5ADXA

Cryoem structure of dynactin complex at 4.0 angstrom resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
370
structure length
370
Chain Sequence
IANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKEQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACTIN RELATED PROTEIN 1
publication title The Structure of the Dynactin Complex and its Interaction with Dynein.
pubmed doi rcsb
molecule tags Structural protein
total genus 85
structure length 370
sequence length 370
chains with identical sequence B, C, D, E, F, G, I
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5adxA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5adxA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 5adxA03
4XH1A 3O1WA 4J8FA 1NGHA 5AQZA 3ZX0A 3WXKA 5BRFA 2Q36A 4H0XB 4K43A 3BEXA 5AQFA 2V51B 4BRLA 1KAZA 4IWVA 4JHDA 5AQMA 3SK3A 4FPAA 1KXPA 3VGMA 2YJEA 3AARA 1NGEA 3L0QA 3O5BA 3ZETA 4EHUA 3W3DA 5BRDA 3O8MA 3TU5A 1NGGA 1Z6RA 3ZEUB 3FZFA 4BR5A 4H5TA 2FSNA 2KHOA 2E1YA 3VOVA 1HX1A 2V7YA 1BA1A 3A8YA 4B9QA 4FWMA 2P9IB 3EKUA 2Q31A 3D2FA 3MCPA 1R59O 4KBOA 2E2QA 3A5OC 5B8HA 4XH4A 1X9JA 4BRCA 2D0OA 3DXMB 3ENOA 3EO3A 3D2EB 4H0VB 5E84A 1C0FA 1XQSC 2E88A 4BRAA 5CE3A 5AFUA 3BF1A 3RSEB 4CBUA 3VETA 3H1QA 3H1VX 4O5FA 3FZMA 3WXLA 4BC3A 2A5XA 1E4FT 3QICA 5ADXH 5LJWA 1XUPO 3FE1A 2FF3B 1RGIA 2Q97A 2CH5A 1HJOA 1H1VA 3IFRA 3P4IA 4CZIA 3D7EO 4F9OA 4H0TB 2V52B 5AQQA 4CBXA 1HKBA 3BF3A 3FFKB 4PL8A 2Q2RA 2P9KB 4H5NA 1DEJA 3MN5A 3WXIA 3MDQA 3CETA 5AQRA 3G25A 2CH6A 5AZIB 2W41A 1MWKA 4FWKA 4GY2B 4DCHA 4CZFA 3U9ZA 3EN9A 3FGUA 4RWTA 5AZJA 1BA0A 3FZKA 1V4SA 2FLOA 3SJHA 2GWKA 3H3OB 4FOIA 2P9LA 5AQWA 2A3ZA 2Q0UA 3GL1A 2VCPA 2IVNA 1D4XA 2E8AA 4CJ7A 3FLCO 2YJFA 1MA9B 5JMVA 5KPTA 1P8ZA 3VPZA 1BG3A 4BRPA 1CZAN 3W0LA 3ZX2A 4CZEA 3EKSA 1WUAA 1U2VB 3UKRA 1HKGA 5KQDA 1T6CA 4B1UB 5LY3A 4B1VA 4AM7A 1E4GT 4BR0A 3VESA 2VYPA 2ZGYA 3LDPA 3LDQA 4FSVA 2NZTA 3VF6A 4PKIA 1TYQB 1EQYA 3CJ9A 1OKJA 3CJBA 4K42A 3A5LC 3HZ6A 4H5RA 1S22A 2ITMA 1LCUA 1YVNA 5AQOA 3ZEUA 4H03B 4NB4A 3VEVA 3WQTA 2IIRA 1ZXOA 5AQKA 2P9IA 1RFQA 1TUYA 2A6AA 4PL7A 2GTDA 1NWKA 1T44A 3CJCA 3AAQA 3DXMA 4BC5A 4C23A 1K8KB 2HOEA 3D2EA 3A5NC 2NRHA 4CI6A 3VF2A 5JLFA 2ZGZA 5AQHA 3RSEA 3ID8A 1ATRA 2CGJA 2YCHA 2I7PA 4CZHA 4BR2A 4BRGA 3EL2A 5I9EB 1NGCA 2E20A 4WQ4A 4XEIA 1QHAA 4YDUA 4IJNA 4QS8A 2P9SB 3M3ZA 4BQLA 3DXKB 2CGLA 2F9WA 2QWRA 5TKYA 2A42A 4EFHA 3A5MC 3U9DA 5AQNA 2BUPA 2YHYA 3O80A 4B1XB 2PBDA 4EIAA 1GLDG 2E2OA 3M6GA 2F9TA 4CD1A 4CZJA 3IDHA 2P9KA 4BGAA 5KQ8A 1QQOA 4BRDA 1BUPA 2OANA 3FZHA 3SMSA 5AZIA 5FPMA 3MK6A 4M7XA 3L4IA 1C0GA 3LM2A 5AFUH 4JAXA 2HMPA 5AQIA 3L6QA 4FWLA 4JHDB 2IVOA 3UKUA 1QZ6A 2E2PA 3MN7A 4MLHA 4EAHD 4IJAA 4BVOA 1J6ZA 1GLBG 2P9PB 4BR4A 3WEEB 5AQSA 1NM1A 2P9NB 2E2NA 3HBTA 1XC3A 3H46O 5AQLA 4QS9A 4B1YB 5AQJA 3ZX3A 4H0OA 4B1ZA 4FWPA 4BRHA 3BUZB 3KZBA 3LDLA 4CZLA 1TUUA 3QMLA 4BR7A 1BOTO 5BPMA 1QZ5A 2EWSA 1U2VA 2GWJA 3I8BA 2D4WA 1JCFA 3EZWA 5AQGA 1GLEG 4A2AA 3QBWA 3IMXA 5BN9A 3CJAA 4IXCA 4B1WB 2QWLA 5F0XA 3C0BA 2Q1NA 2FSJA 4FL9A 3H45C 4CBWA 2GUPA 2YHXA 3AY9A 1QQNA 4WQ5A 1MWMA 2Q0RA 1IG8A 2FSKA 5BPLA 5BR9A 2BTFA 4JN4A 1JCEA 1NLVA 5F2RA 1SQKA 4BG8A 1RDWX 5BPNA 1YAGA 3CQYA 2H3GX 4IO8A 4AM6A 3ATUA 2UYTA 3MMVA 3GDQA 4A2BA 2QWNA 4CZGA 5JICA 2FF6A 4RCHA 2CGKA 5E26A 1HKCA 1ZBSA 1IJJA 3BP8A 5FPEA 3UB5A 4CZKA 3UE5A 1K8KA 2NLXA 5F1XA 4JD2B 1GLCG 3FZLA 2P9UB 2QWQA 5AQXA 5EY4A 1SAZA 4BQZA 2GELA 4I6MB 5BN8A 4Z94A 4M7YA 3IUCA 4ISGA 4BGBA 2P9SA 4FWRA 3WQUA 4DB3A 1LOTB 1BO5O 5AR0A 1X3MA 3WT0A 3C7NB 2ZWHA 3H6EA 5AQYA 3ULEB 1X3NA 4K25A 4BVPA 5KPZA 4IZ9A 3VERA 2D0PA 3ATVA 2ASOA 4BG9A 4BRNA 1DKGD 3QFUA 1SZ2A 2HF4A 3A0IX 1NGDA 3LM9A 5FPDA 1ATNA 1GLAG 2I7NA 3GG4A 2QW9A 1NGAA 3AAPA 3O1BA 2FXUA 3CIPA 4H5WA 4BRKA 2YHWA 2PAVA 3DAWA 2P9PA 2AA4A 4WYBA 4GNIA 3VGKA 3WEEA 4Y0WA 2P9NA 3TPQA 3MN6A 3CERA 3SMPA 3QDKA 4A61A 4BRQA 1MDUB 4PKGA 3CJ1A 3U4LA 4LC9B 3R9PA 5EX5A 4DHYA 4CZMA 3VENA 2VWBA 4E1JA 3VF4A 1NGIA 3WUHA 1HPMA 2QM1A 3VEXA 2W40A 1NGBA 3B8AX 1NGJA 3WXJA 4HTLA 1GLLO 3ZETB 3QBXA 3JS6A 4FWQA 4BROA 2A41A 5ADXA 4L3QA 3S41A 4WQ4C 3O6WA 5JLHA 1ZC6A 4ISEA 4YDUC 5KPRA 1GLFO 1BDGA 2YI1A 2ZF5O 4FOEA 2GEMA 1YXQA 3KVGA 3D2FB 3DJCA 1BU6O 2QWMA 5FPNA 2ASPA 1BWFO 1ATSA 3I33A 4H0YB 4HWIA 4BR9A 3SLCA 3GE1A 4BC4A 3F9MA 1V4TA 4FWOA 4RTFD 4FWNA 1S3XA 3HI0A 1Q18A 4H5VA 1TYQA 4PKHA 2HF3A 3KHYA 3VEWA 4M63C 1ESVA 3H3NO 3VGLA 1GLJO 1Z05A 3CHWA 2IVPA 4JD2A 1HUXA 2QWOA 3ENHA 2P9UA 1NMDA 3R8EA 1NGFA 3UKUB 2V7ZA 3GOIA 5BREA 3J8AA 2A40A 4I6MA 4DQ8A 1U6ZA 1Y64A 5LJVA 1DGKN 4QS7A 3VEOA 4BC2A 4JNEA 3O08A 2DPNA 1KAXA 3MN9A 3VEYA 3DWLA 2AP1A 1WOQA 1YUWA 3JXUA 5EVZA 4BRMA 3M1FA 4FWSA 5EXWA 3O4WA 3C7NA 3ULEA 3VEZA 5ELZA 2ASMA 3LL3A 1HLUA 3LDNA 3HM8A 4XH5A 3FR0A 4EHTA 1JCGA 3QFPA 5BRHA 1T6DA 4FPBA 4K41A 4O8KA 4MO4A 4A62A 4BREA 3CI5A 1KAYA 5AZJB 2QWPA 2QXLA 2E1ZA 2D1KA 4MO5A 4WQ5C 5AQPA 3U8XA 3DXKA 3QB0A 5AQTA 1G99A 2P9LB 3CQXA 1QQMA 3HTVA 3R6MA 4FO0A 4MLEA 4NO7A 4BRIA 4ISFA 4CD3A 5EOYA 3HSCA 3CJ7A 3LDOA 4BRFA 5AQUA 4H0PA 2WUSA 5AQVA 2J4RA 3GBTA 3OHRA 3UKRB 1NBWA
chains in the Genus database with same CATH superfamily
4XH1A 4JRPA 3O1WA 1CXUA 4J8FA 3NVKA 2W42A 4H0XB 5J2QA 4AQYK 5AQFA 4KI6A 3RMCA 1VQMN 1KAZA 4IWVA 3G10A 3LDSA 4FM1A 4M3WA 4FPAA 1KXPA 2D0CA 2YJEA 1XWLA 2Y1IA 3TU5A 2VGMA 2HNDA 3L3VA 3OY9A 3E66A 2E1YA 4DSFA 4GVMA 4NXMK 3A8YA 4B9QA 4CEQA 2HHTA 2P9IB 1BHLA 3SBTA 3V81A 3DXMB 4FM0A 3VQPA 4QOZB 5E84A 1XQSC 3KK3A 4LH5A 1WNSA 2HSTA 3BY5A 4L8RB 3VETA 5MLCQ 3H1VX 4DR3K 1BI4A 4B9TA 4LFAK 4O5FA 4J2DA 3M8PA 1E4FT 3QICA 1FK9A 5ADXH 4FJ9A 4M3UA 4FCYA 4CIGA 2O8FB 2EX3A 3KLGA 1VQ5N 3L2RA 2Q97A 2CH5A 3V4IA 3P4IA 3SI6A 3TANA 4JI0K 3PSFA 3ZYYX 4FLZA 2B5JA 4LF5K 1X9WA 1VQKN 4B9VA 3OYIA 1U4BA 2OPPA 3TABA 3G25A 2CH6A 2BGGA 5C42A 3O3GA 3K5NA 4FW2A 3SCXA 3L2UA 4GY2B 1XNRK 4B9NA 3VQ6A 3VQ7A 4JK7A 4OLBA 1CLQA 3RRHA 1BA0A 3J7ZO 3EYZA 3U6FA 1B92A 4IFYA 1N32K 2HHUA 3H3OB 4FOIA 1KCFA 3WNGA 2E8AA 4CJ7A 1P8ZA 1A5WA 5M1PA 1CZAN 4CJPA 2FBVA 1WUAA 1U2VB 3VQ8A 4B9SA 4B1VA 3CFRA 2UU9K 3RRGA 4FVUA 3LZIA 1RTHA 2D0AA 2ZGYA 1YJ9N 3LDQA 1HQUA 1W9HA 3VF6A 3RMAA 1TYQB 4DTNA 1OKJA 4IFEA 3OYGA 4DR2K 2ITMA 2E5LK 4IKFA 1LCUA 3SNNA 1YVNA 4IDKA 4CGDA 1VQ8N 3VEVA 1TAUA 4M45A 1JLGA 1BIZA 4IDHA 4CK2A 1KVBA 1TUYA 4O44A 4JS4A 1HPZA 4PL7A 3DLKA 1K73O 3WNFA 5FDLA 1S9GA 3E9LA 3F9KA 4C23A 3D2EA 3K5LA 3A5NC 3U3YA 3C94A 1Q7YO 3MX2A 3RSEA 4DMNA 2GX9A 3L8BA 3ZSOA 4YOXA 3THYA 4NXNK 4N76A 1C0UA 2A1SA 3TTCA 4BR2A 4Z4IA 3TAGA 1WSEA 5LL6Z 2F8SA 1K9MO 3M3ZA 4DQSA 2UUCK 5TKYA 1LW0A 3DOKA 4JEPA 3TAQA 2G8IA 2BUPA 2YHYA 3O80A 2PBDA 2E2OA 1J9AA 2F9TA 4WE1A 3VQ4A 3S3OA 1KQSM 2KZMA 2OANA 5GINA 4CHPA 5AZIA 3MK6A 3L4IA 2JLEA 4KTZA 1VSKA 1JLFA 2E2PA 4IJAA 1JJ2M 1TGOA 3SQ2A 2QEXN 1N5YA 2HVIA 4BR4A 5AQSA 2P9NB 4KB1A 2E2NA 4J2BA 3NH1A 1IBKK 3JAMO 4NCAA 4CIEA 4CFBA 4YOTA 3LDLA 3CQ8A 2X74A 3SUOA 3CCMN 1QZ5A 2EWSA 2D4WA 1JCFA 4C8NA 5AQGA 3DMJA 3CJAA 5F0XA 3DLRA 4IG0A 1RDCA 2Q1NA 1WN7A 2FSJA 4FL9A 1W2BM 3KK2A 5GAGP 2XY5A 5HRNA 3I55N 4CEAA 1WB9A 1S1VA 4CJRA 5HLFA 2WFBA 3DI6A 3RMDA 1NLVA 3CYMA 4ICLA 5F2RA 4BG8A 4AF1A 3THVA 3CQYA 3NFAA 2YNFA 3KD1E 3GDQA 1U49A 2QWNA 4CZGA 2DY4A 1RT2A 2CGKA 1ZBSA 2DFEA 3K59A 2F4VK 3NGZA 3HVTA 5FPEA 4DTMA 1K8KA 2O8CB 5T7BA 4FLUA 2VG7A 4DQRA 1QSSA 3OS0A 5KGWA 3QEWA 5AQXA 4BE2A 2PZSA 1SAZA 3BZCA 4NCGA 5JS2A 3N4QA 1RILA 4ISGA 2P9SA 3OVNA 3QNNA 3O4NA 2NRRA 4BECA 1BO5O 5AR0A 3VTIA 4DWIA 5JENA 1X3MA 1RBTA 5AQYA 1YF5L 3NAEA 3LP3A 3OYLA 4I7FA 4DFMA 1Q8IA 1TVRA 5C24A 4ZTFA 1HYVA 5C10A 3K2PA 3RMBA 3LAKA 1NGDA 5GIOA 4FK0A 4E7LA 4KFBA 4KHSA 1NGAA 3AAPA 4JKDA 5KRSA 3M5RA 5KI6A 1UA1A 4A59A 1CXQA 2AA4A 3TARA 2O8DB 4CERA 3HPGA 3AA2A 4IBNA 3TPQA 4DKWA 1S5JA 3MN6A 4I9QA 3AVBA 2G8WA 2O4IA 3QDKA 4DV7K 1ITGA 2HHIA 1G15A 2UUAK 3CJ1A 3R9PA 2FC0A 4FJKA 4DHYA 4CZMA 1HYZA 2PFUA 3HVRA 3L4QA 4E1JA 1DT9A 2X6SA 4CHZA 4O0IA 1ZBUA 1GLLO 4OLAA 4LSLA 3QBXA 2OCEA 4DTOA 5GADP 3S41A 4JK8A 3SPZA 4BACA 1XHZA 2ZJQL 4YDUC 1KSPA 2HHSA 2PYJA 4C1NI 4AHRA 4DQQA 3C95A 3AO1A 4DV1K 1S72N 3TTFA 2QKBA 3TTDA 5CZ1A 3TI0A 4GW6A 1WSJA 3TAPA 3KK1A 1A5VA 4W5TA 3QETA 2QWMA 3NF6A 2ASPA 3PSIA 5CYMA 2VQFK 4K8XA 3V1RA 3SLCA 3GE1A 4BC4A 3ISNC 3K5MA 3SQ1A 4FJGA 4FWNA 1VSJA 3KK7A 3KLEA 3KHYA 4DV0K 3AO5A 3VGLA 1RDUA 1BCMA 1JLQA 1ZBFA 3K58A 1W7AA 1NMDA 1NGFA 1MU2A 1TK0A 4RW7A 5BREA 4XJXA 4HVJA 3OTOK 1Y64A 2NRVA 4BC2A 4KREA 4BWMA 1EETA 3DWLA 1WOQA 1YUWA 4IOXA 2R7YA 4FWSA 5EXWA 3S9HA 4DV3K 2ASMA 4Z4HA 3OYBA 1RTDA 1JCGA 5BRHA 5E41A 4K41A 1N36K 4O8KA 3VQ9A 4LH4A 4Z4EA 1RBSA 3DRPA 4MFBA 2QXLA 4KRFA 1ASWA 1X9MA 4KHYA 4WQ5C 3U8XA 5AQPA 4N47A 4FZYA 3QB0A 3P31A 4JI8K 2P9LB 3HTVA 1QQMA 3CD6N 4MLEA 3AGRA 3LDOA 4BRFA 1IG9A 3NHGA 2OPRA 1KRPA 3ZSQA 4WFNL 3AA3A 3ASMA 2D0BA 2WTUA 1X1PA 2Z1HA 1EXQA 3QEPA 4K43A 5K14A 1VQ6N 4IOAL 4AHVA 3AO4A 5AQMA 5HROA 1VSEA 3VGMA 4OGEA 2OZMA 4E7JA 1NGEA 2O8EB 3W3DA 5BRDA 3O8MA 4LD0A 3KLHA 3DM2A 1J5OA 3ZEUB 1N33K 4KHPK 2FSNA 3WNHA 2KHOA 4KH4A 1BA1A 1SL2A 4FWMA 2HBLA 5CY4A 1O13A 1VQNN 3P83D 4KBOA 5B8HA 3EZ5A 4CJVA 2D0OA 3EO3A 1BISA 3QERA 4KPYA 4BRAA 2Z1GA 5AFUA 3H1QA 3TAFA 3OYJA 3OYKA 3FZMA 4CJQA 4BC3A 4GV6A 4JI4K 2OZSA 4O4GA 1IKWA 4OKEA 4E19A 2QK9A 3PLAA 1T05A 3AVMA 4YHHK 5HRRA 3TR8A 1RGIA 4CEEA 1H1VA 3IFRA 4CZIA 4WFAL 4H0TB 4OX9K 1HKBA 1JLEA 2Q2RA 3V6DA 4W5QA 3F2KA 4J2AA 4KKOA 3NE6A 3SV3A 3DOLA 2E6LA 4DSIA 2E6MA 2W41A 5I42A 1HR0K 1HNVA 3ZT2A 4CZFA 5M1FA 2ZQBA 2WC9A 4I2QA 3FGUA 3ZSVA 5AZJA 4CJ4A 2QTDA 3KIOA 3FZKA 5LMNK 1V4SA 2FLOA 2Q3SA 3C6AA 5AQWA 4CF9A 4YNQA 2P51A 4HUEA 2VCPA 1IKXA 3FLCO 3NBPA 3VN5A 1W97L 2VG5A 3VPZA 1BG3A 1NK0A 4MQ3A 4HUGA 3EKSA 3UKRA 1C1CA 4B1UB 2UUBK 4AM7A 1L3SA 1J5EK 1E4GT 3IS9A 4BR0A 3VESA 4EZ9A 3OYFA 3JYTA 3LDPA 1WSIA 4DTXA 4FSVA 5FROA 2YKNA 3T1AA 3IAYA 1EQYA 4K42A 1N6QA 2DFHA 3D45A 2Y1JA 3VTHA 4O55A 1LWEA 4DSLA 5KRTA 1YITN 1NK5A 3CYGA 1RDBA 1ZXOA 1L5UA 2A6AA 4I9LA 1VQON 5I3UA 1NJZA 4W5OA 4ILJA 2UXBK 4OPHA 4CI6A 4FJNA 2ZGZA 1UAXA 1ATRA 2VGNA 3O4QA 2CGJA 2YCHA 1YVUA 3ZSYA 2XY7A 4B3SK 4CF2A 4BRGA 3EL2A 4FVMA 4YDUA 4IJNA 4EP4A 4M3XA 4BQLA 2CGLA 2G8FA 4GKJK 3NGYA 3TSQA 2A42A 4JI5K 4B8AB 1R0AA 5HRPA 3C6HA 4X66K 4XIUA 1VHXA 5C0YA 1HYSA 3ZT0A 4CD1A 4BDYA 4JS5A 4LY7A 3IDHA 2P9KA 2KZZA 1RCHA 3HL8A 5HP1A 2P5OA 2QKKA 3AA4A 1VQ7N 1U04A 3ULDA 5AQIA 3L6QA 1SL1A 4FJIA 4CGFA 3F5TA 4EAHD 4FZXC 3AVHA 4BVOA 1J6ZA 2P9PB 1UWBA 1NM1A 1KC8O 3P5JA 3Q7BA 3H46O 3I8DA 1IH7A 4B1YB 4DLEA 4B1ZA 4BRHA 1HQEA 2XY6A 1TUUA 3THXB 4U67L 1BOTO 4V19S 1JLAA 4UY8O 1ILYA 4RG8A 3QIOA 2IS3A 3EZWA 1JKHA 1GLEG 3QBWA 3IMXA 5BN9A 1D5AA 4B1WB 3KWIA 3CCVN 2W6LA 3NCIA 4RW6A 3H45C 2JGUA 4FJLA 3MXMA 1EO1A 3AY9A 4JI7K 4WQ5A 5BR9A 1VSFA 5GAHP 3QESA 1KVCA 3V1OA 4JKEA 3VQAA 4E89A 3O9QA 4CGIA 3VQ5A 2H3GX 3ALYA 4AM6A 3ATUA 2UYTA 1IBLK 2AJQA 1ZYQA 3J7YP 4H4MA 2OTLN 2F96A 1B9DA 4A2BA 4CF1A 3SQ4A 1VQPN 1IV0A 4CESA 5E26A 1NG9A 1HKCA 3BP8A 3UB5A 3UE5A 4N56A 3HK2A 1NK6A 1VRTA 4F3OA 3KTQA 1YJWN 3VQBA 1GLCG 3SJJA 3T1HK 2P9UB 1VRUA 3L3UA 3P39A 3CC7N 3TWHA 1W0HA 4Z94A 4ELUA 4B3RK 2W6KA 3LPUA 4B3MK 4BGBA 4CHYA 3SAHA 2KKZA 3WQUA 2NRXA 3C6TA 1KFSA 3ULEB 3CF5L 1FXXA 5KPZA 1X3NA 4K25A 2WONA 2HW3A 3CCJN 1U48A 1I94K 4KH6A 1S1XA 1TKDA 1OVYA 5CHIA 2KQ2A 2ZJRL 3ATVA 2ASOA 4KAZA 4BRNA 2HF4A 3A0IX 1X9SA 1SUQA 4PY5A 1K6YA 2I7NA 1QSLA 3O1BA 3HXMA 2FXUA 2YHWA 3WEEA 4Y0WA 1QTMA 4IOCL 3HRGA 4U7BA 3CMEN 3SMPA 1Q9XA 4A61A 3PO5A 1NK9A 1YTAA 5DMRA 1NK7A 3R1XA 4HCCA 2JWLA 5A2QO 4CEOA 1HPMA 3LPTA 1NGJA 1GOCA 4QCLA 3KJVA 3CXCM 4KV8A 3NGIA 1LW2A 4CK3A 4CEBA 4Q5VA 4Z0UA 4BROA 1NKCA 5ADXA 4L3QA 1Q86O 4WQ4C 1FKPA 3O6WA 1ZC6A 2YNGA 1KTQA 2ZF5O 3ZSRA 2GEMA 1YXQA 3TSUA 5SZTA 2IAJA 2FBTA 3DJCA 1VSLA 1N8RO 1WLJA 3T69A 3OBWA 2YV0X 4BY9C 3VA0A 4CFDA 1RTJA 4KHWA 2HHXA 4FWOA 4RTFD 1KLNA 1BCOA 1BI4B 1Q18A 1HRHA 1B9FA 4PKHA 2HF3A 4CGHA 3QNOA 3M8RA 1NU0A 1M90O 1ESVA 3RR8A 4AHSA 4OPJA 3CHWA 3ENBA 3VQQA 3G4SN 2IVPA 2YHBA 4JD2A 1HUXA 3ENHA 2V7ZA 3GOIA 2EHGA 2A40A 4I6MA 1WAJA 1U6ZA 4DQ8A 4HHTA 1DGKN 4QS7A 4JNEA 1L3TA 4JV5K 3MN9A 2VQEK 5EVZA 4FLTA 3CC2N 3CG7A 3PUFA 4O0JA 3V9SA 3O9RA 3C7NA 1T7PA 4O8UA 1WSFA 3SQ0A 1HLUA 4M3YA 3HM8A 4O5BA 4EHTA 3QFPA 1RBUA 4W5RA 3KD5E 1T6DA 3V9WA 2Z1JA 3CPWM 3PV8A 4BREA 4BE7B 4JYAK 1KAYA 2F8TA 3D6RA 2QWPA 1NKBA 3K57A 4E0DA 5GAEP 2D1KA 4JKHA 3DXKA 4GV9A 1L3VA 4DV5K 5AQTA 1G99A 4CJ3A 1JXBA 3R6MA 4FO0A 4R79A 4NO7A 4BRIA 4ISFA 1RTIA 5EOYA 3CJ7A 5AQUA 4DU4A 3H08A 4H0PA 2WUSA 5J2NA 3CCUN 3CM6A 3GBTA 4DS5A 3HP6A 2O8BA 3OHRA 3WXIA 1SS6A 3OYDA 1J53A 4OO1J 3ZX0A 5BRFA 2Q36A 3MEDA 3BEXA 1IKVA 2B4JA 4JLHA 2V51B 1RBRA 2G8VA 4DR6K 4CVNE 4BRLA 4JHDA 3SK3A 4FYDA 4YY3K 2KLAA 4YOYA 1C6VA 3O5BA 4PA1A 3ZETA 3PY8A 4ZHRA 1Z6RA 4H5TA 4JI3K 5M1OA 4IFVA 3SUQA 2XO7A 4FK4A 3D2FA 2BE2A 1R59O 4CK1A 2E2QA 3SUNA 3A5OC 2HHQA 4XH4A 1X9JA 4AHUA 1CZBA 2IGIA 3D2EB 2B6AA 1TKZA 4FLWA 3AVGA 2HBKA 4KTWA 2E88A 4DUYK 3BF1A 3RSEB 4CBUA 3THYB 1ASUA 3K5OA 3Q7CA 1VSIA 4RW9A 2A5XA 3CMAN 3K0SA 1EP4A 1TV6A 4CFCA 4CHOA 5LJWA 1XUPO 3FE1A 1HJOA 3VQEA 4FLXA 2G8UA 4F9OA 3AVCA 3BF3A 3ID6A 2HMIA 2OA8A 2ZE2A 4YOWA 1DEJA 4C8OA 3MN5A 5AQRA 4X64K 5AZIB 3PIOL 3N4PA 1MWKA 3K9KA 4FWKA 3IRXA 2GBZA 3DLLL 1VSMA 1QSYA 3EN9A 2YNHA 3O3FA 4FW1A 2GWKA 4A57A 3ZLJA 2A3ZA 2Q0UA 3GL1A 4DR4K 2IVNA 1D4XA 3DLGA 2A1RA 1MA9B 2RN2A 5KPTA 3NH2A 2IC3A 4X65K 1S1UA 3AVIA 3DLBA 4WCEL 3LAMA 4LFCK 4E7KA 3OJSA 1ZBLA 2HB5A 1L3UA 3AV9A 2VYPA 4AHTA 5M1QA 2NZTA 3F73A 4PKIA 5FLXO 4E1NA 1Q81O 3A5LC 4DF4A 4PUOA 3MX5A 4H5RA 3V9ZA 2NUBA 5HRSA 5AQOA 2BH1A 3AVLA 1WAFA 4OVLA 5AQKA 4A5BA 3SZ2A 2P9IA 4FK2A 3LWMA 1RDAA 4ILGB 3SPYA 3VQCA 4PHTX 1NWKA 3CJCA 3QEXA 4Z4FA 4CE9A 3L2WA 3DXMA 1XMOK 4BE1A 2X78A 1K8KB 2HOEA 2IDOA 3OA9A 4OPAA 4OPKA 4FXDA 1QVGM 5JLFA 2RHKA 5AQHA 3LP0A 4BDPA 1SV5A 3HOTA 3DRRA 4FJXA 4GV3A 1BIUA 4CZHA 4E72A 5I9EB 4WQ4A 1RBVA 4XEIA 4QS8A 2P9SB 1OH5A 3DXKB 3QEVA 1HJRA 3EEQA 4KO0A 3U9DA 2O8FA 4F2SA 3BDPA 3VQDA 4B1XB 4KH5A 4B08A 4EIAA 1ZBIA 5FRMA 3IG1A 3CCRN 4BGAA 4CJTA 1QQOA 1BUPA 3FZHA 3EY1A 3SMSA 5FPMA 3AA5X 4M7XA 1CZ9A 3E9PA 3LM2A 3UKUA 4FWLA 4JHDB 1QZ6A 3MN7A 4KI4A 2D5RA 1LAWA 3LP1A 5AQLA 5CZ2A 3G71N 3ZX3A 4H0OA 5GIPA 4KB0A 4FWPA 1QS4A 3OJUA 4AH9A 2KFNA 4CZLA 4CEDA 1Y97A 4ID5A 4C8MA 4LFBK 1YIJN 1U2VA 2GWJA 1HNWK 2WOMA 1YJNN 1SKSA 4ELVA 2RPIA 4IXCA 2QWLA 1OH6A 4JI2K 3CCSN 2GUPA 2YHXA 4DV6K 3AVFA 1LWCA 1MWMA 1IG8A 2FSKA 3VMFB 1ASVA 1TK8A 2BTFA 1F21A 4JN4A 1JCEA 1SQKA 4EP5A 3L2VA 1OH8A 3E01A 3NMUA 4IO8A 3MMVA 2ZD1A 4HTUA 3IKMA 1JLCA 3QLHA 3ZT4A 4RCHA 5KTQA 2ZM6K 1IJJA 3LANA 2FBYA 2NNWA 4DU3A 3PX0A 3AVJA 4HCBA 4CJLA 2QWQA 3OYAA 2G8HA 3CCQN 1IBMK 1NK8A 4C8LA 3IUCA 5HOOA 1ZBHA 1OVQA 4FWRA 3JSMA 4GMJB 3WT0A 3BZKA 4H8KA 1LV5A 3KLFA 4NLBA 2RF2A 2F7TA 2D0PA 3PIPL 1T03A 1D9DA 1QHTA 4BG9A 1C1BA 3HPHA 1DKGD 3QFUA 1RT7A 3D0PA 3LP2A 4FJHA 2BANA 3LM9A 2LSNA 3GG4A 1FW6A 2HHHK 1T3VA 4FZZA 4H5WA 4BRKA 3L2QA 4CF0A 1HMVA 3QEIA 4YOUA 4K8ZA 1SKRA 4JI6K 2YNIA 4WYBA 2P9NA 3SYZA 2X6NA 3CERA 3AO3A 4FJ5A 1BGXT 4BRQA 5C2FA 3MXIA 1MDUB 4PKGA 3AGKA 4B3OA 5EX5A 3G0ZA 1VQ4N 3VENA 3T3FA 2VWBA 4DV2K 4B9MA 2VWKA 3P1GA 2W40A 3B8AX 3WXJA 4HTLA 3DRSA 3RWUA 3J80O 3JS6A 4FWQA 3MWTA 2A41A 1JL1A 4FLVA 4ISEA 3ZT1A 5AJ3K 5JVGL 5CR4A 1GLFO 4JKGA 2YI1A 4FOEA 2DTUA 4LF4K 3KVGA 3J81O 3WXMB 1BU6O 1NK4A 3E1YA 4KHUA 5FPNA 3PO4A 1BWFO 1ATSA 2P5GA 2KTQA 4E7HA 3I33A 4HWIA 4C1NK 4BR9A 4FLYA 3F9MA 3AVNA 1S3XA 3HI0A 2YX6A 4JRQA 3PX4A 1NJWA 3VEWA 2O8CA 3ZSZA 3H3NO 2UXCK 1LAVA 1NMNA 1GLJO 4LF9K 4CFAA 1EKEA 3ZT3A 3UKUB 4M3RA 4RW8A 3MEEA 2KW4A 4K0KK 4ILHA 4DQIA 5LJVA 4DF8A 3I56N 2DPNA 1KAXA 2AP1A 4BRMA 4CJSA 2RE2A 1DTQA 1NNEA 4DLGA 3KWGA 3C65A 3VEZA 4F4KA 5ELZA 4B8CA 2NRTA 3LL3A 3NDKA 4DV4K 3LDNA 2Z1IA 3FR0A 3HM9A 3QO9A 4A62A 5M1NA 4N41A 3TAMA 1XNQK 1VAZA 3CI5A 5AZJB 3ITHA 5DK5A 4DR5K 3CCLN 2E1ZA 4OKKA 3DLHA 4FJ8A 2G8KA 4DTUA 4DFJA 3CQXA 3ZSXA 2QI2A 3WNEA 3S5TA 2I5JA 4CD3A 3AVKA 1TL3A 3CC4N 4B9UA 1K8AO 4CGJA 2O8DA 2J4RA 3O3HA 3HO1A 1A5XA 3UKRB 4CF8A 3UIQA 1NGHA 3OYCA 5AQZA 3O9UA 1S6QA 3WXKA 1EX4A 4DTRA 3CCEN 1U45A 1QE1A 3AARA 2HHWA 3L0QA 4DS4A 1IO2A 5BR8K 1YT3A 4EHUA 1NGGA 3OW2M 3FZFA 1S9EA 4BR5A 3VOVA 1KLMA 1HX1A 3G6EN 2V7YA 2PYLA 3EKUA 2Q31A 3BGRA 3MCPA 1D8YA 4DSKA 1UA0A 3CM5A 1T8EA 2RKIA 4HUFA 4BRCA 1U47A 1BQMA 4C8KA 4G1QA 3ENOA 5M1KA 3MXJA 4H0VB 4Y1DA 1C0FA 5CE3A 1C1AA 2YKMA 1RT6A 3S3MA 4KHQA 4TSXA 3ZCMA 2ZJPL 3V1QA 4JKFA 2OTJN 4PWDA 3WXLA 3V9XA 4CCHA 3LZJA 5FRNA 2FF3B 3THWA 2OPQA 4OJRA 2HHVA 2NRWA 2XY8A 3U3GA 4CW7B 3D7EO 5SWMA 3PX6A 2V52B 5AQQA 3OBYA 4DFPA 4CBXA 4WFBL 3FFKB 4PL8A 3A2FA 2P9KB 4H5NA 1M1KO 4E3SA 3MDQA 3CETA 3MCAB 1XC9A 4DFKA 2E4LA 1GOBA 4G9ZA 3S3NA 3OYEA 4DCHA 4MDBA 4M41A 3SBGA 1NOYA 2GUIA 1XHXA 3U9ZA 4JKBA 4RWTA 4I2PA 4YOVA 2HNZA 3O9TA 3SJHA 4YFUA 4CGGA 2P9LA 4JKGB 2C1IA 2YJFA 1REVA 5JMVA 3T7ZA 4Q0BA 4CZEA 4BRPA 3W0LA 3ZX2A 4R5PA 2ETJA 2ATQA 5KQDA 3OS1A 1HKGA 1T6CA 1C0TA 3CFPA 5LY3A 4PQUA 3C6UA 4M3TA 4JI1K 4MDAA 4ELTA 3DLEA 3AVAA 3SV4A 3HOSA 2XHBA 2C1GA 4ID1A 2HVHA 4Y1CA 3CJ9A 3CJBA 3MWPA 3SAFA 2O8EA 3HZ6A 1D9FA 1LWFA 3MECA 4KTQA 1S22A 4F8RA 4M42A 5DM7L 1HNZK 4NLCA 4H03B 3ZEUA 4NB4A 4CEFA 3WQTA 2IIRA 3HP9A 3HJFA 1JL2A 3FFIA 1RFQA 1N34K 4JK9A 2HNYA 4H4OA 2GTDA 1T44A 4KHNA 3AAQA 2VWJA 3P38A 4BC5A 3NF7A 1HNXK 1KFDA 1EWQA 2NRHA 4IO9L 2IOCA 3VF2A 1BL3A 3ID8A 3HYFA 4B9LA 3VA3A 3M8QA 2I7PA 1TAQA 1TKTA 4X62K 4DSJA 1GOAA 1VSDA 1NGCA 2E20A 1Q82O 4OKJA 1NJIO 3KKRA 1QHAA 4FJJA 1YI2N 2F9WA 2QWRA 4EFHA 3A5MC 5AQNA 1TKXA 2O4GA 1GLDG 3M6GA 4CZJA 1RT1A 5C12A 4LF8K 5KQ8A 4BRDA 4IEEA 5JS1A 3I0RA 1C0GA 3LWLA 3CPEA 5AFUH 4JAXA 2HMPA 4CIFA 5IT9O 5HL7L 2IVOA 4MLHA 3RTVA 1QVFM 2P1JA 4EZ6A 3SUPA 1GLBG 3WEEB 3TAEA 3HBTA 1XC3A 3R3LA 4QS9A 5AQJA 5H1SQ 4ZTJA 3BUZB 3KZBA 4CEZA 5JVHL 5LMUK 3QMLA 4BR7A 5BPMA 3HPOA 3B6OA 3I8BA 3KKSA 4J2EA 5HBMA 4DTPA 4A2AA 1JXEA 1SL0A 4CHNA 3LALA 3CFOA 3C0BA 4CBWA 3HT3A 3ZSWA 4UQGA 4IG3A 5C15A 4DTJA 1QQNA 2Q0RA 5BPLA 4LF7K 4B3TK 1FKOA 1Z26A 1RDWX 4M3ZA 1RT5A 5C2DA 5BPNA 1YAGA 3THWB 4BEBA 4BDZA 5J2PA 1NJXA 1DTTA 1WBBA 5JICA 2FF6A 1NJYA 1S1WA 4FM2A 4CZKA 3O9SA 2NLXA 5F1XA 4JD2B 3FZLA 1OH7A 4GKKK 4BWJA 5C25A 5EY4A 4DU1A 5DM6L 4CJ5A 3KLIA 2GELA 4I6MB 4BQZA 5BN8A 4M7YA 3HSTB 3AO2A 3OYHA 3TSPA 2DFFA 1LOTB 4DB3A 1DLOA 2OPSA 3C7NB 2ZWHA 3H6EA 1RNHA 1E3MA 3K9JA 4BVPA 3E9OA 1NKEA 4IZ9A 3VERA 1TK5A 2PY5A 1JLBA 1SZ2A 3OYNA 4FJ7A 2HBMA 4JKCA 5FPDA 1ATNA 1GLAG 4QAGA 2QW9A 4CJWA 1I3AA 4AHCA 5IWAK 3SAGA 1C0MA 4CJEA 5D3GA 3CIPA 2PAVA 3DAWA 4JKAA 1P90A 2P9PA 1IKYA 1WSGA 4GNIA 3VGKA 5CYQA 4AILC 5J2MA 2O8BB 3OYMA 4CJUA 1RT3A 4N5SA 2HBJA 3T19A 5KGXA 3U4LA 4LC9B 1TL1A 2NRZA 1RDDA 1NOZA 3THXA 5TKWA 4LSNA 4DUZK 3VF4A 1NGIA 3WUHA 3VEXA 2QM1A 4Z4CA 1EWRA 1O1WA 1NGBA 2FBXA 2JWKA 4DR1K 3ZETB 3NF8A 4CHQA 4W5NA 1YHQN 3B6PA 3MEGA 1VQ9N 3J7AP 4DR7K 5JLHA 2YHAA 3QIPA 4Z4GA 4CJKA 5KPRA 1BQNA 1BDGA 2QXFA 3RVCA 3OS2A 1XI1A 5EU7A 1YTUA 3D2FB 4CECA 3NVMA 4RW4A 4E7IA 4DTSA 1XMQK 1VSHA 1KD1O 1J54A 4NYNA 3DYAA 2GV9A 2VG6A 1I39A 4F3TA 4NYFA 4GVEA 4H0YB 4NCBA 4DQPA 1V4TA 2ITGA 4E1MA 1VK0A 4H5VA 1TYQA 4F2RA 3QINA 4M63C 3MAQA 1KVAA 1Z05A 1SKWA 2QWOA 1QQCA 2P9UA 3R8EA 4WF9L 2OYQA 2UXDK 2QA4N 4BE0A 3T1YK 3J8AA 1Z25A 2BDPA 3VEOA 1S1TA 4DSEA 3O08A 4DG1A 4FJMA 3VEYA 3JXUA 3M1FA 1HNIA 3O4WA 3ULEA 1Q9YA 3NF9A 4XH5A 3EE9A 4FPBA 1VQLN 4MO4A 2KFZA 1WSHA 4CJFA 1WBDA 4OGCA 2XRIA 5J1EA 2W00A 3I0SA 4LF6K 2WBNA 1S6PA 4MO5A 4YORA 1FJGK 4A5AA 4IEIA 3V9UA 3NH0A 3HSCA 1UOCA 3M8SA 3RR7A 5AQVA 3EE8A 1RT4A 1NBWA
chains in the Genus database with same CATH topology
4XH1A 3O1WA 4J8FA 3NVKA 1NGHA 5AQZA 3O9UA 3ZX0A 4OO1J 3WXKA 5BRFA 2Q36A 4H0XB 4K43A 3BEXA 4WFNL 5AQFA 2V51B 1VQ6N 4IOAL 4BRLA 3CCEN 1VQMN 1KAZA 4IWVA 4JHDA 5AQMA 3SK3A 4FPAA 1KXPA 3VGMA 2YJEA 3AARA 1NGEA 2KLAA 3L0QA 4YOYA 3O5BA 3ZETA 4EHUA 3W3DA 5BRDA 3O8MA 3TU5A 2VGMA 1NGGA 1Z6RA 3OW2M 3ZEUB 3FZFA 4BR5A 4H5TA 2FSNA 3E66A 2KHOA 2E1YA 3VOVA 1HX1A 4KH4A 3G6EN 2V7YA 1BA1A 5M1OA 3A8YA 4B9QA 4FWMA 2P9IB 2HBLA 1VQNN 1O13A 3EKUA 2Q31A 3D2FA 3MCPA 1R59O 4KBOA 3SBTA 2E2QA 3A5OC 5B8HA 4XH4A 1X9JA 4BRCA 2D0OA 3DXMB 3ENOA 5M1KA 3EO3A 3D2EB 4H0VB 5E84A 2HBKA 1C0FA 1XQSC 2E88A 4BRAA 5CE3A 5AFUA 2HSTA 3BF1A 3RSEB 4CBUA 3VETA 5MLCQ 3H1QA 3H1VX 2ZJPL 4O5FA 4JKFA 3Q7CA 2OTJN 3FZMA 3WXLA 4BC3A 4GV6A 2A5XA 1E4FT 3QICA 3CMAN 3PLAA 5ADXH 5LJWA 1XUPO 3FE1A 2FF3B 1RGIA 1VQ5N 2Q97A 2CH5A 1HJOA 1H1VA 2NRWA 3IFRA 3P4IA 4CZIA 3D7EO 3ZYYX 4F9OA 4WFAL 4H0TB 2V52B 5AQQA 3OBYA 4CBXA 1HKBA 1VQKN 4WFBL 3ID6A 3BF3A 3FFKB 4PL8A 2Q2RA 2P9KB 4H5NA 3F2KA 1M1KO 4YOWA 1DEJA 3MN5A 3WXIA 3MDQA 3CETA 3MCAB 5AQRA 3G25A 2CH6A 5AZIB 3PIOL 3N4PA 2W41A 1MWKA 3K9KA 4FWKA 4G9ZA 4GY2B 4DCHA 4MDBA 3DLLL 4CZFA 5M1FA 2WC9A 3SBGA 4JK7A 3U9ZA 3EN9A 3FGUA 4JKBA 4RWTA 4YOVA 5AZJA 2QTDA 1BA0A 3J7ZO 3FZKA 1V4SA 2FLOA 3O9TA 3SJHA 2GWKA 3H3OB 4A57A 4FOIA 2P9LA 3C6AA 5AQWA 2A3ZA 2Q0UA 3GL1A 2VCPA 3CF5L 2IVNA 1D4XA 2E8AA 4JKGB 2C1IA 4CJ7A 3FLCO 2YJFA 1MA9B 5JMVA 3T7ZA 5KPTA 1P8ZA 1W97L 5M1PA 3VPZA 1BG3A 4BRPA 1CZAN 3W0LA 3ZX2A 4CZEA 3EKSA 1WUAA 1U2VB 3UKRA 1HKGA 4WCEL 5KQDA 1T6CA 4B1UB 5LY3A 4B1VA 4AM7A 4MDAA 1E4GT 4BR0A 4FVUA 3VESA 2VYPA 2ZGYA 3LDPA 1YJ9N 3HOSA 5M1QA 3LDQA 4FSVA 2C1GA 2NZTA 3VF6A 4PKIA 1TYQB 1EQYA 3CJ9A 1OKJA 3CJBA 3MWPA 4K42A 3SAFA 1Q81O 3A5LC 4IFEA 3HZ6A 3MX5A 4H5RA 1S22A 2ITMA 1LCUA 3VTHA 1YVNA 5AQOA 5DM7L 4NLCA 4H03B 2BH1A 4NB4A 3ZEUA 1VQ8N 3VEVA 1YITN 3WQTA 2IIRA 1ZXOA 5AQKA 4IDHA 4A5BA 2P9IA 1RFQA 1TUYA 2A6AA 4JK9A 4ILGB 1VQON 4PL7A 4PHTX 2GTDA 1NWKA 1T44A 1K73O 3CJCA 3AAQA 3DXMA 3P38A 4BC5A 4ILJA 3E9LA 4C23A 1K8KB 2HOEA 3D2EA 3A5NC 3OA9A 2NRHA 4OPAA 4OPHA 4IO9L 4CI6A 3VF2A 1QVGM 5JLFA 2RHKA 2ZGZA 5AQHA 1Q7YO 3MX2A 3RSEA 3ID8A 2GX9A 1ATRA 2VGNA 4YOXA 2CGJA 2YCHA 3HOTA 2I7PA 1NBWA 4GV3A 3TTCA 4CZHA 4BR2A 4BRGA 3EL2A 5I9EB 1NGCA 2E20A 4WQ4A 1Q82O 1NJIO 4XEIA 1QHAA 4YDUA 4IJNA 4QS8A 2P9SB 1K9MO 3M3ZA 4BQLA 3DXKB 2CGLA 1YI2N 2F9WA 2QWRA 5TKYA 2A42A 3TSQA 4EFHA 3A5MC 3U9DA 5AQNA 4JEPA 2BUPA 3C6HA 2YHYA 3O80A 4B1XB 4KH5A 2PBDA 4EIAA 1GLDG 5C0YA 2E2OA 3M6GA 2F9TA 4CD1A 4CZJA 3CCRN 5C12A 3IDHA 2P9KA 1KQSM 4BGAA 5KQ8A 1QQOA 4BRDA 1BUPA 2OANA 4IEEA 3FZHA 5GINA 3SMSA 5AZIA 5FPMA 3MK6A 4M7XA 3E9PA 3L4IA 1C0GA 1VQ7N 3CPEA 3LM2A 5AFUH 4JAXA 2HMPA 5AQIA 3L6QA 5HL7L 4FWLA 4JHDB 2IVOA 3UKUA 1QZ6A 2E2PA 3MN7A 4MLHA 3F5TA 1QVFM 4EAHD 4IJAA 1JJ2M 2QEXN 4BVOA 1J6ZA 1GLBG 2P9PB 4BR4A 3WEEB 5AQSA 1NM1A 2P9NB 2E2NA 1KC8O 3HBTA 1XC3A 3Q7BA 3R3LA 3H46O 5AQLA 4QS9A 4B1YB 3G71N 5AQJA 3ZX3A 4H0OA 4B1ZA 5GIPA 5H1SQ 4FWPA 4YOTA 4BRHA 3BUZB 3KZBA 3LDLA 5JVHL 4CZLA 1TUUA 3QMLA 4BR7A 4U67L 1BOTO 5BPMA 1YIJN 3CCMN 1QZ5A 2EWSA 4UY8O 1ILYA 1U2VA 2GWJA 3I8BA 2D4WA 1JCFA 3EZWA 5AQGA 1GLEG 4A2AA 3QBWA 1YJNN 3IMXA 5BN9A 3CJAA 4IXCA 4B1WB 3CCVN 2QWLA 3KWIA 5F0XA 3C0BA 2Q1NA 2FSJA 4FL9A 3CCSN 3H45C 1W2BM 4CBWA 2GUPA 2YHXA 5GAGP 1EO1A 5C15A 3I55N 3AY9A 1QQNA 4WQ5A 1MWMA 2Q0RA 1IG8A 2FSKA 3VMFB 5BPLA 2WFBA 5BR9A 2BTFA 5GAHP 4JN4A 1JCEA 1NLVA 5F2RA 4JKEA 1SQKA 4BG8A 4AF1A 1RDWX 3O9QA 5C2DA 5BPNA 3NMUA 1YAGA 3CQYA 2H3GX 4IO8A 4AM6A 4BEBA 3ATUA 2UYTA 3MMVA 2OTLN 3GDQA 4A2BA 3IKMA 2QWNA 4CZGA 5JICA 2FF6A 1VQPN 4RCHA 2CGKA 5E26A 1HKCA 1ZBSA 1IJJA 3BP8A 5FPEA 3UB5A 4CZKA 3UE5A 2NNWA 1K8KA 3O9SA 2NLXA 5F1XA 1YJWN 4JD2B 1GLCG 3FZLA 2P9UB 2QWQA 5AQXA 5EY4A 3P39A 3CCQN 3CC7N 1SAZA 5DM6L 4BQZA 2GELA 4I6MB 5BN8A 4Z94A 4M7YA 3IUCA 3N4QA 4ISGA 5HOOA 4BGBA 2P9SA 4FWRA 3TSPA 2KKZA 3SAHA 2NRRA 3WQUA 4DB3A 1LOTB 2NRXA 1BO5O 4BECA 5AR0A 3VTIA 1X3MA 3WT0A 3C7NB 1YF5L 2ZWHA 3H6EA 4NLBA 1X3NA 3K9JA 4K25A 5AQYA 3ULEB 4BVPA 3E9OA 5KPZA 3CCJN 2F7TA 4IZ9A 4KH6A 3VERA 2D0PA 3PIPL 1OVYA 5CHIA 2ZJRL 3ATVA 2ASOA 4BG9A 4BRNA 5C10A 1DKGD 3QFUA 1SZ2A 2HF4A 3A0IX 1NGDA 5GIOA 2HBMA 3LM9A 4JKCA 5FPDA 1ATNA 1GLAG 2I7NA 3GG4A 2QW9A 1NGAA 3AAPA 1T3VA 3O1BA 3SAGA 2FXUA 3CIPA 4H5WA 4BRKA 4JKDA 3M5RA 2YHWA 2PAVA 3DAWA 4JKAA 1P90A 2P9PA 4YOUA 4A59A 2AA4A 4WYBA 4GNIA 3VGKA 3WEEA 4Y0WA 2P9NA 4IOCL 4DKWA 3HRGA 3TPQA 4U7BA 3MN6A 3CMEN 3CERA 3SMPA 3QDKA 4A61A 4BRQA 5C2FA 2HBJA 1MDUB 4PKGA 3CJ1A 3R1XA 3U4LA 3AGKA 4LC9B 3R9PA 2NRZA 5EX5A 4DHYA 4CZMA 1VQ4N 2PFUA 2JWLA 5TKWA 3VENA 2VWBA 3L4QA 4E1JA 3VF4A 1DT9A 1NGIA 3WUHA 1HPMA 2QM1A 3VEXA 2W40A 1NGBA 3B8AX 1NGJA 3WXJA 2JWKA 4HTLA 1GLLO 3CXCM 3ZETB 3QBXA 3JS6A 4FWQA 1YHQN 4BROA 3MWTA 2A41A 1VQ9N 5ADXA 5GADP 4L3QA 3S41A 4JK8A 1Q86O 4WQ4C 3O6WA 5JLHA 3OHRA 2ZJQL 1ZC6A 4ISEA 4YDUC 5JVGL 5KPRA 5CR4A 1GLFO 1BDGA 2YI1A 2ZF5O 4FOEA 2GEMA 4JKGA 1YXQA 3TSUA 3RVCA 4C1NI 3KVGA 1S72N 3D2FB 3NVMA 3TTFA 3DJCA 3TTDA 3WXMB 1KD1O 1BU6O 3E1YA 2QWMA 5FPNA 2ASPA 1N8RO 3T69A 1BWFO 1ATSA 3OBWA 4BY9C 3I33A 4GVEA 4H0YB 4HWIA 4C1NK 4BR9A 3SLCA 3GE1A 4BC4A 3F9MA 1V4TA 4FWOA 4RTFD 4FWNA 1S3XA 3HI0A 1Q18A 2YX6A 1TYQA 3KK7A 4H5VA 2HF3A 3KHYA 4PKHA 3VEWA 4M63C 1ESVA 1M90O 3H3NO 3VGLA 1GLJO 1RDUA 1Z05A 3CHWA 3ENBA 3G4SN 2IVPA 4JD2A 1HUXA 2QWOA 3ENHA 2P9UA 1NMDA 3R8EA 1NGFA 3UKUB 2V7ZA 4WF9L 3GOIA 5BREA 2QA4N 4XJXA 3J8AA 2A40A 4ILHA 4I6MA 4DQ8A 1U6ZA 1Y64A 2NRVA 5LJVA 1DGKN 4QS7A 3VEOA 4BC2A 4JNEA 3I56N 3O08A 2DPNA 1KAXA 3MN9A 3VEYA 3DWLA 2AP1A 1WOQA 1YUWA 3JXUA 5EVZA 4BRMA 4IOXA 2RE2A 3M1FA 4FWSA 3KWGA 5EXWA 3C65A 3CC2N 3O4WA 3O9RA 3C7NA 3ULEA 3VEZA 5ELZA 2ASMA 2NRTA 4O8UA 3LL3A 1HLUA 3LDNA 3HM8A 4XH5A 3FR0A 4EHTA 1JCGA 3QFPA 5BRHA 1T6DA 3EE9A 4FPBA 4K41A 4O8KA 3CPWM 1VQLN 4MO4A 4A62A 4BREA 5M1NA 4BE7B 1VAZA 3CI5A 1KAYA 5AZJB 3D6RA 2QWPA 2W00A 2QXLA 3CCLN 2WBNA 2E1ZA 5GAEP 2D1KA 4JKHA 4MO5A 4WQ5C 5AQPA 3U8XA 3DXKA 4GV9A 3QB0A 3P31A 4YORA 5AQTA 1G99A 2P9LB 3CQXA 1QQMA 3HTVA 2QI2A 3R6MA 3CD6N 4FO0A 4IEIA 4A5AA 4MLEA 4NO7A 4R79A 4BRIA 4ISFA 4CD3A 5EOYA 3AGRA 3CJ7A 3HSCA 3LDOA 5AQUA 4BRFA 3CC4N 1K8AO 4H0PA 2WUSA 5AQVA 2J4RA 3CCUN 3GBTA 3EE8A 3UKRB 1SS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XH1 A;  3O1W A;  4J8F A;  1NGH A;  5AQZ A;  3ZX0 A;  3WXK A;  5BRF A;  2Q36 A;  4H0X B;  4K43 A;  3BEX A;  5AQF A;  2V51 B;  4BRL A;  1KAZ A;  4IWV A;  4JHD A;  5AQM A;  3SK3 A;  4FPA A;  1KXP A;  3VGM A;  2YJE A;  3AAR A;  1NGE A;  3L0Q A;  3O5B A;  3ZET A;  4EHU A;  3W3D A;  5BRD A;  3O8M A;  3TU5 A;  1NGG A;  1Z6R A;  3ZEU B;  3FZF A;  4BR5 A;  4H5T A;  2FSN A;  2KHO A;  2E1Y A;  3VOV A;  1HX1 A;  2V7Y A;  1BA1 A;  3A8Y A;  4B9Q A;  4FWM A;  2P9I B;  3EKU A;  2Q31 A;  3D2F A;  3MCP A;  1R59 O;  4KBO A;  2E2Q A;  3A5O C;  5B8H A;  4XH4 A;  1X9J A;  4BRC A;  2D0O A;  3DXM B;  3ENO A;  3EO3 A;  3D2E B;  4H0V B;  5E84 A;  1C0F A;  1XQS C;  2E88 A;  4BRA A;  5CE3 A;  5AFU A;  3BF1 A;  3RSE B;  4CBU A;  3VET A;  3H1Q A;  3H1V X;  4O5F A;  3FZM A;  3WXL A;  4BC3 A;  2A5X A;  1E4F T;  3QIC A;  5ADX H;  5LJW A;  1XUP O;  3FE1 A;  2FF3 B;  1RGI A;  2Q97 A;  2CH5 A;  1HJO A;  1H1V A;  3IFR A;  3P4I A;  4CZI A;  3D7E O;  4F9O A;  4H0T B;  2V52 B;  5AQQ A;  4CBX A;  1HKB A;  3BF3 A;  3FFK B;  4PL8 A;  2Q2R A;  2P9K B;  4H5N A;  1DEJ A;  3MN5 A;  3WXI A;  3MDQ A;  3CET A;  5AQR A;  3G25 A;  2CH6 A;  5AZI B;  2W41 A;  1MWK A;  4FWK A;  4GY2 B;  4DCH A;  4CZF A;  3U9Z A;  3EN9 A;  3FGU A;  4RWT A;  5AZJ A;  1BA0 A;  3FZK A;  1V4S A;  2FLO A;  3SJH A;  2GWK A;  3H3O B;  4FOI A;  2P9L A;  5AQW A;  2A3Z A;  2Q0U A;  3GL1 A;  2VCP A;  2IVN A;  1D4X A;  2E8A A;  4CJ7 A;  3FLC O;  2YJF A;  1MA9 B;  5JMV A;  5KPT A;  1P8Z A;  3VPZ A;  1BG3 A;  4BRP A;  1CZA N;  3W0L A;  3ZX2 A;  4CZE A;  3EKS A;  1WUA A;  1U2V B;  3UKR A;  1HKG A;  5KQD A;  1T6C A;  4B1U B;  5LY3 A;  4B1V A;  4AM7 A;  1E4G T;  4BR0 A;  3VES A;  2VYP A;  2ZGY A;  3LDP A;  3LDQ A;  4FSV A;  2NZT A;  3VF6 A;  4PKI A;  1TYQ B;  1EQY A;  3CJ9 A;  1OKJ A;  3CJB A;  4K42 A;  3A5L C;  3HZ6 A;  4H5R A;  1S22 A;  2ITM A;  1LCU A;  1YVN A;  5AQO A;  3ZEU A;  4H03 B;  4NB4 A;  3VEV A;  3WQT A;  2IIR A;  1ZXO A;  5AQK A;  2P9I A;  1RFQ A;  1TUY A;  2A6A A;  4PL7 A;  2GTD A;  1NWK A;  1T44 A;  3CJC A;  3AAQ A;  3DXM A;  4BC5 A;  4C23 A;  1K8K B;  2HOE A;  3D2E A;  3A5N C;  2NRH A;  4CI6 A;  3VF2 A;  5JLF A;  2ZGZ A;  5AQH A;  3RSE A;  3ID8 A;  1ATR A;  2CGJ A;  2YCH A;  2I7P A;  4CZH A;  4BR2 A;  4BRG A;  3EL2 A;  5I9E B;  1NGC A;  2E20 A;  4WQ4 A;  4XEI A;  1QHA A;  4YDU A;  4IJN A;  4QS8 A;  2P9S B;  3M3Z A;  4BQL A;  3DXK B;  2CGL A;  2F9W A;  2QWR A;  5TKY A;  2A42 A;  4EFH A;  3A5M C;  3U9D A;  5AQN A;  2BUP A;  2YHY A;  3O80 A;  4B1X B;  2PBD A;  4EIA A;  1GLD G;  2E2O A;  3M6G A;  2F9T A;  4CD1 A;  4CZJ A;  3IDH A;  2P9K A;  4BGA A;  5KQ8 A;  1QQO A;  4BRD A;  1BUP A;  2OAN A;  3FZH A;  3SMS A;  5AZI A;  5FPM A;  3MK6 A;  4M7X A;  3L4I A;  1C0G A;  3LM2 A;  5AFU H;  4JAX A;  2HMP A;  5AQI A;  3L6Q A;  4FWL A;  4JHD B;  2IVO A;  3UKU A;  1QZ6 A;  2E2P A;  3MN7 A;  4MLH A;  4EAH D;  4IJA A;  4BVO A;  1J6Z A;  1GLB G;  2P9P B;  4BR4 A;  3WEE B;  5AQS A;  1NM1 A;  2P9N B;  2E2N A;  3HBT A;  1XC3 A;  3H46 O;  5AQL A;  4QS9 A;  4B1Y B;  5AQJ A;  3ZX3 A;  4H0O A;  4B1Z A;  4FWP A;  4BRH A;  3BUZ B;  3KZB A;  3LDL A;  4CZL A;  1TUU A;  3QML A;  4BR7 A;  1BOT O;  5BPM A;  1QZ5 A;  2EWS A;  1U2V A;  2GWJ A;  3I8B A;  2D4W A;  1JCF A;  3EZW A;  5AQG A;  1GLE G;  4A2A A;  3QBW A;  3IMX A;  5BN9 A;  3CJA A;  4IXC A;  4B1W B;  2QWL A;  5F0X A;  3C0B A;  2Q1N A;  2FSJ A;  4FL9 A;  3H45 C;  4CBW A;  2GUP A;  2YHX A;  3AY9 A;  1QQN A;  4WQ5 A;  1MWM A;  2Q0R A;  1IG8 A;  2FSK A;  5BPL A;  5BR9 A;  2BTF A;  4JN4 A;  1JCE A;  1NLV A;  5F2R A;  1SQK A;  4BG8 A;  1RDW X;  5BPN A;  1YAG A;  3CQY A;  2H3G X;  4IO8 A;  4AM6 A;  3ATU A;  2UYT A;  3MMV A;  3GDQ A;  4A2B A;  2QWN A;  4CZG A;  5JIC A;  2FF6 A;  4RCH A;  2CGK A;  5E26 A;  1HKC A;  1ZBS A;  1IJJ A;  3BP8 A;  5FPE A;  3UB5 A;  4CZK A;  3UE5 A;  1K8K A;  2NLX A;  5F1X A;  4JD2 B;  1GLC G;  3FZL A;  2P9U B;  2QWQ A;  5AQX A;  5EY4 A;  1SAZ A;  4BQZ A;  2GEL A;  4I6M B;  5BN8 A;  4Z94 A;  4M7Y A;  3IUC A;  4ISG A;  4BGB A;  2P9S A;  4FWR A;  3WQU A;  4DB3 A;  1LOT B;  1BO5 O;  5AR0 A;  1X3M A;  3WT0 A;  3C7N B;  2ZWH A;  3H6E A;  5AQY A;  3ULE B;  1X3N A;  4K25 A;  4BVP A;  5KPZ A;  4IZ9 A;  3VER A;  2D0P A;  3ATV A;  2ASO A;  4BG9 A;  4BRN A;  1DKG D;  3QFU A;  1SZ2 A;  2HF4 A;  3A0I X;  1NGD A;  3LM9 A;  5FPD A;  1ATN A;  1GLA G;  2I7N A;  3GG4 A;  2QW9 A;  1NGA A;  3AAP A;  3O1B A;  2FXU A;  3CIP A;  4H5W A;  4BRK A;  2YHW A;  2PAV A;  3DAW A;  2P9P A;  2AA4 A;  4WYB A;  4GNI A;  3VGK A;  3WEE A;  4Y0W A;  2P9N A;  3TPQ A;  3MN6 A;  3CER A;  3SMP A;  3QDK A;  4A61 A;  4BRQ A;  1MDU B;  4PKG A;  3CJ1 A;  3U4L A;  4LC9 B;  3R9P A;  5EX5 A;  4DHY A;  4CZM A;  3VEN A;  2VWB A;  4E1J A;  3VF4 A;  1NGI A;  3WUH A;  1HPM A;  2QM1 A;  3VEX A;  2W40 A;  1NGB A;  3B8A X;  1NGJ A;  3WXJ A;  4HTL A;  1GLL O;  3ZET B;  3QBX A;  3JS6 A;  4FWQ A;  4BRO A;  2A41 A;  5ADX A;  4L3Q A;  3S41 A;  4WQ4 C;  3O6W A;  5JLH A;  1ZC6 A;  4ISE A;  4YDU C;  5KPR A;  1GLF O;  1BDG A;  2YI1 A;  2ZF5 O;  4FOE A;  2GEM A;  1YXQ A;  3KVG A;  3D2F B;  3DJC A;  1BU6 O;  2QWM A;  5FPN A;  2ASP A;  1BWF O;  1ATS A;  3I33 A;  4H0Y B;  4HWI A;  4BR9 A;  3SLC A;  3GE1 A;  4BC4 A;  3F9M A;  1V4T A;  4FWO A;  4RTF D;  4FWN A;  1S3X A;  3HI0 A;  1Q18 A;  4H5V A;  1TYQ A;  4PKH A;  2HF3 A;  3KHY A;  3VEW A;  4M63 C;  1ESV A;  3H3N O;  3VGL A;  1GLJ O;  1Z05 A;  3CHW A;  2IVP A;  4JD2 A;  1HUX A;  2QWO A;  3ENH A;  2P9U A;  1NMD A;  3R8E A;  1NGF A;  3UKU B;  2V7Z A;  3GOI A;  5BRE A;  3J8A A;  2A40 A;  4I6M A;  4DQ8 A;  1U6Z A;  1Y64 A;  5LJV A;  1DGK N;  4QS7 A;  3VEO A;  4BC2 A;  4JNE A;  3O08 A;  2DPN A;  1KAX A;  3MN9 A;  3VEY A;  3DWL A;  2AP1 A;  1WOQ A;  1YUW A;  3JXU A;  5EVZ A;  4BRM A;  3M1F A;  4FWS A;  5EXW A;  3O4W A;  3C7N A;  3ULE A;  3VEZ A;  5ELZ A;  2ASM A;  3LL3 A;  1HLU A;  3LDN A;  3HM8 A;  4XH5 A;  3FR0 A;  4EHT A;  1JCG A;  3QFP A;  5BRH A;  1T6D A;  4FPB A;  4K41 A;  4O8K A;  4MO4 A;  4A62 A;  4BRE A;  3CI5 A;  1KAY A;  5AZJ B;  2QWP A;  2QXL A;  2E1Z A;  2D1K A;  4MO5 A;  4WQ5 C;  5AQP A;  3U8X A;  3DXK A;  3QB0 A;  5AQT A;  1G99 A;  2P9L B;  3CQX A;  1QQM A;  3HTV A;  3R6M A;  4FO0 A;  4MLE A;  4NO7 A;  4BRI A;  4ISF A;  4CD3 A;  5EOY A;  3HSC A;  3CJ7 A;  3LDO A;  4BRF A;  5AQU A;  4H0P A;  2WUS A;  5AQV A;  2J4R A;  3GBT A;  3OHR A;  3UKR B;  1NBW A; 
#chains in the Genus database with same CATH topology
 4XH1 A;  4JRP A;  3O1W A;  1CXU A;  4J8F A;  3NVK A;  2W42 A;  4H0X B;  5J2Q A;  4AQY K;  5AQF A;  4KI6 A;  3RMC A;  1VQM N;  1KAZ A;  4IWV A;  3G10 A;  3LDS A;  4FM1 A;  4M3W A;  4FPA A;  1KXP A;  2D0C A;  2YJE A;  1XWL A;  2Y1I A;  3TU5 A;  2VGM A;  2HND A;  3L3V A;  3OY9 A;  3E66 A;  2E1Y A;  4DSF A;  4GVM A;  4NXM K;  3A8Y A;  4B9Q A;  4CEQ A;  2HHT A;  2P9I B;  1BHL A;  3SBT A;  3V81 A;  3DXM B;  4FM0 A;  3VQP A;  4QOZ B;  5E84 A;  1XQS C;  3KK3 A;  4LH5 A;  1WNS A;  2HST A;  3BY5 A;  4L8R B;  3VET A;  5MLC Q;  3H1V X;  4DR3 K;  1BI4 A;  4B9T A;  4LFA K;  4O5F A;  4J2D A;  3M8P A;  1E4F T;  3QIC A;  1FK9 A;  5ADX H;  4FJ9 A;  4M3U A;  4FCY A;  4CIG A;  2O8F B;  2EX3 A;  3KLG A;  1VQ5 N;  3L2R A;  2Q97 A;  2CH5 A;  3V4I A;  3P4I A;  3SI6 A;  3TAN A;  4JI0 K;  3PSF A;  3ZYY X;  4FLZ A;  2B5J A;  4LF5 K;  1X9W A;  1VQK N;  4B9V A;  3OYI A;  1U4B A;  2OPP A;  3TAB A;  3G25 A;  2CH6 A;  2BGG A;  5C42 A;  3O3G A;  3K5N A;  4FW2 A;  3SCX A;  3L2U A;  4GY2 B;  1XNR K;  4B9N A;  3VQ6 A;  3VQ7 A;  4JK7 A;  4OLB A;  1CLQ A;  3RRH A;  1BA0 A;  3J7Z O;  3EYZ A;  3U6F A;  1B92 A;  4IFY A;  1N32 K;  2HHU A;  3H3O B;  4FOI A;  1KCF A;  3WNG A;  2E8A A;  4CJ7 A;  1P8Z A;  1A5W A;  5M1P A;  1CZA N;  4CJP A;  2FBV A;  1WUA A;  1U2V B;  3VQ8 A;  4B9S A;  4B1V A;  3CFR A;  2UU9 K;  3RRG A;  4FVU A;  3LZI A;  1RTH A;  2D0A A;  2ZGY A;  1YJ9 N;  3LDQ A;  1HQU A;  1W9H A;  3VF6 A;  3RMA A;  1TYQ B;  4DTN A;  1OKJ A;  4IFE A;  3OYG A;  4DR2 K;  2ITM A;  2E5L K;  4IKF A;  1LCU A;  3SNN A;  1YVN A;  4IDK A;  4CGD A;  1VQ8 N;  3VEV A;  1TAU A;  4M45 A;  1JLG A;  1BIZ A;  4IDH A;  4CK2 A;  1KVB A;  1TUY A;  4O44 A;  4JS4 A;  1HPZ A;  4PL7 A;  3DLK A;  1K73 O;  3WNF A;  5FDL A;  1S9G A;  3E9L A;  3F9K A;  4C23 A;  3D2E A;  3K5L A;  3A5N C;  3U3Y A;  3C94 A;  1Q7Y O;  3MX2 A;  3RSE A;  4DMN A;  2GX9 A;  3L8B A;  3ZSO A;  4YOX A;  3THY A;  4NXN K;  4N76 A;  1C0U A;  2A1S A;  3TTC A;  4BR2 A;  4Z4I A;  3TAG A;  1WSE A;  5LL6 Z;  2F8S A;  1K9M O;  3M3Z A;  4DQS A;  2UUC K;  5TKY A;  1LW0 A;  3DOK A;  4JEP A;  3TAQ A;  2G8I A;  2BUP A;  2YHY A;  3O80 A;  2PBD A;  2E2O A;  1J9A A;  2F9T A;  4WE1 A;  3VQ4 A;  3S3O A;  1KQS M;  2KZM A;  2OAN A;  5GIN A;  4CHP A;  5AZI A;  3MK6 A;  3L4I A;  2JLE A;  4KTZ A;  1VSK A;  1JLF A;  2E2P A;  4IJA A;  1JJ2 M;  1TGO A;  3SQ2 A;  2QEX N;  1N5Y A;  2HVI A;  4BR4 A;  5AQS A;  2P9N B;  4KB1 A;  2E2N A;  4J2B A;  3NH1 A;  1IBK K;  3JAM O;  4NCA A;  4CIE A;  4CFB A;  4YOT A;  3LDL A;  3CQ8 A;  2X74 A;  3SUO A;  3CCM N;  1QZ5 A;  2EWS A;  2D4W A;  1JCF A;  4C8N A;  5AQG A;  3DMJ A;  3CJA A;  5F0X A;  3DLR A;  4IG0 A;  1RDC A;  2Q1N A;  1WN7 A;  2FSJ A;  4FL9 A;  1W2B M;  3KK2 A;  5GAG P;  2XY5 A;  5HRN A;  3I55 N;  4CEA A;  1WB9 A;  1S1V A;  4CJR A;  5HLF A;  2WFB A;  3DI6 A;  3RMD A;  1NLV A;  3CYM A;  4ICL A;  5F2R A;  4BG8 A;  4AF1 A;  3THV A;  3CQY A;  3NFA A;  2YNF A;  3KD1 E;  3GDQ A;  1U49 A;  2QWN A;  4CZG A;  2DY4 A;  1RT2 A;  2CGK A;  1ZBS A;  2DFE A;  3K59 A;  2F4V K;  3NGZ A;  3HVT A;  5FPE A;  4DTM A;  1K8K A;  2O8C B;  5T7B A;  4FLU A;  2VG7 A;  4DQR A;  1QSS A;  3OS0 A;  5KGW A;  3QEW A;  5AQX A;  4BE2 A;  2PZS A;  1SAZ A;  3BZC A;  4NCG A;  5JS2 A;  3N4Q A;  1RIL A;  4ISG A;  2P9S A;  3OVN A;  3QNN A;  3O4N A;  2NRR A;  4BEC A;  1BO5 O;  5AR0 A;  3VTI A;  4DWI A;  5JEN A;  1X3M A;  1RBT A;  5AQY A;  1YF5 L;  3NAE A;  3LP3 A;  3OYL A;  4I7F A;  4DFM A;  1Q8I A;  1TVR A;  5C24 A;  4ZTF A;  1HYV A;  5C10 A;  3K2P A;  3RMB A;  3LAK A;  1NGD A;  5GIO A;  4FK0 A;  4E7L A;  4KFB A;  4KHS A;  1NGA A;  3AAP A;  4JKD A;  5KRS A;  3M5R A;  5KI6 A;  1UA1 A;  4A59 A;  1CXQ A;  2AA4 A;  3TAR A;  2O8D B;  4CER A;  3HPG A;  3AA2 A;  4IBN A;  3TPQ A;  4DKW A;  1S5J A;  3MN6 A;  4I9Q A;  3AVB A;  2G8W A;  2O4I A;  3QDK A;  4DV7 K;  1ITG A;  2HHI A;  1G15 A;  2UUA K;  3CJ1 A;  3R9P A;  2FC0 A;  4FJK A;  4DHY A;  4CZM A;  1HYZ A;  2PFU A;  3HVR A;  3L4Q A;  4E1J A;  1DT9 A;  2X6S A;  4CHZ A;  4O0I A;  1ZBU A;  1GLL O;  4OLA A;  4LSL A;  3QBX A;  2OCE A;  4DTO A;  5GAD P;  3S41 A;  4JK8 A;  3SPZ A;  4BAC A;  1XHZ A;  2ZJQ L;  4YDU C;  1KSP A;  2HHS A;  2PYJ A;  4C1N I;  4AHR A;  4DQQ A;  3C95 A;  3AO1 A;  4DV1 K;  1S72 N;  3TTF A;  2QKB A;  3TTD A;  5CZ1 A;  3TI0 A;  4GW6 A;  1WSJ A;  3TAP A;  3KK1 A;  1A5V A;  4W5T A;  3QET A;  2QWM A;  3NF6 A;  2ASP A;  3PSI A;  5CYM A;  2VQF K;  4K8X A;  3V1R A;  3SLC A;  3GE1 A;  4BC4 A;  3ISN C;  3K5M A;  3SQ1 A;  4FJG A;  4FWN A;  1VSJ A;  3KK7 A;  3KLE A;  3KHY A;  4DV0 K;  3AO5 A;  3VGL A;  1RDU A;  1BCM A;  1JLQ A;  1ZBF A;  3K58 A;  1W7A A;  1NMD A;  1NGF A;  1MU2 A;  1TK0 A;  4RW7 A;  5BRE A;  4XJX A;  4HVJ A;  3OTO K;  1Y64 A;  2NRV A;  4BC2 A;  4KRE A;  4BWM A;  1EET A;  3DWL A;  1WOQ A;  1YUW A;  4IOX A;  2R7Y A;  4FWS A;  5EXW A;  3S9H A;  4DV3 K;  2ASM A;  4Z4H A;  3OYB A;  1RTD A;  1JCG A;  5BRH A;  5E41 A;  4K41 A;  1N36 K;  4O8K A;  3VQ9 A;  4LH4 A;  4Z4E A;  1RBS A;  3DRP A;  4MFB A;  2QXL A;  4KRF A;  1ASW A;  1X9M A;  4KHY A;  4WQ5 C;  3U8X A;  5AQP A;  4N47 A;  4FZY A;  3QB0 A;  3P31 A;  4JI8 K;  2P9L B;  3HTV A;  1QQM A;  3CD6 N;  4MLE A;  3AGR A;  3LDO A;  4BRF A;  1IG9 A;  3NHG A;  2OPR A;  1KRP A;  3ZSQ A;  4WFN L;  3AA3 A;  3ASM A;  2D0B A;  2WTU A;  1X1P A;  2Z1H A;  1EXQ A;  3QEP A;  4K43 A;  5K14 A;  1VQ6 N;  4IOA L;  4AHV A;  3AO4 A;  5AQM A;  5HRO A;  1VSE A;  3VGM A;  4OGE A;  2OZM A;  4E7J A;  1NGE A;  2O8E B;  3W3D A;  5BRD A;  3O8M A;  4LD0 A;  3KLH A;  3DM2 A;  1J5O A;  3ZEU B;  1N33 K;  4KHP K;  2FSN A;  3WNH A;  2KHO A;  4KH4 A;  1BA1 A;  1SL2 A;  4FWM A;  2HBL A;  5CY4 A;  1O13 A;  1VQN N;  3P83 D;  4KBO A;  5B8H A;  3EZ5 A;  4CJV A;  2D0O A;  3EO3 A;  1BIS A;  3QER A;  4KPY A;  4BRA A;  2Z1G A;  5AFU A;  3H1Q A;  3TAF A;  3OYJ A;  3OYK A;  3FZM A;  4CJQ A;  4BC3 A;  4GV6 A;  4JI4 K;  2OZS A;  4O4G A;  1IKW A;  4OKE A;  4E19 A;  2QK9 A;  3PLA A;  1T05 A;  3AVM A;  4YHH K;  5HRR A;  3TR8 A;  1RGI A;  4CEE A;  1H1V A;  3IFR A;  4CZI A;  4WFA L;  4H0T B;  4OX9 K;  1HKB A;  1JLE A;  2Q2R A;  3V6D A;  4W5Q A;  3F2K A;  4J2A A;  4KKO A;  3NE6 A;  3SV3 A;  3DOL A;  2E6L A;  4DSI A;  2E6M A;  2W41 A;  5I42 A;  1HR0 K;  1HNV A;  3ZT2 A;  4CZF A;  5M1F A;  2ZQB A;  2WC9 A;  4I2Q A;  3FGU A;  3ZSV A;  5AZJ A;  4CJ4 A;  2QTD A;  3KIO A;  3FZK A;  5LMN K;  1V4S A;  2FLO A;  2Q3S A;  3C6A A;  5AQW A;  4CF9 A;  4YNQ A;  2P51 A;  4HUE A;  2VCP A;  1IKX A;  3FLC O;  3NBP A;  3VN5 A;  1W97 L;  2VG5 A;  3VPZ A;  1BG3 A;  1NK0 A;  4MQ3 A;  4HUG A;  3EKS A;  3UKR A;  1C1C A;  4B1U B;  2UUB K;  4AM7 A;  1L3S A;  1J5E K;  1E4G T;  3IS9 A;  4BR0 A;  3VES A;  4EZ9 A;  3OYF A;  3JYT A;  3LDP A;  1WSI A;  4DTX A;  4FSV A;  5FRO A;  2YKN A;  3T1A A;  3IAY A;  1EQY A;  4K42 A;  1N6Q A;  2DFH A;  3D45 A;  2Y1J A;  3VTH A;  4O55 A;  1LWE A;  4DSL A;  5KRT A;  1YIT N;  1NK5 A;  3CYG A;  1RDB A;  1ZXO A;  1L5U A;  2A6A A;  4I9L A;  1VQO N;  5I3U A;  1NJZ A;  4W5O A;  4ILJ A;  2UXB K;  4OPH A;  4CI6 A;  4FJN A;  2ZGZ A;  1UAX A;  1ATR A;  2VGN A;  3O4Q A;  2CGJ A;  2YCH A;  1YVU A;  3ZSY A;  2XY7 A;  4B3S K;  4CF2 A;  4BRG A;  3EL2 A;  4FVM A;  4YDU A;  4IJN A;  4EP4 A;  4M3X A;  4BQL A;  2CGL A;  2G8F A;  4GKJ K;  3NGY A;  3TSQ A;  2A42 A;  4JI5 K;  4B8A B;  1R0A A;  5HRP A;  3C6H A;  4X66 K;  4XIU A;  1VHX A;  5C0Y A;  1HYS A;  3ZT0 A;  4CD1 A;  4BDY A;  4JS5 A;  4LY7 A;  3IDH A;  2P9K A;  2KZZ A;  1RCH A;  3HL8 A;  5HP1 A;  2P5O A;  2QKK A;  3AA4 A;  1VQ7 N;  1U04 A;  3ULD A;  5AQI A;  3L6Q A;  1SL1 A;  4FJI A;  4CGF A;  3F5T A;  4EAH D;  4FZX C;  3AVH A;  4BVO A;  1J6Z A;  2P9P B;  1UWB A;  1NM1 A;  1KC8 O;  3P5J A;  3Q7B A;  3H46 O;  3I8D A;  1IH7 A;  4B1Y B;  4DLE A;  4B1Z A;  4BRH A;  1HQE A;  2XY6 A;  1TUU A;  3THX B;  4U67 L;  1BOT O;  4V19 S;  1JLA A;  4UY8 O;  1ILY A;  4RG8 A;  3QIO A;  2IS3 A;  3EZW A;  1JKH A;  1GLE G;  3QBW A;  3IMX A;  5BN9 A;  1D5A A;  4B1W B;  3KWI A;  3CCV N;  2W6L A;  3NCI A;  4RW6 A;  3H45 C;  2JGU A;  4FJL A;  3MXM A;  1EO1 A;  3AY9 A;  4JI7 K;  4WQ5 A;  5BR9 A;  1VSF A;  5GAH P;  3QES A;  1KVC A;  3V1O A;  4JKE A;  3VQA A;  4E89 A;  3O9Q A;  4CGI A;  3VQ5 A;  2H3G X;  3ALY A;  4AM6 A;  3ATU A;  2UYT A;  1IBL K;  2AJQ A;  1ZYQ A;  3J7Y P;  4H4M A;  2OTL N;  2F96 A;  1B9D A;  4A2B A;  4CF1 A;  3SQ4 A;  1VQP N;  1IV0 A;  4CES A;  5E26 A;  1NG9 A;  1HKC A;  3BP8 A;  3UB5 A;  3UE5 A;  4N56 A;  3HK2 A;  1NK6 A;  1VRT A;  4F3O A;  3KTQ A;  1YJW N;  3VQB A;  1GLC G;  3SJJ A;  3T1H K;  2P9U B;  1VRU A;  3L3U A;  3P39 A;  3CC7 N;  3TWH A;  1W0H A;  4Z94 A;  4ELU A;  4B3R K;  2W6K A;  3LPU A;  4B3M K;  4BGB A;  4CHY A;  3SAH A;  2KKZ A;  3WQU A;  2NRX A;  3C6T A;  1KFS A;  3ULE B;  3CF5 L;  1FXX A;  5KPZ A;  1X3N A;  4K25 A;  2WON A;  2HW3 A;  3CCJ N;  1U48 A;  1I94 K;  4KH6 A;  1S1X A;  1TKD A;  1OVY A;  5CHI A;  2KQ2 A;  2ZJR L;  3ATV A;  2ASO A;  4KAZ A;  4BRN A;  2HF4 A;  3A0I X;  1X9S A;  1SUQ A;  4PY5 A;  1K6Y A;  2I7N A;  1QSL A;  3O1B A;  3HXM A;  2FXU A;  2YHW A;  3WEE A;  4Y0W A;  1QTM A;  4IOC L;  3HRG A;  4U7B A;  3CME N;  3SMP A;  1Q9X A;  4A61 A;  3PO5 A;  1NK9 A;  1YTA A;  5DMR A;  1NK7 A;  3R1X A;  4HCC A;  2JWL A;  5A2Q O;  4CEO A;  1HPM A;  3LPT A;  1NGJ A;  1GOC A;  4QCL A;  3KJV A;  3CXC M;  4KV8 A;  3NGI A;  1LW2 A;  4CK3 A;  4CEB A;  4Q5V A;  4Z0U A;  4BRO A;  1NKC A;  5ADX A;  4L3Q A;  1Q86 O;  4WQ4 C;  1FKP A;  3O6W A;  1ZC6 A;  2YNG A;  1KTQ A;  2ZF5 O;  3ZSR A;  2GEM A;  1YXQ A;  3TSU A;  5SZT A;  2IAJ A;  2FBT A;  3DJC A;  1VSL A;  1N8R O;  1WLJ A;  3T69 A;  3OBW A;  2YV0 X;  4BY9 C;  3VA0 A;  4CFD A;  1RTJ A;  4KHW A;  2HHX A;  4FWO A;  4RTF D;  1KLN A;  1BCO A;  1BI4 B;  1Q18 A;  1HRH A;  1B9F A;  4PKH A;  2HF3 A;  4CGH A;  3QNO A;  3M8R A;  1NU0 A;  1M90 O;  1ESV A;  3RR8 A;  4AHS A;  4OPJ A;  3CHW A;  3ENB A;  3VQQ A;  3G4S N;  2IVP A;  2YHB A;  4JD2 A;  1HUX A;  3ENH A;  2V7Z A;  3GOI A;  2EHG A;  2A40 A;  4I6M A;  1WAJ A;  1U6Z A;  4DQ8 A;  4HHT A;  1DGK N;  4QS7 A;  4JNE A;  1L3T A;  4JV5 K;  3MN9 A;  2VQE K;  5EVZ A;  4FLT A;  3CC2 N;  3CG7 A;  3PUF A;  4O0J A;  3V9S A;  3O9R A;  3C7N A;  1T7P A;  4O8U A;  1WSF A;  3SQ0 A;  1HLU A;  4M3Y A;  3HM8 A;  4O5B A;  4EHT A;  3QFP A;  1RBU A;  4W5R A;  3KD5 E;  1T6D A;  3V9W A;  2Z1J A;  3CPW M;  3PV8 A;  4BRE A;  4BE7 B;  4JYA K;  1KAY A;  2F8T A;  3D6R A;  2QWP A;  1NKB A;  3K57 A;  4E0D A;  5GAE P;  2D1K A;  4JKH A;  3DXK A;  4GV9 A;  1L3V A;  4DV5 K;  5AQT A;  1G99 A;  4CJ3 A;  1JXB A;  3R6M A;  4FO0 A;  4R79 A;  4NO7 A;  4BRI A;  4ISF A;  1RTI A;  5EOY A;  3CJ7 A;  5AQU A;  4DU4 A;  3H08 A;  4H0P A;  2WUS A;  5J2N A;  3CCU N;  3CM6 A;  3GBT A;  4DS5 A;  3HP6 A;  2O8B A;  3OHR A;  3WXI A;  1SS6 A;  3OYD A;  1J53 A;  4OO1 J;  3ZX0 A;  5BRF A;  2Q36 A;  3MED A;  3BEX A;  1IKV A;  2B4J A;  4JLH A;  2V51 B;  1RBR A;  2G8V A;  4DR6 K;  4CVN E;  4BRL A;  4JHD A;  3SK3 A;  4FYD A;  4YY3 K;  2KLA A;  4YOY A;  1C6V A;  3O5B A;  4PA1 A;  3ZET A;  3PY8 A;  4ZHR A;  1Z6R A;  4H5T A;  4JI3 K;  5M1O A;  4IFV A;  3SUQ A;  2XO7 A;  4FK4 A;  3D2F A;  2BE2 A;  1R59 O;  4CK1 A;  2E2Q A;  3SUN A;  3A5O C;  2HHQ A;  4XH4 A;  1X9J A;  4AHU A;  1CZB A;  2IGI A;  3D2E B;  2B6A A;  1TKZ A;  4FLW A;  3AVG A;  2HBK A;  4KTW A;  2E88 A;  4DUY K;  3BF1 A;  3RSE B;  4CBU A;  3THY B;  1ASU A;  3K5O A;  3Q7C A;  1VSI A;  4RW9 A;  2A5X A;  3CMA N;  3K0S A;  1EP4 A;  1TV6 A;  4CFC A;  4CHO A;  5LJW A;  1XUP O;  3FE1 A;  1HJO A;  3VQE A;  4FLX A;  2G8U A;  4F9O A;  3AVC A;  3BF3 A;  3ID6 A;  2HMI A;  2OA8 A;  2ZE2 A;  4YOW A;  1DEJ A;  4C8O A;  3MN5 A;  5AQR A;  4X64 K;  5AZI B;  3PIO L;  3N4P A;  1MWK A;  3K9K A;  4FWK A;  3IRX A;  2GBZ A;  3DLL L;  1VSM A;  1QSY A;  3EN9 A;  2YNH A;  3O3F A;  4FW1 A;  2GWK A;  4A57 A;  3ZLJ A;  2A3Z A;  2Q0U A;  3GL1 A;  4DR4 K;  2IVN A;  1D4X A;  3DLG A;  2A1R A;  1MA9 B;  2RN2 A;  5KPT A;  3NH2 A;  2IC3 A;  4X65 K;  1S1U A;  3AVI A;  3DLB A;  4WCE L;  3LAM A;  4LFC K;  4E7K A;  3OJS A;  1ZBL A;  2HB5 A;  1L3U A;  3AV9 A;  2VYP A;  4AHT A;  5M1Q A;  2NZT A;  3F73 A;  4PKI A;  5FLX O;  4E1N A;  1Q81 O;  3A5L C;  4DF4 A;  4PUO A;  3MX5 A;  4H5R A;  3V9Z A;  2NUB A;  5HRS A;  5AQO A;  2BH1 A;  3AVL A;  1WAF A;  4OVL A;  5AQK A;  4A5B A;  3SZ2 A;  2P9I A;  4FK2 A;  3LWM A;  1RDA A;  4ILG B;  3SPY A;  3VQC A;  4PHT X;  1NWK A;  3CJC A;  3QEX A;  4Z4F A;  4CE9 A;  3L2W A;  3DXM A;  1XMO K;  4BE1 A;  2X78 A;  1K8K B;  2HOE A;  2IDO A;  3OA9 A;  4OPA A;  4OPK A;  4FXD A;  1QVG M;  5JLF A;  2RHK A;  5AQH A;  3LP0 A;  4BDP A;  1SV5 A;  3HOT A;  3DRR A;  4FJX A;  4GV3 A;  1BIU A;  4CZH A;  4E72 A;  5I9E B;  4WQ4 A;  1RBV A;  4XEI A;  4QS8 A;  2P9S B;  1OH5 A;  3DXK B;  3QEV A;  1HJR A;  3EEQ A;  4KO0 A;  3U9D A;  2O8F A;  4F2S A;  3BDP A;  3VQD A;  4B1X B;  4KH5 A;  4B08 A;  4EIA A;  1ZBI A;  5FRM A;  3IG1 A;  3CCR N;  4BGA A;  4CJT A;  1QQO A;  1BUP A;  3FZH A;  3EY1 A;  3SMS A;  5FPM A;  3AA5 X;  4M7X A;  1CZ9 A;  3E9P A;  3LM2 A;  3UKU A;  4FWL A;  4JHD B;  1QZ6 A;  3MN7 A;  4KI4 A;  2D5R A;  1LAW A;  3LP1 A;  5AQL A;  5CZ2 A;  3G71 N;  3ZX3 A;  4H0O A;  5GIP A;  4KB0 A;  4FWP A;  1QS4 A;  3OJU A;  4AH9 A;  2KFN A;  4CZL A;  4CED A;  1Y97 A;  4ID5 A;  4C8M A;  4LFB K;  1YIJ N;  1U2V A;  2GWJ A;  1HNW K;  2WOM A;  1YJN N;  1SKS A;  4ELV A;  2RPI A;  4IXC A;  2QWL A;  1OH6 A;  4JI2 K;  3CCS N;  2GUP A;  2YHX A;  4DV6 K;  3AVF A;  1LWC A;  1MWM A;  1IG8 A;  2FSK A;  3VMF B;  1ASV A;  1TK8 A;  2BTF A;  1F21 A;  4JN4 A;  1JCE A;  1SQK A;  4EP5 A;  3L2V A;  1OH8 A;  3E01 A;  3NMU A;  4IO8 A;  3MMV A;  2ZD1 A;  4HTU A;  3IKM A;  1JLC A;  3QLH A;  3ZT4 A;  4RCH A;  5KTQ A;  2ZM6 K;  1IJJ A;  3LAN A;  2FBY A;  2NNW A;  4DU3 A;  3PX0 A;  3AVJ A;  4HCB A;  4CJL A;  2QWQ A;  3OYA A;  2G8H A;  3CCQ N;  1IBM K;  1NK8 A;  4C8L A;  3IUC A;  5HOO A;  1ZBH A;  1OVQ A;  4FWR A;  3JSM A;  4GMJ B;  3WT0 A;  3BZK A;  4H8K A;  1LV5 A;  3KLF A;  4NLB A;  2RF2 A;  2F7T A;  2D0P A;  3PIP L;  1T03 A;  1D9D A;  1QHT A;  4BG9 A;  1C1B A;  3HPH A;  1DKG D;  3QFU A;  1RT7 A;  3D0P A;  3LP2 A;  4FJH A;  2BAN A;  3LM9 A;  2LSN A;  3GG4 A;  1FW6 A;  2HHH K;  1T3V A;  4FZZ A;  4H5W A;  4BRK A;  3L2Q A;  4CF0 A;  1HMV A;  3QEI A;  4YOU A;  4K8Z A;  1SKR A;  4JI6 K;  2YNI A;  4WYB A;  2P9N A;  3SYZ A;  2X6N A;  3CER A;  3AO3 A;  4FJ5 A;  1BGX T;  4BRQ A;  5C2F A;  3MXI A;  1MDU B;  4PKG A;  3AGK A;  4B3O A;  5EX5 A;  3G0Z A;  1VQ4 N;  3VEN A;  3T3F A;  2VWB A;  4DV2 K;  4B9M A;  2VWK A;  3P1G A;  2W40 A;  3B8A X;  3WXJ A;  4HTL A;  3DRS A;  3RWU A;  3J80 O;  3JS6 A;  4FWQ A;  3MWT A;  2A41 A;  1JL1 A;  4FLV A;  4ISE A;  3ZT1 A;  5AJ3 K;  5JVG L;  5CR4 A;  1GLF O;  4JKG A;  2YI1 A;  4FOE A;  2DTU A;  4LF4 K;  3KVG A;  3J81 O;  3WXM B;  1BU6 O;  1NK4 A;  3E1Y A;  4KHU A;  5FPN A;  3PO4 A;  1BWF O;  1ATS A;  2P5G A;  2KTQ A;  4E7H A;  3I33 A;  4HWI A;  4C1N K;  4BR9 A;  4FLY A;  3F9M A;  3AVN A;  1S3X A;  3HI0 A;  2YX6 A;  4JRQ A;  3PX4 A;  1NJW A;  3VEW A;  2O8C A;  3ZSZ A;  3H3N O;  2UXC K;  1LAV A;  1NMN A;  1GLJ O;  4LF9 K;  4CFA A;  1EKE A;  3ZT3 A;  3UKU B;  4M3R A;  4RW8 A;  3MEE A;  2KW4 A;  4K0K K;  4ILH A;  4DQI A;  5LJV A;  4DF8 A;  3I56 N;  2DPN A;  1KAX A;  2AP1 A;  4BRM A;  4CJS A;  2RE2 A;  1DTQ A;  1NNE A;  4DLG A;  3KWG A;  3C65 A;  3VEZ A;  4F4K A;  5ELZ A;  4B8C A;  2NRT A;  3LL3 A;  3NDK A;  4DV4 K;  3LDN A;  2Z1I A;  3FR0 A;  3HM9 A;  3QO9 A;  4A62 A;  5M1N A;  4N41 A;  3TAM A;  1XNQ K;  1VAZ A;  3CI5 A;  5AZJ B;  3ITH A;  5DK5 A;  4DR5 K;  3CCL N;  2E1Z A;  4OKK A;  3DLH A;  4FJ8 A;  2G8K A;  4DTU A;  4DFJ A;  3CQX A;  3ZSX A;  2QI2 A;  3WNE A;  3S5T A;  2I5J A;  4CD3 A;  3AVK A;  1TL3 A;  3CC4 N;  4B9U A;  1K8A O;  4CGJ A;  2O8D A;  2J4R A;  3O3H A;  3HO1 A;  1A5X A;  3UKR B;  4CF8 A;  3UIQ A;  1NGH A;  3OYC A;  5AQZ A;  3O9U A;  1S6Q A;  3WXK A;  1EX4 A;  4DTR A;  3CCE N;  1U45 A;  1QE1 A;  3AAR A;  2HHW A;  3L0Q A;  4DS4 A;  1IO2 A;  5BR8 K;  1YT3 A;  4EHU A;  1NGG A;  3OW2 M;  3FZF A;  1S9E A;  4BR5 A;  3VOV A;  1KLM A;  1HX1 A;  3G6E N;  2V7Y A;  2PYL A;  3EKU A;  2Q31 A;  3BGR A;  3MCP A;  1D8Y A;  4DSK A;  1UA0 A;  3CM5 A;  1T8E A;  2RKI A;  4HUF A;  4BRC A;  1U47 A;  1BQM A;  4C8K A;  4G1Q A;  3ENO A;  5M1K A;  3MXJ A;  4H0V B;  4Y1D A;  1C0F A;  5CE3 A;  1C1A A;  2YKM A;  1RT6 A;  3S3M A;  4KHQ A;  4TSX A;  3ZCM A;  2ZJP L;  3V1Q A;  4JKF A;  2OTJ N;  4PWD A;  3WXL A;  3V9X A;  4CCH A;  3LZJ A;  5FRN A;  2FF3 B;  3THW A;  2OPQ A;  4OJR A;  2HHV A;  2NRW A;  2XY8 A;  3U3G A;  4CW7 B;  3D7E O;  5SWM A;  3PX6 A;  2V52 B;  5AQQ A;  3OBY A;  4DFP A;  4CBX A;  4WFB L;  3FFK B;  4PL8 A;  3A2F A;  2P9K B;  4H5N A;  1M1K O;  4E3S A;  3MDQ A;  3CET A;  3MCA B;  1XC9 A;  4DFK A;  2E4L A;  1GOB A;  4G9Z A;  3S3N A;  3OYE A;  4DCH A;  4MDB A;  4M41 A;  3SBG A;  1NOY A;  2GUI A;  1XHX A;  3U9Z A;  4JKB A;  4RWT A;  4I2P A;  4YOV A;  2HNZ A;  3O9T A;  3SJH A;  4YFU A;  4CGG A;  2P9L A;  4JKG B;  2C1I A;  2YJF A;  1REV A;  5JMV A;  3T7Z A;  4Q0B A;  4CZE A;  4BRP A;  3W0L A;  3ZX2 A;  4R5P A;  2ETJ A;  2ATQ A;  5KQD A;  3OS1 A;  1HKG A;  1T6C A;  1C0T A;  3CFP A;  5LY3 A;  4PQU A;  3C6U A;  4M3T A;  4JI1 K;  4MDA A;  4ELT A;  3DLE A;  3AVA A;  3SV4 A;  3HOS A;  2XHB A;  2C1G A;  4ID1 A;  2HVH A;  4Y1C A;  3CJ9 A;  3CJB A;  3MWP A;  3SAF A;  2O8E A;  3HZ6 A;  1D9F A;  1LWF A;  3MEC A;  4KTQ A;  1S22 A;  4F8R A;  4M42 A;  5DM7 L;  1HNZ K;  4NLC A;  4H03 B;  3ZEU A;  4NB4 A;  4CEF A;  3WQT A;  2IIR A;  3HP9 A;  3HJF A;  1JL2 A;  3FFI A;  1RFQ A;  1N34 K;  4JK9 A;  2HNY A;  4H4O A;  2GTD A;  1T44 A;  4KHN A;  3AAQ A;  2VWJ A;  3P38 A;  4BC5 A;  3NF7 A;  1HNX K;  1KFD A;  1EWQ A;  2NRH A;  4IO9 L;  2IOC A;  3VF2 A;  1BL3 A;  3ID8 A;  3HYF A;  4B9L A;  3VA3 A;  3M8Q A;  2I7P A;  1TAQ A;  1TKT A;  4X62 K;  4DSJ A;  1GOA A;  1VSD A;  1NGC A;  2E20 A;  1Q82 O;  4OKJ A;  1NJI O;  3KKR A;  1QHA A;  4FJJ A;  1YI2 N;  2F9W A;  2QWR A;  4EFH A;  3A5M C;  5AQN A;  1TKX A;  2O4G A;  1GLD G;  3M6G A;  4CZJ A;  1RT1 A;  5C12 A;  4LF8 K;  5KQ8 A;  4BRD A;  4IEE A;  5JS1 A;  3I0R A;  1C0G A;  3LWL A;  3CPE A;  5AFU H;  4JAX A;  2HMP A;  4CIF A;  5IT9 O;  5HL7 L;  2IVO A;  4MLH A;  3RTV A;  1QVF M;  2P1J A;  4EZ6 A;  3SUP A;  1GLB G;  3WEE B;  3TAE A;  3HBT A;  1XC3 A;  3R3L A;  4QS9 A;  5AQJ A;  5H1S Q;  4ZTJ A;  3BUZ B;  3KZB A;  4CEZ A;  5JVH L;  5LMU K;  3QML A;  4BR7 A;  5BPM A;  3HPO A;  3B6O A;  3I8B A;  3KKS A;  4J2E A;  5HBM A;  4DTP A;  4A2A A;  1JXE A;  1SL0 A;  4CHN A;  3LAL A;  3CFO A;  3C0B A;  4CBW A;  3HT3 A;  3ZSW A;  4UQG A;  4IG3 A;  5C15 A;  4DTJ A;  1QQN A;  2Q0R A;  5BPL A;  4LF7 K;  4B3T K;  1FKO A;  1Z26 A;  1RDW X;  4M3Z A;  1RT5 A;  5C2D A;  5BPN A;  1YAG A;  3THW B;  4BEB A;  4BDZ A;  5J2P A;  1NJX A;  1DTT A;  1WBB A;  5JIC A;  2FF6 A;  1NJY A;  1S1W A;  4FM2 A;  4CZK A;  3O9S A;  2NLX A;  5F1X A;  4JD2 B;  3FZL A;  1OH7 A;  4GKK K;  4BWJ A;  5C25 A;  5EY4 A;  4DU1 A;  5DM6 L;  4CJ5 A;  3KLI A;  2GEL A;  4I6M B;  4BQZ A;  5BN8 A;  4M7Y A;  3HST B;  3AO2 A;  3OYH A;  3TSP A;  2DFF A;  1LOT B;  4DB3 A;  1DLO A;  2OPS A;  3C7N B;  2ZWH A;  3H6E A;  1RNH A;  1E3M A;  3K9J A;  4BVP A;  3E9O A;  1NKE A;  4IZ9 A;  3VER A;  1TK5 A;  2PY5 A;  1JLB A;  1SZ2 A;  3OYN A;  4FJ7 A;  2HBM A;  4JKC A;  5FPD A;  1ATN A;  1GLA G;  4QAG A;  2QW9 A;  4CJW A;  1I3A A;  4AHC A;  5IWA K;  3SAG A;  1C0M A;  4CJE A;  5D3G A;  3CIP A;  2PAV A;  3DAW A;  4JKA A;  1P90 A;  2P9P A;  1IKY A;  1WSG A;  4GNI A;  3VGK A;  5CYQ A;  4AIL C;  5J2M A;  2O8B B;  3OYM A;  4CJU A;  1RT3 A;  4N5S A;  2HBJ A;  3T19 A;  5KGX A;  3U4L A;  4LC9 B;  1TL1 A;  2NRZ A;  1RDD A;  1NOZ A;  3THX A;  5TKW A;  4LSN A;  4DUZ K;  3VF4 A;  1NGI A;  3WUH A;  3VEX A;  2QM1 A;  4Z4C A;  1EWR A;  1O1W A;  1NGB A;  2FBX A;  2JWK A;  4DR1 K;  3ZET B;  3NF8 A;  4CHQ A;  4W5N A;  1YHQ N;  3B6P A;  3MEG A;  1VQ9 N;  3J7A P;  4DR7 K;  5JLH A;  2YHA A;  3QIP A;  4Z4G A;  4CJK A;  5KPR A;  1BQN A;  1BDG A;  2QXF A;  3RVC A;  3OS2 A;  1XI1 A;  5EU7 A;  1YTU A;  3D2F B;  4CEC A;  3NVM A;  4RW4 A;  4E7I A;  4DTS A;  1XMQ K;  1VSH A;  1KD1 O;  1J54 A;  4NYN A;  3DYA A;  2GV9 A;  2VG6 A;  1I39 A;  4F3T A;  4NYF A;  4GVE A;  4H0Y B;  4NCB A;  4DQP A;  1V4T A;  2ITG A;  4E1M A;  1VK0 A;  4H5V A;  1TYQ A;  4F2R A;  3QIN A;  4M63 C;  3MAQ A;  1KVA A;  1Z05 A;  1SKW A;  2QWO A;  1QQC A;  2P9U A;  3R8E A;  4WF9 L;  2OYQ A;  2UXD K;  2QA4 N;  4BE0 A;  3T1Y K;  3J8A A;  1Z25 A;  2BDP A;  3VEO A;  1S1T A;  4DSE A;  3O08 A;  4DG1 A;  4FJM A;  3VEY A;  3JXU A;  3M1F A;  1HNI A;  3O4W A;  3ULE A;  1Q9Y A;  3NF9 A;  4XH5 A;  3EE9 A;  4FPB A;  1VQL N;  4MO4 A;  2KFZ A;  1WSH A;  4CJF A;  1WBD A;  4OGC A;  2XRI A;  5J1E A;  2W00 A;  3I0S A;  4LF6 K;  2WBN A;  1S6P A;  4MO5 A;  4YOR A;  1FJG K;  4A5A A;  4IEI A;  3V9U A;  3NH0 A;  3HSC A;  1UOC A;  3M8S A;  3RR7 A;  5AQV A;  3EE8 A;  1RT4 A;  1NBW A; 
#chains in the Genus database with same CATH homology
 4XH1 A;  3O1W A;  4J8F A;  3NVK A;  1NGH A;  5AQZ A;  3O9U A;  3ZX0 A;  4OO1 J;  3WXK A;  5BRF A;  2Q36 A;  4H0X B;  4K43 A;  3BEX A;  4WFN L;  5AQF A;  2V51 B;  1VQ6 N;  4IOA L;  4BRL A;  3CCE N;  1VQM N;  1KAZ A;  4IWV A;  4JHD A;  5AQM A;  3SK3 A;  4FPA A;  1KXP A;  3VGM A;  2YJE A;  3AAR A;  1NGE A;  2KLA A;  3L0Q A;  4YOY A;  3O5B A;  3ZET A;  4EHU A;  3W3D A;  5BRD A;  3O8M A;  3TU5 A;  2VGM A;  1NGG A;  1Z6R A;  3OW2 M;  3ZEU B;  3FZF A;  4BR5 A;  4H5T A;  2FSN A;  3E66 A;  2KHO A;  2E1Y A;  3VOV A;  1HX1 A;  4KH4 A;  3G6E N;  2V7Y A;  1BA1 A;  5M1O A;  3A8Y A;  4B9Q A;  4FWM A;  2P9I B;  2HBL A;  1VQN N;  1O13 A;  3EKU A;  2Q31 A;  3D2F A;  3MCP A;  1R59 O;  4KBO A;  3SBT A;  2E2Q A;  3A5O C;  5B8H A;  4XH4 A;  1X9J A;  4BRC A;  2D0O A;  3DXM B;  3ENO A;  5M1K A;  3EO3 A;  3D2E B;  4H0V B;  5E84 A;  2HBK A;  1C0F A;  1XQS C;  2E88 A;  4BRA A;  5CE3 A;  5AFU A;  2HST A;  3BF1 A;  3RSE B;  4CBU A;  3VET A;  5MLC Q;  3H1Q A;  3H1V X;  2ZJP L;  4O5F A;  4JKF A;  3Q7C A;  2OTJ N;  3FZM A;  3WXL A;  4BC3 A;  4GV6 A;  2A5X A;  1E4F T;  3QIC A;  3CMA N;  3PLA A;  5ADX H;  5LJW A;  1XUP O;  3FE1 A;  2FF3 B;  1RGI A;  1VQ5 N;  2Q97 A;  2CH5 A;  1HJO A;  1H1V A;  2NRW A;  3IFR A;  3P4I A;  4CZI A;  3D7E O;  3ZYY X;  4F9O A;  4WFA L;  4H0T B;  2V52 B;  5AQQ A;  3OBY A;  4CBX A;  1HKB A;  1VQK N;  4WFB L;  3ID6 A;  3BF3 A;  3FFK B;  4PL8 A;  2Q2R A;  2P9K B;  4H5N A;  3F2K A;  1M1K O;  4YOW A;  1DEJ A;  3MN5 A;  3WXI A;  3MDQ A;  3CET A;  3MCA B;  5AQR A;  3G25 A;  2CH6 A;  5AZI B;  3PIO L;  3N4P A;  2W41 A;  1MWK A;  3K9K A;  4FWK A;  4G9Z A;  4GY2 B;  4DCH A;  4MDB A;  3DLL L;  4CZF A;  5M1F A;  2WC9 A;  3SBG A;  4JK7 A;  3U9Z A;  3EN9 A;  3FGU A;  4JKB A;  4RWT A;  4YOV A;  5AZJ A;  2QTD A;  1BA0 A;  3J7Z O;  3FZK A;  1V4S A;  2FLO A;  3O9T A;  3SJH A;  2GWK A;  3H3O B;  4A57 A;  4FOI A;  2P9L A;  3C6A A;  5AQW A;  2A3Z A;  2Q0U A;  3GL1 A;  2VCP A;  3CF5 L;  2IVN A;  1D4X A;  2E8A A;  4JKG B;  2C1I A;  4CJ7 A;  3FLC O;  2YJF A;  1MA9 B;  5JMV A;  3T7Z A;  5KPT A;  1P8Z A;  1W97 L;  5M1P A;  3VPZ A;  1BG3 A;  4BRP A;  1CZA N;  3W0L A;  3ZX2 A;  4CZE A;  3EKS A;  1WUA A;  1U2V B;  3UKR A;  1HKG A;  4WCE L;  5KQD A;  1T6C A;  4B1U B;  5LY3 A;  4B1V A;  4AM7 A;  4MDA A;  1E4G T;  4BR0 A;  4FVU A;  3VES A;  2VYP A;  2ZGY A;  3LDP A;  1YJ9 N;  3HOS A;  5M1Q A;  3LDQ A;  4FSV A;  2C1G A;  2NZT A;  3VF6 A;  4PKI A;  1TYQ B;  1EQY A;  3CJ9 A;  1OKJ A;  3CJB A;  3MWP A;  4K42 A;  3SAF A;  1Q81 O;  3A5L C;  4IFE A;  3HZ6 A;  3MX5 A;  4H5R A;  1S22 A;  2ITM A;  1LCU A;  3VTH A;  1YVN A;  5AQO A;  5DM7 L;  4NLC A;  4H03 B;  2BH1 A;  4NB4 A;  3ZEU A;  1VQ8 N;  3VEV A;  1YIT N;  3WQT A;  2IIR A;  1ZXO A;  5AQK A;  4IDH A;  4A5B A;  2P9I A;  1RFQ A;  1TUY A;  2A6A A;  4JK9 A;  4ILG B;  1VQO N;  4PL7 A;  4PHT X;  2GTD A;  1NWK A;  1T44 A;  1K73 O;  3CJC A;  3AAQ A;  3DXM A;  3P38 A;  4BC5 A;  4ILJ A;  3E9L A;  4C23 A;  1K8K B;  2HOE A;  3D2E A;  3A5N C;  3OA9 A;  2NRH A;  4OPA A;  4OPH A;  4IO9 L;  4CI6 A;  3VF2 A;  1QVG M;  5JLF A;  2RHK A;  2ZGZ A;  5AQH A;  1Q7Y O;  3MX2 A;  3RSE A;  3ID8 A;  2GX9 A;  1ATR A;  2VGN A;  4YOX A;  2CGJ A;  2YCH A;  3HOT A;  2I7P A;  1NBW A;  4GV3 A;  3TTC A;  4CZH A;  4BR2 A;  4BRG A;  3EL2 A;  5I9E B;  1NGC A;  2E20 A;  4WQ4 A;  1Q82 O;  1NJI O;  4XEI A;  1QHA A;  4YDU A;  4IJN A;  4QS8 A;  2P9S B;  1K9M O;  3M3Z A;  4BQL A;  3DXK B;  2CGL A;  1YI2 N;  2F9W A;  2QWR A;  5TKY A;  2A42 A;  3TSQ A;  4EFH A;  3A5M C;  3U9D A;  5AQN A;  4JEP A;  2BUP A;  3C6H A;  2YHY A;  3O80 A;  4B1X B;  4KH5 A;  2PBD A;  4EIA A;  1GLD G;  5C0Y A;  2E2O A;  3M6G A;  2F9T A;  4CD1 A;  4CZJ A;  3CCR N;  5C12 A;  3IDH A;  2P9K A;  1KQS M;  4BGA A;  5KQ8 A;  1QQO A;  4BRD A;  1BUP A;  2OAN A;  4IEE A;  3FZH A;  5GIN A;  3SMS A;  5AZI A;  5FPM A;  3MK6 A;  4M7X A;  3E9P A;  3L4I A;  1C0G A;  1VQ7 N;  3CPE A;  3LM2 A;  5AFU H;  4JAX A;  2HMP A;  5AQI A;  3L6Q A;  5HL7 L;  4FWL A;  4JHD B;  2IVO A;  3UKU A;  1QZ6 A;  2E2P A;  3MN7 A;  4MLH A;  3F5T A;  1QVF M;  4EAH D;  4IJA A;  1JJ2 M;  2QEX N;  4BVO A;  1J6Z A;  1GLB G;  2P9P B;  4BR4 A;  3WEE B;  5AQS A;  1NM1 A;  2P9N B;  2E2N A;  1KC8 O;  3HBT A;  1XC3 A;  3Q7B A;  3R3L A;  3H46 O;  5AQL A;  4QS9 A;  4B1Y B;  3G71 N;  5AQJ A;  3ZX3 A;  4H0O A;  4B1Z A;  5GIP A;  5H1S Q;  4FWP A;  4YOT A;  4BRH A;  3BUZ B;  3KZB A;  3LDL A;  5JVH L;  4CZL A;  1TUU A;  3QML A;  4BR7 A;  4U67 L;  1BOT O;  5BPM A;  1YIJ N;  3CCM N;  1QZ5 A;  2EWS A;  4UY8 O;  1ILY A;  1U2V A;  2GWJ A;  3I8B A;  2D4W A;  1JCF A;  3EZW A;  5AQG A;  1GLE G;  4A2A A;  3QBW A;  1YJN N;  3IMX A;  5BN9 A;  3CJA A;  4IXC A;  4B1W B;  3CCV N;  2QWL A;  3KWI A;  5F0X A;  3C0B A;  2Q1N A;  2FSJ A;  4FL9 A;  3CCS N;  3H45 C;  1W2B M;  4CBW A;  2GUP A;  2YHX A;  5GAG P;  1EO1 A;  5C15 A;  3I55 N;  3AY9 A;  1QQN A;  4WQ5 A;  1MWM A;  2Q0R A;  1IG8 A;  2FSK A;  3VMF B;  5BPL A;  2WFB A;  5BR9 A;  2BTF A;  5GAH P;  4JN4 A;  1JCE A;  1NLV A;  5F2R A;  4JKE A;  1SQK A;  4BG8 A;  4AF1 A;  1RDW X;  3O9Q A;  5C2D A;  5BPN A;  3NMU A;  1YAG A;  3CQY A;  2H3G X;  4IO8 A;  4AM6 A;  4BEB A;  3ATU A;  2UYT A;  3MMV A;  2OTL N;  3GDQ A;  4A2B A;  3IKM A;  2QWN A;  4CZG A;  5JIC A;  2FF6 A;  1VQP N;  4RCH A;  2CGK A;  5E26 A;  1HKC A;  1ZBS A;  1IJJ A;  3BP8 A;  5FPE A;  3UB5 A;  4CZK A;  3UE5 A;  2NNW A;  1K8K A;  3O9S A;  2NLX A;  5F1X A;  1YJW N;  4JD2 B;  1GLC G;  3FZL A;  2P9U B;  2QWQ A;  5AQX A;  5EY4 A;  3P39 A;  3CCQ N;  3CC7 N;  1SAZ A;  5DM6 L;  4BQZ A;  2GEL A;  4I6M B;  5BN8 A;  4Z94 A;  4M7Y A;  3IUC A;  3N4Q A;  4ISG A;  5HOO A;  4BGB A;  2P9S A;  4FWR A;  3TSP A;  2KKZ A;  3SAH A;  2NRR A;  3WQU A;  4DB3 A;  1LOT B;  2NRX A;  1BO5 O;  4BEC A;  5AR0 A;  3VTI A;  1X3M A;  3WT0 A;  3C7N B;  1YF5 L;  2ZWH A;  3H6E A;  4NLB A;  1X3N A;  3K9J A;  4K25 A;  5AQY A;  3ULE B;  4BVP A;  3E9O A;  5KPZ A;  3CCJ N;  2F7T A;  4IZ9 A;  4KH6 A;  3VER A;  2D0P A;  3PIP L;  1OVY A;  5CHI A;  2ZJR L;  3ATV A;  2ASO A;  4BG9 A;  4BRN A;  5C10 A;  1DKG D;  3QFU A;  1SZ2 A;  2HF4 A;  3A0I X;  1NGD A;  5GIO A;  2HBM A;  3LM9 A;  4JKC A;  5FPD A;  1ATN A;  1GLA G;  2I7N A;  3GG4 A;  2QW9 A;  1NGA A;  3AAP A;  1T3V A;  3O1B A;  3SAG A;  2FXU A;  3CIP A;  4H5W A;  4BRK A;  4JKD A;  3M5R A;  2YHW A;  2PAV A;  3DAW A;  4JKA A;  1P90 A;  2P9P A;  4YOU A;  4A59 A;  2AA4 A;  4WYB A;  4GNI A;  3VGK A;  3WEE A;  4Y0W A;  2P9N A;  4IOC L;  4DKW A;  3HRG A;  3TPQ A;  4U7B A;  3MN6 A;  3CME N;  3CER A;  3SMP A;  3QDK A;  4A61 A;  4BRQ A;  5C2F A;  2HBJ A;  1MDU B;  4PKG A;  3CJ1 A;  3R1X A;  3U4L A;  3AGK A;  4LC9 B;  3R9P A;  2NRZ A;  5EX5 A;  4DHY A;  4CZM A;  1VQ4 N;  2PFU A;  2JWL A;  5TKW A;  3VEN A;  2VWB A;  3L4Q A;  4E1J A;  3VF4 A;  1DT9 A;  1NGI A;  3WUH A;  1HPM A;  2QM1 A;  3VEX A;  2W40 A;  1NGB A;  3B8A X;  1NGJ A;  3WXJ A;  2JWK A;  4HTL A;  1GLL O;  3CXC M;  3ZET B;  3QBX A;  3JS6 A;  4FWQ A;  1YHQ N;  4BRO A;  3MWT A;  2A41 A;  1VQ9 N;  5ADX A;  5GAD P;  4L3Q A;  3S41 A;  4JK8 A;  1Q86 O;  4WQ4 C;  3O6W A;  5JLH A;  3OHR A;  2ZJQ L;  1ZC6 A;  4ISE A;  4YDU C;  5JVG L;  5KPR A;  5CR4 A;  1GLF O;  1BDG A;  2YI1 A;  2ZF5 O;  4FOE A;  2GEM A;  4JKG A;  1YXQ A;  3TSU A;  3RVC A;  4C1N I;  3KVG A;  1S72 N;  3D2F B;  3NVM A;  3TTF A;  3DJC A;  3TTD A;  3WXM B;  1KD1 O;  1BU6 O;  3E1Y A;  2QWM A;  5FPN A;  2ASP A;  1N8R O;  3T69 A;  1BWF O;  1ATS A;  3OBW A;  4BY9 C;  3I33 A;  4GVE A;  4H0Y B;  4HWI A;  4C1N K;  4BR9 A;  3SLC A;  3GE1 A;  4BC4 A;  3F9M A;  1V4T A;  4FWO A;  4RTF D;  4FWN A;  1S3X A;  3HI0 A;  1Q18 A;  2YX6 A;  1TYQ A;  3KK7 A;  4H5V A;  2HF3 A;  3KHY A;  4PKH A;  3VEW A;  4M63 C;  1ESV A;  1M90 O;  3H3N O;  3VGL A;  1GLJ O;  1RDU A;  1Z05 A;  3CHW A;  3ENB A;  3G4S N;  2IVP A;  4JD2 A;  1HUX A;  2QWO A;  3ENH A;  2P9U A;  1NMD A;  3R8E A;  1NGF A;  3UKU B;  2V7Z A;  4WF9 L;  3GOI A;  5BRE A;  2QA4 N;  4XJX A;  3J8A A;  2A40 A;  4ILH A;  4I6M A;  4DQ8 A;  1U6Z A;  1Y64 A;  2NRV A;  5LJV A;  1DGK N;  4QS7 A;  3VEO A;  4BC2 A;  4JNE A;  3I56 N;  3O08 A;  2DPN A;  1KAX A;  3MN9 A;  3VEY A;  3DWL A;  2AP1 A;  1WOQ A;  1YUW A;  3JXU A;  5EVZ A;  4BRM A;  4IOX A;  2RE2 A;  3M1F A;  4FWS A;  3KWG A;  5EXW A;  3C65 A;  3CC2 N;  3O4W A;  3O9R A;  3C7N A;  3ULE A;  3VEZ A;  5ELZ A;  2ASM A;  2NRT A;  4O8U A;  3LL3 A;  1HLU A;  3LDN A;  3HM8 A;  4XH5 A;  3FR0 A;  4EHT A;  1JCG A;  3QFP A;  5BRH A;  1T6D A;  3EE9 A;  4FPB A;  4K41 A;  4O8K A;  3CPW M;  1VQL N;  4MO4 A;  4A62 A;  4BRE A;  5M1N A;  4BE7 B;  1VAZ A;  3CI5 A;  1KAY A;  5AZJ B;  3D6R A;  2QWP A;  2W00 A;  2QXL A;  3CCL N;  2WBN A;  2E1Z A;  5GAE P;  2D1K A;  4JKH A;  4MO5 A;  4WQ5 C;  5AQP A;  3U8X A;  3DXK A;  4GV9 A;  3QB0 A;  3P31 A;  4YOR A;  5AQT A;  1G99 A;  2P9L B;  3CQX A;  1QQM A;  3HTV A;  2QI2 A;  3R6M A;  3CD6 N;  4FO0 A;  4IEI A;  4A5A A;  4MLE A;  4NO7 A;  4R79 A;  4BRI A;  4ISF A;  4CD3 A;  5EOY A;  3AGR A;  3CJ7 A;  3HSC A;  3LDO A;  5AQU A;  4BRF A;  3CC4 N;  1K8A O;  4H0P A;  2WUS A;  5AQV A;  2J4R A;  3CCU N;  3GBT A;  3EE8 A;  3UKR B;  1SS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...