5ADXA

Cryoem structure of dynactin complex at 4.0 angstrom resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
370
structure length
370
Chain Sequence
IANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKEQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Dynactin Complex and its Interaction with Dynein.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords ACTIN RELATED PROTEIN 1
total genus 85
structure length 370
sequence length 370
chains with identical sequence B, C, D, E, F, G, I
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5adxA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5adxA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 5adxA03
1HKCA 4XEIA 5BPNA 5AQPA 2F9TA 3ENOA 5KQ8A 3IMXA 1NBWA 2CGJA 3VEVA 4BRFA 4H0OA 5FPMA 1K8KA 3GG4A 3AY9A 3IUCA 3ID8A 3OHRA 4JD2B 2I7NA 5AQYA 1R59O 2QW9A 5ADXH 1U2VA 3ZEUA 3WXLA 4WQ4C 4RTFD 3QFUA 3D2FA 4FOIA 3CQXA 4BGBA 5JMVA 2P9SB 3WT0A 4HTLA 3M1FA 2H3GX 4WQ5A 3HZ6A 5AQHA 4I6MB 3WQUA 1NGBA 3A5LC 3MN7A 4FWSA 4QS7A 5ADXA 1BA0A 2VCPA 4H5NA 4J8FA 3UKUB 3SMSA 5LJWA 2IIRA 4O5FA 2PAVA 3ATVA 2D0OA 2IVPA 1MDUB 1KAXA 5BR9A 4BRDA 2HF3A 5AFUH 1RGIA 3RSEA 3FE1A 4BC3A 4H0PA 3H1VX 4IJAA 4BGAA 2E8AA 3ZX2A 1QZ6A 1KXPA 4H0YB 5BPLA 3I33A 3VEZA 4FOEA 5KQDA 4CZGA 4H0TB 2QWPA 2E88A 4BRNA 1DGKN 3EKUA 4BG8A 3WXJA 1WUAA 3FZMA 2P9NA 4A61A 3CETA 1Z6RA 4WQ5C 3B8AX 4FPBA 5B8HA 4O8KA 2YJEA 5AQJA 1IG8A 3ZETA 4BRGA 4BRQA 5I9EB 4ISFA 4PL7A 3MMVA 4BRHA 2GUPA 3VF6A 1GLBG 1U6ZA 4Y0WA 3GDQA 2I7PA 3O4WA 4BC2A 4XH4A 1QZ5A 2A3ZA 2E2PA 4JD2A 4BR0A 5AQMA 1BU6O 3LM2A 3VGLA 1TYQA 3DXKB 3VOVA 4AM7A 5KPRA 1GLDG 3WEEB 4EHTA 3DJCA 3ZX0A 4FWQA 2VYPA 2P9SA 3LM9A 1T6DA 4BR9A 1HLUA 4JN4A 4PKHA 5AZIA 3U4LA 3VENA 1SAZA 3ATUA 4CZMA 4NB4A 1C0FA 1YVNA 3IFRA 4H0VB 5AQKA 4BC4A 1NGJA 2EWSA 4M7XA 1JCFA 3RSEB 3KZBA 2QWMA 5AQTA 1NWKA 1RFQA 1V4TA 4K41A 4CD1A 2Q31A 2Q0UA 3HTVA 3QBWA 2OANA 2Q0RA 1S3XA 3WXIA 4PKGA 5E26A 3CQYA 3D2EA 4L3QA 3ULEB 2Q2RA 4ISEA 4B1YB 4IZ9A 3WUHA 1ESVA 2CGKA 3MN9A 4EIAA 4XH5A 3A5OC 1BUPA 2E2QA 4BRKA 3ZETB 2PBDA 3AAQA 3UB5A 1SZ2A 1XQSC 5AZJA 1HPMA 4K42A 2V52B 3BF1A 2P9LB 2ZF5O 3AARA 1K8KB 5AQLA 4BR7A 1T44A 3CI5A 4JHDA 5AQNA 1U2VB 3BF3A 1HKGA 2CGLA 4KBOA 3VERA 3IDHA 3O08A 4CBXA 5BRHA 4BC5A 4JAXA 2ASMA 3CJCA 3L4IA 3DAWA 3WQTA 3UKRB 2QWRA 1JCGA 3JS6A 3D7EO 4BR4A 3CJ7A 5AQSA 2P9UA 2J4RA 3WXKA 4FWRA 4BVPA 4FWKA 2FLOA 4FWMA 2QM1A 4MO5A 4PL8A 1ZC6A 1YUWA 1G99A 3LDPA 3U8XA 4YDUC 3A0IX 3CHWA 3AAPA 1S22A 3UE5A 1Z05A 4BROA 3H46O 4CZHA 1NGIA 2P9IA 1KAYA 3C7NA 3LDNA 4GY2B 3VESA 3VGKA 3DXMA 4CZLA 2A5XA 2P9KA 3QBXA 1TUYA 4CZKA 3O5BA 1BA1A 2GWJA 2P9NB 3HSCA 1QQOA 3MN6A 2FF6A 1X3MA 5AZIB 1GLFO 2QXLA 4K43A 5FPEA 2DPNA 1NGAA 2W40A 3LL3A 4DCHA 3FLCO 2W41A 3JXUA 1Y64A 4WYBA 5EOYA 3CIPA 2F9WA 4YDUA 2ZGZA 4BR2A 4BRAA 2E2NA 3TU5A 2P9IB 2FF3B 1DKGD 1TYQB 2FXUA 3C0BA 3DXKA 3C7NB 3DWLA 2NRHA 4M63C 4CZFA 4IXCA 3VPZA 1HUXA 2GEMA 1YAGA 5AQXA 2QWLA 4BQLA 2YJFA 1GLEG 4AM6A 5AQFA 3HBTA 5AQOA 5LY3A 1H1VA 4H5WA 1Q18A 2P9PB 4ISGA 4EHUA 3CJ9A 2CH5A 2KHOA 3P4IA 2D4WA 2P9LA 3FZKA 2HOEA 2AP1A 4BRIA 4DB3A 5EY4A 3M6GA 3VEOA 1DEJA 4F9OA 2YHXA 4JHDB 1SQKA 2D1KA 3H3NO 2V7YA 5TKYA 3GBTA 1JCEA 2HMPA 3CJAA 2E1ZA 2P9KB 3VF2A 4DHYA 1NLVA 1LOTB 5JICA 1NMDA 4LC9B 5AQGA 4BRMA 3FZHA 3ULEA 1ZXOA 4FWNA 3VF4A 3LDLA 5AFUA 3A8YA 4I6MA 5BRFA 5AQUA 2A40A 3GE1A 3SLCA 1OKJA 5AQVA 2E1YA 4BVOA 4FPAA 3QMLA 3R6MA 4CD3A 1BOTO 3SK3A 4A2AA 3FR0A 1XC3A 5AZJB 2ASOA 2NZTA 2UYTA 4H5RA 4MLEA 2Q36A 4BRCA 1LCUA 2CH6A 3QB0A 1C0GA 3VETA 3H1QA 4A62A 4HWIA 2V51B 1V4SA 5AQQA 2AA4A 1TUUA 5EVZA 1P8ZA 3H45C 3BUZB 3EZWA 1KAZA 2E20A 3LDQA 3W3DA 3GL1A 5JLHA 2YCHA 2GWKA 2YI1A 5F1XA 5EXWA 1NGHA 3SMPA 1NM1A 4CZJA 3MDQA 1MA9B 2YHYA 3EL2A 3H6EA 5E84A 1GLLO 3QDKA 3TPQA 4B1UB 2FSKA 2FSJA 4GNIA 5EX5A 4H5VA 4WQ4A 3O6WA 3BEXA 3QFPA 3J8AA 5BREA 2A6AA 3G25A 4MLHA 1MWKA 4DQ8A 4BG9A 2E2OA 4B1WB 3GOIA 3KHYA 3FGUA 1QQMA 3U9DA 3WEEA 3H3OB 2IVNA 1HJOA 3MN5A 3QICA 4CI6A 5CE3A 5F0XA 4CJ7A 4BR5A 1X9JA 4IWVA 2GTDA 3ENHA 4JNEA 3O80A 4FWLA 1BDGA 4Z94A 4CBUA 4IJNA 3SJHA 5FPNA 4E1JA 2QWQA 4RCHA 5ELZA 3FZLA 3O1WA 2BTFA 3I8BA 4H5TA 1MWMA 3L6QA 4CZIA 3R8EA 1QQNA 4MO4A 3W0LA 3BP8A 2FSNA 3EO3A 1IJJA 3O1BA 4BRPA 4BQZA 2QWOA 1E4FT 2D0PA 3D2EB 1BO5O 2QWNA 1E4GT 4K25A 4PKIA 4BREA 4FO0A 4C23A 1HX1A 3LDOA 1GLCG 3UKRA 1ZBSA 1GLJO 1CZAN 5AQIA 1NGEA 1RDWX 3F9MA 2P9PA 2P9UB 1X3NA 1ATSA 3VEYA 4BRLA 3MCPA 5AQZA 5BN8A 4B1VA 2Q97A 4B1XB 1ATNA 3VEWA 3M3ZA 1BG3A 1WOQA 2ASPA 3S41A 3VEXA 4H0XB 4EFHA 3KVGA 4CZEA 4H03B 4IO8A 4NO7A 1ATRA 1NGFA 5FPDA 3R9PA 1T6CA 5BPMA 4QS8A 3FZFA 3CERA 4B1ZA 1HKBA 1BWFO 4FWOA 1NGCA 4FSVA 3ZX3A 2A41A 1EQYA 3ZEUB 4QS9A 3EKSA 4FL9A 4B9QA 3L0QA 5AQWA 3D2FB 4XH1A 2BUPA 2YHWA 3CJ1A 3VGMA 5F2RA 2NLXA 4M7YA 4RWTA 1XUPO 4FWPA 4A2BA 2ITMA 2A42A 2WUSA 2IVOA 2VWBA 5LJVA 5JLFA 2HF4A 1NGGA 3EN9A 3UKUA 5AR0A 5AQRA 1YXQA 4EAHD 3FFKB 2GELA 3A5NC 3HI0A 4CBWA 3A5MC 5BRDA 1NGDA 1GLAG 2ZWHA 3DXMB 3HM8A 5BN9A 3U9ZA 1QHAA 1D4XA 3CJBA 5KPZA 2ZGYA 2Q1NA 2V7ZA 5KPTA 3O8MA 1J6ZA 3MK6A
chains in the Genus database with same CATH superfamily
3KK3A 1HKCA 5JENA 5BPNA 1IH7A 3CCRN 3ENOA 3SQ0A 3CG7A 3OYGA 4V19S 1KD1O 1K8KA 2WFBA 3MWPA 1SV5A 2D0BA 3ID8A 1UAXA 4CFCA 4O8UA 1IBMK 5AQYA 3C6TA 1TL3A 4C8MA 4JRQA 2B5JA 4CW7B 2E6LA 4HHTA 3L3VA 1UWBA 4IG0A 4F2SA 4CESA 5GADP 4BGBA 3WT0A 2H3GX 2IGIA 2RF2A 4A5AA 2D0CA 4JLHA 3O9UA 1J54A 4FM0A 1NGBA 3A5LC 3RTVA 4FWSA 1S6QA 3THYA 1BA0A 4J8FA 3TTCA 3CMEN 3UKUB 5LJWA 4O5FA 2PAVA 3ATVA 3AO1A 5JS1A 3BZKA 5JVGL 1MDUB 4YOVA 3ZSRA 4M3YA 3LP3A 2UXDK 1JKHA 4BC3A 1RTDA 1QZ6A 5BPLA 4CJEA 4FOEA 1B9FA 2G8IA 3SBGA 5HBMA 1DGKN 3EKUA 3O3HA 3WXJA 3U6FA 4FK4A 2P9NA 3CETA 3LP0A 4FJHA 5B8HA 3K5LA 5LMUK 2YJEA 3NF6A 3ZETA 2G8FA 3HP6A 5I9EB 4ISFA 4BWJA 1GLBG 4CJPA 1U6ZA 4Y0WA 3O4WA 1QZ5A 2A3ZA 3K0SA 2E2PA 4JD2A 2E4LA 4BR0A 4O44A 3TSUA 3SUNA 4FCYA 4FW1A 3OYKA 1WSHA 1Y97A 1A5WA 1C1CA 3VOVA 4AM7A 1GLDG 1N36K 4K0KK 3DOKA 4FWQA 2P9SA 3LM9A 2O4IA 3K5MA 4IO9L 1BI4A 3VQAA 4JN4A 2GX9A 4NXMK 1NJXA 3OA9A 3DLHA 2VQFK 3AVFA 1KVCA 1C0FA 1C6VA 1DTQA 1JCFA 2QWMA 3MEGA 5AQTA 3VQ5A 1JLCA 2OANA 2Q0RA 2NRTA 2OCEA 1GOBA 1WSFA 4PKGA 4L3QA 1CZBA 1U4BA 2FBVA 3C6AA 5KGXA 4IZ9A 3DM2A 4IFVA 3MN9A 4XH5A 3ZETB 1W0HA 3AVHA 4WF9L 4B3RK 4DF4A 2V52B 4DR3K 3BF1A 1RCHA 2HHUA 4JKGA 4CFDA 4GV9A 1K8KB 5AQLA 1L5UA 5CYMA 3NH0A 3A2FA 4BACA 2CGLA 5CY4A 4BE1A 4BE2A 3TAMA 3WQTA 4JI6K 1K9MO 4BR4A 1WBBA 1YJ9N 3WXKA 3TAEA 4FWRA 1C1AA 3QEPA 1HYSA 1VSEA 3AA5X 4L8RB 4FWMA 2QM1A 4Z4EA 4DR6K 2XHBA 3CYGA 1EKEA 4GKJK 3A0IX 3ZT0A 4BROA 4C1NI 3I0RA 3CCJN 4X62K 2W6KA 1KAYA 4YOTA 2A5XA 1K8AO 4E7KA 1BA1A 4CJ3A 4YY3K 4JRPA 3S9HA 3KKRA 1NK0A 3KK7A 2IAJA 2FF6A 4DSEA 4CJLA 3FFIA 2OZMA 1J9AA 1X3MA 3THWA 2OTLN 1RDBA 4KHSA 5FPEA 3LL3A 3FLCO 2YNFA 4AQYK 3JXUA 1Y64A 5KI6A 1UA1A 4FLZA 1JJ2M 4YDUA 2QK9A 4I9LA 3TU5A 3LZIA 4NLBA 3L2UA 3DWLA 4G9ZA 2NRHA 4M63C 2KZMA 2X6SA 3VPZA 2GEMA 2G8UA 3PX0A 5DK5A 3M8QA 2JWLA 5AQFA 4DU3A 4FZXC 1U47A 5FRNA 1XHXA 1FKPA 1RILA 4BRIA 3QINA 1SUQA 4KREA 4DS4A 1J5OA 2E1ZA 4DV0K 3OYJA 4B8AB 1OH6A 2VWKA 1NU0A 4J2DA 3G71N 2IDOA 3HP9A 1ZXOA 4CFBA 3LDLA 5AFUA 4CGFA 4I6MA 5K14A 4O0IA 3SPZA 1P90A 1QS4A 2A40A 3ZSVA 4UY8O 2IS3A 3SK3A 4FXDA 4OPJA 5HRRA 3KLEA 3ZCMA 3IG1A 2FBYA 1RBUA 4KV8A 1IG9A 3OYDA 3NVMA 3QB0A 3VETA 3PSFA 2FBTA 3SUQA 1EXQA 4J2EA 3EZWA 4FW2A 3P83D 4OGCA 3GL1A 1TVRA 4CGGA 3LAMA 3SNNA 3CD6N 3O4NA 4Z4GA 4IKFA 3OS2A 5DMRA 5FRMA 2DTUA 3MX5A 4GNIA 5LL6Z 3VTHA 4GVMA 5TKWA 1Z26A 1Q9YA 4XIUA 4WQ4A 3G4SN 3F5TA 1RBTA 3G25A 4BG9A 3OVNA 4B1WB 2YNGA 3FGUA 4DLGA 5C0YA 4CJ5A 2IVNA 3QICA 4CI6A 1WAJA 3TR8A 5F0XA 4JV5K 4MDBA 3NCIA 3OYCA 4JKAA 2NUBA 3VQ4A 2P5OA 2E6MA 1EX4A 4FWLA 1WAFA 2NRRA 1FW6A 1RDUA 4DSKA 4IJNA 4IFEA 3QESA 5FPNA 2QWQA 4K8ZA 2GV9A 1MWMA 3P31A 5KTQA 4IEIA 1VQPN 4KHUA 3DRPA 1QQNA 4MO4A 3OYHA 3I55N 3T3FA 4CJUA 4CJWA 1IJJA 4EZ6A 2QWOA 1E4FT 2D0PA 4KFBA 1BO5O 4PKIA 2HHTA 3IS9A 4C23A 1GLCG 2ZD1A 1CZAN 5AQIA 1D5AA 1CXUA 3QEIA 1W9HA 2P9PA 1ZBIA 3AVIA 1ATSA 1HQEA 2HSTA 4B1VA 1S1WA 3V6DA 4FJIA 3VEWA 3M3ZA 3NF9A 1NJZA 3RMBA 1HNZK 1VQ4N 2VQEK 5MLCQ 3ZT1A 1MU2A 2OYQA 4FJMA 1T6CA 1VSLA 1S1UA 4DTRA 5BPMA 3OY9A 3CXCM 3CERA 1I3AA 1HKBA 2UUBK 4FWOA 4W5RA 4ZTFA 4FSVA 3ZX3A 2EHGA 2A41A 4M3WA 1EQYA 3ZEUB 4DTJA 4QS9A 1NKBA 4CFAA 2HW3A 1LAVA 3PIOL 2YHWA 5HL7L 4M7YA 4RWTA 3KD1E 4O4GA 4A2BA 2ITMA 4KKOA 1TKTA 5LJVA 3IAYA 5AR0A 5AQRA 1NKCA 1KCFA 1QSLA 5H1SQ 3AVGA 3PX6A 1D4XA 5KPZA 3HVRA 2YX6A 3V1OA 5KPTA 4RW9A 3SQ2A 5GAEP 3OYEA 3IMXA 4F2RA 4YORA 3VEVA 4NCAA 2KTQA 4H0OA 3T1YK 5E41A 2OA8A 3C94A 1JLEA 3HRGA 3AY9A 4LFCK 1TAUA 1W2BM 1RBRA 3IUCA 4JD2B 2Z1HA 4DUYK 2I7NA 3CCVN 1R59O 4CEOA 1RT5A 3SI6A 3L2WA 1EO1A 3ZEUA 3WXLA 4CJTA 2RHKA 3T19A 3TANA 3AA4A 4WQ4C 1VQ9N 1VSJA 4IG3A 5JMVA 4NYNA 4HTLA 3M1FA 5AQHA 3HM9A 2DFHA 1IKVA 3WQUA 1QSSA 5CR4A 3MN7A 4OGEA 2KQ2A 2ATQA 3M8RA 4N76A 2D0OA 1LWCA 2IVPA 1LW2A 4CHNA 4BRDA 3QLHA 3CC7N 4H0PA 4B3MK 4Z4HA 2E5LK 2HMIA 1KXPA 4H0YB 4DSJA 3I33A 1XWLA 4ELTA 3PLAA 3MEDA 2QWPA 4DV3K 5C25A 1VQ7N 2O8EB 4LD0A 3JAMO 1N32K 4KHNA 1NKEA 1F21A 3F2KA 1BI4B 1Z6RA 4WQ5C 4LFBK 4J2AA 1IG8A 4BRQA 2ZE2A 4PL7A 3MMVA 3PO4A 4CGIA 3OS1A 4DTOA 4HCBA 3TWHA 4KAZA 5AQMA 2BDPA 4WCEL 3QEWA 1KSPA 1BU6O 3LM2A 3O9QA 1VHXA 5M1OA 3VGLA 1TYQA 3DXKB 2QKKA 2FBXA 4C8LA 3KLFA 3DJCA 3ZX0A 2YV0X 3G0ZA 3TAGA 3H08A 1N34K 3KD5E 5AZIA 3RR8A 1ITGA 2ZJPL 1SAZA 3ATUA 2EWSA 1X9WA 1RBSA 2QI2A 3HPGA 3PIPL 4PWDA 1T3VA 2Q31A 4CIEA 3HTVA 2O8CB 2G8VA 2OTJN 1S9EA 3TTFA 2HHHK 2GBZA 1VQKN 2Q2RA 4ISEA 4B1YB 3C6UA 3Q7CA 4FVUA 1WSEA 1IKXA 3EE8A 4EIAA 1JXBA 3A5OC 2E2QA 3UB5A 1SZ2A 5AZJA 5CYQA 4KTWA 4M3TA 1ZBHA 4DQIA 4K42A 1RT2A 1S9GA 2O8FA 3AVLA 1X1PA 2ETJA 4RW6A 2WC9A 4BR7A 3AV9A 3L2VA 5AQNA 3BF3A 4KBOA 3NGYA 3VERA 3IDHA 2ASMA 1SKWA 4IOAL 1VRUA 3UKRB 2UUCK 2QWRA 1HYVA 3JS6A 4FJ8A 3D7EO 2O8DB 1OVQA 1LWFA 2P9UA 3I0SA 4E7HA 4DS5A 4BVPA 4CEBA 5FROA 2B6AA 2FLOA 3ZT3A 2F8SA 4CHYA 3K5OA 4PL8A 1L3UA 1FK9A 1ZC6A 1G99A 4CF8A 4YDUC 4HVJA 3OYLA 2PYLA 3CHWA 4CJSA 1Z05A 4N56A 3H46O 3OYFA 1O13A 4FLWA 2P9IA 3CFRA 2P5GA 2KW4A 3LDNA 4GY2B 4JI1K 3VA0A 3VESA 5HRSA 4QCLA 3P5JA 3QBXA 1XI1A 3E9OA 2GWJA 3O5BA 1QSYA 2P9NB 3RRHA 3DLLL 3G10A 3L3UA 3M5RA 2O8BA 4ILHA 4DFPA 5AZIB 1GLFO 3KK1A 3AA2A 4LH5A 4FZYA 4DCHA 4HUFA 4CK3A 3AO4A 2HHIA 4WYBA 5EOYA 2ZGZA 4BR2A 1WBDA 2E2NA 2XY6A 4O55A 4DU4A 2NRWA 4GVEA 4DFKA 4DKWA 1JL2A 3C0BA 3C7NB 3MXMA 4BDYA 2JLEA 1YAGA 5IT9O 5AQXA 4BQLA 3V9XA 1KLNA 2W00A 1GLEG 3V1QA 3ZT4A 5AQOA 5LY3A 4JEPA 1H1VA 3T1AA 4H5WA 1IBKK 2W6LA 5JVHL 1JLAA 2P9PB 4O0JA 5A2QO 1HNVA 1RT6A 3BZCA 2KHOA 3KWIA 3F73A 1FKOA 4KTQA 2HOEA 1WLJA 4DB3A 2WBNA 3M6GA 1DEJA 4F9OA 4LF7K 2QTDA 1SQKA 4JHDB 3ISNC 3K5NA 3CCQN 4DR4K 2V7YA 2VG6A 3V9WA 2A1RA 1D9DA 2O8CA 3CJAA 1NLVA 4UQGA 1QTMA 4BDPA 1RDAA 3SYZA 3ULEA 1QHTA 4FWNA 4H4MA 4E1MA 4EP4A 2DFFA 5AQUA 1OKJA 2E1YA 4FPAA 3QMLA 3R6MA 3VQ9A 4A2AA 2ZJRL 1XC3A 4X65K 4DQSA 4DSFA 3EYZA 4IOCL 4BRCA 3L2RA 2CH6A 1L3VA 3DMJA 1J53A 2XRIA 3H1QA 3QEXA 1NOYA 4FJNA 5KRSA 3BUZB 3SUPA 2YKNA 4LH4A 2E20A 1ZBLA 5JLHA 3AVAA 2GWKA 2YI1A 3LWLA 5F1XA 4DSIA 2W42A 4B9SA 4F4KA 1HJRA 1YF5L 3MDQA 3OJSA 3TPQA 3M8PA 4B1UB 2FSKA 2FSJA 1BGXT 4H5VA 4PA1A 2ZJQL 3O6WA 3E01A 2G8WA 4MLHA 4OLAA 1VSFA 3ASMA 4BE7B 4E0DA 4LSNA 2EX3A 3V9SA 3VN5A 1S5JA 4F3TA 3MN5A 5CE3A 2P51A 4RW7A 3WXMB 4W5OA 1UA0A 4DR7K 4CJ7A 4IWVA 2GTDA 4CHQA 3HT3A 1Q81O 1Q8IA 2BGGA 4DQRA 4OO1J 1HNWK 3V4IA 1NJYA 3SJHA 2OZSA 3FZLA 4C8OA 5CHIA 4H5TA 1KFSA 1HR0K 4GV6A 3K9JA 3R8EA 4N5SA 2X78A 3KWGA 3DLBA 3EO3A 1XMQK 1UOCA 4KH6A 4ZTJA 3SJJA 3O1BA 2KLAA 3D2EB 1YIJN 4CGDA 4FO0A 4BEBA 1HX1A 3LDOA 4KTZA 4X66K 3UKRA 4FLTA 4CK2A 1IO2A 4BECA 4FLVA 1RDWX 1X3NA 3VEYA 3MWTA 3HYFA 3P39A 5AQZA 5BN8A 5IWAK 4YOWA 3NVKA 1WOQA 3K57A 3CC2N 3S41A 1C0UA 4YOUA 4H0XB 4NO7A 1JLQA 4IO8A 1ATRA 3HVTA 4LF9K 4JI3K 5FDLA 1TV6A 3R9PA 4DV2K 4QS8A 3NBPA 1B92A 4B1ZA 1ILYA 1BWFO 3VQ6A 3J81O 3QEVA 4B3SK 5GAGP 2PFUA 4DTNA 5HRPA 5C24A 4B9QA 3DOLA 4XH1A 4IBNA 2BUPA 1BQNA 5F2RA 1HMVA 3HO1A 2NLXA 4B8CA 3HPOA 4DSLA 1XUPO 2YNIA 2C1GA 4FJLA 4LF4K 3RRGA 5BR8K 3TAFA 1KFDA 1VSKA 2VWBA 3I56N 1VQON 3HJFA 2HF4A 4YOXA 3MAQA 3EN9A 4DFJA 3FFKB 3A5NC 4QAGA 5BRDA 1BIZA 3THXB 2ZWHA 3DXMB 1LW0A 1QHAA 2BH1A 3CJBA 5M1QA 2ZGYA 4B08A 2V7ZA 5C12A 2QA4N 3N4PA 1OH5A 2DY4A 4XEIA 2RN2A 4ICLA 5AQPA 2YHBA 1TK5A 4JK7A 4LSLA 1NBWA 1OH7A 4OPAA 5C10A 4JKGB 5FPMA 3NAEA 2VG7A 3E9LA 4RW4A 4AHCA 3O9SA 2O8FB 1C1BA 3OHRA 4EP5A 3NHGA 3AVMA 5FLXO 2HBJA 3VQ8A 4CK1A 3QFUA 4QOZB 4FOIA 3NE6A 3EE9A 3CQXA 4JI7K 3MEEA 4WQ5A 3CM5A 1N8RO 1QVFM 4Q5VA 4PUOA 5ADXA 2VCPA 4H5NA 4JKHA 1T05A 2X6NA 3M8SA 5T7BA 4JI0K 1YTAA 3OW2M 4CF9A 1OH8A 1KAXA 4TSXA 4B9UA 3RSEA 4PQUA 3FE1A 2JGUA 2Z1IA 3H1VX 2Z1GA 4BGAA 3ZX2A 5DM6L 1X9MA 4JS5A 2RE2A 3VEZA 5KQDA 3HPHA 4CZGA 3E66A 5SZTA 2HHWA 3VTIA 4BRNA 1WUAA 3J7ZO 1YVUA 1VAZA 3B8AX 4I2PA 4O8KA 3I8DA 4BRGA 3O4QA 4C8NA 1NNEA 3DRRA 4BRHA 3CFOA 5KGWA 2GUPA 4KH5A 4BC2A 4IDHA 3MX2A 4DLEA 4DTPA 4FZZA 4AHTA 5C2FA 3CPWM 4ELUA 4EHTA 1Q9XA 4JK9A 4FJGA 4AHRA 1T6DA 4BR9A 5CZ2A 1HLUA 4PKHA 4AF1A 4Q0BA 3U4LA 3VENA 1NK9A 3QNNA 4M42A 4NB4A 1ZYQA 4BC4A 4CEDA 1NGJA 4M7XA 3RSEB 3KZBA 1NWKA 3OTOK 4A5BA 3AVCA 4DTSA 3THVA 3QBWA 3WXIA 3IKMA 5C15A 3S3MA 5E26A 3CQYA 3D2EA 3ULEB 2HNYA 3O9TA 2NRXA 4YNQA 3G6EN 4B9LA 1BUPA 4BRKA 3NGZA 2PBDA 3AAQA 3J7AP 1XQSC 5GAHP 1HPMA 1NMNA 2P9LB 2ZF5O 4OVLA 3VQDA 3AARA 1T44A 1BISA 1J5EK 1U2VB 1HKGA 2AJQA 1RT4A 3RVCA 1LWEA 5BRHA 4BC5A 4E7LA 3MXIA 1EP4A 3CJCA 3DAWA 1G15A 3PX4A 3QNOA 1OVYA 1JCGA 3P1GA 3KLIA 5AQSA 2J4RA 2IC3A 5J2NA 1TK0A 4FWKA 5CZ1A 4DTMA 1KVBA 1NOZA 2HBLA 3LP2A 4MO5A 3B6PA 3AVJA 4FJKA 1YUWA 4Z4CA 3C6HA 3AAPA 1S22A 4OX9K 1BL3A 1NGIA 1TAQA 2IOCA 1M1KO 2F7TA 3C7NA 5M1KA 2QKBA 3DXMA 4CZLA 5I3UA 1TUYA 4DV6K 2XY5A 3HSCA 2RKIA 4RG8A 1GOAA 1RT1A 4CJ4A 1KVAA 4DMNA 3ITHA 1JL1A 4KHWA 4CJFA 3AO3A 2JWKA 1YJWN 3E9PA 1XNRK 1U45A 4FK0A 2W41A 3SPYA 3ZSZA 1WSJA 5J2MA 2FC0A 4BRAA 4GMJB 4E7IA 2P9IB 2ZQBA 1I94K 1TYQB 3DXKA 4CF2A 2HBKA 4WFNL 4M3ZA 2QWLA 3KIOA 2YJFA 4Z4IA 3ENBA 4KHQA 4I7FA 1NK5A 1XC9A 1WSGA 2P9LA 4Y1CA 3U3GA 3JYTA 5EY4A 4NXNK 2KFZA 2D1KA 5TKYA 3GBTA 2HMPA 5HP1A 1T03A 2F8TA 1NMDA 4LC9B 1NK4A 3LALA 4CIFA 3FZHA 2B4JA 3CPEA 2Q3SA 3A8YA 3TTDA 3GE1A 2HBMA 3CCMN 3CMAN 1VSMA 3DLKA 1BOTO 3E1YA 3FR0A 4C1NK 5AZJB 2UYTA 1RTJA 4MLEA 2Q36A 3VQ7A 1ZBFA 1VSIA 4B3TK 1L3TA 4I9QA 3NGIA 4A62A 1V4SA 3C65A 3PUFA 4A59A 1TUUA 1N33K 3SAHA 2WONA 5EVZA 1P8ZA 3SCXA 4DTUA 3SAGA 1KAZA 3W3DA 3ZT2A 3QIOA 4FYDA 3KTQA 5EXWA 5D3GA 5C42A 4N41A 2HHSA 3OYIA 3K59A 4CCHA 2YHYA 1GLLO 3KLHA 1ZBUA 1LV5A 5EX5A 2C1IA 3OBWA 3J8AA 5BREA 1RTIA 2A6AA 3R3LA 1HRHA 2OPPA 3GOIA 4CECA 3SZ2A 2PZSA 5SWMA 1Q86O 3U9DA 3WEEA 3H3OB 3SV3A 3PY8A 3WNGA 2BANA 4BDZA 4DR1K 1XNQK 4DV4K 4BR5A 3EY1A 4E3SA 3D0PA 1ASVA 1X9JA 3OYMA 3JSMA 3ENHA 4JNEA 4F8RA 3WNEA 1VQ6N 3O80A 3T1HK 1U48A 3MCAB 4E1JA 1VQLN 2UUAK 2NRZA 3O1WA 1IBLK 2Y1JA 3I8BA 4WE1A 2Y1IA 3W0LA 2FSNA 4EZ9A 4BQZA 1YI2N 2QWNA 1E4GT 3V81A 4C8KA 4CJQA 1S1XA 4BREA 3PV8A 3MXJA 3O3GA 3TAQA 4CHZA 4WFBL 4B9NA 4JI8K 1VQ8N 1NK8A 1XHZA 3OJUA 2F4VK 3MCPA 1J6ZA 4H4OA 3KJVA 4FLXA 3AO5A 2Z1JA 3SQ4A 2ASPA 3KVGA 3NF7A 1RTHA 5FPDA 3J7YP 3L4QA 4RW8A 2HVHA 4FK2A 1VQNN 3TAPA 3FZFA 5C2DA 4KB0A 3AA3A 4CJKA 3BDPA 1NGCA 4JI4K 3D45A 4OJRA 1YJNN 1NJWA 3EKSA 4FL9A 1DTTA 3D2FB 3CJ1A 3CYMA 3V1RA 1TKXA 4FWPA 3WNHA 2OPRA 4NYFA 3VMFB 4JYAK 3S5TA 4DUZK 4FLYA 1QE1A 5JLFA 1YXQA 4EAHD 2VWJA 1RDDA 2DFEA 2GELA 2HHXA 4IFYA 2VG5A 4CERA 4N47A 4CJRA 3HM8A 4FLUA 3U9ZA 1ASUA 3VQQA 4CEFA 4YFUA 1HQUA 1BCOA 2Q1NA 3J80O 3AVKA 1SL2A 1BHLA 1IKWA 2F9TA 3AVBA 1YT3A 4FJJA 5KQ8A 4FJ7A 5HRNA 2G8HA 2HHVA 1X9SA 1D9FA 1M90O 2CGJA 4HTUA 1EWQA 4CE9A 3SV4A 4BRFA 4B9VA 4B3OA 1SL1A 3NH1A 4OPHA 1CXQA 3RMAA 3GG4A 5KRTA 1HYZA 1T7PA 4NCBA 5GIOA 3L8BA 1SKSA 2QW9A 5ADXH 1C0TA 1U2VA 1R0AA 2UXBK 5HOOA 4CF1A 1WN7A 3SBTA 4RTFD 2YHAA 3D2FA 4X64K 4OKKA 2P9SB 1Q7YO 4XJXA 4AHUA 3HZ6A 4M3RA 3CCSN 4DU1A 1RDCA 4MFBA 4DTXA 3ZSYA 2QXFA 4I6MB 4FM1A 3O9RA 2G8KA 4B9MA 4QS7A 2WOMA 2PYJA 4AHSA 1QVGM 2KZZA 4KHYA 4OKEA 3BY5A 3SMSA 2IIRA 3QIPA 1RT7A 1W97L 5BR9A 1CLQA 2HF3A 4Z0UA 5AFUH 4DR5K 1JLBA 1RGIA 3ZSOA 3ZLJA 3RMCA 4IJAA 2E8AA 3NMUA 4ILGB 2YNHA 2HNDA 3DRSA 4U7BA 4H0TB 2E88A 2QEXN 4CHPA 4BG8A 3HXMA 3FZMA 4U67L 3DLRA 3F9KA 4A61A 4FPBA 4KB1A 1I39A 5I42A 4GV3A 3HSTB 4IEEA 5AQJA 4JI5K 1KC8O 3VF6A 3K2PA 3GDQA 2I7PA 3KLGA 4XH4A 3MECA 3LZJA 5J2QA 4CF0A 4G1QA 2HHQA 1HNIA 2XO7A 1WNSA 3LAKA 4HCCA 3SUOA 1ASWA 4ID5A 5KPRA 3WEEB 2P1JA 3LANA 2VYPA 4KH4A 4JI2K 3RR7A 3AO2A 2O8BB 2PY5A 4DF8A 4CZMA 1KTQA 4JK8A 4JS4A 1YVNA 3IFRA 4H0VB 5AQKA 3R1XA 2XY8A 1EETA 1RFQA 1V4TA 4K41A 1VQMN 4CD1A 2Q0UA 4CGHA 1S3XA 3PO5A 1CZ9A 3NFAA 3CC4N 3Q7BA 5J1EA 2KFNA 1U04A 3WUHA 1ESVA 1SS6A 5HROA 2CGKA 3IRXA 1VSHA 3RWUA 4CGJA 2D5RA 4JKDA 1A5XA 2OPSA 3TI0A 4PHTX 3EZ5A 1REVA 4KHPK 4DV1K 3CI5A 4FVMA 3LPUA 1GOCA 1QQCA 4JHDA 4AHVA 4J2BA 2OPQA 3O08A 4CBXA 4CEEA 4JAXA 2NNWA 4LF5K 4DR2K 1KRPA 3L4IA 3C95A 1BQMA 4W5NA 3ID6A 4CIGA 3CJ7A 2HB5A 3RMDA 4DWIA 3ZYYX 3THYB 1XMOK 4CEAA 3THWB 1DLOA 1RT3A 3BGRA 4E1NA 1VK0A 4BE0A 4OLBA 1WSIA 1O1WA 1NJIO 1HNXK 4F3OA 3LDPA 3U8XA 3UE5A 3OBYA 4Z4FA 3NDKA 3K58A 4CZHA 3ALYA 1C0MA 4LF6K 4KI6A 2R7YA 3VGKA 4CEQA 2P9KA 4CZKA 1IKYA 1RBVA 3S3NA 2UU9K 1QQOA 3MN6A 3DI6A 4Y1DA 3VQEA 5DM7L 3DYAA 2QXLA 4K43A 2DPNA 1NGAA 2W40A 3V9ZA 4ILJA 1D8YA 4E89A 3HL8A 4GKKK 1N5YA 3CIPA 2F9WA 3T69A 4LFAK 1TGOA 4IOXA 1E3MA 2FF3B 1DKGD 5GINA 2FXUA 4CZFA 4IXCA 1HUXA 1T8EA 3DLEA 5M1NA 3CF5L 3QETA 4AM6A 3HBTA 4OKJA 4LF8K 1Q18A 3VQCA 4ISGA 4EHUA 1VRTA 4CEZA 4ZHRA 3CJ9A 2CH5A 3P4IA 2D4WA 4ELVA 3FZKA 1HPZA 2AP1A 2D0AA 4E7JA 5EU7A 3VEOA 2ZM6K 3LP1A 2YHXA 5LMNK 3H3NO 3NF8A 1YTUA 1JCEA 3CM6A 3SAFA 3OYNA 1NK6A 1TK8A 4E19A 4I2QA 2P9KB 3VF2A 4DHYA 3TSQA 4MDAA 2BE2A 1LOTB 5JICA 3L2QA 3S3OA 4FM2A 5AQGA 3CCUN 4JKFA 4BRMA 2O8DA 3VF4A 5BRFA 2HVIA 3SLCA 5AQVA 1WB9A 4BVOA 4KRFA 4CD3A 3VQBA 3AVNA 2ASOA 2LSNA 2NZTA 4H5RA 4R5PA 2RPIA 4K8XA 1LCUA 5M1PA 3CQ8A 1VSDA 3AGKA 1C0GA 5J2PA 1S1TA 4HWIA 2V51B 5AQQA 2AA4A 4MQ3A 4B9TA 4OPKA 3CCEN 3H45C 1A5VA 3LDQA 4IDKA 4JKBA 4NCGA 2YCHA 4DG1A 3TARA 4DQQA 3AGRA 1S6PA 3ZSQA 1NGHA 3SMPA 4YOYA 1NM1A 4NLCA 2WTUA 3ULDA 4CZJA 4DV5K 4BY9C 1SL0A 1MA9B 5E84A 3EL2A 3H6EA 3QDKA 3U3YA 4YHHK 2HNZA 3BEXA 3QFPA 1L3SA 3PSIA 1EWRA 2XY7A 1JLFA 4DQ8A 1MWKA 3THXA 4KI4A 1N6QA 1FJGK 2E2OA 4AILC 4WFAL 4FJ5A 2GUIA 3KHYA 2UXCK 2VGNA 1QQMA 1HJOA 2X74A 1YITN 2A1SA 1W7AA 4CVNE 3N4QA 3DLGA 1BDGA 4A57A 4Z94A 4JKEA 4CBUA 4RCHA 5ELZA 2BTFA 3L6QA 1K6YA 4CZIA 2F96A 3BP8A 5JS2A 1S1VA 3KK2A 3CCLN 4BRPA 4M3UA 2O4GA 3TSPA 4M3XA 4K25A 1BCMA 3WNFA 4HUGA 1S72N 3B6OA 1ZBSA 1GLJO 4W5QA 1DT9A 1NGEA 2ITGA 4M45A 3V9UA 1U49A 3F9MA 1BIUA 4GW6A 4PY5A 2P9UB 4M41A 4KPYA 4E72A 4BRLA 3NH2A 2Q97A 4B1XB 1ATNA 3ZSXA 1NK7A 2YKMA 1BG3A 3T7ZA 3K9KA 1TL1A 4CJVA 3P38A 3VEXA 4DQPA 2KKZA 4EFHA 4CZEA 4H03B 5M1FA 3OYBA 3OS0A 4DFMA 1KLMA 1NGFA 1TKDA 4LY7A 1TKZA 3HK2A 1JLGA 3KKSA 3VA3A 3CFPA 3UIQA 3HOSA 3SQ1A 1LAWA 2I5JA 4CHOA 3LDSA 4DV7K 3QO9A 1SKRA 3L0QA 5AQWA 5AJ3K 4JKCA 1K73O 1VQ5N 4FJXA 4R79A 3VGMA 4W5TA 3ZSWA 2NRVA 2VGMA 4FJ9A 1B9DA 2A42A 2WUSA 2IVOA 1Q82O 1KQSM 1NGGA 3UKUA 4KO0A 4H8KA 3HI0A 1RNHA 4CBWA 4HUEA 3A5MC 4O5BA 5HLFA 1NGDA 1NG9A 3O3FA 1JXEA 1Z25A 3OYAA 3EEQA 1GLAG 3HOTA 5BN9A 4ID1A 4AH9A 5GIPA 1YHQN 3QERA 3TABA 2O8EA 1IV0A 4BWMA 3O8MA 3VQPA 3LPTA 3D6RA 3MK6A 1FXXA 3LWMA
chains in the Genus database with same CATH topology
1HKCA 4XEIA 5GAEP 5BPNA 5AQPA 3CCRN 2F9TA 3ENOA 5KQ8A 4JK7A 3IMXA 1NBWA 1M90O 2CGJA 4YORA 3VEVA 4BRFA 4OPAA 4H0OA 5C10A 4JKGB 5FPMA 4OPHA 1KD1O 1K8KA 2WFBA 3E9LA 3GG4A 3MWPA 3HRGA 3AY9A 3O9SA 1W2BM 3IUCA 3ID8A 3OHRA 4JD2B 5GIOA 2I7NA 3CCVN 4O8UA 5AQYA 1R59O 2QW9A 2HBJA 5ADXH 1U2VA 1EO1A 3ZEUA 3WXLA 2RHKA 5HOOA 4WQ4C 3SBTA 4RTFD 1VQ9N 3QFUA 3D2FA 4FOIA 5GADP 3EE9A 3CQXA 4BGBA 5JMVA 2P9SB 3WT0A 4HTLA 1Q7YO 3M1FA 4XJXA 2H3GX 4WQ5A 3HZ6A 3CCSN 5AQHA 4A5AA 1N8RO 3O9UA 4I6MB 1QVFM 3WQUA 3O9RA 1NGBA 3A5LC 5CR4A 3MN7A 4FWSA 4QS7A 5ADXA 1BA0A 2VCPA 4H5NA 4JKHA 4J8FA 3TTCA 1QVGM 3CMEN 3UKUB 3SMSA 5LJWA 2IIRA 4O5FA 2PAVA 3ATVA 2D0OA 3OW2M 2IVPA 1W97L 5JVGL 1MDUB 4YOVA 1KAXA 5BR9A 4BRDA 2HF3A 5AFUH 1RGIA 3RSEA 3FE1A 4BC3A 4H0PA 3CC7N 3H1VX 4IJAA 4BGAA 2E8AA 3ZX2A 1QZ6A 3NMUA 1KXPA 4ILGB 5DM6L 4H0YB 5BPLA 3I33A 2RE2A 3VEZA 4FOEA 5KQDA 4CZGA 3E66A 3PLAA 4U7BA 4H0TB 2QWPA 1VQ7N 3VTIA 2E88A 3SBGA 1DGKN 3EKUA 4BG8A 3WXJA 4BRNA 1WUAA 2QEXN 3FZMA 3J7ZO 4U67L 2P9NA 4A61A 3CETA 1VAZA 1Z6RA 3F2KA 3B8AX 4FPBA 4WQ5C 5B8HA 4GV3A 4O8KA 2YJEA 4IEEA 1IG8A 3N4PA 5AQJA 3ZETA 4BRQA 4BRGA 5I9EB 4ISFA 4PL7A 3MMVA 4BRHA 1KC8O 2GUPA 4KH5A 3VF6A 1GLBG 1U6ZA 4Y0WA 3GDQA 2I7PA 3O4WA 4BC2A 4XH4A 1QZ5A 2A3ZA 4IDHA 2E2PA 4JD2A 4BR0A 5AQMA 3MX2A 4WCEL 3TSUA 1BU6O 3LM2A 3O9QA 5C2FA 5M1OA 3VGLA 1TYQA 3DXKB 3VOVA 4AM7A 5KPRA 3CPWM 1GLDG 3WEEB 4EHTA 3DJCA 4JK9A 3ZX0A 4FWQA 2VYPA 2P9SA 4KH4A 3LM9A 1T6DA 4BR9A 4IO9L 1HLUA 4JN4A 2GX9A 4PKHA 5AZIA 3U4LA 4AF1A 3VENA 2ZJPL 1SAZA 3OA9A 3ATUA 4CZMA 4JK8A 4NB4A 1C0FA 1YVNA 3IFRA 4H0VB 5AQKA 4BC4A 1NGJA 2EWSA 3R1XA 2QI2A 4M7XA 1JCFA 3RSEB 3KZBA 3PIPL 2QWMA 5AQTA 1NWKA 1RFQA 1T3VA 1V4TA 4K41A 4A5BA 1VQMN 4CD1A 2Q31A 2Q0UA 3HTVA 3QBWA 2OANA 2Q0RA 1S3XA 3WXIA 2NRTA 3IKMA 5C15A 2OTJN 4PKGA 5E26A 3CQYA 3D2EA 4L3QA 3TTFA 3ULEB 1VQKN 2Q2RA 3O9TA 4ISEA 3CC4N 3C6AA 2NRXA 3Q7BA 4B1YB 3Q7CA 4FVUA 3G6EN 4IZ9A 3EE8A 3WUHA 1ESVA 1SS6A 2CGKA 3MN9A 4EIAA 4XH5A 3A5OC 1BUPA 2E2QA 4BRKA 3ZETB 2PBDA 3AAQA 3UB5A 1SZ2A 1XQSC 5AZJA 4JKDA 5GAHP 4WF9L 1HPMA 4PHTX 4K42A 2V52B 3BF1A 2P9LB 2ZF5O 4JKGA 2WC9A 3AARA 4GV9A 1K8KB 5AQLA 4BR7A 1T44A 3CI5A 4JHDA 5AQNA 1U2VB 3BF3A 1HKGA 2CGLA 4KBOA 3RVCA 3VERA 3IDHA 3O08A 4CBXA 5BRHA 4BC5A 4JAXA 2ASMA 2NNWA 4IOAL 3CJCA 3L4IA 3DAWA 3WQTA 3UKRB 3ID6A 1OVYA 2QWRA 1JCGA 3JS6A 3D7EO 4BR4A 1YJ9N 1K9MO 3CJ7A 5AQSA 2P9UA 2J4RA 3WXKA 4FWRA 4BVPA 3ZYYX 4FWKA 2FLOA 2HBLA 4FWMA 2QM1A 4MO5A 4PL8A 1ZC6A 1NJIO 1YUWA 1G99A 3LDPA 3U8XA 3C6HA 4YDUC 3A0IX 3CHWA 3AAPA 1S22A 3UE5A 3OBYA 1Z05A 4BROA 4C1NI 3H46O 4CZHA 1O13A 3CCJN 1NGIA 2P9IA 1M1KO 2F7TA 1KAYA 3C7NA 3LDNA 4GY2B 4YOTA 5M1KA 3VESA 3VGKA 3DXMA 4CZLA 2A5XA 2P9KA 1K8AO 3QBXA 1TUYA 4CZKA 3E9OA 1BA1A 2GWJA 3O5BA 2P9NB 3HSCA 1QQOA 3MN6A 3DLLL 3KK7A 2FF6A 3M5RA 1X3MA 4ILHA 5DM7L 5AZIB 2OTLN 1GLFO 2JWKA 1YJWN 3E9PA 2QXLA 4K43A 5FPEA 2DPNA 1NGAA 2W40A 3LL3A 4DCHA 3FLCO 2W41A 4ILJA 3JXUA 1Y64A 4WYBA 1JJ2M 5EOYA 3CIPA 2F9WA 4YDUA 3T69A 2ZGZA 4IOXA 4BR2A 4BRAA 2E2NA 3TU5A 2NRWA 2P9IB 4GVEA 2FF3B 1DKGD 4NLBA 4DKWA 1TYQB 2FXUA 3C0BA 3DXKA 3C7NB 5GINA 3DWLA 4G9ZA 2NRHA 4M63C 4CZFA 4IXCA 3VPZA 1HUXA 2GEMA 2HBKA 1YAGA 5AQXA 4WFNL 2QWLA 4BQLA 2YJFA 5M1NA 3CF5L 1GLEG 2W00A 2JWLA 3ENBA 4AM6A 5AQFA 3HBTA 5AQOA 5LY3A 4JEPA 1H1VA 4H5WA 5JVHL 1Q18A 2P9PB 4ISGA 4EHUA 3CJ9A 2CH5A 2KHOA 3KWIA 2D4WA 3P4IA 2P9LA 3FZKA 2HOEA 2AP1A 4BRIA 4DB3A 2WBNA 5EY4A 3M6GA 3VEOA 1DEJA 4F9OA 2YHXA 2QTDA 1SQKA 2D1KA 3H3NO 4JHDB 3CCQN 2V7YA 5TKYA 3GBTA 1JCEA 2HMPA 3SAFA 3CJAA 2E1ZA 2P9KB 3VF2A 4DHYA 3TSQA 1NLVA 4MDAA 1LOTB 5JICA 1NMDA 4LC9B 5AQGA 3CCUN 4JKFA 3G71N 4BRMA 3FZHA 3ULEA 1ZXOA 4FWNA 3CPEA 3VF4A 3LDLA 5AFUA 3A8YA 4I6MA 5BRFA 5AQUA 3TTDA 1P90A 2A40A 3GE1A 3SLCA 1OKJA 2HBMA 5AQVA 3CMAN 2E1YA 3CCMN 4UY8O 4BVOA 4FPAA 3QMLA 3R6MA 4CD3A 1BOTO 3SK3A 4A2AA 3E1YA 2ZJRL 3FR0A 4C1NK 1XC3A 5AZJB 2ASOA 2NZTA 2UYTA 4H5RA 4MLEA 4IOCL 2Q36A 4BRCA 1LCUA 5M1PA 2CH6A 3AGKA 3NVMA 1C0GA 3QB0A 3VETA 3H1QA 4A62A 4HWIA 2V51B 1V4SA 3C65A 5AQQA 2AA4A 4A59A 1TUUA 3SAHA 5EVZA 1P8ZA 3CCEN 3H45C 3BUZB 3EZWA 3SAGA 1KAZA 2E20A 3LDQA 3W3DA 3GL1A 4JKBA 5JLHA 2YCHA 2GWKA 2YI1A 5F1XA 3AGRA 5EXWA 1NGHA 3SMPA 4YOYA 1NM1A 4NLCA 3CD6N 1YF5L 4CZJA 3MDQA 4BY9C 1MA9B 2YHYA 3EL2A 3H6EA 5E84A 1GLLO 3QDKA 3TPQA 3MX5A 4B1UB 2FSKA 2FSJA 4GNIA 5EX5A 3VTHA 5TKWA 2C1IA 3OBWA 4H5VA 2ZJQL 4WQ4A 3O6WA 3BEXA 3QFPA 3J8AA 3G4SN 3F5TA 5BREA 2A6AA 3R3LA 3G25A 4MLHA 1MWKA 4DQ8A 4BG9A 2E2OA 4WFAL 4B1WB 3GOIA 4BE7B 3KHYA 3FGUA 2VGNA 5C0YA 1Q86O 1QQMA 3U9DA 3WEEA 3H3OB 2IVNA 1HJOA 3MN5A 3QICA 4CI6A 5CE3A 3WXMB 5F0XA 4CJ7A 4MDBA 4BR5A 1YITN 1X9JA 4IWVA 2GTDA 4JKAA 3ENHA 1Q81O 4JNEA 4OO1J 1VQ6N 3N4QA 3O80A 4FWLA 1BDGA 4A57A 2NRRA 4Z94A 1RDUA 4JKEA 4IJNA 4CBUA 4IFEA 3MCAB 3SJHA 5FPNA 4E1JA 2QWQA 4RCHA 5ELZA 1VQLN 2NRZA 3FZLA 3O1WA 2BTFA 5CHIA 3I8BA 4H5TA 1MWMA 3L6QA 3P31A 4CZIA 4IEIA 1VQPN 4GV6A 3K9JA 1QQNA 4MO4A 3R8EA 3I55N 3W0LA 3BP8A 3KWGA 2FSNA 3EO3A 4KH6A 3CCLN 1IJJA 3O1BA 4BRPA 3TSPA 2KLAA 2QWOA 1E4FT 4BQZA 2D0PA 3D2EB 1YI2N 1BO5O 2QWNA 1E4GT 4K25A 4PKIA 1YIJN 4BREA 4FO0A 1S72N 4C23A 4BEBA 1HX1A 3LDOA 1GLCG 3UKRA 1ZBSA 1GLJO 1CZAN 5AQIA 1DT9A 1NGEA 4WFBL 4BECA 1RDWX 3F9MA 2P9PA 2P9UB 1X3NA 1VQ8N 1ATSA 3VEYA 4BRLA 2HSTA 3MCPA 3MWTA 3P39A 5AQZA 4B1VA 5BN8A 4YOWA 2Q97A 4B1XB 3NVKA 1ATNA 3VEWA 3M3ZA 1BG3A 3T7ZA 1WOQA 3K9KA 3CC2N 2ASPA 3S41A 3P38A 3VEXA 1VQ4N 4YOUA 2KKZA 4H0XB 4EFHA 5MLCQ 3KVGA 4CZEA 4H03B 4IO8A 4NO7A 5M1FA 1ATRA 1NGFA 5FPDA 3L4QA 1T6CA 3R9PA 5BPMA 1VQNN 4QS8A 3FZFA 3CXCM 3CERA 5C2DA 4B1ZA 1HKBA 3HOSA 1ILYA 1BWFO 4FWOA 1NGCA 5GAGP 4FSVA 3ZX3A 2A41A 1EQYA 2PFUA 3ZEUB 4QS9A 1YJNN 3EKSA 4FL9A 4B9QA 3L0QA 5AQWA 1VQ5N 3D2FB 4JKCA 4XH1A 3PIOL 1K73O 2BUPA 2YHWA 3CJ1A 4R79A 3VGMA 5F2RA 5HL7L 2NLXA 4M7YA 4RWTA 1XUPO 2NRVA 2VGMA 4FWPA 4A2BA 3VMFB 2C1GA 2ITMA 2A42A 2WUSA 2IVOA 2VWBA 3I56N 1Q82O 5LJVA 1VQON 1KQSM 5JLFA 2HF4A 4YOXA 1NGGA 3EN9A 3UKUA 5AR0A 5AQRA 1YXQA 4EAHD 3FFKB 2GELA 3A5NC 3HI0A 4CBWA 3A5MC 5BRDA 1NGDA 5H1SQ 1GLAG 2ZWHA 3DXMB 3HOTA 3HM8A 5BN9A 3U9ZA 1QHAA 2BH1A 1D4XA 5GIPA 3CJBA 5KPZA 1YHQN 5M1QA 2ZGYA 2YX6A 2Q1NA 2V7ZA 5KPTA 5C12A 2QA4N 3O8MA 1J6ZA 3D6RA 3MK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HKC A;  4XEI A;  5BPN A;  5AQP A;  2F9T A;  3ENO A;  5KQ8 A;  3IMX A;  1NBW A;  2CGJ A;  3VEV A;  4BRF A;  4H0O A;  5FPM A;  1K8K A;  3GG4 A;  3AY9 A;  3IUC A;  3ID8 A;  3OHR A;  4JD2 B;  2I7N A;  5AQY A;  1R59 O;  2QW9 A;  5ADX H;  1U2V A;  3ZEU A;  3WXL A;  4WQ4 C;  4RTF D;  3QFU A;  3D2F A;  4FOI A;  3CQX A;  4BGB A;  5JMV A;  2P9S B;  3WT0 A;  4HTL A;  3M1F A;  2H3G X;  4WQ5 A;  3HZ6 A;  5AQH A;  4I6M B;  3WQU A;  1NGB A;  3A5L C;  3MN7 A;  4FWS A;  4QS7 A;  5ADX A;  1BA0 A;  2VCP A;  4H5N A;  4J8F A;  3UKU B;  3SMS A;  5LJW A;  2IIR A;  4O5F A;  2PAV A;  3ATV A;  2D0O A;  2IVP A;  1MDU B;  1KAX A;  5BR9 A;  4BRD A;  2HF3 A;  5AFU H;  1RGI A;  3RSE A;  3FE1 A;  4BC3 A;  4H0P A;  3H1V X;  4IJA A;  4BGA A;  2E8A A;  3ZX2 A;  1QZ6 A;  1KXP A;  4H0Y B;  5BPL A;  3I33 A;  3VEZ A;  4FOE A;  5KQD A;  4CZG A;  4H0T B;  2QWP A;  2E88 A;  4BRN A;  1DGK N;  3EKU A;  4BG8 A;  3WXJ A;  1WUA A;  3FZM A;  2P9N A;  4A61 A;  3CET A;  1Z6R A;  4WQ5 C;  3B8A X;  4FPB A;  5B8H A;  4O8K A;  2YJE A;  5AQJ A;  1IG8 A;  3ZET A;  4BRG A;  4BRQ A;  5I9E B;  4ISF A;  4PL7 A;  3MMV A;  4BRH A;  2GUP A;  3VF6 A;  1GLB G;  1U6Z A;  4Y0W A;  3GDQ A;  2I7P A;  3O4W A;  4BC2 A;  4XH4 A;  1QZ5 A;  2A3Z A;  2E2P A;  4JD2 A;  4BR0 A;  5AQM A;  1BU6 O;  3LM2 A;  3VGL A;  1TYQ A;  3DXK B;  3VOV A;  4AM7 A;  5KPR A;  1GLD G;  3WEE B;  4EHT A;  3DJC A;  3ZX0 A;  4FWQ A;  2VYP A;  2P9S A;  3LM9 A;  1T6D A;  4BR9 A;  1HLU A;  4JN4 A;  4PKH A;  5AZI A;  3U4L A;  3VEN A;  1SAZ A;  3ATU A;  4CZM A;  4NB4 A;  1C0F A;  1YVN A;  3IFR A;  4H0V B;  5AQK A;  4BC4 A;  1NGJ A;  2EWS A;  4M7X A;  1JCF A;  3RSE B;  3KZB A;  2QWM A;  5AQT A;  1NWK A;  1RFQ A;  1V4T A;  4K41 A;  4CD1 A;  2Q31 A;  2Q0U A;  3HTV A;  3QBW A;  2OAN A;  2Q0R A;  1S3X A;  3WXI A;  4PKG A;  5E26 A;  3CQY A;  3D2E A;  4L3Q A;  3ULE B;  2Q2R A;  4ISE A;  4B1Y B;  4IZ9 A;  3WUH A;  1ESV A;  2CGK A;  3MN9 A;  4EIA A;  4XH5 A;  3A5O C;  1BUP A;  2E2Q A;  4BRK A;  3ZET B;  2PBD A;  3AAQ A;  3UB5 A;  1SZ2 A;  1XQS C;  5AZJ A;  1HPM A;  4K42 A;  2V52 B;  3BF1 A;  2P9L B;  2ZF5 O;  3AAR A;  1K8K B;  5AQL A;  4BR7 A;  1T44 A;  3CI5 A;  4JHD A;  5AQN A;  1U2V B;  3BF3 A;  1HKG A;  2CGL A;  4KBO A;  3VER A;  3IDH A;  3O08 A;  4CBX A;  5BRH A;  4BC5 A;  4JAX A;  2ASM A;  3CJC A;  3L4I A;  3DAW A;  3WQT A;  3UKR B;  2QWR A;  1JCG A;  3JS6 A;  3D7E O;  4BR4 A;  3CJ7 A;  5AQS A;  2P9U A;  2J4R A;  3WXK A;  4FWR A;  4BVP A;  4FWK A;  2FLO A;  4FWM A;  2QM1 A;  4MO5 A;  4PL8 A;  1ZC6 A;  1YUW A;  1G99 A;  3LDP A;  3U8X A;  4YDU C;  3A0I X;  3CHW A;  3AAP A;  1S22 A;  3UE5 A;  1Z05 A;  4BRO A;  3H46 O;  4CZH A;  1NGI A;  2P9I A;  1KAY A;  3C7N A;  3LDN A;  4GY2 B;  3VES A;  3VGK A;  3DXM A;  4CZL A;  2A5X A;  2P9K A;  3QBX A;  1TUY A;  4CZK A;  3O5B A;  1BA1 A;  2GWJ A;  2P9N B;  3HSC A;  1QQO A;  3MN6 A;  2FF6 A;  1X3M A;  5AZI B;  1GLF O;  2QXL A;  4K43 A;  5FPE A;  2DPN A;  1NGA A;  2W40 A;  3LL3 A;  4DCH A;  3FLC O;  2W41 A;  3JXU A;  1Y64 A;  4WYB A;  5EOY A;  3CIP A;  2F9W A;  4YDU A;  2ZGZ A;  4BR2 A;  4BRA A;  2E2N A;  3TU5 A;  2P9I B;  2FF3 B;  1DKG D;  1TYQ B;  2FXU A;  3C0B A;  3DXK A;  3C7N B;  3DWL A;  2NRH A;  4M63 C;  4CZF A;  4IXC A;  3VPZ A;  1HUX A;  2GEM A;  1YAG A;  5AQX A;  2QWL A;  4BQL A;  2YJF A;  1GLE G;  4AM6 A;  5AQF A;  3HBT A;  5AQO A;  5LY3 A;  1H1V A;  4H5W A;  1Q18 A;  2P9P B;  4ISG A;  4EHU A;  3CJ9 A;  2CH5 A;  2KHO A;  3P4I A;  2D4W A;  2P9L A;  3FZK A;  2HOE A;  2AP1 A;  4BRI A;  4DB3 A;  5EY4 A;  3M6G A;  3VEO A;  1DEJ A;  4F9O A;  2YHX A;  4JHD B;  1SQK A;  2D1K A;  3H3N O;  2V7Y A;  5TKY A;  3GBT A;  1JCE A;  2HMP A;  3CJA A;  2E1Z A;  2P9K B;  3VF2 A;  4DHY A;  1NLV A;  1LOT B;  5JIC A;  1NMD A;  4LC9 B;  5AQG A;  4BRM A;  3FZH A;  3ULE A;  1ZXO A;  4FWN A;  3VF4 A;  3LDL A;  5AFU A;  3A8Y A;  4I6M A;  5BRF A;  5AQU A;  2A40 A;  3GE1 A;  3SLC A;  1OKJ A;  5AQV A;  2E1Y A;  4BVO A;  4FPA A;  3QML A;  3R6M A;  4CD3 A;  1BOT O;  3SK3 A;  4A2A A;  3FR0 A;  1XC3 A;  5AZJ B;  2ASO A;  2NZT A;  2UYT A;  4H5R A;  4MLE A;  2Q36 A;  4BRC A;  1LCU A;  2CH6 A;  3QB0 A;  1C0G A;  3VET A;  3H1Q A;  4A62 A;  4HWI A;  2V51 B;  1V4S A;  5AQQ A;  2AA4 A;  1TUU A;  5EVZ A;  1P8Z A;  3H45 C;  3BUZ B;  3EZW A;  1KAZ A;  2E20 A;  3LDQ A;  3W3D A;  3GL1 A;  5JLH A;  2YCH A;  2GWK A;  2YI1 A;  5F1X A;  5EXW A;  1NGH A;  3SMP A;  1NM1 A;  4CZJ A;  3MDQ A;  1MA9 B;  2YHY A;  3EL2 A;  3H6E A;  5E84 A;  1GLL O;  3QDK A;  3TPQ A;  4B1U B;  2FSK A;  2FSJ A;  4GNI A;  5EX5 A;  4H5V A;  4WQ4 A;  3O6W A;  3BEX A;  3QFP A;  3J8A A;  5BRE A;  2A6A A;  3G25 A;  4MLH A;  1MWK A;  4DQ8 A;  4BG9 A;  2E2O A;  4B1W B;  3GOI A;  3KHY A;  3FGU A;  1QQM A;  3U9D A;  3WEE A;  3H3O B;  2IVN A;  1HJO A;  3MN5 A;  3QIC A;  4CI6 A;  5CE3 A;  5F0X A;  4CJ7 A;  4BR5 A;  1X9J A;  4IWV A;  2GTD A;  3ENH A;  4JNE A;  3O80 A;  4FWL A;  1BDG A;  4Z94 A;  4CBU A;  4IJN A;  3SJH A;  5FPN A;  4E1J A;  2QWQ A;  4RCH A;  5ELZ A;  3FZL A;  3O1W A;  2BTF A;  3I8B A;  4H5T A;  1MWM A;  3L6Q A;  4CZI A;  3R8E A;  1QQN A;  4MO4 A;  3W0L A;  3BP8 A;  2FSN A;  3EO3 A;  1IJJ A;  3O1B A;  4BRP A;  4BQZ A;  2QWO A;  1E4F T;  2D0P A;  3D2E B;  1BO5 O;  2QWN A;  1E4G T;  4K25 A;  4PKI A;  4BRE A;  4FO0 A;  4C23 A;  1HX1 A;  3LDO A;  1GLC G;  3UKR A;  1ZBS A;  1GLJ O;  1CZA N;  5AQI A;  1NGE A;  1RDW X;  3F9M A;  2P9P A;  2P9U B;  1X3N A;  1ATS A;  3VEY A;  4BRL A;  3MCP A;  5AQZ A;  5BN8 A;  4B1V A;  2Q97 A;  4B1X B;  1ATN A;  3VEW A;  3M3Z A;  1BG3 A;  1WOQ A;  2ASP A;  3S41 A;  3VEX A;  4H0X B;  4EFH A;  3KVG A;  4CZE A;  4H03 B;  4IO8 A;  4NO7 A;  1ATR A;  1NGF A;  5FPD A;  3R9P A;  1T6C A;  5BPM A;  4QS8 A;  3FZF A;  3CER A;  4B1Z A;  1HKB A;  1BWF O;  4FWO A;  1NGC A;  4FSV A;  3ZX3 A;  2A41 A;  1EQY A;  3ZEU B;  4QS9 A;  3EKS A;  4FL9 A;  4B9Q A;  3L0Q A;  5AQW A;  3D2F B;  4XH1 A;  2BUP A;  2YHW A;  3CJ1 A;  3VGM A;  5F2R A;  2NLX A;  4M7Y A;  4RWT A;  1XUP O;  4FWP A;  4A2B A;  2ITM A;  2A42 A;  2WUS A;  2IVO A;  2VWB A;  5LJV A;  5JLF A;  2HF4 A;  1NGG A;  3EN9 A;  3UKU A;  5AR0 A;  5AQR A;  1YXQ A;  4EAH D;  3FFK B;  2GEL A;  3A5N C;  3HI0 A;  4CBW A;  3A5M C;  5BRD A;  1NGD A;  1GLA G;  2ZWH A;  3DXM B;  3HM8 A;  5BN9 A;  3U9Z A;  1QHA A;  1D4X A;  3CJB A;  5KPZ A;  2ZGY A;  2Q1N A;  2V7Z A;  5KPT A;  3O8M A;  1J6Z A;  3MK6 A; 
#chains in the Genus database with same CATH topology
 3KK3 A;  1HKC A;  5JEN A;  5BPN A;  1IH7 A;  3CCR N;  3ENO A;  3SQ0 A;  3CG7 A;  3OYG A;  4V19 S;  1KD1 O;  1K8K A;  2WFB A;  3MWP A;  1SV5 A;  2D0B A;  3ID8 A;  1UAX A;  4CFC A;  4O8U A;  1IBM K;  5AQY A;  3C6T A;  1TL3 A;  4C8M A;  4JRQ A;  2B5J A;  4CW7 B;  2E6L A;  4HHT A;  3L3V A;  1UWB A;  4IG0 A;  4F2S A;  4CES A;  5GAD P;  4BGB A;  3WT0 A;  2H3G X;  2IGI A;  2RF2 A;  4A5A A;  2D0C A;  4JLH A;  3O9U A;  1J54 A;  4FM0 A;  1NGB A;  3A5L C;  3RTV A;  4FWS A;  1S6Q A;  3THY A;  1BA0 A;  4J8F A;  3TTC A;  3CME N;  3UKU B;  5LJW A;  4O5F A;  2PAV A;  3ATV A;  3AO1 A;  5JS1 A;  3BZK A;  5JVG L;  1MDU B;  4YOV A;  3ZSR A;  4M3Y A;  3LP3 A;  2UXD K;  1JKH A;  4BC3 A;  1RTD A;  1QZ6 A;  5BPL A;  4CJE A;  4FOE A;  1B9F A;  2G8I A;  3SBG A;  5HBM A;  1DGK N;  3EKU A;  3O3H A;  3WXJ A;  3U6F A;  4FK4 A;  2P9N A;  3CET A;  3LP0 A;  4FJH A;  5B8H A;  3K5L A;  5LMU K;  2YJE A;  3NF6 A;  3ZET A;  2G8F A;  3HP6 A;  5I9E B;  4ISF A;  4BWJ A;  1GLB G;  4CJP A;  1U6Z A;  4Y0W A;  3O4W A;  1QZ5 A;  2A3Z A;  3K0S A;  2E2P A;  4JD2 A;  2E4L A;  4BR0 A;  4O44 A;  3TSU A;  3SUN A;  4FCY A;  4FW1 A;  3OYK A;  1WSH A;  1Y97 A;  1A5W A;  1C1C A;  3VOV A;  4AM7 A;  1GLD G;  1N36 K;  4K0K K;  3DOK A;  4FWQ A;  2P9S A;  3LM9 A;  2O4I A;  3K5M A;  4IO9 L;  1BI4 A;  3VQA A;  4JN4 A;  2GX9 A;  4NXM K;  1NJX A;  3OA9 A;  3DLH A;  2VQF K;  3AVF A;  1KVC A;  1C0F A;  1C6V A;  1DTQ A;  1JCF A;  2QWM A;  3MEG A;  5AQT A;  3VQ5 A;  1JLC A;  2OAN A;  2Q0R A;  2NRT A;  2OCE A;  1GOB A;  1WSF A;  4PKG A;  4L3Q A;  1CZB A;  1U4B A;  2FBV A;  3C6A A;  5KGX A;  4IZ9 A;  3DM2 A;  4IFV A;  3MN9 A;  4XH5 A;  3ZET B;  1W0H A;  3AVH A;  4WF9 L;  4B3R K;  4DF4 A;  2V52 B;  4DR3 K;  3BF1 A;  1RCH A;  2HHU A;  4JKG A;  4CFD A;  4GV9 A;  1K8K B;  5AQL A;  1L5U A;  5CYM A;  3NH0 A;  3A2F A;  4BAC A;  2CGL A;  5CY4 A;  4BE1 A;  4BE2 A;  3TAM A;  3WQT A;  4JI6 K;  1K9M O;  4BR4 A;  1WBB A;  1YJ9 N;  3WXK A;  3TAE A;  4FWR A;  1C1A A;  3QEP A;  1HYS A;  1VSE A;  3AA5 X;  4L8R B;  4FWM A;  2QM1 A;  4Z4E A;  4DR6 K;  2XHB A;  3CYG A;  1EKE A;  4GKJ K;  3A0I X;  3ZT0 A;  4BRO A;  4C1N I;  3I0R A;  3CCJ N;  4X62 K;  2W6K A;  1KAY A;  4YOT A;  2A5X A;  1K8A O;  4E7K A;  1BA1 A;  4CJ3 A;  4YY3 K;  4JRP A;  3S9H A;  3KKR A;  1NK0 A;  3KK7 A;  2IAJ A;  2FF6 A;  4DSE A;  4CJL A;  3FFI A;  2OZM A;  1J9A A;  1X3M A;  3THW A;  2OTL N;  1RDB A;  4KHS A;  5FPE A;  3LL3 A;  3FLC O;  2YNF A;  4AQY K;  3JXU A;  1Y64 A;  5KI6 A;  1UA1 A;  4FLZ A;  1JJ2 M;  4YDU A;  2QK9 A;  4I9L A;  3TU5 A;  3LZI A;  4NLB A;  3L2U A;  3DWL A;  4G9Z A;  2NRH A;  4M63 C;  2KZM A;  2X6S A;  3VPZ A;  2GEM A;  2G8U A;  3PX0 A;  5DK5 A;  3M8Q A;  2JWL A;  5AQF A;  4DU3 A;  4FZX C;  1U47 A;  5FRN A;  1XHX A;  1FKP A;  1RIL A;  4BRI A;  3QIN A;  1SUQ A;  4KRE A;  4DS4 A;  1J5O A;  2E1Z A;  4DV0 K;  3OYJ A;  4B8A B;  1OH6 A;  2VWK A;  1NU0 A;  4J2D A;  3G71 N;  2IDO A;  3HP9 A;  1ZXO A;  4CFB A;  3LDL A;  5AFU A;  4CGF A;  4I6M A;  5K14 A;  4O0I A;  3SPZ A;  1P90 A;  1QS4 A;  2A40 A;  3ZSV A;  4UY8 O;  2IS3 A;  3SK3 A;  4FXD A;  4OPJ A;  5HRR A;  3KLE A;  3ZCM A;  3IG1 A;  2FBY A;  1RBU A;  4KV8 A;  1IG9 A;  3OYD A;  3NVM A;  3QB0 A;  3VET A;  3PSF A;  2FBT A;  3SUQ A;  1EXQ A;  4J2E A;  3EZW A;  4FW2 A;  3P83 D;  4OGC A;  3GL1 A;  1TVR A;  4CGG A;  3LAM A;  3SNN A;  3CD6 N;  3O4N A;  4Z4G A;  4IKF A;  3OS2 A;  5DMR A;  5FRM A;  2DTU A;  3MX5 A;  4GNI A;  5LL6 Z;  3VTH A;  4GVM A;  5TKW A;  1Z26 A;  1Q9Y A;  4XIU A;  4WQ4 A;  3G4S N;  3F5T A;  1RBT A;  3G25 A;  4BG9 A;  3OVN A;  4B1W B;  2YNG A;  3FGU A;  4DLG A;  5C0Y A;  4CJ5 A;  2IVN A;  3QIC A;  4CI6 A;  1WAJ A;  3TR8 A;  5F0X A;  4JV5 K;  4MDB A;  3NCI A;  3OYC A;  4JKA A;  2NUB A;  3VQ4 A;  2P5O A;  2E6M A;  1EX4 A;  4FWL A;  1WAF A;  2NRR A;  1FW6 A;  1RDU A;  4DSK A;  4IJN A;  4IFE A;  3QES A;  5FPN A;  2QWQ A;  4K8Z A;  2GV9 A;  1MWM A;  3P31 A;  5KTQ A;  4IEI A;  1VQP N;  4KHU A;  3DRP A;  1QQN A;  4MO4 A;  3OYH A;  3I55 N;  3T3F A;  4CJU A;  4CJW A;  1IJJ A;  4EZ6 A;  2QWO A;  1E4F T;  2D0P A;  4KFB A;  1BO5 O;  4PKI A;  2HHT A;  3IS9 A;  4C23 A;  1GLC G;  2ZD1 A;  1CZA N;  5AQI A;  1D5A A;  1CXU A;  3QEI A;  1W9H A;  2P9P A;  1ZBI A;  3AVI A;  1ATS A;  1HQE A;  2HST A;  4B1V A;  1S1W A;  3V6D A;  4FJI A;  3VEW A;  3M3Z A;  3NF9 A;  1NJZ A;  3RMB A;  1HNZ K;  1VQ4 N;  2VQE K;  5MLC Q;  3ZT1 A;  1MU2 A;  2OYQ A;  4FJM A;  1T6C A;  1VSL A;  1S1U A;  4DTR A;  5BPM A;  3OY9 A;  3CXC M;  3CER A;  1I3A A;  1HKB A;  2UUB K;  4FWO A;  4W5R A;  4ZTF A;  4FSV A;  3ZX3 A;  2EHG A;  2A41 A;  4M3W A;  1EQY A;  3ZEU B;  4DTJ A;  4QS9 A;  1NKB A;  4CFA A;  2HW3 A;  1LAV A;  3PIO L;  2YHW A;  5HL7 L;  4M7Y A;  4RWT A;  3KD1 E;  4O4G A;  4A2B A;  2ITM A;  4KKO A;  1TKT A;  5LJV A;  3IAY A;  5AR0 A;  5AQR A;  1NKC A;  1KCF A;  1QSL A;  5H1S Q;  3AVG A;  3PX6 A;  1D4X A;  5KPZ A;  3HVR A;  2YX6 A;  3V1O A;  5KPT A;  4RW9 A;  3SQ2 A;  5GAE P;  3OYE A;  3IMX A;  4F2R A;  4YOR A;  3VEV A;  4NCA A;  2KTQ A;  4H0O A;  3T1Y K;  5E41 A;  2OA8 A;  3C94 A;  1JLE A;  3HRG A;  3AY9 A;  4LFC K;  1TAU A;  1W2B M;  1RBR A;  3IUC A;  4JD2 B;  2Z1H A;  4DUY K;  2I7N A;  3CCV N;  1R59 O;  4CEO A;  1RT5 A;  3SI6 A;  3L2W A;  1EO1 A;  3ZEU A;  3WXL A;  4CJT A;  2RHK A;  3T19 A;  3TAN A;  3AA4 A;  4WQ4 C;  1VQ9 N;  1VSJ A;  4IG3 A;  5JMV A;  4NYN A;  4HTL A;  3M1F A;  5AQH A;  3HM9 A;  2DFH A;  1IKV A;  3WQU A;  1QSS A;  5CR4 A;  3MN7 A;  4OGE A;  2KQ2 A;  2ATQ A;  3M8R A;  4N76 A;  2D0O A;  1LWC A;  2IVP A;  1LW2 A;  4CHN A;  4BRD A;  3QLH A;  3CC7 N;  4H0P A;  4B3M K;  4Z4H A;  2E5L K;  2HMI A;  1KXP A;  4H0Y B;  4DSJ A;  3I33 A;  1XWL A;  4ELT A;  3PLA A;  3MED A;  2QWP A;  4DV3 K;  5C25 A;  1VQ7 N;  2O8E B;  4LD0 A;  3JAM O;  1N32 K;  4KHN A;  1NKE A;  1F21 A;  3F2K A;  1BI4 B;  1Z6R A;  4WQ5 C;  4LFB K;  4J2A A;  1IG8 A;  4BRQ A;  2ZE2 A;  4PL7 A;  3MMV A;  3PO4 A;  4CGI A;  3OS1 A;  4DTO A;  4HCB A;  3TWH A;  4KAZ A;  5AQM A;  2BDP A;  4WCE L;  3QEW A;  1KSP A;  1BU6 O;  3LM2 A;  3O9Q A;  1VHX A;  5M1O A;  3VGL A;  1TYQ A;  3DXK B;  2QKK A;  2FBX A;  4C8L A;  3KLF A;  3DJC A;  3ZX0 A;  2YV0 X;  3G0Z A;  3TAG A;  3H08 A;  1N34 K;  3KD5 E;  5AZI A;  3RR8 A;  1ITG A;  2ZJP L;  1SAZ A;  3ATU A;  2EWS A;  1X9W A;  1RBS A;  2QI2 A;  3HPG A;  3PIP L;  4PWD A;  1T3V A;  2Q31 A;  4CIE A;  3HTV A;  2O8C B;  2G8V A;  2OTJ N;  1S9E A;  3TTF A;  2HHH K;  2GBZ A;  1VQK N;  2Q2R A;  4ISE A;  4B1Y B;  3C6U A;  3Q7C A;  4FVU A;  1WSE A;  1IKX A;  3EE8 A;  4EIA A;  1JXB A;  3A5O C;  2E2Q A;  3UB5 A;  1SZ2 A;  5AZJ A;  5CYQ A;  4KTW A;  4M3T A;  1ZBH A;  4DQI A;  4K42 A;  1RT2 A;  1S9G A;  2O8F A;  3AVL A;  1X1P A;  2ETJ A;  4RW6 A;  2WC9 A;  4BR7 A;  3AV9 A;  3L2V A;  5AQN A;  3BF3 A;  4KBO A;  3NGY A;  3VER A;  3IDH A;  2ASM A;  1SKW A;  4IOA L;  1VRU A;  3UKR B;  2UUC K;  2QWR A;  1HYV A;  3JS6 A;  4FJ8 A;  3D7E O;  2O8D B;  1OVQ A;  1LWF A;  2P9U A;  3I0S A;  4E7H A;  4DS5 A;  4BVP A;  4CEB A;  5FRO A;  2B6A A;  2FLO A;  3ZT3 A;  2F8S A;  4CHY A;  3K5O A;  4PL8 A;  1L3U A;  1FK9 A;  1ZC6 A;  1G99 A;  4CF8 A;  4YDU C;  4HVJ A;  3OYL A;  2PYL A;  3CHW A;  4CJS A;  1Z05 A;  4N56 A;  3H46 O;  3OYF A;  1O13 A;  4FLW A;  2P9I A;  3CFR A;  2P5G A;  2KW4 A;  3LDN A;  4GY2 B;  4JI1 K;  3VA0 A;  3VES A;  5HRS A;  4QCL A;  3P5J A;  3QBX A;  1XI1 A;  3E9O A;  2GWJ A;  3O5B A;  1QSY A;  2P9N B;  3RRH A;  3DLL L;  3G10 A;  3L3U A;  3M5R A;  2O8B A;  4ILH A;  4DFP A;  5AZI B;  1GLF O;  3KK1 A;  3AA2 A;  4LH5 A;  4FZY A;  4DCH A;  4HUF A;  4CK3 A;  3AO4 A;  2HHI A;  4WYB A;  5EOY A;  2ZGZ A;  4BR2 A;  1WBD A;  2E2N A;  2XY6 A;  4O55 A;  4DU4 A;  2NRW A;  4GVE A;  4DFK A;  4DKW A;  1JL2 A;  3C0B A;  3C7N B;  3MXM A;  4BDY A;  2JLE A;  1YAG A;  5IT9 O;  5AQX A;  4BQL A;  3V9X A;  1KLN A;  2W00 A;  1GLE G;  3V1Q A;  3ZT4 A;  5AQO A;  5LY3 A;  4JEP A;  1H1V A;  3T1A A;  4H5W A;  1IBK K;  2W6L A;  5JVH L;  1JLA A;  2P9P B;  4O0J A;  5A2Q O;  1HNV A;  1RT6 A;  3BZC A;  2KHO A;  3KWI A;  3F73 A;  1FKO A;  4KTQ A;  2HOE A;  1WLJ A;  4DB3 A;  2WBN A;  3M6G A;  1DEJ A;  4F9O A;  4LF7 K;  2QTD A;  1SQK A;  4JHD B;  3ISN C;  3K5N A;  3CCQ N;  4DR4 K;  2V7Y A;  2VG6 A;  3V9W A;  2A1R A;  1D9D A;  2O8C A;  3CJA A;  1NLV A;  4UQG A;  1QTM A;  4BDP A;  1RDA A;  3SYZ A;  3ULE A;  1QHT A;  4FWN A;  4H4M A;  4E1M A;  4EP4 A;  2DFF A;  5AQU A;  1OKJ A;  2E1Y A;  4FPA A;  3QML A;  3R6M A;  3VQ9 A;  4A2A A;  2ZJR L;  1XC3 A;  4X65 K;  4DQS A;  4DSF A;  3EYZ A;  4IOC L;  4BRC A;  3L2R A;  2CH6 A;  1L3V A;  3DMJ A;  1J53 A;  2XRI A;  3H1Q A;  3QEX A;  1NOY A;  4FJN A;  5KRS A;  3BUZ B;  3SUP A;  2YKN A;  4LH4 A;  2E20 A;  1ZBL A;  5JLH A;  3AVA A;  2GWK A;  2YI1 A;  3LWL A;  5F1X A;  4DSI A;  2W42 A;  4B9S A;  4F4K A;  1HJR A;  1YF5 L;  3MDQ A;  3OJS A;  3TPQ A;  3M8P A;  4B1U B;  2FSK A;  2FSJ A;  1BGX T;  4H5V A;  4PA1 A;  2ZJQ L;  3O6W A;  3E01 A;  2G8W A;  4MLH A;  4OLA A;  1VSF A;  3ASM A;  4BE7 B;  4E0D A;  4LSN A;  2EX3 A;  3V9S A;  3VN5 A;  1S5J A;  4F3T A;  3MN5 A;  5CE3 A;  2P51 A;  4RW7 A;  3WXM B;  4W5O A;  1UA0 A;  4DR7 K;  4CJ7 A;  4IWV A;  2GTD A;  4CHQ A;  3HT3 A;  1Q81 O;  1Q8I A;  2BGG A;  4DQR A;  4OO1 J;  1HNW K;  3V4I A;  1NJY A;  3SJH A;  2OZS A;  3FZL A;  4C8O A;  5CHI A;  4H5T A;  1KFS A;  1HR0 K;  4GV6 A;  3K9J A;  3R8E A;  4N5S A;  2X78 A;  3KWG A;  3DLB A;  3EO3 A;  1XMQ K;  1UOC A;  4KH6 A;  4ZTJ A;  3SJJ A;  3O1B A;  2KLA A;  3D2E B;  1YIJ N;  4CGD A;  4FO0 A;  4BEB A;  1HX1 A;  3LDO A;  4KTZ A;  4X66 K;  3UKR A;  4FLT A;  4CK2 A;  1IO2 A;  4BEC A;  4FLV A;  1RDW X;  1X3N A;  3VEY A;  3MWT A;  3HYF A;  3P39 A;  5AQZ A;  5BN8 A;  5IWA K;  4YOW A;  3NVK A;  1WOQ A;  3K57 A;  3CC2 N;  3S41 A;  1C0U A;  4YOU A;  4H0X B;  4NO7 A;  1JLQ A;  4IO8 A;  1ATR A;  3HVT A;  4LF9 K;  4JI3 K;  5FDL A;  1TV6 A;  3R9P A;  4DV2 K;  4QS8 A;  3NBP A;  1B92 A;  4B1Z A;  1ILY A;  1BWF O;  3VQ6 A;  3J81 O;  3QEV A;  4B3S K;  5GAG P;  2PFU A;  4DTN A;  5HRP A;  5C24 A;  4B9Q A;  3DOL A;  4XH1 A;  4IBN A;  2BUP A;  1BQN A;  5F2R A;  1HMV A;  3HO1 A;  2NLX A;  4B8C A;  3HPO A;  4DSL A;  1XUP O;  2YNI A;  2C1G A;  4FJL A;  4LF4 K;  3RRG A;  5BR8 K;  3TAF A;  1KFD A;  1VSK A;  2VWB A;  3I56 N;  1VQO N;  3HJF A;  2HF4 A;  4YOX A;  3MAQ A;  3EN9 A;  4DFJ A;  3FFK B;  3A5N C;  4QAG A;  5BRD A;  1BIZ A;  3THX B;  2ZWH A;  3DXM B;  1LW0 A;  1QHA A;  2BH1 A;  3CJB A;  5M1Q A;  2ZGY A;  4B08 A;  2V7Z A;  5C12 A;  2QA4 N;  3N4P A;  1OH5 A;  2DY4 A;  4XEI A;  2RN2 A;  4ICL A;  5AQP A;  2YHB A;  1TK5 A;  4JK7 A;  4LSL A;  1NBW A;  1OH7 A;  4OPA A;  5C10 A;  4JKG B;  5FPM A;  3NAE A;  2VG7 A;  3E9L A;  4RW4 A;  4AHC A;  3O9S A;  2O8F B;  1C1B A;  3OHR A;  4EP5 A;  3NHG A;  3AVM A;  5FLX O;  2HBJ A;  3VQ8 A;  4CK1 A;  3QFU A;  4QOZ B;  4FOI A;  3NE6 A;  3EE9 A;  3CQX A;  4JI7 K;  3MEE A;  4WQ5 A;  3CM5 A;  1N8R O;  1QVF M;  4Q5V A;  4PUO A;  5ADX A;  2VCP A;  4H5N A;  4JKH A;  1T05 A;  2X6N A;  3M8S A;  5T7B A;  4JI0 K;  1YTA A;  3OW2 M;  4CF9 A;  1OH8 A;  1KAX A;  4TSX A;  4B9U A;  3RSE A;  4PQU A;  3FE1 A;  2JGU A;  2Z1I A;  3H1V X;  2Z1G A;  4BGA A;  3ZX2 A;  5DM6 L;  1X9M A;  4JS5 A;  2RE2 A;  3VEZ A;  5KQD A;  3HPH A;  4CZG A;  3E66 A;  5SZT A;  2HHW A;  3VTI A;  4BRN A;  1WUA A;  3J7Z O;  1YVU A;  1VAZ A;  3B8A X;  4I2P A;  4O8K A;  3I8D A;  4BRG A;  3O4Q A;  4C8N A;  1NNE A;  3DRR A;  4BRH A;  3CFO A;  5KGW A;  2GUP A;  4KH5 A;  4BC2 A;  4IDH A;  3MX2 A;  4DLE A;  4DTP A;  4FZZ A;  4AHT A;  5C2F A;  3CPW M;  4ELU A;  4EHT A;  1Q9X A;  4JK9 A;  4FJG A;  4AHR A;  1T6D A;  4BR9 A;  5CZ2 A;  1HLU A;  4PKH A;  4AF1 A;  4Q0B A;  3U4L A;  3VEN A;  1NK9 A;  3QNN A;  4M42 A;  4NB4 A;  1ZYQ A;  4BC4 A;  4CED A;  1NGJ A;  4M7X A;  3RSE B;  3KZB A;  1NWK A;  3OTO K;  4A5B A;  3AVC A;  4DTS A;  3THV A;  3QBW A;  3WXI A;  3IKM A;  5C15 A;  3S3M A;  5E26 A;  3CQY A;  3D2E A;  3ULE B;  2HNY A;  3O9T A;  2NRX A;  4YNQ A;  3G6E N;  4B9L A;  1BUP A;  4BRK A;  3NGZ A;  2PBD A;  3AAQ A;  3J7A P;  1XQS C;  5GAH P;  1HPM A;  1NMN A;  2P9L B;  2ZF5 O;  4OVL A;  3VQD A;  3AAR A;  1T44 A;  1BIS A;  1J5E K;  1U2V B;  1HKG A;  2AJQ A;  1RT4 A;  3RVC A;  1LWE A;  5BRH A;  4BC5 A;  4E7L A;  3MXI A;  1EP4 A;  3CJC A;  3DAW A;  1G15 A;  3PX4 A;  3QNO A;  1OVY A;  1JCG A;  3P1G A;  3KLI A;  5AQS A;  2J4R A;  2IC3 A;  5J2N A;  1TK0 A;  4FWK A;  5CZ1 A;  4DTM A;  1KVB A;  1NOZ A;  2HBL A;  3LP2 A;  4MO5 A;  3B6P A;  3AVJ A;  4FJK A;  1YUW A;  4Z4C A;  3C6H A;  3AAP A;  1S22 A;  4OX9 K;  1BL3 A;  1NGI A;  1TAQ A;  2IOC A;  1M1K O;  2F7T A;  3C7N A;  5M1K A;  2QKB A;  3DXM A;  4CZL A;  5I3U A;  1TUY A;  4DV6 K;  2XY5 A;  3HSC A;  2RKI A;  4RG8 A;  1GOA A;  1RT1 A;  4CJ4 A;  1KVA A;  4DMN A;  3ITH A;  1JL1 A;  4KHW A;  4CJF A;  3AO3 A;  2JWK A;  1YJW N;  3E9P A;  1XNR K;  1U45 A;  4FK0 A;  2W41 A;  3SPY A;  3ZSZ A;  1WSJ A;  5J2M A;  2FC0 A;  4BRA A;  4GMJ B;  4E7I A;  2P9I B;  2ZQB A;  1I94 K;  1TYQ B;  3DXK A;  4CF2 A;  2HBK A;  4WFN L;  4M3Z A;  2QWL A;  3KIO A;  2YJF A;  4Z4I A;  3ENB A;  4KHQ A;  4I7F A;  1NK5 A;  1XC9 A;  1WSG A;  2P9L A;  4Y1C A;  3U3G A;  3JYT A;  5EY4 A;  4NXN K;  2KFZ A;  2D1K A;  5TKY A;  3GBT A;  2HMP A;  5HP1 A;  1T03 A;  2F8T A;  1NMD A;  4LC9 B;  1NK4 A;  3LAL A;  4CIF A;  3FZH A;  2B4J A;  3CPE A;  2Q3S A;  3A8Y A;  3TTD A;  3GE1 A;  2HBM A;  3CCM N;  3CMA N;  1VSM A;  3DLK A;  1BOT O;  3E1Y A;  3FR0 A;  4C1N K;  5AZJ B;  2UYT A;  1RTJ A;  4MLE A;  2Q36 A;  3VQ7 A;  1ZBF A;  1VSI A;  4B3T K;  1L3T A;  4I9Q A;  3NGI A;  4A62 A;  1V4S A;  3C65 A;  3PUF A;  4A59 A;  1TUU A;  1N33 K;  3SAH A;  2WON A;  5EVZ A;  1P8Z A;  3SCX A;  4DTU A;  3SAG A;  1KAZ A;  3W3D A;  3ZT2 A;  3QIO A;  4FYD A;  3KTQ A;  5EXW A;  5D3G A;  5C42 A;  4N41 A;  2HHS A;  3OYI A;  3K59 A;  4CCH A;  2YHY A;  1GLL O;  3KLH A;  1ZBU A;  1LV5 A;  5EX5 A;  2C1I A;  3OBW A;  3J8A A;  5BRE A;  1RTI A;  2A6A A;  3R3L A;  1HRH A;  2OPP A;  3GOI A;  4CEC A;  3SZ2 A;  2PZS A;  5SWM A;  1Q86 O;  3U9D A;  3WEE A;  3H3O B;  3SV3 A;  3PY8 A;  3WNG A;  2BAN A;  4BDZ A;  4DR1 K;  1XNQ K;  4DV4 K;  4BR5 A;  3EY1 A;  4E3S A;  3D0P A;  1ASV A;  1X9J A;  3OYM A;  3JSM A;  3ENH A;  4JNE A;  4F8R A;  3WNE A;  1VQ6 N;  3O80 A;  3T1H K;  1U48 A;  3MCA B;  4E1J A;  1VQL N;  2UUA K;  2NRZ A;  3O1W A;  1IBL K;  2Y1J A;  3I8B A;  4WE1 A;  2Y1I A;  3W0L A;  2FSN A;  4EZ9 A;  4BQZ A;  1YI2 N;  2QWN A;  1E4G T;  3V81 A;  4C8K A;  4CJQ A;  1S1X A;  4BRE A;  3PV8 A;  3MXJ A;  3O3G A;  3TAQ A;  4CHZ A;  4WFB L;  4B9N A;  4JI8 K;  1VQ8 N;  1NK8 A;  1XHZ A;  3OJU A;  2F4V K;  3MCP A;  1J6Z A;  4H4O A;  3KJV A;  4FLX A;  3AO5 A;  2Z1J A;  3SQ4 A;  2ASP A;  3KVG A;  3NF7 A;  1RTH A;  5FPD A;  3J7Y P;  3L4Q A;  4RW8 A;  2HVH A;  4FK2 A;  1VQN N;  3TAP A;  3FZF A;  5C2D A;  4KB0 A;  3AA3 A;  4CJK A;  3BDP A;  1NGC A;  4JI4 K;  3D45 A;  4OJR A;  1YJN N;  1NJW A;  3EKS A;  4FL9 A;  1DTT A;  3D2F B;  3CJ1 A;  3CYM A;  3V1R A;  1TKX A;  4FWP A;  3WNH A;  2OPR A;  4NYF A;  3VMF B;  4JYA K;  3S5T A;  4DUZ K;  4FLY A;  1QE1 A;  5JLF A;  1YXQ A;  4EAH D;  2VWJ A;  1RDD A;  2DFE A;  2GEL A;  2HHX A;  4IFY A;  2VG5 A;  4CER A;  4N47 A;  4CJR A;  3HM8 A;  4FLU A;  3U9Z A;  1ASU A;  3VQQ A;  4CEF A;  4YFU A;  1HQU A;  1BCO A;  2Q1N A;  3J80 O;  3AVK A;  1SL2 A;  1BHL A;  1IKW A;  2F9T A;  3AVB A;  1YT3 A;  4FJJ A;  5KQ8 A;  4FJ7 A;  5HRN A;  2G8H A;  2HHV A;  1X9S A;  1D9F A;  1M90 O;  2CGJ A;  4HTU A;  1EWQ A;  4CE9 A;  3SV4 A;  4BRF A;  4B9V A;  4B3O A;  1SL1 A;  3NH1 A;  4OPH A;  1CXQ A;  3RMA A;  3GG4 A;  5KRT A;  1HYZ A;  1T7P A;  4NCB A;  5GIO A;  3L8B A;  1SKS A;  2QW9 A;  5ADX H;  1C0T A;  1U2V A;  1R0A A;  2UXB K;  5HOO A;  4CF1 A;  1WN7 A;  3SBT A;  4RTF D;  2YHA A;  3D2F A;  4X64 K;  4OKK A;  2P9S B;  1Q7Y O;  4XJX A;  4AHU A;  3HZ6 A;  4M3R A;  3CCS N;  4DU1 A;  1RDC A;  4MFB A;  4DTX A;  3ZSY A;  2QXF A;  4I6M B;  4FM1 A;  3O9R A;  2G8K A;  4B9M A;  4QS7 A;  2WOM A;  2PYJ A;  4AHS A;  1QVG M;  2KZZ A;  4KHY A;  4OKE A;  3BY5 A;  3SMS A;  2IIR A;  3QIP A;  1RT7 A;  1W97 L;  5BR9 A;  1CLQ A;  2HF3 A;  4Z0U A;  5AFU H;  4DR5 K;  1JLB A;  1RGI A;  3ZSO A;  3ZLJ A;  3RMC A;  4IJA A;  2E8A A;  3NMU A;  4ILG B;  2YNH A;  2HND A;  3DRS A;  4U7B A;  4H0T B;  2E88 A;  2QEX N;  4CHP A;  4BG8 A;  3HXM A;  3FZM A;  4U67 L;  3DLR A;  3F9K A;  4A61 A;  4FPB A;  4KB1 A;  1I39 A;  5I42 A;  4GV3 A;  3HST B;  4IEE A;  5AQJ A;  4JI5 K;  1KC8 O;  3VF6 A;  3K2P A;  3GDQ A;  2I7P A;  3KLG A;  4XH4 A;  3MEC A;  3LZJ A;  5J2Q A;  4CF0 A;  4G1Q A;  2HHQ A;  1HNI A;  2XO7 A;  1WNS A;  3LAK A;  4HCC A;  3SUO A;  1ASW A;  4ID5 A;  5KPR A;  3WEE B;  2P1J A;  3LAN A;  2VYP A;  4KH4 A;  4JI2 K;  3RR7 A;  3AO2 A;  2O8B B;  2PY5 A;  4DF8 A;  4CZM A;  1KTQ A;  4JK8 A;  4JS4 A;  1YVN A;  3IFR A;  4H0V B;  5AQK A;  3R1X A;  2XY8 A;  1EET A;  1RFQ A;  1V4T A;  4K41 A;  1VQM N;  4CD1 A;  2Q0U A;  4CGH A;  1S3X A;  3PO5 A;  1CZ9 A;  3NFA A;  3CC4 N;  3Q7B A;  5J1E A;  2KFN A;  1U04 A;  3WUH A;  1ESV A;  1SS6 A;  5HRO A;  2CGK A;  3IRX A;  1VSH A;  3RWU A;  4CGJ A;  2D5R A;  4JKD A;  1A5X A;  2OPS A;  3TI0 A;  4PHT X;  3EZ5 A;  1REV A;  4KHP K;  4DV1 K;  3CI5 A;  4FVM A;  3LPU A;  1GOC A;  1QQC A;  4JHD A;  4AHV A;  4J2B A;  2OPQ A;  3O08 A;  4CBX A;  4CEE A;  4JAX A;  2NNW A;  4LF5 K;  4DR2 K;  1KRP A;  3L4I A;  3C95 A;  1BQM A;  4W5N A;  3ID6 A;  4CIG A;  3CJ7 A;  2HB5 A;  3RMD A;  4DWI A;  3ZYY X;  3THY B;  1XMO K;  4CEA A;  3THW B;  1DLO A;  1RT3 A;  3BGR A;  4E1N A;  1VK0 A;  4BE0 A;  4OLB A;  1WSI A;  1O1W A;  1NJI O;  1HNX K;  4F3O A;  3LDP A;  3U8X A;  3UE5 A;  3OBY A;  4Z4F A;  3NDK A;  3K58 A;  4CZH A;  3ALY A;  1C0M A;  4LF6 K;  4KI6 A;  2R7Y A;  3VGK A;  4CEQ A;  2P9K A;  4CZK A;  1IKY A;  1RBV A;  3S3N A;  2UU9 K;  1QQO A;  3MN6 A;  3DI6 A;  4Y1D A;  3VQE A;  5DM7 L;  3DYA A;  2QXL A;  4K43 A;  2DPN A;  1NGA A;  2W40 A;  3V9Z A;  4ILJ A;  1D8Y A;  4E89 A;  3HL8 A;  4GKK K;  1N5Y A;  3CIP A;  2F9W A;  3T69 A;  4LFA K;  1TGO A;  4IOX A;  1E3M A;  2FF3 B;  1DKG D;  5GIN A;  2FXU A;  4CZF A;  4IXC A;  1HUX A;  1T8E A;  3DLE A;  5M1N A;  3CF5 L;  3QET A;  4AM6 A;  3HBT A;  4OKJ A;  4LF8 K;  1Q18 A;  3VQC A;  4ISG A;  4EHU A;  1VRT A;  4CEZ A;  4ZHR A;  3CJ9 A;  2CH5 A;  3P4I A;  2D4W A;  4ELV A;  3FZK A;  1HPZ A;  2AP1 A;  2D0A A;  4E7J A;  5EU7 A;  3VEO A;  2ZM6 K;  3LP1 A;  2YHX A;  5LMN K;  3H3N O;  3NF8 A;  1YTU A;  1JCE A;  3CM6 A;  3SAF A;  3OYN A;  1NK6 A;  1TK8 A;  4E19 A;  4I2Q A;  2P9K B;  3VF2 A;  4DHY A;  3TSQ A;  4MDA A;  2BE2 A;  1LOT B;  5JIC A;  3L2Q A;  3S3O A;  4FM2 A;  5AQG A;  3CCU N;  4JKF A;  4BRM A;  2O8D A;  3VF4 A;  5BRF A;  2HVI A;  3SLC A;  5AQV A;  1WB9 A;  4BVO A;  4KRF A;  4CD3 A;  3VQB A;  3AVN A;  2ASO A;  2LSN A;  2NZT A;  4H5R A;  4R5P A;  2RPI A;  4K8X A;  1LCU A;  5M1P A;  3CQ8 A;  1VSD A;  3AGK A;  1C0G A;  5J2P A;  1S1T A;  4HWI A;  2V51 B;  5AQQ A;  2AA4 A;  4MQ3 A;  4B9T A;  4OPK A;  3CCE N;  3H45 C;  1A5V A;  3LDQ A;  4IDK A;  4JKB A;  4NCG A;  2YCH A;  4DG1 A;  3TAR A;  4DQQ A;  3AGR A;  1S6P A;  3ZSQ A;  1NGH A;  3SMP A;  4YOY A;  1NM1 A;  4NLC A;  2WTU A;  3ULD A;  4CZJ A;  4DV5 K;  4BY9 C;  1SL0 A;  1MA9 B;  5E84 A;  3EL2 A;  3H6E A;  3QDK A;  3U3Y A;  4YHH K;  2HNZ A;  3BEX A;  3QFP A;  1L3S A;  3PSI A;  1EWR A;  2XY7 A;  1JLF A;  4DQ8 A;  1MWK A;  3THX A;  4KI4 A;  1N6Q A;  1FJG K;  2E2O A;  4AIL C;  4WFA L;  4FJ5 A;  2GUI A;  3KHY A;  2UXC K;  2VGN A;  1QQM A;  1HJO A;  2X74 A;  1YIT N;  2A1S A;  1W7A A;  4CVN E;  3N4Q A;  3DLG A;  1BDG A;  4A57 A;  4Z94 A;  4JKE A;  4CBU A;  4RCH A;  5ELZ A;  2BTF A;  3L6Q A;  1K6Y A;  4CZI A;  2F96 A;  3BP8 A;  5JS2 A;  1S1V A;  3KK2 A;  3CCL N;  4BRP A;  4M3U A;  2O4G A;  3TSP A;  4M3X A;  4K25 A;  1BCM A;  3WNF A;  4HUG A;  1S72 N;  3B6O A;  1ZBS A;  1GLJ O;  4W5Q A;  1DT9 A;  1NGE A;  2ITG A;  4M45 A;  3V9U A;  1U49 A;  3F9M A;  1BIU A;  4GW6 A;  4PY5 A;  2P9U B;  4M41 A;  4KPY A;  4E72 A;  4BRL A;  3NH2 A;  2Q97 A;  4B1X B;  1ATN A;  3ZSX A;  1NK7 A;  2YKM A;  1BG3 A;  3T7Z A;  3K9K A;  1TL1 A;  4CJV A;  3P38 A;  3VEX A;  4DQP A;  2KKZ A;  4EFH A;  4CZE A;  4H03 B;  5M1F A;  3OYB A;  3OS0 A;  4DFM A;  1KLM A;  1NGF A;  1TKD A;  4LY7 A;  1TKZ A;  3HK2 A;  1JLG A;  3KKS A;  3VA3 A;  3CFP A;  3UIQ A;  3HOS A;  3SQ1 A;  1LAW A;  2I5J A;  4CHO A;  3LDS A;  4DV7 K;  3QO9 A;  1SKR A;  3L0Q A;  5AQW A;  5AJ3 K;  4JKC A;  1K73 O;  1VQ5 N;  4FJX A;  4R79 A;  3VGM A;  4W5T A;  3ZSW A;  2NRV A;  2VGM A;  4FJ9 A;  1B9D A;  2A42 A;  2WUS A;  2IVO A;  1Q82 O;  1KQS M;  1NGG A;  3UKU A;  4KO0 A;  4H8K A;  3HI0 A;  1RNH A;  4CBW A;  4HUE A;  3A5M C;  4O5B A;  5HLF A;  1NGD A;  1NG9 A;  3O3F A;  1JXE A;  1Z25 A;  3OYA A;  3EEQ A;  1GLA G;  3HOT A;  5BN9 A;  4ID1 A;  4AH9 A;  5GIP A;  1YHQ N;  3QER A;  3TAB A;  2O8E A;  1IV0 A;  4BWM A;  3O8M A;  3VQP A;  3LPT A;  3D6R A;  3MK6 A;  1FXX A;  3LWM A; 
#chains in the Genus database with same CATH homology
 1HKC A;  4XEI A;  5GAE P;  5BPN A;  5AQP A;  3CCR N;  2F9T A;  3ENO A;  5KQ8 A;  4JK7 A;  3IMX A;  1NBW A;  1M90 O;  2CGJ A;  4YOR A;  3VEV A;  4BRF A;  4OPA A;  4H0O A;  5C10 A;  4JKG B;  5FPM A;  4OPH A;  1KD1 O;  1K8K A;  2WFB A;  3E9L A;  3GG4 A;  3MWP A;  3HRG A;  3AY9 A;  3O9S A;  1W2B M;  3IUC A;  3ID8 A;  3OHR A;  4JD2 B;  5GIO A;  2I7N A;  3CCV N;  4O8U A;  5AQY A;  1R59 O;  2QW9 A;  2HBJ A;  5ADX H;  1U2V A;  1EO1 A;  3ZEU A;  3WXL A;  2RHK A;  5HOO A;  4WQ4 C;  3SBT A;  4RTF D;  1VQ9 N;  3QFU A;  3D2F A;  4FOI A;  5GAD P;  3EE9 A;  3CQX A;  4BGB A;  5JMV A;  2P9S B;  3WT0 A;  4HTL A;  1Q7Y O;  3M1F A;  4XJX A;  2H3G X;  4WQ5 A;  3HZ6 A;  3CCS N;  5AQH A;  4A5A A;  1N8R O;  3O9U A;  4I6M B;  1QVF M;  3WQU A;  3O9R A;  1NGB A;  3A5L C;  5CR4 A;  3MN7 A;  4FWS A;  4QS7 A;  5ADX A;  1BA0 A;  2VCP A;  4H5N A;  4JKH A;  4J8F A;  3TTC A;  1QVG M;  3CME N;  3UKU B;  3SMS A;  5LJW A;  2IIR A;  4O5F A;  2PAV A;  3ATV A;  2D0O A;  3OW2 M;  2IVP A;  1W97 L;  5JVG L;  1MDU B;  4YOV A;  1KAX A;  5BR9 A;  4BRD A;  2HF3 A;  5AFU H;  1RGI A;  3RSE A;  3FE1 A;  4BC3 A;  4H0P A;  3CC7 N;  3H1V X;  4IJA A;  4BGA A;  2E8A A;  3ZX2 A;  1QZ6 A;  3NMU A;  1KXP A;  4ILG B;  5DM6 L;  4H0Y B;  5BPL A;  3I33 A;  2RE2 A;  3VEZ A;  4FOE A;  5KQD A;  4CZG A;  3E66 A;  3PLA A;  4U7B A;  4H0T B;  2QWP A;  1VQ7 N;  3VTI A;  2E88 A;  3SBG A;  1DGK N;  3EKU A;  4BG8 A;  3WXJ A;  4BRN A;  1WUA A;  2QEX N;  3FZM A;  3J7Z O;  4U67 L;  2P9N A;  4A61 A;  3CET A;  1VAZ A;  1Z6R A;  3F2K A;  3B8A X;  4FPB A;  4WQ5 C;  5B8H A;  4GV3 A;  4O8K A;  2YJE A;  4IEE A;  1IG8 A;  3N4P A;  5AQJ A;  3ZET A;  4BRQ A;  4BRG A;  5I9E B;  4ISF A;  4PL7 A;  3MMV A;  4BRH A;  1KC8 O;  2GUP A;  4KH5 A;  3VF6 A;  1GLB G;  1U6Z A;  4Y0W A;  3GDQ A;  2I7P A;  3O4W A;  4BC2 A;  4XH4 A;  1QZ5 A;  2A3Z A;  4IDH A;  2E2P A;  4JD2 A;  4BR0 A;  5AQM A;  3MX2 A;  4WCE L;  3TSU A;  1BU6 O;  3LM2 A;  3O9Q A;  5C2F A;  5M1O A;  3VGL A;  1TYQ A;  3DXK B;  3VOV A;  4AM7 A;  5KPR A;  3CPW M;  1GLD G;  3WEE B;  4EHT A;  3DJC A;  4JK9 A;  3ZX0 A;  4FWQ A;  2VYP A;  2P9S A;  4KH4 A;  3LM9 A;  1T6D A;  4BR9 A;  4IO9 L;  1HLU A;  4JN4 A;  2GX9 A;  4PKH A;  5AZI A;  3U4L A;  4AF1 A;  3VEN A;  2ZJP L;  1SAZ A;  3OA9 A;  3ATU A;  4CZM A;  4JK8 A;  4NB4 A;  1C0F A;  1YVN A;  3IFR A;  4H0V B;  5AQK A;  4BC4 A;  1NGJ A;  2EWS A;  3R1X A;  2QI2 A;  4M7X A;  1JCF A;  3RSE B;  3KZB A;  3PIP L;  2QWM A;  5AQT A;  1NWK A;  1RFQ A;  1T3V A;  1V4T A;  4K41 A;  4A5B A;  1VQM N;  4CD1 A;  2Q31 A;  2Q0U A;  3HTV A;  3QBW A;  2OAN A;  2Q0R A;  1S3X A;  3WXI A;  2NRT A;  3IKM A;  5C15 A;  2OTJ N;  4PKG A;  5E26 A;  3CQY A;  3D2E A;  4L3Q A;  3TTF A;  3ULE B;  1VQK N;  2Q2R A;  3O9T A;  4ISE A;  3CC4 N;  3C6A A;  2NRX A;  3Q7B A;  4B1Y B;  3Q7C A;  4FVU A;  3G6E N;  4IZ9 A;  3EE8 A;  3WUH A;  1ESV A;  1SS6 A;  2CGK A;  3MN9 A;  4EIA A;  4XH5 A;  3A5O C;  1BUP A;  2E2Q A;  4BRK A;  3ZET B;  2PBD A;  3AAQ A;  3UB5 A;  1SZ2 A;  1XQS C;  5AZJ A;  4JKD A;  5GAH P;  4WF9 L;  1HPM A;  4PHT X;  4K42 A;  2V52 B;  3BF1 A;  2P9L B;  2ZF5 O;  4JKG A;  2WC9 A;  3AAR A;  4GV9 A;  1K8K B;  5AQL A;  4BR7 A;  1T44 A;  3CI5 A;  4JHD A;  5AQN A;  1U2V B;  3BF3 A;  1HKG A;  2CGL A;  4KBO A;  3RVC A;  3VER A;  3IDH A;  3O08 A;  4CBX A;  5BRH A;  4BC5 A;  4JAX A;  2ASM A;  2NNW A;  4IOA L;  3CJC A;  3L4I A;  3DAW A;  3WQT A;  3UKR B;  3ID6 A;  1OVY A;  2QWR A;  1JCG A;  3JS6 A;  3D7E O;  4BR4 A;  1YJ9 N;  1K9M O;  3CJ7 A;  5AQS A;  2P9U A;  2J4R A;  3WXK A;  4FWR A;  4BVP A;  3ZYY X;  4FWK A;  2FLO A;  2HBL A;  4FWM A;  2QM1 A;  4MO5 A;  4PL8 A;  1ZC6 A;  1NJI O;  1YUW A;  1G99 A;  3LDP A;  3U8X A;  3C6H A;  4YDU C;  3A0I X;  3CHW A;  3AAP A;  1S22 A;  3UE5 A;  3OBY A;  1Z05 A;  4BRO A;  4C1N I;  3H46 O;  4CZH A;  1O13 A;  3CCJ N;  1NGI A;  2P9I A;  1M1K O;  2F7T A;  1KAY A;  3C7N A;  3LDN A;  4GY2 B;  4YOT A;  5M1K A;  3VES A;  3VGK A;  3DXM A;  4CZL A;  2A5X A;  2P9K A;  1K8A O;  3QBX A;  1TUY A;  4CZK A;  3E9O A;  1BA1 A;  2GWJ A;  3O5B A;  2P9N B;  3HSC A;  1QQO A;  3MN6 A;  3DLL L;  3KK7 A;  2FF6 A;  3M5R A;  1X3M A;  4ILH A;  5DM7 L;  5AZI B;  2OTL N;  1GLF O;  2JWK A;  1YJW N;  3E9P A;  2QXL A;  4K43 A;  5FPE A;  2DPN A;  1NGA A;  2W40 A;  3LL3 A;  4DCH A;  3FLC O;  2W41 A;  4ILJ A;  3JXU A;  1Y64 A;  4WYB A;  1JJ2 M;  5EOY A;  3CIP A;  2F9W A;  4YDU A;  3T69 A;  2ZGZ A;  4IOX A;  4BR2 A;  4BRA A;  2E2N A;  3TU5 A;  2NRW A;  2P9I B;  4GVE A;  2FF3 B;  1DKG D;  4NLB A;  4DKW A;  1TYQ B;  2FXU A;  3C0B A;  3DXK A;  3C7N B;  5GIN A;  3DWL A;  4G9Z A;  2NRH A;  4M63 C;  4CZF A;  4IXC A;  3VPZ A;  1HUX A;  2GEM A;  2HBK A;  1YAG A;  5AQX A;  4WFN L;  2QWL A;  4BQL A;  2YJF A;  5M1N A;  3CF5 L;  1GLE G;  2W00 A;  2JWL A;  3ENB A;  4AM6 A;  5AQF A;  3HBT A;  5AQO A;  5LY3 A;  4JEP A;  1H1V A;  4H5W A;  5JVH L;  1Q18 A;  2P9P B;  4ISG A;  4EHU A;  3CJ9 A;  2CH5 A;  2KHO A;  3KWI A;  2D4W A;  3P4I A;  2P9L A;  3FZK A;  2HOE A;  2AP1 A;  4BRI A;  4DB3 A;  2WBN A;  5EY4 A;  3M6G A;  3VEO A;  1DEJ A;  4F9O A;  2YHX A;  2QTD A;  1SQK A;  2D1K A;  3H3N O;  4JHD B;  3CCQ N;  2V7Y A;  5TKY A;  3GBT A;  1JCE A;  2HMP A;  3SAF A;  3CJA A;  2E1Z A;  2P9K B;  3VF2 A;  4DHY A;  3TSQ A;  1NLV A;  4MDA A;  1LOT B;  5JIC A;  1NMD A;  4LC9 B;  5AQG A;  3CCU N;  4JKF A;  3G71 N;  4BRM A;  3FZH A;  3ULE A;  1ZXO A;  4FWN A;  3CPE A;  3VF4 A;  3LDL A;  5AFU A;  3A8Y A;  4I6M A;  5BRF A;  5AQU A;  3TTD A;  1P90 A;  2A40 A;  3GE1 A;  3SLC A;  1OKJ A;  2HBM A;  5AQV A;  3CMA N;  2E1Y A;  3CCM N;  4UY8 O;  4BVO A;  4FPA A;  3QML A;  3R6M A;  4CD3 A;  1BOT O;  3SK3 A;  4A2A A;  3E1Y A;  2ZJR L;  3FR0 A;  4C1N K;  1XC3 A;  5AZJ B;  2ASO A;  2NZT A;  2UYT A;  4H5R A;  4MLE A;  4IOC L;  2Q36 A;  4BRC A;  1LCU A;  5M1P A;  2CH6 A;  3AGK A;  3NVM A;  1C0G A;  3QB0 A;  3VET A;  3H1Q A;  4A62 A;  4HWI A;  2V51 B;  1V4S A;  3C65 A;  5AQQ A;  2AA4 A;  4A59 A;  1TUU A;  3SAH A;  5EVZ A;  1P8Z A;  3CCE N;  3H45 C;  3BUZ B;  3EZW A;  3SAG A;  1KAZ A;  2E20 A;  3LDQ A;  3W3D A;  3GL1 A;  4JKB A;  5JLH A;  2YCH A;  2GWK A;  2YI1 A;  5F1X A;  3AGR A;  5EXW A;  1NGH A;  3SMP A;  4YOY A;  1NM1 A;  4NLC A;  3CD6 N;  1YF5 L;  4CZJ A;  3MDQ A;  4BY9 C;  1MA9 B;  2YHY A;  3EL2 A;  3H6E A;  5E84 A;  1GLL O;  3QDK A;  3TPQ A;  3MX5 A;  4B1U B;  2FSK A;  2FSJ A;  4GNI A;  5EX5 A;  3VTH A;  5TKW A;  2C1I A;  3OBW A;  4H5V A;  2ZJQ L;  4WQ4 A;  3O6W A;  3BEX A;  3QFP A;  3J8A A;  3G4S N;  3F5T A;  5BRE A;  2A6A A;  3R3L A;  3G25 A;  4MLH A;  1MWK A;  4DQ8 A;  4BG9 A;  2E2O A;  4WFA L;  4B1W B;  3GOI A;  4BE7 B;  3KHY A;  3FGU A;  2VGN A;  5C0Y A;  1Q86 O;  1QQM A;  3U9D A;  3WEE A;  3H3O B;  2IVN A;  1HJO A;  3MN5 A;  3QIC A;  4CI6 A;  5CE3 A;  3WXM B;  5F0X A;  4CJ7 A;  4MDB A;  4BR5 A;  1YIT N;  1X9J A;  4IWV A;  2GTD A;  4JKA A;  3ENH A;  1Q81 O;  4JNE A;  4OO1 J;  1VQ6 N;  3N4Q A;  3O80 A;  4FWL A;  1BDG A;  4A57 A;  2NRR A;  4Z94 A;  1RDU A;  4JKE A;  4IJN A;  4CBU A;  4IFE A;  3MCA B;  3SJH A;  5FPN A;  4E1J A;  2QWQ A;  4RCH A;  5ELZ A;  1VQL N;  2NRZ A;  3FZL A;  3O1W A;  2BTF A;  5CHI A;  3I8B A;  4H5T A;  1MWM A;  3L6Q A;  3P31 A;  4CZI A;  4IEI A;  1VQP N;  4GV6 A;  3K9J A;  1QQN A;  4MO4 A;  3R8E A;  3I55 N;  3W0L A;  3BP8 A;  3KWG A;  2FSN A;  3EO3 A;  4KH6 A;  3CCL N;  1IJJ A;  3O1B A;  4BRP A;  3TSP A;  2KLA A;  2QWO A;  1E4F T;  4BQZ A;  2D0P A;  3D2E B;  1YI2 N;  1BO5 O;  2QWN A;  1E4G T;  4K25 A;  4PKI A;  1YIJ N;  4BRE A;  4FO0 A;  1S72 N;  4C23 A;  4BEB A;  1HX1 A;  3LDO A;  1GLC G;  3UKR A;  1ZBS A;  1GLJ O;  1CZA N;  5AQI A;  1DT9 A;  1NGE A;  4WFB L;  4BEC A;  1RDW X;  3F9M A;  2P9P A;  2P9U B;  1X3N A;  1VQ8 N;  1ATS A;  3VEY A;  4BRL A;  2HST A;  3MCP A;  3MWT A;  3P39 A;  5AQZ A;  4B1V A;  5BN8 A;  4YOW A;  2Q97 A;  4B1X B;  3NVK A;  1ATN A;  3VEW A;  3M3Z A;  1BG3 A;  3T7Z A;  1WOQ A;  3K9K A;  3CC2 N;  2ASP A;  3S41 A;  3P38 A;  3VEX A;  1VQ4 N;  4YOU A;  2KKZ A;  4H0X B;  4EFH A;  5MLC Q;  3KVG A;  4CZE A;  4H03 B;  4IO8 A;  4NO7 A;  5M1F A;  1ATR A;  1NGF A;  5FPD A;  3L4Q A;  1T6C A;  3R9P A;  5BPM A;  1VQN N;  4QS8 A;  3FZF A;  3CXC M;  3CER A;  5C2D A;  4B1Z A;  1HKB A;  3HOS A;  1ILY A;  1BWF O;  4FWO A;  1NGC A;  5GAG P;  4FSV A;  3ZX3 A;  2A41 A;  1EQY A;  2PFU A;  3ZEU B;  4QS9 A;  1YJN N;  3EKS A;  4FL9 A;  4B9Q A;  3L0Q A;  5AQW A;  1VQ5 N;  3D2F B;  4JKC A;  4XH1 A;  3PIO L;  1K73 O;  2BUP A;  2YHW A;  3CJ1 A;  4R79 A;  3VGM A;  5F2R A;  5HL7 L;  2NLX A;  4M7Y A;  4RWT A;  1XUP O;  2NRV A;  2VGM A;  4FWP A;  4A2B A;  3VMF B;  2C1G A;  2ITM A;  2A42 A;  2WUS A;  2IVO A;  2VWB A;  3I56 N;  1Q82 O;  5LJV A;  1VQO N;  1KQS M;  5JLF A;  2HF4 A;  4YOX A;  1NGG A;  3EN9 A;  3UKU A;  5AR0 A;  5AQR A;  1YXQ A;  4EAH D;  3FFK B;  2GEL A;  3A5N C;  3HI0 A;  4CBW A;  3A5M C;  5BRD A;  1NGD A;  5H1S Q;  1GLA G;  2ZWH A;  3DXM B;  3HOT A;  3HM8 A;  5BN9 A;  3U9Z A;  1QHA A;  2BH1 A;  1D4X A;  5GIP A;  3CJB A;  5KPZ A;  1YHQ N;  5M1Q A;  2ZGY A;  2YX6 A;  2Q1N A;  2V7Z A;  5KPT A;  5C12 A;  2QA4 N;  3O8M A;  1J6Z A;  3D6R A;  3MK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...