5AEOA

Virulence-associated protein vapg from the intracellular pathogen rhodococcus equi
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
110
Chain Sequence
b'SYSVHGLVTSLAVYQHFSLTVEGGGKTFTGDSGGISIPGVAVLEGTLFTEDLQHLYSDTVSFEYNAVGPYLNINFFDSHGTLLGHVQSGSIGTVSGIGGGTGGWQPKLAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords R. EQUI VAPG PROTEIN
publication title Structural Characterisation of the Virulence-Associated Protein Vapg from the Horse Pathogen Rhodococcus Equi.
pubmed doi rcsb
source organism Rhodococcus equi
molecule tags Immune system
total genus 24
structure length 110
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.480 Mainly Beta Beta Barrel Lipocalin Lipocalin 5aeoA00
5AEOA 4CV7A 4CSBA
chains in the Genus database with same CATH superfamily
2UYWA 1U17A 4D6AA 4BX7B 5B5GA 4COTA 1LCWA 1UYOX 2OZQA 4YGHA 1SWNA 3STKA 2O62A 3EM0A 4MVLA 3SAOA 5BVQA 2Q2PA 1GM6A 2RCTA 3BX7A 3EBWA 1QQSA 1YP6A 2F73A 4GJVA 4GNYA 2WQ9A 3O22A 1H91A 2ALLX 3VG7A 4TQ2A 4QGXA 1K24A 1NP4A 1SLDB 3CQRA 5D45A 1PEEA 3STNA 1O1VA 5FAZA 4ZGFA 1EIIA 2HZQA 4GJSA 1LCVA 4WHIA 1NP1A 1UZ2X 1RXKA 2X56A 5H9KA 3SZJA 4A8ZA 2Y3FA 5FQ8E 1SMPI 4FBVA 1JV4A 4BBOA 1QY2A 5C0NA 4ORXA 2KTDA 1BLRA 1SWJA 3G7XA 3VG3A 3VPJE 4OS3A 1MX8A 2OYBO 5D47A 1CBIA 4ORRA 1KOIA 1DZMA 3EMMA 4XMFA 5AQ6A 1I78A 1O1UA 4KT5A 2JOZA 2OVAA 4Y5DA 5F6BA 1BSYA 4O3ZA 3CBCA 1SWPA 3EBKA 2UZ2A 2VDFA 1VWBB 3C76X 3PH6A 3WJEA 3FA7A 1DF8A 5L3YA 3PEDA 1CJ5A 1MDCA 2WR6A 2G8CO 1D3SA 2L9CA 2OL6O 2W2BA 2YG2A 1OBQA 2X55A 2ZAGA 3ZUOA 1VWPB 5F6ZA 1IFCA 3KZAA 3O19A 5B27A 3RY1A 4ARHA 1E2TA 2W2AA 4M7MA 1ZNLA 1LIEA 2E4JA 4L3RA 3WJGA 3PP6A 1OEJA 1OPBA 3RDXA 4EXZA 1PBYA 3BS2A 1AVEA 2A0AA 2CZUA 4WBKA 4YFQA 1HXZA 3ELZA 2LA7A 1ADLA 4AZNA 3HWEA 4YFRA 2L5PA 4GK9A 2CAMA 1I4UA 5HWZA 1A2DA 5HZQA 5JD2A 3NBXX 5FQ7E 1AB0A 1T0VA 4L1NA 1SRFA 5IXGA 1OSPO 1CBRA 3P6FA 2ANSA 2GH7A 4IRWA 1SWDA 4ALBA 4CPEA 3ZW1A 1ALBA 1RAVA 2BSZA 3FIQA 5HTEA 1N0SA 3T6FA 1JBHA 1LKEA 1X71A 4IABA 2GJ5A 4HPCA 4OKAA 2AH7X 3HOLA 1X8OA 2G79A 2KD2A 3WVMA 1GKAB 4OS8A 4A1YA 4GKCA 2G7BA 3WXQA 4UU3A 4ORSA 2BS6A 1KL4A 3ZW0B 3RY2A 1GT4A 1LIBA 4GGZA 2CBRA 4QYPA 1P6PA 4ZR2A 3B2IA 1LUQA 1SWUA 2X8TA 5EPQA 3V8UA 1NQNA 1JJUA 4I95A 5H9LA 1LPJA 3FA6A 5EZ2A 5K06A 1VWEB 2ACOA 1NBXA 1JQPA 1B56A 2W2FA 2WPUA 4KIIA 4GNWA 3ZW1B 1BEBA 1HMTA 1QG5A 1T8VA 1A57A 1BBPA 4QGWA 3CWKA 1SRHA 1BRQA 2BS5A 2KT4B 2RTGB 2X45A 1QFVA 2DJFA 3F6ZB 3H3IA 1GGLA 3RE6A 3PDFA 2RCQA 4GH7A 2FS6A 2F01A 1ML7A 3VHMA 4MIRA 4Y59A 3BDRA 3MG5A 5HCEC 2IZKA 1OPAA 2A3FX 5HCCC 1KT4A 3NQ3A 2AKQA 1FEMA 4DQ3A 2QCBA 2X32A 4Y0QA 4EQAC 2OY7A 4ORUA 4ZHGA 4HFOA 1GX3A 1G74A 2FTBA 5F1EA 5IO6A 3CKGA 4NLIA 5CE4A 1OEEA 2F09A 1G7NA 4BX7A 4C5PA 1MEPA 3CKFA 3BU1A 3JS1A 3RSWA 3GE2A 2IZHB 3BX8A 1KT7A 4NLJA 4JNJA 4YGZA 4TLJA 1HQPA 4IMOA 1VWGB 4Z28A 2ZAIA 3SLOA 3U03A 1MX7A 3HK1A 3IFBA 1B8EA 4NYQA 3QKGA 5F2BA 1STSB 1LELA 1SWAA 3B2KA 4ES7A 1SWOA 4HPDA 1EPAA 3KFGA 2HLVA 1VPRA 1LF7A 3OD9A 4AZRA 4U46A 3NQ9A 3QQ2A 3OJYC 1VWOB 4NNSA 1SXXA 3RZYA 3SZIA 2PY1A 4QZUA 1JJJA 4ZHFA 1G5WA 4IMNA 5LJDA 2HKDA 3TGAA 4ALOA 1XKIA 2N93A 3Q34A 1DF3A 1ZNEA 2BT9A 5K67A 4NV7A 2EU7X 1SWCA 2RTOB 4DQ4A 1EW3A 2KW1A 5KIDA 3HTYA 3MVFA 3NPOA 1E00A 3KFHA 3FR5A 1VWCB 3HWFA 1KXOA 4JGLA 5FQ6E 3FMZA 3APUA 4O4XA 1OEKA 1CRBA 2ASNX 1HBQA 4LKTA 3S5VA 5FENA 1PTSA 1HY2A 3C78X 2OFBA 4GDZA 3I0AA 5B29A 4CK4A 4ZFXA 2K62A 4OELA 5EEEA 1S2PA 4IBAA 2AT5X 2IZEB 2WEWA 2FKGA 2IZJA 2MWHA 2QO6A 2FHLA 4O4OA 4YDBA 1VYGA 4ORWA 5CHKA 3TZSA 2JU7A 1JJXA 1ZRYA 2AMMX 2NNEA 4KC8A 2C1SA 3FYFA 1SLEB 4O4SA 3AEHA 1RLBE 2IZDB 3WZPA 1EUOA 4O4UA 3KFFA 3TGBA 4GZVA 5IO5A 1KL5A 2OFMX 3KVNA 1QY1A 4BGFA 2IZBA 3BY0A 1SWEA 3FA8A 4INNA 3WOVA 1SRJA 3WZQA 3WJCA 1Y52X 1YIVA 2CM4A 3NX1A 3RBYA 3ZQ3A 4OS0A 5L8OA 1S44A 4YH0A 4FQBB 4LKPA 5HA1A 1FENA 1Y9LA 5HZ6A 3P24A 1D2UA 2FHNX 5LJKA 4XMCA 1QY0A 2HYSA 3B2HA 3N91A 4B55A 1N7YA 1AVGI 5HBSA 3T2WA 4IB9A 5HAEA 2X8FA 2OF8A 3APXA 1E5PA 1I06A 2WEXA 1BJ7A 1VWFB 2OVDA 1LDOA 4GRJA 2WUTA 4PJ2A 4U3QA 2MJIA 2IZLB 4ML7B 1SRIA 3ZW2A 4GUZA 5D4AA 3EW1A 4U9CA 3TF6A 1LIFA 4LZVA 5F58A 4AZPA 3WJDA 4BCSA 1GT1A 1KZWA 2QOSC 3D9WA 1LCZA 3HWDA 3IA8A 1SWSA 1VWHB 3I17A 5EDCA 4I3DA 1VWNB 1VWMB 4N7DA 1KQWA 3U0DA 1B4MA 1GKAA 4IAXA 3PH5A 3ZZVA 2A5CA 1MVGA 2FGSA 3ZW0A 1KFFA 3AUMO 1X8NA 3SLTA 1MUPA 3FDCA 4GGTA 1ICNA 2RD7C 2FLJA 1VWKB 1I9HA 1SXYA 2RTRB 5AJCA 4BVMA 1IFBA 1KT3A 5F7GA 1EQDA 2OVEA 5H9AA 4CDCA 1ICMA 2IZAA 2OFAA 5LJHA 3OE3A 1B0OA 4AYHA 2QO4A 2C1QA 2FT9A 2IZIA 3B2JA 1N9YA 3UEWA 4TKBA 5D48A 2XSTA 2AT8X 3D4RA 1SLFB 3VHIA 4GD9A 4GETA 2QO5A 4PSQA 1YWCA 3B2LA 3KFIA 4Y0PA 5LKFA 3TGCA 2OY5O 3NADA 1HQQA 1RBPA 1N9MA 1PM1X 2A2UA 3VG2A 2X34A 3K3LA 4DNEA 1W4TA 1SXWA 2XKLA 3FEKA 3LTWA 1JYDA 4JHQA 3LHNA 1JYJA 3VG5A 2JW1A 4IAWA 5DPQA 1DZPA 3CBSA 4EKVA 2LBAA 4U8UN 1SWHA 1YUPA 1ZNKA 2WWPA 3APVA 1QFTA 2MO5A 2RTAA 3F9DA 1YWDA 3MM0A 2LBVA 3RWXA 1KZXA 4OMXA 1TOUA 2JU8A 4CPFA 4CPHA 3P02A 2A5BA 2I5VO 3DSZA 2BC3A 4O3YA 1TVQA 2OL8O 4HWMA 1KT6A 2MHDA 3PQUA 3UEXA 4AZOA 3Q6LA 5HZ5A 1MOYA 2IZCB 1I04A 2HMBA 1HXLA 2RTBB 1SY1A 3FR4A 2A2GA 4HPAA 3APWA 1IJ8A 1TXLA 1UYNX 1BSQA 3S26A 1AELA 1KGLA 4JO6A 1CBQA 1SWGA 3T1DA 3VHHA 5AEOA 4YFPA 5KICA 4AZQA 1VWRB 1IW2A 1E02A 4YMYA 4HPBA 2K23A 3LV4A 3WYPA 2PI3O 1E06A 1FELA 4R0BA 1HMSA 4Y0RA 5B11O 1EIOA 2HNXA 1VWDB 3UEUA 2I5ZO 1GXAA 1SRGA 1L6MA 1GX9A 4YCEA 3UAQA 3VE1A 4CPHB 4FBRA 2Z4IA 1X8UA 1O8VA 2DM5A 5IRUA 1SY2A 5IO7A 1AVDA 1STRB 5H9NA 2FKJA 1EXSA 4FGIB 4NP1A 4OEMA 1U18A 3FR2A 1DFVA 2A13A 4MISA 5HA0A 4LZUA 3BSZE 4CV7A 1ZNGA 4KCAA 4I6SA 4QYNA 2FRSA 5JR8A 5LKEA 2IZGB 4KC7A 4LQZA 3WZOA 4N7CA 4Z6JA 2RTPB 4Z2OA 4TKJA 1Y55X 1X8PA 2LKKA 2OL7A 2OY8A 1S7DA 3AKNA 3VG6A 1A18A 1VWIB 1WUBA 2L67A 3HPEA 1RXHA 4NW4A 2AT0X 3FW4A 1RSUB 3BLGA 1LFOA 1JZUA 2X4MA 2G5LA 4CSBA 2CZTA 3RE5A 5HZ8A 5HZ9A 1DZJA 3MX7A 4ZH9A 5EEDA 3PPTA 4EEJA 2VFBA 2RTHB 2VFCA 3SZHA 4CPIA 4M6SA 4ON1A 3RDQA 3EC5A 1DV9A 5B3MO 1DC9A 3PECA 4QQ1A 2JGSA 4ID2A 3OBLA 1VWLB 2RTJA 4YGGA 2OY1O 1YWBA 2RA6A 2Y3EA 3PK2A 4GDAA 2BLGA 4CDFA 4ZHHA 4RUNA 2OF9A 4I9SA 4U8UO 2CM9A 3HOEA 3FELA 3UEVA 2R74A 4AW8A 1HBPA 5IRAA 4QAEA 1MK5A 2JU3A 4ZCBA 5L8IA 4IB7A 1IKJA 5BVTA 1GX8A 2OVSA 5FFHA 4U8UM 1DZKA 1SY3A 3WZNA 2AT6X 1ZNDA 2MF6A 4WFUA 2AVIA 2GTLN 3O2YA 3P6DA 5K68A 4MVKA 1TOWA 2GTFX 3NP1A 5DG4A 1WBIA 4MVEA 2RTEB 1SREA 1JMZA 1VWAB 1W5RA 5CYBA 1BM5A 2BHVA 2RTIB 3SLJA 3VU1A 5L8NA 4O9SA 4GE1A 1XCAA 1SWFA 2ZSCA 3RKGA 5BYPA 1G85A 2R73A 4BJ8A 3CQNA 4RUUA 4NNTA 1Z24A 4A60A 3L4RA 2WSJA 3E3CA 1W6FA 1YWAA 3FA9A 2G78A 1Y0GA 4O3WA 3AKMA 3P6GA 3BRNA 1FDQA 4YCHA 1TW4A 3FIDA 4UU2A 1VYFA 4I9RA 1ACDA 1NC9A 3D95A 4FBOA 4BQUA 2QM9A 2DJGA 1LICA 4XMHA 5LJBA 2AL0X 4EFGA 1SWBA 3JQOA 4YKOA 5HTDA 2C4IA 1N4JA 2Q4NA 4GGRA 1X8QA 3SOTA 3P6CA 1LIDA 2RTKA 3STMX 2LFOA 4QRLA 3EYCA 4YDAA 1VYOA 1SWRA 4OMWA 3D97A 1JMXA 1VWQB 1Y9TA 1EALA 1K3BA 4I60A 1FTPA 1NQMA 2Q9SA 3BU9A 1IIUA 4A1HA 3WYQA 3P6EA 1YP7A 3RDMA 1GT5A 2A8GA 2YMSA 1X89A 1STPA 1SLGB 4ZH6A 3RDSA 2NP1A 4YKMA 4MEEA 1T68X 3JSQA 1SWQA 1KQXA 2LB6A 2X8SA 3NX2A 2NNDA 1FJ1E 3EW2A 4NV8A 5CSEA 1LDQA 3U9PC 1U0XA 4IB6A 4O49A 5IRWA 1MM9A 1N43A 3ZWEA 1IKEA 3DTQA 1ERBA 3ZI8A 2JN3A 1LNMA 3FEPA 1RXJA 4Z27A 4TJZA 3S60A 1BSOA 1OBPA 1SY0A 2WQAE 3FW5A 2L68A 4ODDA 1OBUA 5B10O 3S5XA 2FS7A 4CDDA 5AJBA 1Y53X 2RN4A 1FE3A 5D8JA 3VGWA 1KL3A 3X00A 4XMDA 1HMRA 5EDBA 4BOEA 4ZJ0A 1ZNHA 3WJFA 1EPBA 1PMPA 2Y32A 1JIWI 2POAA 2GTLO 4IB8A 2RTCB 4K19A 5B2AO 2P8GA 4XMGA 3RDOA 1SWTA 3PQSA 4ZHDA 3FLLA 4Z2VA 3F8AA 2OFRX 4I3CA 2RTMA 4QNIA 4YBPA 4WFVA 5KHPA 1RSTB 1UREA 2RQ0A 2FR2A 2GTLM 1QWDA 1BWYA 5BVSA 4YVBA 1AQBA 1I05A 4DCBA 4O3XB 2RTLA 2Q2MA 4BX6A 2RTFB 3WJBA 2FR3A 2CBSA 4D6BA 1NGLA 2R56A 4MVIA 1SXUA 1PBOA 3D96A 3C77X 1KT5A 2NNQA 4BX5A 5LJGA 4CDEA 1QABE 2KTSA 3FENA 3MBTA 4QZTA 5H8TA 3T2XA 4ZHCA 4Y0SA 3NQKA 4EDEA 2JMBA 2Q39A 3RDUA 1EI5A 2RTNB 4XMEA 1ERXA 2QOMA 2QMIA 2RTQB 1GT3A 2AF5A 2MM3A 1NDJA 1SWLA 1VWJB 2X46A 3CMPA 4ZGUA 5LJCA 2Z4HA 1SA8A 3HWGA 1CBSA 3CR6A 1SWKA 3KQ0A 3ZUIA 4TNNA 3GAQA 4TKHA 4BX6B 3WBGA 4AZMA 2AT3X 2FWVA 1BRPA 5B5FA 2M4LA 5LJEA 4Z2PA 3VG4A 4KH8A 3ELXA 2IZFB 4ORYA 4BX5B 2ACPX 3VE2A 4QGVA 5HCDC 1HN2A 2RTDB 4I3BA 4YBUA 4NYRA 3NR3A 4GU8A 2GC9A 3P6HA 3T6LA 2HZRA 2IFBA 1A3YA 1R0UA
chains in the Genus database with same CATH topology
1U17A 4D6AA 4COTA 2OZQA 4YGHA 3STKA 2O62A 3EM0A 4MVLA 3SAOA 5BVQA 2Q2PA 1GM6A 2RCTA 3BX7A 3EBWA 1QQSA 1YP6A 2F73A 4GNYA 2WQ9A 3O22A 1H91A 2ALLX 3VG7A 4TQ2A 4QGXA 1NP4A 1PEEA 3CQRA 5D45A 4ZGFA 1EIIA 1O1VA 5FAZA 2HZQA 4WHIA 1NP1A 1UZ2X 4A8ZA 5H9KA 5FQ8E 1SMPI 4FBVA 1JV4A 1QY2A 5C0NA 4ORXA 2KTDA 1BLRA 3G7XA 3VG3A 3VPJE 4OS3A 1MX8A 5D47A 1CBIA 4ORRA 1KOIA 1DZMA 3EMMA 4XMFA 5AQ6A 1O1UA 4KT5A 2JOZA 2OVAA 5F6BA 1BSYA 4O3ZA 3CBCA 3EBKA 3C76X 3PH6A 3WJEA 3FA7A 3PEDA 1CJ5A 1MDCA 2WR6A 1D3SA 2L9CA 2W2BA 2YG2A 1OBQA 2ZAGA 3ZUOA 5F6ZA 1IFCA 3KZAA 3O19A 5B27A 4ARHA 2W2AA 4M7MA 1ZNLA 1LIEA 2E4JA 4L3RA 3WJGA 3PP6A 1OEJA 1OPBA 4EXZA 3BS2A 2A0AA 2CZUA 4WBKA 4YFQA 3ELZA 2LA7A 1ADLA 4AZNA 3HWEA 4YFRA 2L5PA 4GK9A 1I4UA 5HWZA 1A2DA 5HZQA 3NBXX 5FQ7E 1AB0A 1T0VA 4L1NA 3P6FA 1CBRA 4ALBA 2ANSA 3ZW1A 1ALBA 3FIQA 5HTEA 1N0SA 1JBHA 1LKEA 1X71A 4IABA 2GJ5A 4HPCA 2AH7X 3HOLA 1X8OA 2G79A 2KD2A 3WVMA 1GKAB 4OS8A 4A1YA 4GKCA 2G7BA 3WXQA 4UU3A 4ORSA 2BS6A 3ZW0B 1GT4A 1LIBA 2CBRA 4QYPA 1P6PA 4ZR2A 3B2IA 2X8TA 5EPQA 3V8UA 4I95A 5H9LA 1LPJA 3FA6A 5EZ2A 5K06A 2ACOA 1B56A 2W2FA 4KIIA 4GNWA 3ZW1B 1BEBA 1HMTA 1QG5A 1T8VA 1BBPA 4QGWA 3CWKA 2KT4B 1BRQA 2BS5A 2X45A 3F6ZB 3H3IA 1QFVA 1GGLA 2RCQA 4GH7A 2FS6A 1ML7A 4MIRA 3BDRA 5HCEC 1OPAA 2A3FX 5HCCC 1KT4A 3NQ3A 2AKQA 1FEMA 4DQ3A 4EQAC 4Y0QA 4ORUA 4ZHGA 4HFOA 1G74A 2FTBA 5F1EA 5IO6A 5CE4A 4NLIA 1OEEA 2F09A 1G7NA 3JS1A 3BU1A 3RSWA 3GE2A 4NLJA 3BX8A 1KT7A 4YGZA 3STNA 4TLJA 1HQPA 4IMOA 2ZAIA 3U03A 1MX7A 3HK1A 3IFBA 1B8EA 4NYQA 3QKGA 3B2KA 4ES7A 4HPDA 1EPAA 3KFGA 2HLVA 1VPRA 1LF7A 3OD9A 4AZRA 3NQ9A 3OJYC 4NNSA 3RZYA 1SXXA 2PY1A 4QZUA 1JJJA 4ZHFA 1G5WA 4IMNA 5LJDA 3TGAA 4ALOA 1XKIA 2N93A 1DF3A 1ZNEA 2BT9A 2EU7X 4DQ4A 1EW3A 2KW1A 5KIDA 3HTYA 3MVFA 3NPOA 1E00A 3KFHA 3FR5A 3HWFA 4JGLA 1KXOA 5FQ6E 3FMZA 3APUA 4O4XA 1OEKA 1CRBA 2ASNX 1HBQA 4LKTA 3S5VA 5FENA 3C78X 4GDZA 3I0AA 5B29A 4CK4A 4ZFXA 2K62A 5EEEA 1S2PA 4IBAA 2AT5X 2WEWA 2QO6A 4O4OA 2MWHA 4YDBA 1JJXA 1VYGA 4ORWA 3TZSA 2JU7A 1ZRYA 2AMMX 2NNEA 4KC8A 3FYFA 4O4SA 1RLBE 1EUOA 4O4UA 3KFFA 3TGBA 4GZVA 5IO5A 2OFMX 1QY1A 3BY0A 4INNA 3FA8A 3WOVA 3WJCA 3NX1A 1YIVA 2CM4A 3RBYA 3ZQ3A 4OS0A 5L8OA 1S44A 4YH0A 4FQBB 4LKPA 5HA1A 1FENA 1Y9LA 5HZ6A 3P24A 1D2UA 5LJKA 4XMCA 1QY0A 2HYSA 3B2HA 3N91A 1AVGI 5HBSA 4IB9A 5HAEA 2X8FA 3APXA 1E5PA 1I06A 2WEXA 1BJ7A 4GRJA 2OVDA 4U3QA 2WUTA 4PJ2A 2MJIA 4ML7B 3ZW2A 5D4AA 3TF6A 4U9CA 1LIFA 4LZVA 5F58A 4AZPA 3WJDA 1GT1A 1KZWA 2QOSC 3HWDA 3IA8A 5EDCA 3I17A 4I3DA 3U0DA 4N7DA 1KQWA 1B4MA 1GKAA 4IAXA 3PH5A 3ZZVA 1MVGA 3ZW0A 1X8NA 1MUPA 1ICNA 2RD7C 2FLJA 1SXYA 5AJCA 4BVMA 1IFBA 1KT3A 5F7GA 1EQDA 2OVEA 5H9AA 1ICMA 5LJHA 3OE3A 1B0OA 4AYHA 2QO4A 2FT9A 3B2JA 3UEWA 4TKBA 5D48A 2XSTA 2AT8X 3D4RA 4GETA 2QO5A 4PSQA 1YWCA 3B2LA 3KFIA 4Y0PA 5LKFA 3TGCA 3NADA 1RBPA 1PM1X 2A2UA 3VG2A 3K3LA 2XKLA 1SXWA 3FEKA 1JYDA 3LHNA 1JYJA 3VG5A 2JW1A 4IAWA 5DPQA 1DZPA 3CBSA 2LBAA 4U8UN 1YUPA 1ZNKA 2WWPA 3APVA 1QFTA 2MO5A 3F9DA 1YWDA 2LBVA 3RWXA 1KZXA 4OMXA 1TOUA 2JU8A 3P02A 3DSZA 4O3YA 1TVQA 3UEXA 4HWMA 1KT6A 2MHDA 3PQUA 4AZOA 3Q6LA 5HZ5A 1I04A 2HMBA 3FR4A 4HPAA 1SY1A 2A2GA 3APWA 1TXLA 1AELA 1BSQA 3S26A 1KGLA 1CBQA 3T1DA 5AEOA 4YFPA 5KICA 4AZQA 4YMYA 1IW2A 1E02A 4HPBA 2K23A 3LV4A 1E06A 1FELA 4R0BA 1HMSA 4Y0RA 1EIOA 2HNXA 3UEUA 1GXAA 3VE1A 1L6MA 1GX9A 4YCEA 3UAQA 4FBRA 2Z4IA 1X8UA 1O8VA 2DM5A 1SY2A 5IO7A 5H9NA 1EXSA 4FGIB 4NP1A 1U18A 3FR2A 1DFVA 2A13A 4MISA 5HA0A 4LZUA 3BSZE 4CV7A 1ZNGA 4KCAA 4I6SA 4QYNA 2FRSA 5JR8A 5LKEA 4KC7A 4LQZA 4N7CA 4TKJA 1X8PA 2LKKA 3AKNA 1S7DA 3VG6A 1A18A 2L67A 4NW4A 2AT0X 3FW4A 3BLGA 1LFOA 1JZUA 4CSBA 2CZTA 5HZ8A 5HZ9A 1DZJA 3MX7A 4ZH9A 5EEDA 3PPTA 4EEJA 4M6SA 4ON1A 1DV9A 1DC9A 3PECA 4QQ1A 4ID2A 3OBLA 4YGGA 4ZHHA 1YWBA 2RA6A 2BLGA 4RUNA 4I9SA 4U8UO 2CM9A 3HOEA 3FELA 3UEVA 2R74A 4AW8A 1HBPA 5L8IA 4QAEA 2JU3A 4ZCBA 4IB7A 1IKJA 5BVTA 1GX8A 2OVSA 5FFHA 4U8UM 1DZKA 1SY3A 2AT6X 1ZNDA 4WFUA 2GTLN 3O2YA 3P6DA 4MVKA 1TOWA 2GTFX 3NP1A 5DG4A 4MVEA 5CYBA 1BM5A 2BHVA 5L8NA 3VU1A 4O9SA 4GE1A 1XCAA 3RKGA 5BYPA 1G85A 2R73A 3CQNA 4RUUA 4NNTA 1Z24A 4A60A 3L4RA 2WSJA 3E3CA 1YWAA 3FA9A 2G78A 4O3WA 3AKMA 3P6GA 3BRNA 1FDQA 4YCHA 1TW4A 4UU2A 1VYFA 4I9RA 1ACDA 3D95A 4FBOA 4BQUA 2QM9A 1LICA 4XMHA 5LJBA 2AL0X 4EFGA 3JQOA 4YKOA 5HTDA 2Q4NA 1X8QA 3SOTA 3P6CA 1LIDA 3STMX 2LFOA 4QRLA 3EYCA 4YDAA 4OMWA 3D97A 1Y9TA 1EALA 1FTPA 2Q9SA 3BU9A 1IIUA 4A1HA 3P6EA 1YP7A 1GT5A 2YMSA 1X89A 4ZH6A 2NP1A 4YKMA 1T68X 3JSQA 2LB6A 1KQXA 2X8SA 3NX2A 2NNDA 3U9PC 1U0XA 4IB6A 4O49A 3ZWEA 1IKEA 3DTQA 1ERBA 3ZI8A 2JN3A 1LNMA 3FEPA 4TJZA 3S60A 1BSOA 1OBPA 1SY0A 2WQAE 3FW5A 2L68A 4ODDA 1OBUA 3S5XA 2FS7A 5AJBA 2RN4A 1A57A 1FE3A 5D8JA 4BOEA 4XMDA 1HMRA 5EDBA 4ZJ0A 1ZNHA 3WJFA 1EPBA 1PMPA 4IB8A 1JIWI 2POAA 2GTLO 4K19A 4ZHDA 2P8GA 4XMGA 3PQSA 3FLLA 3F8AA 2OFRX 4I3CA 4QNIA 4YBPA 4WFVA 5KHPA 1UREA 2RQ0A 2FR2A 2GTLM 1QWDA 1BWYA 5BVSA 1AQBA 1I05A 4O3XB 2Q2MA 3WJBA 2FR3A 2CBSA 4D6BA 1NGLA 2R56A 4MVIA 1SXUA 1PBOA 3D96A 3C77X 1KT5A 2NNQA 5LJGA 1QABE 2KTSA 3FENA 3MBTA 4QZTA 5H8TA 4ZHCA 4Y0SA 3NQKA 4EDEA 2JMBA 2Q39A 1EI5A 4XMEA 1ERXA 2QMIA 1GT3A 2X46A 2MM3A 3CMPA 5LJCA 4ZGUA 2Z4HA 1SA8A 3HWGA 1CBSA 3CR6A 3KQ0A 3ZUIA 4TNNA 3GAQA 4TKHA 3WBGA 4AZMA 2AT3X 2FWVA 1BRPA 2M4LA 5LJEA 3VG4A 4KH8A 3ELXA 4ORYA 5HCDC 2ACPX 3VE2A 4QGVA 1HN2A 4I3BA 4YBUA 4NYRA 3NR3A 4GU8A 2GC9A 3P6HA 2HZRA 2IFBA 1A3YA 1R0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AEO A;  4CV7 A;  4CSB A; 
#chains in the Genus database with same CATH topology
 2UYW A;  1U17 A;  4D6A A;  4BX7 B;  5B5G A;  4COT A;  1LCW A;  1UYO X;  2OZQ A;  4YGH A;  1SWN A;  3STK A;  2O62 A;  3EM0 A;  4MVL A;  3SAO A;  5BVQ A;  2Q2P A;  1GM6 A;  2RCT A;  3BX7 A;  3EBW A;  1QQS A;  1YP6 A;  2F73 A;  4GJV A;  4GNY A;  2WQ9 A;  3O22 A;  1H91 A;  2ALL X;  3VG7 A;  4TQ2 A;  4QGX A;  1K24 A;  1NP4 A;  1SLD B;  3CQR A;  5D45 A;  1PEE A;  3STN A;  1O1V A;  5FAZ A;  4ZGF A;  1EII A;  2HZQ A;  4GJS A;  1LCV A;  4WHI A;  1NP1 A;  1UZ2 X;  1RXK A;  2X56 A;  5H9K A;  3SZJ A;  4A8Z A;  2Y3F A;  5FQ8 E;  1SMP I;  4FBV A;  1JV4 A;  4BBO A;  1QY2 A;  5C0N A;  4ORX A;  2KTD A;  1BLR A;  1SWJ A;  3G7X A;  3VG3 A;  3VPJ E;  4OS3 A;  1MX8 A;  2OYB O;  5D47 A;  1CBI A;  4ORR A;  1KOI A;  1DZM A;  3EMM A;  4XMF A;  5AQ6 A;  1I78 A;  1O1U A;  4KT5 A;  2JOZ A;  2OVA A;  4Y5D A;  5F6B A;  1BSY A;  4O3Z A;  3CBC A;  1SWP A;  3EBK A;  2UZ2 A;  2VDF A;  1VWB B;  3C76 X;  3PH6 A;  3WJE A;  3FA7 A;  1DF8 A;  5L3Y A;  3PED A;  1CJ5 A;  1MDC A;  2WR6 A;  2G8C O;  1D3S A;  2L9C A;  2OL6 O;  2W2B A;  2YG2 A;  1OBQ A;  2X55 A;  2ZAG A;  3ZUO A;  1VWP B;  5F6Z A;  1IFC A;  3KZA A;  3O19 A;  5B27 A;  3RY1 A;  4ARH A;  1E2T A;  2W2A A;  4M7M A;  1ZNL A;  1LIE A;  2E4J A;  4L3R A;  3WJG A;  3PP6 A;  1OEJ A;  1OPB A;  3RDX A;  4EXZ A;  1PBY A;  3BS2 A;  1AVE A;  2A0A A;  2CZU A;  4WBK A;  4YFQ A;  1HXZ A;  3ELZ A;  2LA7 A;  1ADL A;  4AZN A;  3HWE A;  4YFR A;  2L5P A;  4GK9 A;  2CAM A;  1I4U A;  5HWZ A;  1A2D A;  5HZQ A;  5JD2 A;  3NBX X;  5FQ7 E;  1AB0 A;  1T0V A;  4L1N A;  1SRF A;  5IXG A;  1OSP O;  1CBR A;  3P6F A;  2ANS A;  2GH7 A;  4IRW A;  1SWD A;  4ALB A;  4CPE A;  3ZW1 A;  1ALB A;  1RAV A;  2BSZ A;  3FIQ A;  5HTE A;  1N0S A;  3T6F A;  1JBH A;  1LKE A;  1X71 A;  4IAB A;  2GJ5 A;  4HPC A;  4OKA A;  2AH7 X;  3HOL A;  1X8O A;  2G79 A;  2KD2 A;  3WVM A;  1GKA B;  4OS8 A;  4A1Y A;  4GKC A;  2G7B A;  3WXQ A;  4UU3 A;  4ORS A;  2BS6 A;  1KL4 A;  3ZW0 B;  3RY2 A;  1GT4 A;  1LIB A;  4GGZ A;  2CBR A;  4QYP A;  1P6P A;  4ZR2 A;  3B2I A;  1LUQ A;  1SWU A;  2X8T A;  5EPQ A;  3V8U A;  1NQN A;  1JJU A;  4I95 A;  5H9L A;  1LPJ A;  3FA6 A;  5EZ2 A;  5K06 A;  1VWE B;  2ACO A;  1NBX A;  1JQP A;  1B56 A;  2W2F A;  2WPU A;  4KII A;  4GNW A;  3ZW1 B;  1BEB A;  1HMT A;  1QG5 A;  1T8V A;  1A57 A;  1BBP A;  4QGW A;  3CWK A;  1SRH A;  1BRQ A;  2BS5 A;  2KT4 B;  2RTG B;  2X45 A;  1QFV A;  2DJF A;  3F6Z B;  3H3I A;  1GGL A;  3RE6 A;  3PDF A;  2RCQ A;  4GH7 A;  2FS6 A;  2F01 A;  1ML7 A;  3VHM A;  4MIR A;  4Y59 A;  3BDR A;  3MG5 A;  5HCE C;  2IZK A;  1OPA A;  2A3F X;  5HCC C;  1KT4 A;  3NQ3 A;  2AKQ A;  1FEM A;  4DQ3 A;  2QCB A;  2X32 A;  4Y0Q A;  4EQA C;  2OY7 A;  4ORU A;  4ZHG A;  4HFO A;  1GX3 A;  1G74 A;  2FTB A;  5F1E A;  5IO6 A;  3CKG A;  4NLI A;  5CE4 A;  1OEE A;  2F09 A;  1G7N A;  4BX7 A;  4C5P A;  1MEP A;  3CKF A;  3BU1 A;  3JS1 A;  3RSW A;  3GE2 A;  2IZH B;  3BX8 A;  1KT7 A;  4NLJ A;  4JNJ A;  4YGZ A;  4TLJ A;  1HQP A;  4IMO A;  1VWG B;  4Z28 A;  2ZAI A;  3SLO A;  3U03 A;  1MX7 A;  3HK1 A;  3IFB A;  1B8E A;  4NYQ A;  3QKG A;  5F2B A;  1STS B;  1LEL A;  1SWA A;  3B2K A;  4ES7 A;  1SWO A;  4HPD A;  1EPA A;  3KFG A;  2HLV A;  1VPR A;  1LF7 A;  3OD9 A;  4AZR A;  4U46 A;  3NQ9 A;  3QQ2 A;  3OJY C;  1VWO B;  4NNS A;  1SXX A;  3RZY A;  3SZI A;  2PY1 A;  4QZU A;  1JJJ A;  4ZHF A;  1G5W A;  4IMN A;  5LJD A;  2HKD A;  3TGA A;  4ALO A;  1XKI A;  2N93 A;  3Q34 A;  1DF3 A;  1ZNE A;  2BT9 A;  5K67 A;  4NV7 A;  2EU7 X;  1SWC A;  2RTO B;  4DQ4 A;  1EW3 A;  2KW1 A;  5KID A;  3HTY A;  3MVF A;  3NPO A;  1E00 A;  3KFH A;  3FR5 A;  1VWC B;  3HWF A;  1KXO A;  4JGL A;  5FQ6 E;  3FMZ A;  3APU A;  4O4X A;  1OEK A;  1CRB A;  2ASN X;  1HBQ A;  4LKT A;  3S5V A;  5FEN A;  1PTS A;  1HY2 A;  3C78 X;  2OFB A;  4GDZ A;  3I0A A;  5B29 A;  4CK4 A;  4ZFX A;  2K62 A;  4OEL A;  5EEE A;  1S2P A;  4IBA A;  2AT5 X;  2IZE B;  2WEW A;  2FKG A;  2IZJ A;  2MWH A;  2QO6 A;  2FHL A;  4O4O A;  4YDB A;  1VYG A;  4ORW A;  5CHK A;  3TZS A;  2JU7 A;  1JJX A;  1ZRY A;  2AMM X;  2NNE A;  4KC8 A;  2C1S A;  3FYF A;  1SLE B;  4O4S A;  3AEH A;  1RLB E;  2IZD B;  3WZP A;  1EUO A;  4O4U A;  3KFF A;  3TGB A;  4GZV A;  5IO5 A;  1KL5 A;  2OFM X;  3KVN A;  1QY1 A;  4BGF A;  2IZB A;  3BY0 A;  1SWE A;  3FA8 A;  4INN A;  3WOV A;  1SRJ A;  3WZQ A;  3WJC A;  1Y52 X;  1YIV A;  2CM4 A;  3NX1 A;  3RBY A;  3ZQ3 A;  4OS0 A;  5L8O A;  1S44 A;  4YH0 A;  4FQB B;  4LKP A;  5HA1 A;  1FEN A;  1Y9L A;  5HZ6 A;  3P24 A;  1D2U A;  2FHN X;  5LJK A;  4XMC A;  1QY0 A;  2HYS A;  3B2H A;  3N91 A;  4B55 A;  1N7Y A;  1AVG I;  5HBS A;  3T2W A;  4IB9 A;  5HAE A;  2X8F A;  2OF8 A;  3APX A;  1E5P A;  1I06 A;  2WEX A;  1BJ7 A;  1VWF B;  2OVD A;  1LDO A;  4GRJ A;  2WUT A;  4PJ2 A;  4U3Q A;  2MJI A;  2IZL B;  4ML7 B;  1SRI A;  3ZW2 A;  4GUZ A;  5D4A A;  3EW1 A;  4U9C A;  3TF6 A;  1LIF A;  4LZV A;  5F58 A;  4AZP A;  3WJD A;  4BCS A;  1GT1 A;  1KZW A;  2QOS C;  3D9W A;  1LCZ A;  3HWD A;  3IA8 A;  1SWS A;  1VWH B;  3I17 A;  5EDC A;  4I3D A;  1VWN B;  1VWM B;  4N7D A;  1KQW A;  3U0D A;  1B4M A;  1GKA A;  4IAX A;  3PH5 A;  3ZZV A;  2A5C A;  1MVG A;  2FGS A;  3ZW0 A;  1KFF A;  3AUM O;  1X8N A;  3SLT A;  1MUP A;  3FDC A;  4GGT A;  1ICN A;  2RD7 C;  2FLJ A;  1VWK B;  1I9H A;  1SXY A;  2RTR B;  5AJC A;  4BVM A;  1IFB A;  1KT3 A;  5F7G A;  1EQD A;  2OVE A;  5H9A A;  4CDC A;  1ICM A;  2IZA A;  2OFA A;  5LJH A;  3OE3 A;  1B0O A;  4AYH A;  2QO4 A;  2C1Q A;  2FT9 A;  2IZI A;  3B2J A;  1N9Y A;  3UEW A;  4TKB A;  5D48 A;  2XST A;  2AT8 X;  3D4R A;  1SLF B;  3VHI A;  4GD9 A;  4GET A;  2QO5 A;  4PSQ A;  1YWC A;  3B2L A;  3KFI A;  4Y0P A;  5LKF A;  3TGC A;  2OY5 O;  3NAD A;  1HQQ A;  1RBP A;  1N9M A;  1PM1 X;  2A2U A;  3VG2 A;  2X34 A;  3K3L A;  4DNE A;  1W4T A;  1SXW A;  2XKL A;  3FEK A;  3LTW A;  1JYD A;  4JHQ A;  3LHN A;  1JYJ A;  3VG5 A;  2JW1 A;  4IAW A;  5DPQ A;  1DZP A;  3CBS A;  4EKV A;  2LBA A;  4U8U N;  1SWH A;  1YUP A;  1ZNK A;  2WWP A;  3APV A;  1QFT A;  2MO5 A;  2RTA A;  3F9D A;  1YWD A;  3MM0 A;  2LBV A;  3RWX A;  1KZX A;  4OMX A;  1TOU A;  2JU8 A;  4CPF A;  4CPH A;  3P02 A;  2A5B A;  2I5V O;  3DSZ A;  2BC3 A;  4O3Y A;  1TVQ A;  2OL8 O;  4HWM A;  1KT6 A;  2MHD A;  3PQU A;  3UEX A;  4AZO A;  3Q6L A;  5HZ5 A;  1MOY A;  2IZC B;  1I04 A;  2HMB A;  1HXL A;  2RTB B;  1SY1 A;  3FR4 A;  2A2G A;  4HPA A;  3APW A;  1IJ8 A;  1TXL A;  1UYN X;  1BSQ A;  3S26 A;  1AEL A;  1KGL A;  4JO6 A;  1CBQ A;  1SWG A;  3T1D A;  3VHH A;  5AEO A;  4YFP A;  5KIC A;  4AZQ A;  1VWR B;  1IW2 A;  1E02 A;  4YMY A;  4HPB A;  2K23 A;  3LV4 A;  3WYP A;  2PI3 O;  1E06 A;  1FEL A;  4R0B A;  1HMS A;  4Y0R A;  5B11 O;  1EIO A;  2HNX A;  1VWD B;  3UEU A;  2I5Z O;  1GXA A;  1SRG A;  1L6M A;  1GX9 A;  4YCE A;  3UAQ A;  3VE1 A;  4CPH B;  4FBR A;  2Z4I A;  1X8U A;  1O8V A;  2DM5 A;  5IRU A;  1SY2 A;  5IO7 A;  1AVD A;  1STR B;  5H9N A;  2FKJ A;  1EXS A;  4FGI B;  4NP1 A;  4OEM A;  1U18 A;  3FR2 A;  1DFV A;  2A13 A;  4MIS A;  5HA0 A;  4LZU A;  3BSZ E;  4CV7 A;  1ZNG A;  4KCA A;  4I6S A;  4QYN A;  2FRS A;  5JR8 A;  5LKE A;  2IZG B;  4KC7 A;  4LQZ A;  3WZO A;  4N7C A;  4Z6J A;  2RTP B;  4Z2O A;  4TKJ A;  1Y55 X;  1X8P A;  2LKK A;  2OL7 A;  2OY8 A;  1S7D A;  3AKN A;  3VG6 A;  1A18 A;  1VWI B;  1WUB A;  2L67 A;  3HPE A;  1RXH A;  4NW4 A;  2AT0 X;  3FW4 A;  1RSU B;  3BLG A;  1LFO A;  1JZU A;  2X4M A;  2G5L A;  4CSB A;  2CZT A;  3RE5 A;  5HZ8 A;  5HZ9 A;  1DZJ A;  3MX7 A;  4ZH9 A;  5EED A;  3PPT A;  4EEJ A;  2VFB A;  2RTH B;  2VFC A;  3SZH A;  4CPI A;  4M6S A;  4ON1 A;  3RDQ A;  3EC5 A;  1DV9 A;  5B3M O;  1DC9 A;  3PEC A;  4QQ1 A;  2JGS A;  4ID2 A;  3OBL A;  1VWL B;  2RTJ A;  4YGG A;  2OY1 O;  1YWB A;  2RA6 A;  2Y3E A;  3PK2 A;  4GDA A;  2BLG A;  4CDF A;  4ZHH A;  4RUN A;  2OF9 A;  4I9S A;  4U8U O;  2CM9 A;  3HOE A;  3FEL A;  3UEV A;  2R74 A;  4AW8 A;  1HBP A;  5IRA A;  4QAE A;  1MK5 A;  2JU3 A;  4ZCB A;  5L8I A;  4IB7 A;  1IKJ A;  5BVT A;  1GX8 A;  2OVS A;  5FFH A;  4U8U M;  1DZK A;  1SY3 A;  3WZN A;  2AT6 X;  1ZND A;  2MF6 A;  4WFU A;  2AVI A;  2GTL N;  3O2Y A;  3P6D A;  5K68 A;  4MVK A;  1TOW A;  2GTF X;  3NP1 A;  5DG4 A;  1WBI A;  4MVE A;  2RTE B;  1SRE A;  1JMZ A;  1VWA B;  1W5R A;  5CYB A;  1BM5 A;  2BHV A;  2RTI B;  3SLJ A;  3VU1 A;  5L8N A;  4O9S A;  4GE1 A;  1XCA A;  1SWF A;  2ZSC A;  3RKG A;  5BYP A;  1G85 A;  2R73 A;  4BJ8 A;  3CQN A;  4RUU A;  4NNT A;  1Z24 A;  4A60 A;  3L4R A;  2WSJ A;  3E3C A;  1W6F A;  1YWA A;  3FA9 A;  2G78 A;  1Y0G A;  4O3W A;  3AKM A;  3P6G A;  3BRN A;  1FDQ A;  4YCH A;  1TW4 A;  3FID A;  4UU2 A;  1VYF A;  4I9R A;  1ACD A;  1NC9 A;  3D95 A;  4FBO A;  4BQU A;  2QM9 A;  2DJG A;  1LIC A;  4XMH A;  5LJB A;  2AL0 X;  4EFG A;  1SWB A;  3JQO A;  4YKO A;  5HTD A;  2C4I A;  1N4J A;  2Q4N A;  4GGR A;  1X8Q A;  3SOT A;  3P6C A;  1LID A;  2RTK A;  3STM X;  2LFO A;  4QRL A;  3EYC A;  4YDA A;  1VYO A;  1SWR A;  4OMW A;  3D97 A;  1JMX A;  1VWQ B;  1Y9T A;  1EAL A;  1K3B A;  4I60 A;  1FTP A;  1NQM A;  2Q9S A;  3BU9 A;  1IIU A;  4A1H A;  3WYQ A;  3P6E A;  1YP7 A;  3RDM A;  1GT5 A;  2A8G A;  2YMS A;  1X89 A;  1STP A;  1SLG B;  4ZH6 A;  3RDS A;  2NP1 A;  4YKM A;  4MEE A;  1T68 X;  3JSQ A;  1SWQ A;  1KQX A;  2LB6 A;  2X8S A;  3NX2 A;  2NND A;  1FJ1 E;  3EW2 A;  4NV8 A;  5CSE A;  1LDQ A;  3U9P C;  1U0X A;  4IB6 A;  4O49 A;  5IRW A;  1MM9 A;  1N43 A;  3ZWE A;  1IKE A;  3DTQ A;  1ERB A;  3ZI8 A;  2JN3 A;  1LNM A;  3FEP A;  1RXJ A;  4Z27 A;  4TJZ A;  3S60 A;  1BSO A;  1OBP A;  1SY0 A;  2WQA E;  3FW5 A;  2L68 A;  4ODD A;  1OBU A;  5B10 O;  3S5X A;  2FS7 A;  4CDD A;  5AJB A;  1Y53 X;  2RN4 A;  1FE3 A;  5D8J A;  3VGW A;  1KL3 A;  3X00 A;  4XMD A;  1HMR A;  5EDB A;  4BOE A;  4ZJ0 A;  1ZNH A;  3WJF A;  1EPB A;  1PMP A;  2Y32 A;  1JIW I;  2POA A;  2GTL O;  4IB8 A;  2RTC B;  4K19 A;  5B2A O;  2P8G A;  4XMG A;  3RDO A;  1SWT A;  3PQS A;  4ZHD A;  3FLL A;  4Z2V A;  3F8A A;  2OFR X;  4I3C A;  2RTM A;  4QNI A;  4YBP A;  4WFV A;  5KHP A;  1RST B;  1URE A;  2RQ0 A;  2FR2 A;  2GTL M;  1QWD A;  1BWY A;  5BVS A;  4YVB A;  1AQB A;  1I05 A;  4DCB A;  4O3X B;  2RTL A;  2Q2M A;  4BX6 A;  2RTF B;  3WJB A;  2FR3 A;  2CBS A;  4D6B A;  1NGL A;  2R56 A;  4MVI A;  1SXU A;  1PBO A;  3D96 A;  3C77 X;  1KT5 A;  2NNQ A;  4BX5 A;  5LJG A;  4CDE A;  1QAB E;  2KTS A;  3FEN A;  3MBT A;  4QZT A;  5H8T A;  3T2X A;  4ZHC A;  4Y0S A;  3NQK A;  4EDE A;  2JMB A;  2Q39 A;  3RDU A;  1EI5 A;  2RTN B;  4XME A;  1ERX A;  2QOM A;  2QMI A;  2RTQ B;  1GT3 A;  2AF5 A;  2MM3 A;  1NDJ A;  1SWL A;  1VWJ B;  2X46 A;  3CMP A;  4ZGU A;  5LJC A;  2Z4H A;  1SA8 A;  3HWG A;  1CBS A;  3CR6 A;  1SWK A;  3KQ0 A;  3ZUI A;  4TNN A;  3GAQ A;  4TKH A;  4BX6 B;  3WBG A;  4AZM A;  2AT3 X;  2FWV A;  1BRP A;  5B5F A;  2M4L A;  5LJE A;  4Z2P A;  3VG4 A;  4KH8 A;  3ELX A;  2IZF B;  4ORY A;  4BX5 B;  2ACP X;  3VE2 A;  4QGV A;  5HCD C;  1HN2 A;  2RTD B;  4I3B A;  4YBU A;  4NYR A;  3NR3 A;  4GU8 A;  2GC9 A;  3P6H A;  3T6L A;  2HZR A;  2IFB A;  1A3Y A;  1R0U A; 
#chains in the Genus database with same CATH homology
 1U17 A;  4D6A A;  4COT A;  2OZQ A;  4YGH A;  3STK A;  2O62 A;  3EM0 A;  4MVL A;  3SAO A;  5BVQ A;  2Q2P A;  1GM6 A;  2RCT A;  3BX7 A;  3EBW A;  1QQS A;  1YP6 A;  2F73 A;  4GNY A;  2WQ9 A;  3O22 A;  1H91 A;  2ALL X;  3VG7 A;  4TQ2 A;  4QGX A;  1NP4 A;  1PEE A;  3CQR A;  5D45 A;  4ZGF A;  1EII A;  1O1V A;  5FAZ A;  2HZQ A;  4WHI A;  1NP1 A;  1UZ2 X;  4A8Z A;  5H9K A;  5FQ8 E;  1SMP I;  4FBV A;  1JV4 A;  1QY2 A;  5C0N A;  4ORX A;  2KTD A;  1BLR A;  3G7X A;  3VG3 A;  3VPJ E;  4OS3 A;  1MX8 A;  5D47 A;  1CBI A;  4ORR A;  1KOI A;  1DZM A;  3EMM A;  4XMF A;  5AQ6 A;  1O1U A;  4KT5 A;  2JOZ A;  2OVA A;  5F6B A;  1BSY A;  4O3Z A;  3CBC A;  3EBK A;  3C76 X;  3PH6 A;  3WJE A;  3FA7 A;  3PED A;  1CJ5 A;  1MDC A;  2WR6 A;  1D3S A;  2L9C A;  2W2B A;  2YG2 A;  1OBQ A;  2ZAG A;  3ZUO A;  5F6Z A;  1IFC A;  3KZA A;  3O19 A;  5B27 A;  4ARH A;  2W2A A;  4M7M A;  1ZNL A;  1LIE A;  2E4J A;  4L3R A;  3WJG A;  3PP6 A;  1OEJ A;  1OPB A;  4EXZ A;  3BS2 A;  2A0A A;  2CZU A;  4WBK A;  4YFQ A;  3ELZ A;  2LA7 A;  1ADL A;  4AZN A;  3HWE A;  4YFR A;  2L5P A;  4GK9 A;  1I4U A;  5HWZ A;  1A2D A;  5HZQ A;  3NBX X;  5FQ7 E;  1AB0 A;  1T0V A;  4L1N A;  3P6F A;  1CBR A;  4ALB A;  2ANS A;  3ZW1 A;  1ALB A;  3FIQ A;  5HTE A;  1N0S A;  1JBH A;  1LKE A;  1X71 A;  4IAB A;  2GJ5 A;  4HPC A;  2AH7 X;  3HOL A;  1X8O A;  2G79 A;  2KD2 A;  3WVM A;  1GKA B;  4OS8 A;  4A1Y A;  4GKC A;  2G7B A;  3WXQ A;  4UU3 A;  4ORS A;  2BS6 A;  3ZW0 B;  1GT4 A;  1LIB A;  2CBR A;  4QYP A;  1P6P A;  4ZR2 A;  3B2I A;  2X8T A;  5EPQ A;  3V8U A;  4I95 A;  5H9L A;  1LPJ A;  3FA6 A;  5EZ2 A;  5K06 A;  2ACO A;  1B56 A;  2W2F A;  4KII A;  4GNW A;  3ZW1 B;  1BEB A;  1HMT A;  1QG5 A;  1T8V A;  1BBP A;  4QGW A;  3CWK A;  2KT4 B;  1BRQ A;  2BS5 A;  2X45 A;  3F6Z B;  3H3I A;  1QFV A;  1GGL A;  2RCQ A;  4GH7 A;  2FS6 A;  1ML7 A;  4MIR A;  3BDR A;  5HCE C;  1OPA A;  2A3F X;  5HCC C;  1KT4 A;  3NQ3 A;  2AKQ A;  1FEM A;  4DQ3 A;  4EQA C;  4Y0Q A;  4ORU A;  4ZHG A;  4HFO A;  1G74 A;  2FTB A;  5F1E A;  5IO6 A;  5CE4 A;  4NLI A;  1OEE A;  2F09 A;  1G7N A;  3JS1 A;  3BU1 A;  3RSW A;  3GE2 A;  4NLJ A;  3BX8 A;  1KT7 A;  4YGZ A;  3STN A;  4TLJ A;  1HQP A;  4IMO A;  2ZAI A;  3U03 A;  1MX7 A;  3HK1 A;  3IFB A;  1B8E A;  4NYQ A;  3QKG A;  3B2K A;  4ES7 A;  4HPD A;  1EPA A;  3KFG A;  2HLV A;  1VPR A;  1LF7 A;  3OD9 A;  4AZR A;  3NQ9 A;  3OJY C;  4NNS A;  3RZY A;  1SXX A;  2PY1 A;  4QZU A;  1JJJ A;  4ZHF A;  1G5W A;  4IMN A;  5LJD A;  3TGA A;  4ALO A;  1XKI A;  2N93 A;  1DF3 A;  1ZNE A;  2BT9 A;  2EU7 X;  4DQ4 A;  1EW3 A;  2KW1 A;  5KID A;  3HTY A;  3MVF A;  3NPO A;  1E00 A;  3KFH A;  3FR5 A;  3HWF A;  4JGL A;  1KXO A;  5FQ6 E;  3FMZ A;  3APU A;  4O4X A;  1OEK A;  1CRB A;  2ASN X;  1HBQ A;  4LKT A;  3S5V A;  5FEN A;  3C78 X;  4GDZ A;  3I0A A;  5B29 A;  4CK4 A;  4ZFX A;  2K62 A;  5EEE A;  1S2P A;  4IBA A;  2AT5 X;  2WEW A;  2QO6 A;  4O4O A;  2MWH A;  4YDB A;  1JJX A;  1VYG A;  4ORW A;  3TZS A;  2JU7 A;  1ZRY A;  2AMM X;  2NNE A;  4KC8 A;  3FYF A;  4O4S A;  1RLB E;  1EUO A;  4O4U A;  3KFF A;  3TGB A;  4GZV A;  5IO5 A;  2OFM X;  1QY1 A;  3BY0 A;  4INN A;  3FA8 A;  3WOV A;  3WJC A;  3NX1 A;  1YIV A;  2CM4 A;  3RBY A;  3ZQ3 A;  4OS0 A;  5L8O A;  1S44 A;  4YH0 A;  4FQB B;  4LKP A;  5HA1 A;  1FEN A;  1Y9L A;  5HZ6 A;  3P24 A;  1D2U A;  5LJK A;  4XMC A;  1QY0 A;  2HYS A;  3B2H A;  3N91 A;  1AVG I;  5HBS A;  4IB9 A;  5HAE A;  2X8F A;  3APX A;  1E5P A;  1I06 A;  2WEX A;  1BJ7 A;  4GRJ A;  2OVD A;  4U3Q A;  2WUT A;  4PJ2 A;  2MJI A;  4ML7 B;  3ZW2 A;  5D4A A;  3TF6 A;  4U9C A;  1LIF A;  4LZV A;  5F58 A;  4AZP A;  3WJD A;  1GT1 A;  1KZW A;  2QOS C;  3HWD A;  3IA8 A;  5EDC A;  3I17 A;  4I3D A;  3U0D A;  4N7D A;  1KQW A;  1B4M A;  1GKA A;  4IAX A;  3PH5 A;  3ZZV A;  1MVG A;  3ZW0 A;  1X8N A;  1MUP A;  1ICN A;  2RD7 C;  2FLJ A;  1SXY A;  5AJC A;  4BVM A;  1IFB A;  1KT3 A;  5F7G A;  1EQD A;  2OVE A;  5H9A A;  1ICM A;  5LJH A;  3OE3 A;  1B0O A;  4AYH A;  2QO4 A;  2FT9 A;  3B2J A;  3UEW A;  4TKB A;  5D48 A;  2XST A;  2AT8 X;  3D4R A;  4GET A;  2QO5 A;  4PSQ A;  1YWC A;  3B2L A;  3KFI A;  4Y0P A;  5LKF A;  3TGC A;  3NAD A;  1RBP A;  1PM1 X;  2A2U A;  3VG2 A;  3K3L A;  2XKL A;  1SXW A;  3FEK A;  1JYD A;  3LHN A;  1JYJ A;  3VG5 A;  2JW1 A;  4IAW A;  5DPQ A;  1DZP A;  3CBS A;  2LBA A;  4U8U N;  1YUP A;  1ZNK A;  2WWP A;  3APV A;  1QFT A;  2MO5 A;  3F9D A;  1YWD A;  2LBV A;  3RWX A;  1KZX A;  4OMX A;  1TOU A;  2JU8 A;  3P02 A;  3DSZ A;  4O3Y A;  1TVQ A;  3UEX A;  4HWM A;  1KT6 A;  2MHD A;  3PQU A;  4AZO A;  3Q6L A;  5HZ5 A;  1I04 A;  2HMB A;  3FR4 A;  4HPA A;  1SY1 A;  2A2G A;  3APW A;  1TXL A;  1AEL A;  1BSQ A;  3S26 A;  1KGL A;  1CBQ A;  3T1D A;  5AEO A;  4YFP A;  5KIC A;  4AZQ A;  4YMY A;  1IW2 A;  1E02 A;  4HPB A;  2K23 A;  3LV4 A;  1E06 A;  1FEL A;  4R0B A;  1HMS A;  4Y0R A;  1EIO A;  2HNX A;  3UEU A;  1GXA A;  3VE1 A;  1L6M A;  1GX9 A;  4YCE A;  3UAQ A;  4FBR A;  2Z4I A;  1X8U A;  1O8V A;  2DM5 A;  1SY2 A;  5IO7 A;  5H9N A;  1EXS A;  4FGI B;  4NP1 A;  1U18 A;  3FR2 A;  1DFV A;  2A13 A;  4MIS A;  5HA0 A;  4LZU A;  3BSZ E;  4CV7 A;  1ZNG A;  4KCA A;  4I6S A;  4QYN A;  2FRS A;  5JR8 A;  5LKE A;  4KC7 A;  4LQZ A;  4N7C A;  4TKJ A;  1X8P A;  2LKK A;  3AKN A;  1S7D A;  3VG6 A;  1A18 A;  2L67 A;  4NW4 A;  2AT0 X;  3FW4 A;  3BLG A;  1LFO A;  1JZU A;  4CSB A;  2CZT A;  5HZ8 A;  5HZ9 A;  1DZJ A;  3MX7 A;  4ZH9 A;  5EED A;  3PPT A;  4EEJ A;  4M6S A;  4ON1 A;  1DV9 A;  1DC9 A;  3PEC A;  4QQ1 A;  4ID2 A;  3OBL A;  4YGG A;  4ZHH A;  1YWB A;  2RA6 A;  2BLG A;  4RUN A;  4I9S A;  4U8U O;  2CM9 A;  3HOE A;  3FEL A;  3UEV A;  2R74 A;  4AW8 A;  1HBP A;  5L8I A;  4QAE A;  2JU3 A;  4ZCB A;  4IB7 A;  1IKJ A;  5BVT A;  1GX8 A;  2OVS A;  5FFH A;  4U8U M;  1DZK A;  1SY3 A;  2AT6 X;  1ZND A;  4WFU A;  2GTL N;  3O2Y A;  3P6D A;  4MVK A;  1TOW A;  2GTF X;  3NP1 A;  5DG4 A;  4MVE A;  5CYB A;  1BM5 A;  2BHV A;  5L8N A;  3VU1 A;  4O9S A;  4GE1 A;  1XCA A;  3RKG A;  5BYP A;  1G85 A;  2R73 A;  3CQN A;  4RUU A;  4NNT A;  1Z24 A;  4A60 A;  3L4R A;  2WSJ A;  3E3C A;  1YWA A;  3FA9 A;  2G78 A;  4O3W A;  3AKM A;  3P6G A;  3BRN A;  1FDQ A;  4YCH A;  1TW4 A;  4UU2 A;  1VYF A;  4I9R A;  1ACD A;  3D95 A;  4FBO A;  4BQU A;  2QM9 A;  1LIC A;  4XMH A;  5LJB A;  2AL0 X;  4EFG A;  3JQO A;  4YKO A;  5HTD A;  2Q4N A;  1X8Q A;  3SOT A;  3P6C A;  1LID A;  3STM X;  2LFO A;  4QRL A;  3EYC A;  4YDA A;  4OMW A;  3D97 A;  1Y9T A;  1EAL A;  1FTP A;  2Q9S A;  3BU9 A;  1IIU A;  4A1H A;  3P6E A;  1YP7 A;  1GT5 A;  2YMS A;  1X89 A;  4ZH6 A;  2NP1 A;  4YKM A;  1T68 X;  3JSQ A;  2LB6 A;  1KQX A;  2X8S A;  3NX2 A;  2NND A;  3U9P C;  1U0X A;  4IB6 A;  4O49 A;  3ZWE A;  1IKE A;  3DTQ A;  1ERB A;  3ZI8 A;  2JN3 A;  1LNM A;  3FEP A;  4TJZ A;  3S60 A;  1BSO A;  1OBP A;  1SY0 A;  2WQA E;  3FW5 A;  2L68 A;  4ODD A;  1OBU A;  3S5X A;  2FS7 A;  5AJB A;  2RN4 A;  1A57 A;  1FE3 A;  5D8J A;  4BOE A;  4XMD A;  1HMR A;  5EDB A;  4ZJ0 A;  1ZNH A;  3WJF A;  1EPB A;  1PMP A;  4IB8 A;  1JIW I;  2POA A;  2GTL O;  4K19 A;  4ZHD A;  2P8G A;  4XMG A;  3PQS A;  3FLL A;  3F8A A;  2OFR X;  4I3C A;  4QNI A;  4YBP A;  4WFV A;  5KHP A;  1URE A;  2RQ0 A;  2FR2 A;  2GTL M;  1QWD A;  1BWY A;  5BVS A;  1AQB A;  1I05 A;  4O3X B;  2Q2M A;  3WJB A;  2FR3 A;  2CBS A;  4D6B A;  1NGL A;  2R56 A;  4MVI A;  1SXU A;  1PBO A;  3D96 A;  3C77 X;  1KT5 A;  2NNQ A;  5LJG A;  1QAB E;  2KTS A;  3FEN A;  3MBT A;  4QZT A;  5H8T A;  4ZHC A;  4Y0S A;  3NQK A;  4EDE A;  2JMB A;  2Q39 A;  1EI5 A;  4XME A;  1ERX A;  2QMI A;  1GT3 A;  2X46 A;  2MM3 A;  3CMP A;  5LJC A;  4ZGU A;  2Z4H A;  1SA8 A;  3HWG A;  1CBS A;  3CR6 A;  3KQ0 A;  3ZUI A;  4TNN A;  3GAQ A;  4TKH A;  3WBG A;  4AZM A;  2AT3 X;  2FWV A;  1BRP A;  2M4L A;  5LJE A;  3VG4 A;  4KH8 A;  3ELX A;  4ORY A;  5HCD C;  2ACP X;  3VE2 A;  4QGV A;  1HN2 A;  4I3B A;  4YBU A;  4NYR A;  3NR3 A;  4GU8 A;  2GC9 A;  3P6H A;  2HZR A;  2IFB A;  1A3Y A;  1R0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...