9A 5I8KH 4Y1AD 2Q76A 1U8MA 3CVIH 4Y88A 3MO1A 3D9AL 1U8KB 1SEBB 1DR9A 3P9LB 1GGTA 3IJSB 5HHOA 2VLRE 3MBEC 2AKRA 4XNZB 3SDAC 1T20A 4RMTA 1NFDF 5I19H 1XT5A 5DYOB 1A7OL 2BHYA 4Q6IC 3MCG1 4Y16C 2LU4A 2WQ8A 3K8MA 2YEZA 3V7MA 4XVUC 5EIQA 3BT2H 2BHUA 3VE0A 1MRDH 2X4UA 5F71A 3PWUB 1VEOA 4NOBA 4WFED 2ARJQ 4ODSL 1CLOH 1P7KB 4F8QA 5HGAA 2ZOLA 4ZQKA 4P2OB 5I73C 1PSKH 1YEDB 1EA9C 1DBKH 1FPTH 3TYFB 3TEUA 4OQTA 5D71H 1YYLL 2E7LA 1J18A 2BCKA 2EE2A 4ZS7H 1NDGA 3UTPD 5GSRA 1SJEA 3Q5YA 5BRZB 1S7QB 2W0KA 4A2MA 4LPVA 2HFFB 4PJIF 3BOVA 3KDMB 3QPXH 4ZXBC 1CU4L 3TVMB 3QXAA 4X6DB 3SJVD 4OV6F 2AJVH 3S36X 4ZO9A 4MNQA 1S7VA 3B83A 3QIWA 1BLNA 3QO1A 4Y5XB 3GO1L 5F97E 1FO0L 3CXDL 1GRWA 3HLAB 3TBVB 4WNQA 3QQ4B 4GBXA 3I6KA 5CD5D 4B53A 4Z77B 2WZPD 5C0NC 3FO9A 3TO4A 3AUVA 5LAXA 3CFCH 4LVOB 1J8KA 1P4BH 5M95B 1GOHA 5EUOF 5F7LB 2WQRA 3RUGB 5MEOB 1MCIA 4U6VH 4MJ5B 2NNAB 1E4XH 2ORBH 5HHNA 1JN6A 5EB9A 2NY5H 1MJJA 3BEWA 3ZT5A 3KLDA 3TT3H 1T1YA 1PFCA 1GC1L 4M7JH 4LVNC 3QXDB 2VIRB 5JLZB 5EOTB 5I76B 3RAJL 1AHWA 3R06A 1U8LA 4I77H 4MQXC 4S1DD 1ZSDB 2PF6A 3KPLB 3NIDE 2Y7QB 1UB6A 2BNRA 3F58H 4HG4K 4OLWL 5ISZD 2GK0A 2V7HA 4QRRB 1EO8H 4DK6A 2BVQA 3AS0A 2DIBA 2VLLA 1ZAGA 1RJZB 3P4OB 4MQSB 1V3LA 4G7YL 5JNYB 2EDEA 3SDCA 3V4PH 4CVUA 4GFTB 2DIAA 3QRGH 3O6FC 4ODTH 3W2DH 4C56E 1RV6X 2W1NA 3HAEH 3UMTA 1J1OL 1YEEL 5FF6A 4OCSL 1NFIA 2XQYK 1WTLA 2VITB 3Q2CA 4N9GA 3TC9A 3DJ9A 2YD4A 4MX7B 4YBLB 3TLRA 2F54E 3BX7C 2ATPB 2JIXB 3UDWA 3OXRB 5D5MB 3VDCA 5GXBB 4JFDB 3S37X 3RPKA 1JNHB 3NFNA 2JJUA 4EUPG 4D0CA 3EHBC 3MRFA 1P2CB 2CKBH 1J0HA 1HKFA 1S9VB 4AENA 1CZ8L 2OI9B 2DQJH 1NAMB 4LSTL 2HJFB 2NXYD 3MLSL 2B1HH 4L9LB 4TNVF 5EBLB 2VLJA 2DDQH 4NJAH 4FZEH 4YH6A 4OZHE 3CCHB 3MRQA 4MA1C 4MJ4A 5DRNA 4Z0BL 1G9NH 3L1OH 4P46D 4H1LG 1YJDL 4P5KA 1XF2A 3BEVA 5I16B 1BMGA 5D70H 3EYVA 3QDJA 3M1BB 4RCAA 1I8KA 3QJFA 3FQXA 1JPTL 2DQGH 5K93A 2RB8A 5IVXA 4JO1L 4OF6A 3GI8H 4NKDB 5E08L 3P11H 1F4WH 2A9NL 3OBAA 1JWUB 3WO3B 4O2CB 4P2QA 4L3AA 3KR3H 2VLRD 4NWTL 4H8WH 3HPJA 2Y1VA 3JWOH 1Z0MA 1XF4A 2X42A 3OKDB 1KXVC 5JUEH 4ZODA 2ZP0T 5LBSL 5IFAH 3BPCB 4HWBH 3MACL 2ZPKH 2O5XL 5CSZB 5DO2D 4JKPH 4PRAA 3QEGH 3L3KA 1YEHH 1ACZA 3ZZ1A 1IM9D 1UACL 3O4OB 1SEQH 1G7LB 4LPCA 2ITCA 2VB5A 3WIIH 1YQ2A 4I0PD 2FYYA 3CMOH 1UZ8A 4G7VH 1KCKA 5D2NA 1KOAA 3UPRB 2APWA 1YDPB 3MV9E 5D7IF 3LSOB 4H26A 3ZDXE 3MREA 4XRCA 4V1DD 5EBWA 2H32H 1R5IA 5JW4M 5I15L 1DEEA 1F6AA 1T2JA 2X44D 4XBEH 2NX5B 3F7YA 4HIEA 1RURL 4Z6AT 3SE8L 2VXQH 4PUBL 1KN2L 1FSKC 4NO0A 4YHMH 3CZFA 5JOFA 4N0CC 1WK0A 2BOCA 4LARL 4JO4H 4JVPA 4OLUL 2ADFH 1ERNA 3HG1D 3VXOA 4PJDB 4LSUH 3HNVH 5T3ZD 2I25N 2J6EH 1RZ7L 4X9IA 3ULUE 5BS0A 3QUXD 3S4SG 3S97C 3FT4B 5ETUB 5L2KD 3PL6A 1ZT7A 2HTLC 4RQQB 4OLYL 4P99A 4D0BA 5E1AA 2NY3B 1S5HA 4AEEA 4N0UB 4BFIB 4X5WB 4S1SH 5IGXH 2F8VA 4P5TA 5DJ8B 1CFNB 4IEFB 2Q86B 4RFOL 4YHLL 2DI8A 2XQBL 1U8MB 1K3ZA 1TJIL 5CWSA 1FORL 2AAVA 2EIEA 4NOFA 2VSCA 5IMMB 1NC2A 2B1AH 2AKRB 4U1GB 4O2FB 3MLRH 4F58L 5E6IA 5I18H 2YEZB 1EAPB 3ALPA 4YIQA 5CP7A 5A2FA 3VE0B 2X4UB 1TZHA 4KZDL 4OIBA 4XX1G 2W91A 5DZLA 1H3VA 3RVUD 3FCTA 3QIUD 1HDMB 1QO3B 3FFCA 4ZQKB 5C0BE 1HN1A 1T1WA 4P23C 5IHZB 2EZ0C 3G6DL 1HKLL 1BEYL 2D03L 2XZCH 1DN0B 1IE5A 5IHUL 5TPWH 1CICB 1JGDB 1NDGB 2NTFA 4PYHA 1QA9A 1IKFH 3F5WB 3ARVA 4KK8D 4OCWH 5E4EC 4Y19E 5IQ7H 4A6YH 1CFVL 4RRPA 3WN5B 3FZUC 3SDYL 4IRZH 1BAFH 1MFBH 5HPOA 5HGDA 1IL1B 1QSFA 3HZKB 1C7TA 1UA6L 4ZFFA 3ZTJH 1FZKA 5F3BB 3QO1B 2GW5A 3KS0H 5E8DL 5FO9A 3CUPB 3WFHA 4WNQB 2XQYG 3QHZH 1SBBA 3HMWL 2GJJA 4N1HB 1YN7B 4CVZB 5DUMH 4CU7A 1K4CA 1EJ6A 1S7RA 5A16B 3OPZH 3CFIC 5GRWA 2JB5H 1NAML 4F7TB 4KVNH 4YGVB 4G43A 4BFBD 3UTZA 1RZKL 1G6RA 1VFBA 1UXWB 2C1OA 4X4XA 3WIHH 2QV2A 3W82A 2WUCH 4RAHA 4G8IB 4LPWA 1XGQA 1BQHB 4X4MA 5C0JA 1ZA6A 5EUKA 2B5IB 4JRYB 4ZTPH 5DR5H 3CXHK 3BEWB 1T1YB 1ZT4A 3ZE0E 5C9JB 4BH7B 2I60H 3H2WA 1HYSC 2V9RA 1RY7B 3AVEA 1JNNL 1AE6L 3QA3B 1UB6B 2BNRB 1NCBH 2NY1C 1B4RA 5KJRH 1FYHB 2FJFA 2JCCF 5DUBB 2FNBA 3F7RA 3QI9C 4TNWK 4AIZA 3V6ZA 3SDCB 3MGAA 5HXMA 5KN5B 3B6SB 4UTBL 1FLRL 4JG1L 3HC0A 4NZRL 4JM2C 3V5KA 1BVLA 2QADC 4PFEA 1MHCA 4IHOB 4LLDA 4ZYKA 5KVDH 2IAMD 3MJ8A 5ID0B 2XPGA 4ORZC 5C3TA 2NW3A 3RKDD 3MCKA 3DV6A 3DXAE 4PG2A 4PTTB 4N9GB 3BHBB 4QTHB 4UZGA 4PJEE 4E42B 4E41E 1KPRB 3VXUA 2PW1A 1B0GB 1EVUA 4YDIL 2GEEA 4D0CB 4JN1H 3ARFC 4OF8A 4GMTH 5ACLA 2X89D 8FABB 4Y4FC 3WS6C 3LRHA 2IANA 5FDWB 2XZAH 3OKKB 5SWSA 4ZXBA 3MRQB 3RX8A 1T1ZB 4HWEL 2YUVA 4PJ5B 4WUUA 5T1KA 2C5DC 5HHXL 5D1XC 3FONB 5T1LB 3ZT7A 5T3XH 4U31A 4F9LC 3ZL4L 1WIOA 1Z6JT 4MD0B 5DEZA 5E99H 4NCDA 3T0ED 1FJ1B 4P9MH 2EYRB 4R97C 3UC0L 4HK0A 4DGYH 1V5JA 1II4E 3F12A 5H94A 1MSPA 4ZUUA 4DKAA 2J8UE 5JMOC 3L9RB 3CGTA 4UMGA 3WHE1 5KVFH 5DJXB 3RWEA 3RU8H 4FNLL 1HIMH 1KFAL 5DHVA 1TJHH 1ONQB 1O7SA 5C0RL 3FHQA 2DQEL 4ZUWA 1I1RA 3OJ2C 4G6AC 2M8XA 3JV6A 4PRAB 3INUL 4M7LH 1BREA 4P4KA 3VGAC 3W0WA 4U1HA 2PCPA 4I2XA 4JFED 3J7HA 3F62A 1JWMA 4YHKL 3JWDC 1OP9A 5FYJE 2F53D 4KMTH 2F58L 4MAYA 5EN2A 4HKJA 1MHHB 1RIUH 3VWJB 3IU4H 3V79C 1HK6A 4X4YA 5I75C 5E2UL 3D5OF 5FYLH 5C2UB 3LQAH 1S9WA 5JXAH 5DFVC 4XC3H 4XRCB 5MI0B 1DLHB 2MFNA 4QXGH 2EE6A 2J1KA 3DVNB 4HJJH 1R5IB 3QFDB 1L9NA 3ZE2E 2ZWLT 4X9BA 3F7YB 3CVHH 3BXNA 5KG9A 1PQZA 4JLRA 3CSGA 4Y4KD 3CZFB 1ZE3C 3MJGX 5EZOH 2Q7YA 4NZDA 3FMGH 3RP1A 2BOCB 1U3ZA 1MCLA 3PWJB 4MVBD 1IGML 2LTQB 2R23A 1SY6A 4AYFA 2PN5A 2BNUB 4DEPC 1CGSL 4S11A 3AREC 4QRPA 2ICWA 4KK9C 4JQIH 3W9DA 1MFAL 3S36L 2Y23A 3A6BL 3ZMRA 4MHHI 2DI7A 3JV0A 2XTJB 1FNGA 2GSGB 3OR6A 4XB8A 4GSDH 3W39A 4M3KB 3FO1A 5EA0H 1LEGB 4NPYA 3V0VB 3RX5A 3ARBA 5J13C 4YXKL 1U8OB 1J1PH 3QUMB 3DI2B 3O11B 1FN4B 1QFWL 3UBXG 2O5YL 4WU7B 3QQ3A 1OGAD 4FQHA 3WD5L 1NUDA 4ODBD 4TNVK 2F15A 5E7FA 1NC2B 4CN1A 3VXRB 3I02B 2YPLB 3FB7A 4U3XA 3UTSD 3RWFA 5E6IB 3G9VA 3RY5A 1JGEB 1N26A 1S78D 1ED3A 4YIQB 1R3KA 3HI6H 1A6TA 4UDUB 3B9VA 4M1DH 3MLPA 1KJVA 3BMWA 4QCIA 4W4OA 4WY7L 5H35B 1NLDH 3QIBD 3FCTB 4JFHD 1CDHA 4LGSB 5I6XC 1E28B 4NCC2 4R2GD 1NGYA 3ABZA 3KJ4B 3MUY1 5I74C 4G42B 4NQEE 2V17L 1MCPL 3IFLH 4UB0L 4WV1B 5IESL 1KENL 1WF5A 3E8UL 2E9WA 1VHPA 3FFDB 1DBAH 1T66C 4NQCD 1JGLH 2R0KL 3BAEL 1CFTA 1E4WL 5EOCH 4P9HL 4PP1D 4YXLH 1CDUA 3QUYB 4HUUB 4Z7WE 1KCRL 5CSGA 1I8MA 4TUOA 1SYSB 5HGDB 1DBJL 3VFOB 1EERB 1QSFB 3UJJL 2ZCKH 4ELME 3MJ7B 5IHLB 4ZFFB 4TUKL 1BPVA 2P7TA 4MA3A 4EN3D 2IMNA 4CU6A 2Y25A 3QB7C 4PV9B 2EH7H 2XN9B 4LCWD 5D1ZA 1FFRA 5CINL 1BJ1H 4ALAL 4NSKA 4G43B 5AWNL 3UTZB 4N0RA 4LHQB 1MAMH 4BK4A 4ZFOB 3CSYA 5JW4R 4WFHD 4JG0L 4O9HH 3T65A 1I7RB 4DZ8B 5C0JB 3CH1A 4LMQE 1MFDH 1ZA6B 3GSNA 1JUFA 3U46B 4NUGL 1CWVA 1U8JA 1LP9A 5CBAA 1ZT4B 5CUSH 5EWIH 3NCCB 2GTWB 2VDNH 1M7DA 3P73B 4UI2A 5HDOA 5KS9B 4Q7DA 4JFXB 4XBPA 1JPFA 1P4IH 5HHQA 4Q74A 5EBMB 2XYCA 4GG6A 3OKEA 3KYMA 3QNYA 5JHLH 4GAFB 3WFCL 1J87A 4KKNA 4PD4K 3G6JE 4AM0A 2PXYB 3DX8B 4KI5C 2FECI 1N6UA 4XP4H 5EIVA 3U6RA 4G8GB 1T03H 1BVLB 1MHCB 4LLDB 3VGFA 5I0DA 1I7TB 4XVSH 1JNLH 2XPGB 1I1AD 4GW4A 2R0ZH 1LD9A 4M61B 1B0WA 4BUGA 4JFFA 3PUCA 3TPUB 4GRMA 4Q58C 1I1YA 3LEVH 2VDLL 4NGHH 1IAKA 1JZ5A 1EEZA 4LCUA 2P5WA 5C08A 3ULSB 5ICZB 1GGUA 2FJHA 4JY6B 1YEIL 5HDQL 1UQSA 4MSWA 1IGJA 2CRYA 5T3XD 3DO7B 3EDDA 1KEGH 1F58L 4NQTA 4AQ1B 3G5XA 5DJZA 1U6AH 4JHAH 5SWSB 2MTPA 4M62L 4RMWA 3PGCB 3HAEG 3QFJA 4DTGH 1E4KC 5T1KB 2F5BL 1S7SB 5K59E 2VQ1B 2EDLA 1W72L 4WJ5B 5DVLA 5E2JA 2OL3A 4CN6A 5SX4I 3DMMB 1R0AH 1FV1A 4G8EA 3M17A 1FH5H 5AYUL 4L4TA 3VD5A 3E2HB 5E9DB 1XR8A 4OFKA 5C0DA 4FFZH 4IRSB 1RQ5A 3MNWB 2HT4C 4DGIL 5HJ3A 2HG5B 5E56A 4ZUUB 1OF2A 3O3UN 5BV7C 2NTSP 4GOSA 5LXGL 4FTVB 1SM3L 2ZSWA 2DBLL 4OZGA 4H1LA 5E00B 4Y7MA 1DBMH 1A4JB 1N8ZA 4TYUA 2VXUL 3MLYH 1AGFB 5DFTA 3EFDH 2K7QA 4Y2DB 2I24N 2ZUXA 2VUOA 3MJ9A 3QUML 3JV6B 2CDGA 1K9TA 3ISWA 3LZFL 1ZLSH 5FYLD 1MHEA 4JJHA 4ACPA 1T5XB 5E8PB 5KSVB 3U9PH 3EYQC 3QI9A 2CUIA 1X5AA 4YDLB 1H0DA 1T7XA 2DTMH 4ZS6D 3EYSL 4K94L 2CIKA 2WM0A 1S9WB 3C60D 5L9DH 3IDXL 1TQBB 3FN9A 5C70A 4RIRB 3SPVB 2OZ4H 1DEDA 1T22A 4KRPB 3HNSL 4PJXF 3QG7L 1E0OB 5GGRA 3L95A 4NNPL 3HC4H 5IW1A 5C0IA 2C4FU 2DMCA 5DHYA 3LB6D 1FNEB 3QUXC 1FYTE 4U0RC 3BRGC 2BC4B 5IMLB 4CBPA 3GI9H 3NZHL 1HH9A 3OAZK 5F9AC 2ESVE 5TE6L 4N1EA 5D1QB 2NY0D 2HKFH 2CK0H 2R23B 4Y4FA 3ARWA 5IW6A 2AK1H 1BFVH 1C12A 1N6VA 4LAQL 2FB4H 4CDHA 3W9DB 2WBJC 1MAJA 2CO7B 5GISH 3U30B 3KLAB 3U0WH 3OR6B 3U7AA 5JDJA 2O5ZH 2P46B 2Z92A 3QQ9C 4FP8H 1CK0L 4PBXA 1UYWH 2C1PA 3T04D 4X6EA 4TULH 1KV3A 3GGWA 3TBSA 4M48L 4Z7NF 3KWWA 4WDIA 1R3JA 4QYOB 1K5NA 5A2JH 2IGFL 1I1FB 2RIKA 2JJWA 4FQHB 4UINL 3T2NL 4ZFOL 3WE6B 1L0YA 3HMXA 4TTGA 3FB8A 5L7XH 5J8OA 1YZZA 1BBDH 3D39B 1TJGL 3N1GC 4NO2A 1FL5A 1NCAL 1A64A 1V7MH 4F57H 2ZUQB 4JFQB 3D25A 3P4NB 2AGJH 2UZIH 2DWEA 2B2XL 3R8QA 4LPYA 3O3AB 4YAQA 1FZJA 2OP4L 5C71A 1QRND 4GT7A 4M43H 3D9AH 4H5SA 2SEBA 5I8CB 3BZEB 4YHIA 5TGBA 4XNUL 2V2TA 1J0IA 3BYTA 1A7OH 4UUJA 4ZAKC 2Q6WB 4CAGA 2D0GA 1FCGA 5FOJA 2BXYA 1PDKA 5EBGA 2FO1A 5FO7A 2JLLA 3T1WA 1QFUL 4ODSH 2C26A 5CBEA 4ELKB 3BQUC 2HLAA 1G9MC 4KI1A 4WTWA 1H15B 4MA3B 2HJLA 3KPRB 2VDOL 4E5XB 4Y5VC 4KKBD 1IT9L 1EZVX 1FC2D 4P2RE 1C7SA 2E7BA 4HUVA 4KKLC 2D2OA 4HUKB 1YYLH 3X3GL 4FQQA 2R9HD 4FMKA 4UAOB 3GM8A 5J6GB 1ZA3A 5BZDA 4PJ7B 5KSAB 2YZ8A 4DN3L 4NQDE 2ED9A 3UTTE 3VXSB 5BZWA 2UWEB 1Y6NR 3IDGA 2KDGA 3O4LD 1C1EL 1Y18B 3K2MC 3VFVB 3WKML 2D7TL 4LDEB 4LBEB 3GO1H 1FO0H 3CXDH 3ZTJG 4P2YA 3REWB 1AXTL 1WV7T 2EDQA 3VI3E 4TTDD 3OJDA 4M4PA 4J4PD 2R1XA 5DK0B 1CLCA 3PF2A 1IEBB 1JPFB 3ILQC 4Z7UE 5HHQB 1MLBA 1MPAL 3GIVA 4X7TB 4GG6B 3EJZD 3KYMB 3BESR 5HYJD 2YBRA 3QNYB 4LLMB 2I5YH 4ZUSA 2WSKA 4FG6C 4AM0B 1AGDA 4J8RA 3B9KD 1G9NC 3QDHA 5ESVA 1LO2L 5GGSA 1GC1H 1QQDA 4PJHB 3VD9A 1K4DA 1YMMB 1EEYA 3BPOC 1LD9B 2C4FT 1OW0A 2BVPA 3H9SD 5DI8A 3RAJH 3Q0HA 5J0BA 1LE9A 5F1OB 1BZ7B 4OLWH 3ULUC 3BH9B 3O2WL 3S5LG 3RY4A 1NBVL 3BJLA 3GSOA 3SJVA 3MA7A 2P5WB 5C08B 2Z35A 4G9FE 2EDHA 4G7YH 3BDYL 4MSWB 4HDIA 1QP1A 5HVGB 1QBBA 3ZKMC 4POYA 2XXCB 2I07A 4J12A 3RHWK 3HB3C 1RU9L 1J1OH 3RNQA 1YEEH 4OCSH 5FGBC 3RGVD 1NKOA 5C6PB 3L7EA 3TM6A 1O0VA 1SJHA 3TCLA 4L3ED 3RIAK 5LG1A 5HGBA 2FR4B 1FV1B 5BJTA 3M17B 1U8NA 5D7JD 2H2SC 3TF7C 2VZ3A 4EUPB 3DWTA 4JREB 2W0FA 1CZ8H 1VFMA 4G3YL 4I3RL 4FXKA 4LSTH 2VH5L 3MLSH 2R15A 1BQLL 3P2TA 4GAJL 3IDYB 2VZOA 4ZFZB 2AEQL 1A1OA 4U6HA 2BXZA 4YX2H 4WW1A 1PX3A 4X98B 1U91A 4XWOD 4NKOA 2EO1A 3Q1SL 4OLXL 3BRDA 4H1LB 1YJDH 1N8ZB 4C54A 4HUWA 3HZMB 1OY3B 2AQ2A 5IK3A 4N0YL 1ZLVK 3E6FB 2H1PL 3OG6B 4NM8L 5TDOB 3CFJA 3MV11 4R3SB 4PJBE 3TN0C 1GYAA 1JPTH 4RAUA 3DRTA 3VGDA 1MCKA 4JO1H 4CMMB 5E08H 1HOCA 2A9NH 4R0LA 5HI5D 4XNMA 1TMCB 5KSUA 5DUPL 2X10A 4ZUTA 2BSRA 4NWTH 1D9KB 1QSED 5EPMA 4K71B 3VD7A 3UPCA 4F15C 4LRNL 4L8CB 4HS8L 1XGRA 5IOPB 1CXLA 5LBSH 4XVJL 2IQAB 2CIKB 3IJYA 3MACH 1C16A 4RGMC 4RMSA 2O5XH 3AMLA 4F7PA 5HYFA 1T2XA 1UACH 1RZ8B 4OM0L 2NR6C 1DUYB 3D0LB 4P46A 1HINL 3MNZB 1ZLWH 3CDCA 1GL4B 1Q9KA 2ICES 4OAWA 5DD1L 1OP5H 3KPQB 2DQIL 3NZ8A 4JO2L 5F7FA 1IAOA 4D3CL 4X6DF 3EUUA 4OFVA 1A1MB 4HAFA 4ZPTA 5IW6B 2VLKB 2YXFA 1NBQA 1VKXB 5GRJL 1J05A 4RGNE 4RFEA 3P4MB 1E4KA 5I15H 3QYCA 2VJXA 2VLRA 4DUWA 1QHOA 4RX4D 1XIWC 4FFVD 1RURH 1H5BB 3SE8H 4PUBH 2X1OA 3A67H 4X6EB 1G1YA 4PRDA 3BKJL 4LARH 3OTTA 4LLQA 4HHAA 1R3JB 4OLUH 4O4YL 2LU3A 3S88H 3BYYA 1G7JB 3D18B 1WIUA 1JTOA 3GJFA 5GSVB 1RZ7H 2BVEA 4Q2ZA 4XXDB 3QIBC 1FZMB 3S4SB 1J0JA 4MNGB 4GS7B 2BZDA 1X44A 3MRMA 4OLYH 4GKSA 5LVEA 5GGVY 3V5DB 4I0PA 3RTQC 5C0AE 1MEXL 3MBXL 5IEKB 2HMIC 1FZJB 4IOFC 4RFOH 4YHLH 1HXYA 2DI9A 2J88L 1OD7A 4AQOA 2PYFA 2XQBH 4YHYB 3PQYB 1DQTA 1TJIH 3UBXA 1FORH 5E8OB 2XWJA 3O41B 4FFWC 1WBYA 4U6YA 2SEBB 3PDGA 3BKML 5F7WC 3B2UC 4F58H 4UUJB 5DQDL 4PGCB 1XGUA 4ODWA 1KLUA 4XT1C 5GPRA 3D2UD 1EBPA 5FO7B 4HC1A 3GMLB 4M02A 2WUBL 3HNTL 5GIRB 4KZDH 1I7UB 1PGRB 1AFVL 1KYOJ 3HG1A 2DKUA 5D5MF 5GS3A 2B7DT 2FH8A 1P69B 4NJ9L 5CBEB 4Z0XA 4BSJA 5J9PA 3TFKD 1J7VR 3G6DH 3QULB 1HKLH 3QUXA 1BEYH 2D03H 3WDJA 3S96A 1MCRA 4HUVB 1BJ8A 5IHUH 3HCVA 5L2KA 3LKNA 4FQQB 1MI5D 4ZO8A 2P5EB 2XTLA 3O9WD 3T09A 1CFVH 1FIEA 3SDYH 1J86A 1RZJL 4L1HA 4Y1AB 2CLVA 2YOCA 1UJ3A 1QTYT 1UA6H 1XCTB 4KTYA 3SCMB 3GUTA 1MY7A 5E8DH 3LS5L 1KJ3L 5DTFA 3RWDA 2A77L 4PJGA 5DJ0A 4AL8L 2OX5A 3HMWH 3D6GA 2FEEL 3VG9C 4N8VG 2NZ9C 3H8NA 2E6PA 2P1YA 3F8UB 2V6HA 1NAMH 1YC8A 5B39G 3NPZB 1FIGL 2C3HA 3GIZL 2LV4A 4J3UA 1RZKH 2AJSL 1GPOL 2YBRB 2Z4QA 5DD0L 2FH6A 5DHXB 5EOQL 5IBUG 3NFPA 1NFDA 3QIUA 4ZUSB 5I1IL 1TTGA 2VISB 3QCVL 4TRPL 1LVEA 5CMAA 5JIIA 4PGBA 5L88L 3RUGE 2BVOB 1DQDL 5GGSB 1QQDB 1PBYA 5CEYB 4CRPA 4LHUG 3WUZA 2BVPB 3RPIA 3CMGA 3V4VL 3G5YA 3GSXB 1LE9B 2Y36L 4YGAB 1JNNH 3K2UL 2JJTA 2Q8BL 1FDLL 3SKOA 1T0MA 5HGHA 3SJVB 4D9QE 3TA3D 5DRZB 5F9DC 5I17A 2CLZB 5HDBF 5DC9B 1EZVY 2A0LD 4C59B 4HJGB 5E5MA 1EIBA 4UTBH 1ZTXL 2ICWI 4JG1H 4XZUB 5TE7L 5MHSE 4PJIA 4NZRH 4QF1B 4CGTA 4FFYL 2I07B 1MRFL 4HIXL 3LQZB 4XCFL 5BXFA 1DE4A 1PEWA 4BSWA 3VXMB 4PG9A 1TPXC 4ZO7A 3OKMB 3HZYB 3QUZD 1N59B 5KANG 3B2VL 3FO0L 3H3BC 4OT1L 2ADGB 4Y5VA 4XMKL 5D96B 3GSUB 5HHME 5HI4C 2DMBA 3QNXB 4PJDF 3TZVD 3STLA 5B8CA 4YDIH 3C09B 3PWLB 3IFPA 4GQ9L 4HPYL 4PJEF 2H9GB 2W0FB 2P43B 2VO5A 4FQLL 4FXKB 3ZHLA 5EUOA 1NSNL 2IH3B 4DCQA 5I1LB 4XC1H 4U1IA 3L7FA 4D94A 1U91B 5BO1L 4NKOB 4HWEH 5ISZB 4S1QL 3LDBB 3BE1L 3HAEA 5HHXH 3T0AA 3GK8L 3FT2A 1WJ3A 5IB1A 3I50H 2GITA 4AEIH 4HUWB 2HN7A 4W6YB 1AO7D 5ESAB 5IHBA 2YMXL 3DRTB 4PGZA 2B4CL 3RZCB 1ZLUK 3JBG7 3LKQA 3UC0H 4R0LB 2IAMA 2CKBA 5FK9B 1L9MA 4PBWD 4ZUTB 5EPMB 1NUFA 5LGJB 1AR1C 3MOAL 1IKNC 5FDYA 3VXNA 4J2XA 3QISA 4FNLH 1KFAH 3IJYB 5EZIL 3WFZA 2XWBB 3MFFA 5C0RH 4NQXA 3IFOA 2DQEH 5FA4B 2KBGA 3OGCA 1NEZG 2X89A 3VXTA 5I1JL 2Z31D 2I9LB 3INUH 1QPXA 1HSAB 2E9IA 2DBJA 4EI6B 4KROB 4YHKH 4P46B 4AH2A 2YK1L 4P3WA 2F58H 1Q9KB 1PX4A 3X3FL 5GS0D 5E2UH 3PXJA 5IB5B 3Q6FA 4ZPTB 5E2TL 4Z5RA 1OT1A 3T0EA 1F6FB 5BRZD 3RDTD 4YR6A 2ZG2A 5FGBA 4W6XB 2E9JA 4HWBA 1ZXQA 4XGZB 2BP3A 1TQCB 3K7UA 4DW2L 3F7QA 2NPLX 2F19L 5JOEA 4O5LL 1BFOA 3IAPA 3V6BR 1P5UA 1V7NL 3WFEL 1MLCB 4YK4B 2NX5E 1PKQE 4P3DA 3MRDA 3QRFM 5B4MD 2YN5A 3VH8G 1IGMH 1T21A 2X4PB 5AAWA 3L3OB 1CGSH 2DWDB 5KSBE 4HLJA 4X7SL 4MXQD 4XAKD 1IM9B 4Q2ZB 3T0DA 3SGDI 1MFAH 3A6BH 1QNZL 1X5YA 2PYED 3CK0L 2H32A 2F53A 3MRMB 3WSQL 5ICYB 4LKXA 4OZIB 3DIFA 4G8FB 4M8QA 1EHAA 4B5EA 2OTUB 3TPKA 1UWXK 3AB0C 1AR2A 4Y19A 4YXKH 3WKNA 1NQBA 2E7HA 2WWMD 4IOIA 1BZQK 1QFWH 2FECL 1RUAH 2O5YH 4N0UE 1A02N 4V1DB 3UBXB 3WD5H 2XWJB 2GT9A 2EDWA 25C8L 2ZUWA 2J6EA 1G7QA 1UVQB 4M00A 3WJLA 4QRRD 2MPAL 5HHOE 4Y4KA 4NRXA 3ARYA 5KVMC 1OP3K 5DDHB 4LVEA 2R2HB 3L6FB 4GKNB 4WY7H 5F88A 4CW1A 4N5UA 3O6KL 4F2MB 3ZO0A 1ZHLA 5C92A 2WINB 4QT5A 1OPGL 3S96B 2V17H 1JFQL 1MCPH 4HSQA 4UB0H 1MCBA 5IESH 1KENH 3E8UH 3LRSA 1YY8B 1R24A 2R0KH 3ZTNL 3BAEH 4JFDD 2QEJA 2GSIA 1R3IL 4PRPB 2HTKD 3OKNB 4GQPH 4HXAL 4WI2A 4P57A 4MMZC 1WAAF 2Q87A 4LSVL 1E4WH 4P9HH 1QPPA 3MLVL 3IJHA 2NY2D 3TYGL 2FSEA 4HPOL 5DJAA 1DBJH 5L0QC 3UJJH 4NN7C 3O8XC 1OGAA 1WBZA 2GQHA 3QDMD 4TUKH 2X4RA 3RWDB 5DJ0B 4ELMF 3OAYH 3AY4A 3UTSA 1AH1A 4IIQC 1BFTA 5C9KA 4PJCF 5E8NA 5CINH 1D5MB 4ALAH 3WJJC 1CT8A 4OD2A 5AWNH 5IR1A 1Z9MA 1FNSL 3G5ZB 4JJ5B 3DXAA 1N4XL 3NFPB 1XF3B 1NFDB 3QIBA 2XI9A 5GRVK 2CPCA 4A6YA 4BSVB 4JG0H 2FGWL 3MCLL 1BX2A 2HKHL 4NKMA 3TP4A 1MJ8L 5CMAB 3UJTL 2QQLL 1GHFL 3MRRB 2KH2B 4PJ9C 1BZ9A 3ROLA 1U8IA 4NUGH 1U8HA 4PGBB 3RTQA 3ZYJA 4NQCA 1KCSL 1MAKA 3ESVF 5TH2A 4E0RA 4JRYE 1I7ZB 2PW2A 5LQBL 3GB7B 4LIQE 1W0VB 1U3HC 3TBYB 1MELA 5J1AB 4KK6D 3VFRB 3G5VA 3WFCH 5I17B 4EN3A 3OB0K 3WIHA 3C6LB 2BNRE 4ORGB 3QEQB 5FKAA 4YZFE 5CD3A 2AEIT 3SKNB 1F2QA 3SEPA 1QR1B 5D7SL 4LCWA 3QDAA 2UY6A 3U0PA 1TLKA 3BP6B 1KF9B 1GGCL 3OHXA 2FZ3B 2EO9A 4JZOB 4NKQB 1G0XA 2VDLH 5IB4A 3K4ZA 4QHUA 5GZOC 5IFJB 3S5LA 4RMQA 1FG9C 4PJ8B 4LAJH 4APQC 1RHHA 3H7BB 3SBWC 2A74B 1VA9A 3GMRA 1J5OL 4M9OA 1YEIH 3BN9C 4I5BB 4WCYL 4YFDB 5HDQH 4UIKL 5HVHB 4OKVA 4FRWA 3DBXA 2JB6B 2MOVA 1F58H 1OCWL 5EUOB 4DCQB 4EI5C 1OTUC 4M6OL 3EIFA 1R3LB 4M62H 5IB2B 3QHTC 3BH8A 2F5BH 1NC4D 5FYKU 2VLJE 1I9IL 3U2SA 1MH5B 2HN7B 2UYLA 2F74B 1A3RL 4UQ2A 1F00I 4PJ5E 4Q9QL 5AYUH 3S35X 4DQOL 1DN2A 2W59A 1TVBA 4F37F 4BQ6A 2H6PB 3AU1B 2R2BA 4HX1B 3LKQB 4OI7A 1NCNA 1HHIB 1KIUA 4DGIH 2JCCA 4DOHB 1I1AA 2NY6D 3QCUL 5ADPL 4D8PB 5IVXE 2YZ1A 5LXGH 5IQ9B 3MMEB 1SM3H 2DBLH 3GSVA 5BQ7B 4J3TA 4Y4HC 2IWGA 1M7IA 3KHQA 2W60B 5DC0A 4G6FB 2VXUH 2J12B 4XP6L 4BKLA 2IH1A 3BZFB 4YE4L 4ZFGL 3VXTB 3PHOA 3QUMH 2W0LA 2PO6C 2XV6B 3LZFH 3DPBA 43CAA 1FCCA 1Z0NA 1T1XA 2D0HA 4ZOAA 4B0MM 1OGTA 3MGTA 2YRZA 4MS8C 4MDJB 1F11A 3VRLE 5IVZB 3TT1L 4JAMB 5DRWB 2FO4A 1ZOXA 3DVIA 1JRHI 1P6FA 3BGFB 4LSDA 3EYSH 3VFUB 4K94H 4C4KT 5JZ7D 1CICD 3IDXH 1B9ZA 4WGWB 4S0TD 5EIIB 4Z5RB 3T0EB 3KPNB 3UO1L 1Q1JL 3L3JB 3QG7H 1IGTA 3NCYS 4NNPH 4CADB 1ZHNA 3MBEB 4X99B 1BFOB 4UT7L 4ETYA 3NZHH 5HY9B 3C5ZC 1S7UA 3CU1A 3L3GA 5TE6H 1QVOB 4Q6IB 4Y16B 4TUJA 5EO1B 4WHTA 5DMYA 3E1F1 3MRDB 1BIIA 1SJXA 3N1FC 4MWFA 1N5AA 2VZUA 1G7PA 1DQML 4XAWL 5F7EL 1ZT1A 4LAQH 43C9B 3B3IB 1BWMA 2H26B 4JFEB 4U49A 5I73B 1JI1A 4NQEA 4Z8FL 1WQVT 2ADJA 5KS9F 5IT2L 2AP2A 1CK0H 5BS0E 2AV1A 3DIFB 3MRJA 4QY8A 3CVHA 5ERWB 2XTJE 4KQ3L 1Z2KA 1IQWL 3VD3A 1RHFA 4XTRD 3TBTB 3C60A 4HS3B 4HMDA 3LKOB 2IGFH 5E95B 5CLTA 1Q9LB 4X6CF 4LQ1A 4UINH 3T2NH 1FZOB 2GT9B 4PY7A 2DOCA 5IMKA 3KYOB 1TJGH 3THML 3NCYP 2ZSVB 1NCAH 5JDSB 5D7IB 3IDMA 2ICEA 5E24E 3MLWL 2B2XH 1RK1A 2YR3A 3GRWL 5DA0B 3VXRE 2V5TA 2YPLE 2XY2A 3HR6A 1DSFL 3NTCL 5SV4A 5C8JA 2OP4H 3DX7A 4JCMA 3O9WC 2IBZX 3IU3A 3DGGA 3DGCR 1IGYA 4HJ0C 3S7GA 3CFKA 1ZHLB 5FGRA 2VDKL 3ARGC 4MJ2A 4W6WB 4EEEA 2QKIA 4XNUH 1TVHA 2X4SB 5T5NF 4S1RL 5E94A 4KHTL 4JPIA 2GSIB 3EJYC 4P57B 1S8DA 3QDGB 4QGYA 4LVNB 3CIQA 4YXHL 1CXHA 3SGJA 1OARL 4AEHL 2ZUVA 4OIAA 3C2AL 4XH2B 1QFUH 4R96A 3BP7A 4QKXB 3TJHD 1GC1C 1S9XA 2Y6SD 1OGAB 1ZHKA 3RVXC 1KTLB 1BF8A 2D31B 1R5WB 3EFFA 4Z7QE 2ATKB 2OK0L 2FHBA 1OAUL 1FG2A 2VDOH 2BOBA 1M6OA 5F9WB 3G6JA 1IT9H 3WUWA 1QSFE 3ZT6A 4ERSL 2G9HB 3X3GH 3O6FB 5T1LD 3GM0A 3L3DB 1IEAA 4OCNC 2NZIA 4WHDA 1I3UA 1W0WA 5C0CD 4DN3H 5I1GL 1AKJD 1C1EH 1CE1L 5ILTL 4A6YB 3WKMH 4GAYB 1BX2B 4R2GB 1IC5L 2D7TH 1UZ6E 2ENSA 4LGRB 2B8OT 2Z8WC 4X0KA 5TE4L 4Z76B 2EYTB 2L7JA 1AXTH 3H9HB 1E27A 4R4NC 5DQ9B 5HD8C 4NQCB 3B5TA 4X4ME 3W11C 4QHMB 5TH2B 1JZ3A 4X8JB 2PW2B 4JFPB 3C5SA 1GGIL 1MPAH 4PY8I 3I75A 5B39A 1BOGA 4RGNC 4MA1B 4BH8B 3WLWD 2BY0A 4HEPG 2DQDL 3D85A 3KJ6L 4Z7UF 3G5VB 3CXHJ 1SYVA 4KKAD 3MPCA 5JO5A 1AC6A 1KT2A 3ULVE 3CD4A 4D9RE 2E5EA 4CJ0A 1LO2H 5AZEL 3QXTA 4LCWB 4ODUB 5CEZE 3VWJD 1YA5A 3V4UL 1CG9A 1OT2A 1S7XA 5CZXD 1KLFA 4PGJA 1W8NA 1XH3A 4WW2C 3M07A 3VJ6A 5FB8A 5IB4B 3NCFB 3O4LA 1ZVHA 3O2WH 2IALA 1NBVH 4NQUA 3S5LB 4NDMB 2ARWA 3ZKXC 3RIFF 3IDIA 5J11B 4O00A 2VTFA 3BDYH 1EUTA 4IMLA 3MRIB 3LN4B 3WNNA 2VLME 1KPVB 2CLRA 5JOPE 1PYWA 1RU9H 2Q20A 3MV7D 4OGAC 5INCB 4RWYL 1A8JH 4DAGL 5IV2B 3FL7A 1DVFD 4JANB 5IWLC 3DLQR 4P48A 1KB9J 5HYJA 5DS8B 1I8LC 2IANE 5DLML 2W38A 3H9YA 5SWSE 3U2SB 1S7TA 2UYLB 3OKLA 3BKCL 3SKMA 4JO3L 1P4LB 2X70B 4UQ2B 3RL2A 1XGPA 2EKJA 2NY4B 3GMOA 3B9KA 1TVBB 1XZ0A 3FT3A 2VE6B 5CJBA 1OTSC 5D6DC 4GG8A 5JA9A 4G3YH 4I3RH 2MQCA 2R2BB 2VH5H 5DT1L 1BQLH 4GAJH 4NNXA 5JPMB 4ZSOB 3ES6B 3H9SA 2AEQH 3T0XA 4U1JB 1Z5LA 2FWOA 5DEFB 1HZHL 1NMCC 3Q1SH 4OLXH 4OD1L 5K9QI 2D7OA 4PLKD 2IBBA 3FQRB 1M7IB 4XXCC 4P2OC 4KH2A 4N0YH 4L8SC 1TZIB 4R4BB 3GMQA 4NFBA 2H1PH 4NM8H 2HFEA 1NGQL 1UB5A 3PHOB 5DVKA 5FM8A 2YUZA 1HNFA 4QHLA 43CAB 4CVWA 4LLVB 2VAAB 1HQ4B 4PB0L 2VZ1A 4LDLB 1P7QB 1BBJB 3PV6A 4FQJL 1XR9A 5J3HC 3N0PB 1DZBA 4MJIB 1J8HD 2L4OA 5DUPH 3R8BB 3MGTB 2H3NA 3RGVA 1UKQA 2CIIB 4JQVA 3W0WE 2DQHH 2FO4B 4LRNH 1VCAA 4K9EC 4I2XE 5CIPB 3RI5K 3TVMC 1RZGB 2GCYA 1I3GL 4HS8H 5D7JA 4HKXB 4OF0A 2BSSB 4XVJH 1LE5B 3BWAA 3MRLB 4Y5XC 3AGVA 5B38G 3HE6C 4YPGB 1MF2L 2BMKB 4JM4L 5C0GA 3V9FA 1Q38A 1NEZA 4KXZH 2QR0B 3GMMB 4KDVA 1FHGA 2HT2C 2R2EA 3QUYD 4OM0H 3UZEA 3T8XA 2IPTL 3CJJA 1ZHNB 3QH3A 1HINH 2R39A 4LVOC 4WFFD 1V8HA 3SBWA 3CFEB 3X12B 1LO3L 2DQIH 4KHXL 4RMRA 2UWEF 1P9MC 4KV5F 4PR5A 3LPGA 4JO2H 1BIIB 4D3CH 1N5AB 1G7PB 2EXWD 4EI5A 2XN9D 3KPTA 5GRJH 5H8DA 1FVCA 3BIAX 3CFDA 5AG8A 2APFA 5C09D 3DUUB 4P23B 1CGTA 5F8QC 2OZ4A 3ZDYF 2NY7L 2OR9L 3SDXF 2BFVL 1QSEA 3MGOB 4JHZA 1UWEL 4XNXL 3IVKA 5JHDB 4MXVE 3VI4F 1QYGL 2FX7L 3CVHB 1ADQL 3DVGA 2VQTA 3BKJH 1A14H 4X6BB 4QXWA 1KJMA 4O4YH 3C60B 3STZB 4LP5A 1FVDB 3DV4A 3BZ4A 3S3PA 5C0FA 1WFTA 4WENB 3VXQA 2YD9A 1QZ1A 1KBGL 1Q9WB 1GGBL 5FGSA 5E2VL 5EU6B 5FOBA 3O3BB 1E4XI 4P2RA 3CPLA 1KULA 3C6SA 3IDMB 2ICEB 4PREA 2X4QA 1FL3A 3IS1X 4BFEA 2PXYD 1MEXH 3MBXH 3J8F7 1I8IB 2Y5TA 4PJXA 1UKTA 4KJQC 5SWQB 3UTTA 1ZK9A 1CL7L 2J88H 4G8GD 4HFWA 3IU3B 3OKOB 1YPZF 1HILA 2OI9C 3WFBL 2DM3A 3MRHA 4L9LC 1MFCL 3BKMH 3BGMA 4RX4A 5FGCE 2UUDH 2WBKA 5J57B 4KQ4L 4I48A 1TVHB 4JZJC 1W0YT 2NQCA 1OQXA 3DROA 5DQDH 4BZ1L 4OZ4B 4JPIB 2ADIB 5E6YA 4XPFL 1AGEB 4NQVA 2JTDA 2Z9TA 2MJWA 1X4ZA 4HFUH 3VG0L 4QHNB 1WIPA 2WUBH 3HNTH 1GXEA 5I2IB 1YNTB 1AFVH 3V52L 1GJIA 2OQJA 3P9MA 3O45B 4NJ9H 1S9XB 3QEHA 4XHJC 5DJ2A 2NY1B 3IXAB 3HPLB 2W9LA 5D93B 1FG2B 2Y5EA 4AIXA 2DN7A 1KC5L 5JPNA 1NJ9B 4UNTA 1MREL 5D2LB 2AXFA 3DMMD 1E6JL 1MFNA 2YSSA 4JM2B 3RGHA 1IM3B 4K07A 1H3XA 2QADB 1NBYA 3RA7L 1FAIL 1I9RL 3JV4B 1G6VK 4KKCD 1PZUB 4F3FA 5E9DD 1RZJH 1QRNB 4IRSD 2HVKB 4PJ7E 5FXCH 1D5XB 3IT8D 4G9FA 1VFAA 1HSBB 1QFWM 1KJ3H 3LS5H 3VFNB 3O4OC 2A77H 4LVHC 2P49B 4AL8H 4FTVD 3S35L 4G80A 1EV2E 3LKSB 4EUPH 4N8VB 5DK2A 4JFOA 4W70A 1OB1B 4HIIA 3V95A 4KJPC 5ID1B 1WVZA 4N5EC 1WICA 1FIGH 2A73A 3GIZH 5F89A 5B39B 2EDDA 1WLHA 3ZYZA 2IBZY 3QO0B 3V5HA 2AJSH 1GPOH 5DD0H 3CLEL 5EOQH 3NN8B 5IBUB 4LF3A 5I1IH 3QCVH 5SWZD 4TRPH 2BY2A 2VOTA 5D1XB 4GG6E 3U79A 4G9DA 4M4RA 5L88H 2DQCL 5HDLA 5FYKL 1DQDH 1X5FA 1FO0A 4K3DL 4FN0A 5HI3D 1MI5A 5FCUL 1OSPL 3I84A 1CXFA 3WHXB 4OF5A 3O9WA 4YBQC 4PV8A 4LHUB 4R97B 4WI5A 1CD1B 3V4VH 4HWZA 4KVCL 2Y36H 3RNKA 3K2UH 3SDDC 3O4LB 2Q8BH 1YMME 1CTNA 1FDLH 1NL0L 3G08A 1JTTA 2IALB 3O3EB 4KRPD 4JFFE 3KYNA 5SX5H 1IGIL 2IJ0C 5HVWA 4YWGL 1UCBL 1ZTXH 2P5WE 5C08E 5TE7H 3O2DL 4PJBA 4FFYH 4UIMA 1MRFH 4HIXH 2N4IA 1MFEL 5EC1B 5I1DA 5JA8B 4PJFF 1PYWB 3NCEB 2NY3C 5D1QD 1KGCE 2PNDA 5C86A 1UJTA 32C2A 1GGYA 3FOLB 3B2VH 3FO0H 5HYJB 3VFTA 1JCKA 4OT1H 1JWSB 5GGRY 1EX0A 4XMKH 2OTWB 4RNRB 3ARXA 4HUXB 1CYGA 3QFJE 5IB3A 4GQ9H 1MJ7L 5HYSG 3FT3B 4HPYH 5I75B 4U1GC 4LLWA 4FQLH 1UEYA 4LKCB 4NNXB 2G60L 3H9SB 1B0RA 4HIHB 5BO1H 2FWOB 2AJXL 4S1QH 3BE1H 4QRQA 3GK8H 2ICWJ 3KLHD 5F96L 3STBA 4WEBL 1BQSA 4KJWD 4O58L 3D39D 5MEQA 1QBLL 1T0NB 2VAJA 3MZTA 5I8OL 4XPTL 2HFEB 2YMXH 2XWTB 2A9ML 4U2YA 3QPQC 2E7LC 2XKNB 2B4CH 5CHNA 3SY0A 4PYGA 3AS3A 3TIEA 1OAZL 3AREB 2XT1B 3PV6B 1XR9B 3GDBA 3RGVB 1N7ML 2VXVL 3DSNA 5DMGD 5F7NC 3EOAA 1JV5A 3MOAH 2EIZB 4L3EB 5MEND 3IETA 3PP3H 2X1WL 3TNMB 2RQ8A 1X3DA 2C3VB 4GXVL 3MXWL 3TZVA 1A7QL 5FKPA 1BOYA 3QIWC 3PDOA 5EZIH 3UROR 5IW3A 3VWKB 5C0GB 3L5WB 4F9PC 5I1JH 3BP4A 2RFXA 4GBXC 5DVOA 4WW2A 2DQTL 2KUTA 2ITDA 4HV8B 3ZE1E 2R2EB 1JNJA 3T8XB 4FOMA 2XZQH 1YY9C 3ZSTA 1DQJB 3QH3B 3WS3A 5IEHA 2YK1H 3EKCA 4LSRL 4K7FB 12E8L 3KPRD 3X3FH 1QSZA 4YDVA 1AO7A 1ZANL 5C0AA 3BD4A 4F7MA 5A1AA 1KN4L 3U0TB 2DLGA 2B5IC 2F5AL 5E2TH 1J9CT 1NGZA 4PJAF 5KSAD 1J1XL 1F3DJ 2HLFC 3VXSD 2VLKE 4ONFL 5I74B 1SJVA 5FUZL 1INQA 4DW2H 1QSEB 2F19H 1T89A 4O5LH 3IVKB 1KYOK 3P9LA 1S3KL 5IM7B 1V7NH 4XP1L 1U9KA 3WFEH 3JVGA 1T6WA 1KJMB 1K2DB 4QRUB 5DYOA 3ZLQC 3SDCC 3VH8B 4K7PL 5A3ID 1PKOA 5E8EB 5GZND 4AK1A 5C0FB 1ITBB 2Z31A 4X7SH 4DGVL 1Q94B 3O6ML 1OAYL 1JYXA 3N50A 1QNZH 5H37G 1F2XK 5FOBB 1P7KA 3CPLB 2ZJSL 3CK0H 4NO3B 4YFLF 3U7YL 4FQXD 1NCUA 3WSQH 1W2KT 4HIJA 3ILPB 4HEME 3UDWC 5GRXG 5F1NA 1YEDA 2Y5TB 4M1CC 5BRZA 3RDTA 1S7QA 2M26A 3MZGB 1BVKB 4YHNA 1PZ5B 25C8H 4FABL 1NGXB 2NYYD 3KDMA 2HT3C 1X7QB 4FQPA 4I48B 3PQYE 1CDYA 1JGVL 2H2PD 4YHZL 3DROB 4X6DA 4NHCL 4ZD3L 2MPAH 2Q8AL 4Y5XA 3HLAA 3TBVA 3QQ4A 3UP1A 4NRYB 4NUJB 5FUCE 4Z77A 2AERT 3O6KH 2YXMA 3LIZL 4NT6B 1TFHA 4OF7A 4XX1E 1OPGH 4RA0C 2A6KB 1JFQH 1ORSB 2GKIA 2PYEA 2IPUK 3DTXA 3IAQA 4J23A 3T1FB 5MEOA 3RUGA 1P9MA 3DOSA 1CXIA 1WEJL 3ZTNH 4BQ9A 2X05A 3T3PE 4MJ5A 1HCFX 2YSSB 1R3IH 4HXAH 3KPPB 4LSVH 2OJZL 1M4KA 5SX4H 1EO5A 2Y9RT 3MLVH 5DEGB 3TYGH 4HPOH 4DZBB 4UT9L 3QXDA 2HWZL 5JLZA 3JWDL 4JDVA 2F8OA 1ZSDA 2IMMA 4Y1AE 5AAMA 1A6ZB 3KPLA 2Y7QA 3KG5A 4G80B 4HKZB 4QRRA 4OCMC 4QXUL 4X9GA 4WI6A 1MOEA 4JRXD 1RJZA 3P4OA 3D2UB 1VEPA 5JNYA 1CDGA 5FV1L 2OMNA 3UX9B 1IILE 1FNSH 5F1IB 1I85C 5E6ZA 1N4XH 1RJYA 2BSTB 5T5NG 2NW2B 1OD9A 1FFPB 2J8HA 2FGWH 2VL5A 2HKHH 3MCLH 2KKQA 4WFEE 1MJ8H 2P8MA 3UJTH 2QQLH 1GHFH 4QWWD 2VITA 4UNUA 2R0WL 4L5FH 3WXVL 3M45A 2ATPA 3OXRA 1KCSH 4PPTA 5D5MA 3BO8B 1AI1L 4JFDA 1MI5B 3JTSB 4IDLA 1JNHA 4CMHC 4P3CL 3OV6A 3CDYA 4PV8B 4OCXL 4HWZB 1S9VA 3UTPE 2YS4A 3C5JB 1U58B 1NAMA 3G08B 4NZUL 2HJFA 4OCYL 3QDMA 1F4YL 3CCHA 3OAUL 2I9TB 4K8RC 3GJEB 3FN3A 3SJVE 2XTJC 3MUHL 3PL6C 5D7SH 2MCPL 5I1DB 5ANMB 4YUEL 3M1BA 1GGCH 3QAZB 4LOUC 32C2B 5JIHA 4U2ZA 4NM4L 4P5TC 2HVJA 2E27L 2EDNA 1JWUA 4O2CA 1FFNB 3MXVL 1ND0B 3JWNC 2IEPA 3AC0A 2VABB 1J5OH 4PLKC 3N85L 4WCYH 1MCJA 1F3JB 3HS0B 4UIKH 5M94B 1LO5B 5JIPA 3OKDA 1I9JL 5E6IC 1OCWH 4F7EB 3Q6GL 2FIRT 1EBAA 2HJKB 4M6OH 1B0RB 4XHQA 4OZIF 2FEDD 5CSZA 2OJEA 4HD9A 3TA3B 3FQUA 1I9IH 1BF2A 5KW9L 5DSCB 3B8YA 2LAAA 2K3TA 5GRUL 1A3RH 4JEGB 4Q9QH 5ISZE 4ETQA 4DQOH 2VWEE 1F8TL 2XA8H 4WV1C 4QXTB 5K9OA 4O2EA 5CHNB 2EDJA 4XCEB 3SY0B 1KIPB 4LMQI 4KFZC 3PGFL 3FRUB 3D87B 3QCUH 5JXED 5ADPH 3QUZB 2WBJB 2FLRT 3LSOA 1YUHB 1JHKL 5ACZB 1MQ8A 3PQYD 1UM6L 2MHAB 3O0RL 3C8KB 1JV5B 1WISA 3WL9B 4XCNB 5ITFB 2YD6A 4KZEL 4WTZA 5IVXF 3TZVB 1A1NA 5FKPB 2NX5A 4JHBA 3MJ6A 3PDOB 4XP6H 4YE4H 3X13A 4C56B 1C5CL 1MVFA 1A6PA 1N0LA 4OFYD 2A6IB 4Z9KB 5DJYA 1A9EB 4TVPL 2Q1EA 2BVYA 4NFCA 5B3JF 3U4EB 2FCBA 4PJDA 3ARDB 4L4VB 2F54B 2IBGA 4MQTB 1F42A 1NC4A 5D7LD 3TT1H 4TNWF 4EOWL 3WO4B 2EDTA 1BQUA 1AO7B 3D3VD 3FT4A 4LCCB 1HWHB 5ETUA 3TH2T 4RQQA 1C08B 1T6VN 3IDJB 3UO1H 1Q1JH 4BFIA 1JPGB 4X5WA 2P5ED 4OZHB 1UWGL 3IXTB 2Q86A 1FVEB 1DDHB 1YYML 1AY1L 1INQB 4GRWF 3IKKA 4XBGB 4UT7H 2XA3A 3SCMD 1T80A 1UKSA 2Z8SA 2JF1A 4U1KB 3ULVC 3G9AB 5AZ2L 4ZAKB 5IMMA 4JY4B 2VRAA 5JW3L 4WVRA 4O2FA 4B50A 1DQMH 4UBDD 4U0QB 4XAWH 5CJQL 5F7EH 1EAPA 2Z31B 4Z7VF 1IBGL 3QXVA 3LPFA 3BQUB 1RJLB 2XRAL 4C57C 1FNHA 4WIQA 4Z8FH 3UAJC 4DKDC 1HDMA 1QO3A 4PG2C 5GS1A 4HIJB 5IT2H 1N2RA 1X4XA 4R7NB 5I8EB 4H20L 5IHZA 2VZVA 5F1NB 1ZHBB 4KQ3H 4MMXC 4XMPL 1DN0A 4OZFG 5CGYD 4WHCA 1CICA 1JGDA 2Q3AA 3RWIA 3KVQA 5KOVC 3RDTB 3F5WA 4YHNB 5DA4A 1N3NB 4WFGD 3WN5A 5F3HA 4X8XA 3BMVA 4NC1E 4U1SA 5ALCL 1CDJA 3THMH 1IL1A 4OTXL 4V1DE 1PY9A 3SE4A 3HZKA 1FFOB 4MD5B 5F3BA 2V5SA 3MLWH 3GRWH 1UT9A 4NKIL 5IROC 5C3LD 3CUPA 4HCRH 5KANI 3DMMC 4F9PA 1DSFH 3MV9B 4RMVA 3NTCH 5A40E 3EOYG 4U7SA 1YN7A 4CVZA 4ZPVA 3T3MF 3L5IA 4HS6B 3DURB 1MY5A 3VFPB 5A16A 4F7TA 5BV7L 4WO4D 3HG1E 3VXMD 4YGVA 1X5KA 1LO4L 2VDKH 1WZMA 3FRPG 5T3ZE 2PYEB 1UXWA 3DTXB 1TCRB 5GGUB 3I6GA 3KPOB 4G8IA 2WMPA 1BQHA 4KHTH 1MCHA 2APVA 2CK2A 4JRYA 4YXHH 5L2KE 5C2BL 1OARH 4AEHH 2YN3A 3C2AH 3BPOB 2RJMA 1ETZA 1CGUA 5C9JA 3RRQA 5I9QB 4BH7A 4Y2DC 3MRGB 2OK0H 4HUMB 1OAUH 4P4KC 4JDVB 4GO6B 4GW5B 3OR7B 3QA3A 4WWID 5F7UA 2GUOB 1MJUH 4ERSH 2OCFD 5DUBA 2APTA 4KWUA 2X7LA 4PJGE 4MAYC 4JDTL 3L5JA 3PWPD 5KN5A 3BZDA 3B6SA 5I1GH 4ENED 5E7BA 3VU2A 1CE1H 1RJYB 3RZCD 4IHOA 5ILTH 1FGNL 1GZPB 4YEFA 5ID0A 2VL5B 3NCMA 1IC5H 2P8MB 2O61B 2ARJB 1UM4H 4PTTA 2GTZA 1NFDE 3BHBA 5IG7B 4QTHA 5TE4H 4BQCA 3M8OL 4MNQD 1ACYL 3QWRD 1QHPA 2D3VA 4E42A 2OBGA 1KPRA 3SE3A 1D6EB 5JMRA 1B0GA 5GRYA 4KK5D 5FO8A 1YC7A 1GGIH 4LDOB 5I66A 1PG7W 2DM4A 2NY2B 8FABA 3GKWL 5C0BB 1ZMYA 3TO4D 2DQDH 2Z8RA 3KJ6H 3RVVC 4P59L 5FDWA 2B0SL 4EDWL 3QDMB 3OKKA 1ZGLB 3KPSD 1T1ZA 4LU5L 4KROD 1DFBL 4MB3A 1WAAA 4PJ5A 1SQ2N 4HGMA 3VRIA 3TWCH 3FONA 5AZEH 3TN0B 5T1LA 3V4UH 2F8XC 4R8WL 3NIFF 3IKCA 4GMSL 1CFBA 1A2YB 5C0CA 2FBJL 5D6CB 4PJIE 4DVRL 4MD0A 2HVJB 3ARBC 1AKJA 1FJ1A 2EYRA 2DF3A 5EO0B 3D69B 4JKMA 4F15B 1HXMB 3L9RA 3T2QA 1TVDA 2BDNL 4HXBL 5DJXA 4PY8J 3MRNA 3REVB 3LH2L 2C3XA 4RGMB 5IBLD 1ONQA 1L7IL 1YNLL 4JZNB 1DUZA 4RWYH 1CDIA 4DAGH 3IRZA 2EXYD 2EYSA 5EUOE 5DLMH 2OJEB 4B7IA 5FM5M 3FQUB 1RFDL 4W4OC 3WBDA 3VRJB 5CJXC 2NXZD 2WIIB 3BKCH 4JO3H 4ETQB 3NPSB 4JGMA 4Y5YB 1EHLL 1AXSB 3EYFA 5HYSA 1YMHA 5K9OB 4O2EB 1MHHA 1ZVYA 5IIEB 4L8BB 3VWJA 2G75B 4MHHG 2DQFA 5DT1H 1I85A 4MJ6B 1GOFA 1RIHL 2EDOA 2EIDA 3NMEA 1G9ML 4UQ3B 3S9DB 5LWYL 2KZWA 1JJUA 3PXHA 1HZHH 1DLHA 2VUYA 5AD0A 3DVNA 1XIWB 4OD1H 2FLBT 3QFDA 5DQJB 1CIDA 5J12C 4X83A 5E0QA 1A1NB 3MROB 2ENYA 5ESQA 5GS0L 2DLIA 3PP4L 3X13B 1NFKA 1HEZB 3QDJD 4I3SL 5DJYB 5HHPB 2I27N 4OQ1A 2UVFA 3CC5B 5D1ZC 5CEXA 3PWJA 4PB0H 1JPST 3MV7A 4FQJH 4NYLB 4MYWB 2BNUA 1NC4B 2IADB 4HQQL 3H9ZA 4RMUA 4P2QD 4PJEB 4OGXL 1A7RL 1I3GH 3VFSA 5GRVL 2GSGA 2D4DA 1SBSL 4QRTA 3C8HA 1HYRC 3AROA 3MLTB 5B38B 4TN9A 1MF2H 4JM4H 2CMRL 3RWCB 3SQOL 1AQDB 4PRPD 5DJ6B 1LEGA 3V0VA 4HK3N 2NY6B 3QZWG 1U8OA 5LGKA 3QUMA 3DO3A 2IPTH 3O11A 3T0EE 5HYQB 1FN4A 4G5ZL 3WNPA 4WU7A 1F6LL 3DUSB 1ZVSB 4HH9B 1WSST 4R7DB 1I3RA 1LO3H 4LEOB 4KHXH 2EE9A 3VXRA 3I02A 2YPLA 3W9EA 1JGEA 1X5LA 2ZOKB 2VDRL 2OTPA 4I4WB 4GW1B 4UDUA 5K9JL 1MRCL 3ULUL 1VEMA 5C0EB 1J8HA 2NY7H 2OR9H 5H35A 3T0VA 3P11L 2BFVH 2DJUA 3PJSA 1UWEH 4XNXH 5GS1B 2NYYC 1N2RB 4HKBB 1E28A 2YC1B 3NACL 1QYGH 2FX7H 2QHRL 1ADQH 3PIQB 4JFEE 4G42A 5F72S 4XI5D 4BFGA 4WV1A 2F53E 4GKZB 4RGOL 3L3IB 3FFDA 4MXVF 3N06B 3RWIB 1MWAL 1K6QL 1B4JL 2YD8A 3DARA 1KBGH 4WWKD 1FQ9C 3QUYA 4HUUA 4CNIB 5F3HB 1GGBH 3NIGF 5E2VH 4U1SB 4QOKD 1SYSA 3VFOA 3K8KA 3MJ7A 4IS6A 1X6NA 4NBYB 2A83B 3TBWA 3C6LD 3BD3A 4KAQL 1NBZB 2DLTA 1AGCB 3QEQD 4HZLB 5C7XL 4PV9A 1CL7H 5D7IE 5E5UB 4ZPVB 5DMKB 2XN9A 3NGBB 1ULVA 4JREC 1OAKL 4M9PA 3MA9L 3WFBH 3VFGL 4POZC 1MFCH 1TENA 2IFFL 1UH3A 2CSPA 3QWOA 3IDYC 4U7KA 5TDNB 4ZFOA 4KQ4H 3OKYA 4BZ1H 3I6GB 1JF1A 4PJ8D 1I7RA 4KJYB 4XPFH 4DZ8A 4N90D 3VG0H 3I3BA 4QGTA 2VYRE 5C6TL 1TETL 5DD3H 3U46A 2CDEB 2YA2A 3ARZA 3V52H 1ETZB 2GTWA 4AEFA 1YEGL 3QDGE 3P73A 5KS9A 4IRJD 4UNVA 1RUQL 2HRLA 4JFXA 4JDZA 4YC2C 1EGJL 5EBMA 3EO1B 3V6OA 2FX8L 3FFCD 1KC5H 2ZNXA 2R1YB 1OGAE 3H0TB 1BD2D 1MREH 1D9KC 2X7LB 3FQTB 2CR3A 4K71C 5GQBA 4JFYB 3HE7B 2PXYA 3DX8A 3UTSE 4Y0GA 3RVTC 3RA7H 1FAIH 1I9RH 1MCSA 4G8GA 1U8QB 3KPMB 5ICXB 1I7TA 1AIFB 2QSVA 2PETA 4M61A 3TPUA 4ZDHA 2GTZB 4JFHE 4WI3A 1BFSA 4YDJA 1FBIL 1N0XL 2WLYA 3S35H 4MB4A 3ULSA 5ICZA 1KB9K 3I6LD 4K3JL 4FXGB 5FO8B 4RSVA 4JY6A 4G6FD 3OAZH 4DFHA 5I66B 3P30L 4NQCE 1X4YA 3TESA 3DO7A 3CLEH 3HZVB 3E6HA 5EFIB 1JK8A 2EC9U 4RDQF 1LP9F 4U6XB 2YWZA 3PWVA 1SMOA 3PGCA 1OAQL 3UYPA 4GRLD 4PLJC 2EKSB 1S7SA 2VQ1A 3VRIB 3SHSA 2DQCH 4WJ5A 2WWKO 5FYKH 5IROA 3GZKA 1K3IA 3OJMB 4RAVA 1CDBA 4HLZG 4K3DH 1H5BC 3DMMA 5FCUH 3V8OA 1OSPH 3IKCB 4Z7WB 5C0CB 4KVCH 1IKFL 3RVWD 4LCWE 5E9DA 1AKJB 4ELMB 2AK4D 1YN6B 5IJVA 4IRSA 1B88A 1NL0H 3MNWA 4AIOA 3T0BA 1MCFA 2HG5A 4PJCB 5CIPH 1IGIH 3MBED 4WFHE 4FTVA 3SDAD 4YWGH 1UCBH 2FBOJ 3BRFA 1I4FB 5I30L 3O2DH 5E00A 3I85A 5CGMA 1A4JA 1H3GA 3MRNB 1MFEH 4Y16D 4A2LA 4XNQB 1NUNB 4XVUD 2CD0A 5K9KB 3ZKNC 1DUZB 1AGFA 1M1SA 4Y2DA 2EYSB 3DNKA 1J11A 3DETC 4YHYC 5T1MB 3LOWA 2GJZA 3OMZA 3VFMA 1T5XA 5FHBL 5E8PA 5KSVA 1MJ7H 1IARB 3EYFB 5HYSB 3VXUD 4X5XB 1YMHB 4OUOA 2DQFB 5DVMA 5FUCC 4RISL 2G60H 1KCLA 4MA7L 4RIRA 1HE7A 2AJXH 2A6DB 3SPVA 2OLDA 2DB8A 1X9QA 1EO7A 5AD0B 2JCCE 4LSQL 4ZXBD 3PE9A 4BZ2L 1T83A 3PABB 5F96H 1WGOA 1IAIL 2GY5A 4WUUD 5EU3B 4WEBH 4O58H 2N7AA 5ESQB 1W72B 1QBLH 3FO2B 2JJSC 1FNEA 5I8OH 4XPTH 1T7YA 2BC4A 3H42L 5IMLA 2A9MH 4LRIA 2EDXA 5J56B 1OTTC 4OZGF 1OAZH 5CEXB 5C0ND 5D1QA 3MV7B 1DVFB 1N7MH 2VXVH 5T3XE 4QNPF 4Z7OF 5FYJL 4M7ZB 3PHQA