5AFHA

Alpha7-achbp in complex with lobeline
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
205
structure length
205
Chain Sequence
GEFQRKLYKELVKNYNPDVIPTQRDRPVTVYFSLSLLQIMDVDEKNQVVDVVFWLQMSWTDHYLQWNVSEYPGVKQVSVPISSLWVPDLAAYNAISKPEVLTPQLALVNSSGHVQYLPSIRQRFSCDVSGVDTESGATCKLKFGSWTHHSRELDLQMQEADISGYIPYSRFELVGVTQKRSERFYECCKEPYPDVTFTVTFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE-BINDING PROTEIN, NEURONAL ACETYLCHOLINE RECEPT
publication title Molecular Blueprint of Allosteric Binding Sites in a Homologue of the Agonist-Binding Domain of the Alpha7 Nicotinic Acetylcholine Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 46
structure length 205
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5afhA00
4ILBA 3UQ4A 3WTKA 5AFMA 2XQ6A 2BYNA 3C84A 5HCJA 5HEJA 5KE4A 3UQ7A 3RIAA 5HCMA 3UU6A 4AFTA 3SH1A 3UUBA 2WN9A 4TWFA 5AFKA 4HFDA 2YOEA 2WNJA 4Z90A 4UY2A 4TWDA 5KZUA 4LMJA 4UM3P 5J5IA 3P4WA 4LMLA 3RQWA 5AFJA 2BG9C 4IL9A 3ZKRA 5AFLA 4UM3A 3U8JA 5BP0A 3UU8A 5FJVA 5LXBA 4ZK1A 5IUXA 5AINA 2XYSA 3UU5A 3SQ6A 2VL0A 2QC1B 4FRRA 2XYTA 4ZZBA 4D01A 3EAMA 3PEOA 3JAFA 4HFHA 4COFA 5CO5A 4X5TA 5J5HA 3RIFA 2C9TA 5AFNA 5SYOA 4AFGA 4ZK4A 2ZJUA 5LG3A 5J0ZA 2WZYA 4QH5A 2XQ7A 3EI0A 1UV6A 4HFBA 2ZJVA 4ZR6A 2PH9A 4ILCA 2BYPA 4QACA 3IGQA 4ALXA 1I9BA 2XZ5A 4A98A 2XQ9A 3SIOA 1UX2A 3U8KA 2XNTA 3WTIA 3TLSA 3WTHA 2Y56A 3U8MA 2Y54A 3WTOA 4TWHA 2YKSA 2YMDA 2XQ5A 3UU4A 4UM3S 3EHZA 4ZRUA 3JAEA 4LMKA 4ZZCA 2UZ6A 3RHWA 3ZDGA 4HFIA 5TVCA 3WTJA 2XZ6A 2BYRA 3LSVA 4UXUA 5J5FA 2BJ0A 4PIRA 3WTNA 4NZBA 3RI5A 3TLVA 2XQ8A 5L4HA 4BFQA 2W8GA 3GUAA 2YMEA 2BG9B 2BYQA 5J5GA 3U8LA 5AFHA 2XQAA 4HFEA 4NPPA 4B5DA 5HEHA 3TLWA 2W8FA 2BR8A 5HEUA 4IREA 4WV9A 1UW6A 5BW2A 4QH1A 3C79A 3SQ9A 3RQUA 5JMEA 2X00D 2XNVA 4QH4A 3UU3A 4ZJTA 2Y7YA 5HEOA 3ZDHA 3PMZA 4TNWA 4IL4A 2Y57A 4AFHA 4BQTA 2BG9A 3TLUA 5BRXA 3WIPA 4ILAA 4EZ1A 2BR7A 4UM1A 5CFBA 5L4EA 4Z91A 4ZJSA 4A97A 2WNLA 2YN6A 3T4MA 3WTMA 4QAAA 3U8NA 2Y58A 2BYSA 5AFMB 2WNCA 2XQ3A 3TLTA 4F8HA 2X00A 4TNVA 3WTLA 3P50A 2BG9E 5HEGA 2PGZA 2XQ4A 4HQPA 4XHEA 2XNUA 4HFCA 3JADA 4DBMA 4QABA 4XK9A 5L47A
chains in the Genus database with same CATH superfamily
4ILBA 3UQ4A 3WTKA 5AFMA 2XQ6A 2BYNA 3C84A 5HCJA 5HEJA 5KE4A 3UQ7A 3RIAA 5HCMA 3UU6A 4AFTA 3SH1A 3UUBA 2WN9A 4TWFA 5AFKA 4HFDA 2YOEA 2WNJA 4Z90A 4UY2A 4TWDA 5KZUA 4LMJA 4UM3P 5J5IA 3P4WA 4LMLA 3RQWA 5AFJA 2BG9C 4IL9A 3ZKRA 5AFLA 4UM3A 3U8JA 5BP0A 3UU8A 5FJVA 5LXBA 4ZK1A 5IUXA 5AINA 2XYSA 3UU5A 3SQ6A 2VL0A 2QC1B 4FRRA 2XYTA 4ZZBA 4D01A 3EAMA 3PEOA 3JAFA 4HFHA 4COFA 5CO5A 4X5TA 5J5HA 3RIFA 2C9TA 5AFNA 5SYOA 4AFGA 4ZK4A 2ZJUA 5LG3A 5J0ZA 2WZYA 4QH5A 2XQ7A 3EI0A 1UV6A 4HFBA 2ZJVA 4ZR6A 2PH9A 4ILCA 2BYPA 4QACA 3IGQA 4ALXA 1I9BA 2XZ5A 4A98A 2XQ9A 3SIOA 1UX2A 3U8KA 2XNTA 3WTIA 3TLSA 3WTHA 2Y56A 3U8MA 2Y54A 3WTOA 4TWHA 2YKSA 2YMDA 2XQ5A 3UU4A 4UM3S 3EHZA 4ZRUA 3JAEA 4LMKA 4ZZCA 2UZ6A 3RHWA 3ZDGA 4HFIA 5TVCA 3WTJA 2XZ6A 2BYRA 3LSVA 4UXUA 5J5FA 2BJ0A 4PIRA 3WTNA 4NZBA 3RI5A 3TLVA 2XQ8A 5L4HA 4BFQA 2W8GA 3GUAA 2YMEA 2BG9B 2BYQA 5J5GA 3U8LA 5AFHA 2XQAA 4HFEA 4NPPA 4B5DA 5HEHA 3TLWA 2W8FA 2BR8A 5HEUA 4IREA 4WV9A 1UW6A 5BW2A 4QH1A 3C79A 3SQ9A 3RQUA 5JMEA 2X00D 2XNVA 4QH4A 3UU3A 4ZJTA 2Y7YA 5HEOA 3ZDHA 3PMZA 4TNWA 4IL4A 2Y57A 4AFHA 4BQTA 2BG9A 3TLUA 5BRXA 3WIPA 4ILAA 4EZ1A 2BR7A 4UM1A 5CFBA 5L4EA 4Z91A 4ZJSA 4A97A 2WNLA 2YN6A 3T4MA 3WTMA 4QAAA 3U8NA 2Y58A 2BYSA 5AFMB 2WNCA 2XQ3A 3TLTA 4F8HA 2X00A 4TNVA 3WTLA 3P50A 2BG9E 5HEGA 2PGZA 2XQ4A 4HQPA 4XHEA 2XNUA 4HFCA 3JADA 4DBMA 4QABA 4XK9A 5L47A
chains in the Genus database with same CATH topology
4ILBA 3UQ4A 3WTKA 5AFMA 2XQ6A 2BYNA 3C84A 5HCJA 5HEJA 5KE4A 3UQ7A 3RIAA 5HCMA 3UU6A 4AFTA 3SH1A 3UUBA 2WN9A 4TWFA 5AFKA 4HFDA 2YOEA 2WNJA 4Z90A 4UY2A 4TWDA 5KZUA 4LMJA 4UM3P 5J5IA 3P4WA 4LMLA 3RQWA 5AFJA 2BG9C 4IL9A 3ZKRA 5AFLA 4UM3A 3U8JA 5BP0A 3UU8A 5FJVA 5LXBA 4ZK1A 5IUXA 5AINA 2XYSA 3UU5A 3SQ6A 2VL0A 2QC1B 4FRRA 2XYTA 4ZZBA 4D01A 3EAMA 3PEOA 3JAFA 4HFHA 4COFA 5CO5A 4X5TA 5J5HA 3RIFA 2C9TA 5AFNA 5SYOA 4AFGA 4ZK4A 2ZJUA 5LG3A 5J0ZA 2WZYA 4QH5A 2XQ7A 3EI0A 1UV6A 4HFBA 2ZJVA 4ZR6A 2PH9A 4ILCA 2BYPA 4QACA 3IGQA 4ALXA 1I9BA 2XZ5A 4A98A 2XQ9A 3SIOA 1UX2A 3U8KA 2XNTA 3WTIA 3TLSA 3WTHA 2Y56A 3U8MA 2Y54A 3WTOA 4TWHA 2YKSA 2YMDA 2XQ5A 3UU4A 4UM3S 3EHZA 4ZRUA 3JAEA 4LMKA 4ZZCA 2UZ6A 3RHWA 3ZDGA 4HFIA 5TVCA 3WTJA 2XZ6A 2BYRA 3LSVA 4UXUA 5J5FA 2BJ0A 4PIRA 3WTNA 4NZBA 3RI5A 3TLVA 2XQ8A 5L4HA 4BFQA 2W8GA 3GUAA 2YMEA 2BG9B 2BYQA 5J5GA 3U8LA 5AFHA 2XQAA 4HFEA 4NPPA 4B5DA 5HEHA 3TLWA 2W8FA 2BR8A 5HEUA 4IREA 4WV9A 1UW6A 5BW2A 4QH1A 3C79A 3SQ9A 3RQUA 5JMEA 2X00D 2XNVA 4QH4A 3UU3A 4ZJTA 2Y7YA 5HEOA 3ZDHA 3PMZA 4TNWA 4IL4A 2Y57A 4AFHA 4BQTA 2BG9A 3TLUA 5BRXA 3WIPA 4ILAA 4EZ1A 2BR7A 4UM1A 5CFBA 5L4EA 4Z91A 4ZJSA 4A97A 2WNLA 2YN6A 3T4MA 3WTMA 4QAAA 3U8NA 2Y58A 2BYSA 5AFMB 2WNCA 2XQ3A 3TLTA 4F8HA 2X00A 4TNVA 3WTLA 3P50A 2BG9E 5HEGA 2PGZA 2XQ4A 4HQPA 4XHEA 2XNUA 4HFCA 3JADA 4DBMA 4QABA 4XK9A 5L47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILB A;  3UQ4 A;  3WTK A;  5AFM A;  2XQ6 A;  2BYN A;  3C84 A;  5HCJ A;  5HEJ A;  5KE4 A;  3UQ7 A;  3RIA A;  5HCM A;  3UU6 A;  4AFT A;  3SH1 A;  3UUB A;  2WN9 A;  4TWF A;  5AFK A;  4HFD A;  2YOE A;  2WNJ A;  4Z90 A;  4UY2 A;  4TWD A;  5KZU A;  4LMJ A;  4UM3 P;  5J5I A;  3P4W A;  4LML A;  3RQW A;  5AFJ A;  2BG9 C;  4IL9 A;  3ZKR A;  5AFL A;  4UM3 A;  3U8J A;  5BP0 A;  3UU8 A;  5FJV A;  5LXB A;  4ZK1 A;  5IUX A;  5AIN A;  2XYS A;  3UU5 A;  3SQ6 A;  2VL0 A;  2QC1 B;  4FRR A;  2XYT A;  4ZZB A;  4D01 A;  3EAM A;  3PEO A;  3JAF A;  4HFH A;  4COF A;  5CO5 A;  4X5T A;  5J5H A;  3RIF A;  2C9T A;  5AFN A;  5SYO A;  4AFG A;  4ZK4 A;  2ZJU A;  5LG3 A;  5J0Z A;  2WZY A;  4QH5 A;  2XQ7 A;  3EI0 A;  1UV6 A;  4HFB A;  2ZJV A;  4ZR6 A;  2PH9 A;  4ILC A;  2BYP A;  4QAC A;  3IGQ A;  4ALX A;  1I9B A;  2XZ5 A;  4A98 A;  2XQ9 A;  3SIO A;  1UX2 A;  3U8K A;  2XNT A;  3WTI A;  3TLS A;  3WTH A;  2Y56 A;  3U8M A;  2Y54 A;  3WTO A;  4TWH A;  2YKS A;  2YMD A;  2XQ5 A;  3UU4 A;  4UM3 S;  3EHZ A;  4ZRU A;  3JAE A;  4LMK A;  4ZZC A;  2UZ6 A;  3RHW A;  3ZDG A;  4HFI A;  5TVC A;  3WTJ A;  2XZ6 A;  2BYR A;  3LSV A;  4UXU A;  5J5F A;  2BJ0 A;  4PIR A;  3WTN A;  4NZB A;  3RI5 A;  3TLV A;  2XQ8 A;  5L4H A;  4BFQ A;  2W8G A;  3GUA A;  2YME A;  2BG9 B;  2BYQ A;  5J5G A;  3U8L A;  5AFH A;  2XQA A;  4HFE A;  4NPP A;  4B5D A;  5HEH A;  3TLW A;  2W8F A;  2BR8 A;  5HEU A;  4IRE A;  4WV9 A;  1UW6 A;  5BW2 A;  4QH1 A;  3C79 A;  3SQ9 A;  3RQU A;  5JME A;  2X00 D;  2XNV A;  4QH4 A;  3UU3 A;  4ZJT A;  2Y7Y A;  5HEO A;  3ZDH A;  3PMZ A;  4TNW A;  4IL4 A;  2Y57 A;  4AFH A;  4BQT A;  2BG9 A;  3TLU A;  5BRX A;  3WIP A;  4ILA A;  4EZ1 A;  2BR7 A;  4UM1 A;  5CFB A;  5L4E A;  4Z91 A;  4ZJS A;  4A97 A;  2WNL A;  2YN6 A;  3T4M A;  3WTM A;  4QAA A;  3U8N A;  2Y58 A;  2BYS A;  5AFM B;  2WNC A;  2XQ3 A;  3TLT A;  4F8H A;  2X00 A;  4TNV A;  3WTL A;  3P50 A;  2BG9 E;  5HEG A;  2PGZ A;  2XQ4 A;  4HQP A;  4XHE A;  2XNU A;  4HFC A;  3JAD A;  4DBM A;  4QAB A;  4XK9 A;  5L47 A; 
#chains in the Genus database with same CATH topology
 4ILB A;  3UQ4 A;  3WTK A;  5AFM A;  2XQ6 A;  2BYN A;  3C84 A;  5HCJ A;  5HEJ A;  5KE4 A;  3UQ7 A;  3RIA A;  5HCM A;  3UU6 A;  4AFT A;  3SH1 A;  3UUB A;  2WN9 A;  4TWF A;  5AFK A;  4HFD A;  2YOE A;  2WNJ A;  4Z90 A;  4UY2 A;  4TWD A;  5KZU A;  4LMJ A;  4UM3 P;  5J5I A;  3P4W A;  4LML A;  3RQW A;  5AFJ A;  2BG9 C;  4IL9 A;  3ZKR A;  5AFL A;  4UM3 A;  3U8J A;  5BP0 A;  3UU8 A;  5FJV A;  5LXB A;  4ZK1 A;  5IUX A;  5AIN A;  2XYS A;  3UU5 A;  3SQ6 A;  2VL0 A;  2QC1 B;  4FRR A;  2XYT A;  4ZZB A;  4D01 A;  3EAM A;  3PEO A;  3JAF A;  4HFH A;  4COF A;  5CO5 A;  4X5T A;  5J5H A;  3RIF A;  2C9T A;  5AFN A;  5SYO A;  4AFG A;  4ZK4 A;  2ZJU A;  5LG3 A;  5J0Z A;  2WZY A;  4QH5 A;  2XQ7 A;  3EI0 A;  1UV6 A;  4HFB A;  2ZJV A;  4ZR6 A;  2PH9 A;  4ILC A;  2BYP A;  4QAC A;  3IGQ A;  4ALX A;  1I9B A;  2XZ5 A;  4A98 A;  2XQ9 A;  3SIO A;  1UX2 A;  3U8K A;  2XNT A;  3WTI A;  3TLS A;  3WTH A;  2Y56 A;  3U8M A;  2Y54 A;  3WTO A;  4TWH A;  2YKS A;  2YMD A;  2XQ5 A;  3UU4 A;  4UM3 S;  3EHZ A;  4ZRU A;  3JAE A;  4LMK A;  4ZZC A;  2UZ6 A;  3RHW A;  3ZDG A;  4HFI A;  5TVC A;  3WTJ A;  2XZ6 A;  2BYR A;  3LSV A;  4UXU A;  5J5F A;  2BJ0 A;  4PIR A;  3WTN A;  4NZB A;  3RI5 A;  3TLV A;  2XQ8 A;  5L4H A;  4BFQ A;  2W8G A;  3GUA A;  2YME A;  2BG9 B;  2BYQ A;  5J5G A;  3U8L A;  5AFH A;  2XQA A;  4HFE A;  4NPP A;  4B5D A;  5HEH A;  3TLW A;  2W8F A;  2BR8 A;  5HEU A;  4IRE A;  4WV9 A;  1UW6 A;  5BW2 A;  4QH1 A;  3C79 A;  3SQ9 A;  3RQU A;  5JME A;  2X00 D;  2XNV A;  4QH4 A;  3UU3 A;  4ZJT A;  2Y7Y A;  5HEO A;  3ZDH A;  3PMZ A;  4TNW A;  4IL4 A;  2Y57 A;  4AFH A;  4BQT A;  2BG9 A;  3TLU A;  5BRX A;  3WIP A;  4ILA A;  4EZ1 A;  2BR7 A;  4UM1 A;  5CFB A;  5L4E A;  4Z91 A;  4ZJS A;  4A97 A;  2WNL A;  2YN6 A;  3T4M A;  3WTM A;  4QAA A;  3U8N A;  2Y58 A;  2BYS A;  5AFM B;  2WNC A;  2XQ3 A;  3TLT A;  4F8H A;  2X00 A;  4TNV A;  3WTL A;  3P50 A;  2BG9 E;  5HEG A;  2PGZ A;  2XQ4 A;  4HQP A;  4XHE A;  2XNU A;  4HFC A;  3JAD A;  4DBM A;  4QAB A;  4XK9 A;  5L47 A; 
#chains in the Genus database with same CATH homology
 4ILB A;  3UQ4 A;  3WTK A;  5AFM A;  2XQ6 A;  2BYN A;  3C84 A;  5HCJ A;  5HEJ A;  5KE4 A;  3UQ7 A;  3RIA A;  5HCM A;  3UU6 A;  4AFT A;  3SH1 A;  3UUB A;  2WN9 A;  4TWF A;  5AFK A;  4HFD A;  2YOE A;  2WNJ A;  4Z90 A;  4UY2 A;  4TWD A;  5KZU A;  4LMJ A;  4UM3 P;  5J5I A;  3P4W A;  4LML A;  3RQW A;  5AFJ A;  2BG9 C;  4IL9 A;  3ZKR A;  5AFL A;  4UM3 A;  3U8J A;  5BP0 A;  3UU8 A;  5FJV A;  5LXB A;  4ZK1 A;  5IUX A;  5AIN A;  2XYS A;  3UU5 A;  3SQ6 A;  2VL0 A;  2QC1 B;  4FRR A;  2XYT A;  4ZZB A;  4D01 A;  3EAM A;  3PEO A;  3JAF A;  4HFH A;  4COF A;  5CO5 A;  4X5T A;  5J5H A;  3RIF A;  2C9T A;  5AFN A;  5SYO A;  4AFG A;  4ZK4 A;  2ZJU A;  5LG3 A;  5J0Z A;  2WZY A;  4QH5 A;  2XQ7 A;  3EI0 A;  1UV6 A;  4HFB A;  2ZJV A;  4ZR6 A;  2PH9 A;  4ILC A;  2BYP A;  4QAC A;  3IGQ A;  4ALX A;  1I9B A;  2XZ5 A;  4A98 A;  2XQ9 A;  3SIO A;  1UX2 A;  3U8K A;  2XNT A;  3WTI A;  3TLS A;  3WTH A;  2Y56 A;  3U8M A;  2Y54 A;  3WTO A;  4TWH A;  2YKS A;  2YMD A;  2XQ5 A;  3UU4 A;  4UM3 S;  3EHZ A;  4ZRU A;  3JAE A;  4LMK A;  4ZZC A;  2UZ6 A;  3RHW A;  3ZDG A;  4HFI A;  5TVC A;  3WTJ A;  2XZ6 A;  2BYR A;  3LSV A;  4UXU A;  5J5F A;  2BJ0 A;  4PIR A;  3WTN A;  4NZB A;  3RI5 A;  3TLV A;  2XQ8 A;  5L4H A;  4BFQ A;  2W8G A;  3GUA A;  2YME A;  2BG9 B;  2BYQ A;  5J5G A;  3U8L A;  5AFH A;  2XQA A;  4HFE A;  4NPP A;  4B5D A;  5HEH A;  3TLW A;  2W8F A;  2BR8 A;  5HEU A;  4IRE A;  4WV9 A;  1UW6 A;  5BW2 A;  4QH1 A;  3C79 A;  3SQ9 A;  3RQU A;  5JME A;  2X00 D;  2XNV A;  4QH4 A;  3UU3 A;  4ZJT A;  2Y7Y A;  5HEO A;  3ZDH A;  3PMZ A;  4TNW A;  4IL4 A;  2Y57 A;  4AFH A;  4BQT A;  2BG9 A;  3TLU A;  5BRX A;  3WIP A;  4ILA A;  4EZ1 A;  2BR7 A;  4UM1 A;  5CFB A;  5L4E A;  4Z91 A;  4ZJS A;  4A97 A;  2WNL A;  2YN6 A;  3T4M A;  3WTM A;  4QAA A;  3U8N A;  2Y58 A;  2BYS A;  5AFM B;  2WNC A;  2XQ3 A;  3TLT A;  4F8H A;  2X00 A;  4TNV A;  3WTL A;  3P50 A;  2BG9 E;  5HEG A;  2PGZ A;  2XQ4 A;  4HQP A;  4XHE A;  2XNU A;  4HFC A;  3JAD A;  4DBM A;  4QAB A;  4XK9 A;  5L47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...