5AFHA

Alpha7-achbp in complex with lobeline
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
205
structure length
205
Chain Sequence
b'GEFQRKLYKELVKNYNPDVIPTQRDRPVTVYFSLSLLQIMDVDEKNQVVDVVFWLQMSWTDHYLQWNVSEYPGVKQVSVPISSLWVPDLAAYNAISKPEVLTPQLALVNSSGHVQYLPSIRQRFSCDVSGVDTESGATCKLKFGSWTHHSRELDLQMQEADISGYIPYSRFELVGVTQKRSERFYECCKEPYPDVTFTVTFRKKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE-BINDING PROTEIN, NEURONAL ACETYLCHOLINE RECEPT
publication title Molecular Blueprint of Allosteric Binding Sites in a Homologue of the Agonist-Binding Domain of the Alpha7 Nicotinic Acetylcholine Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 46
structure length 205
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5afhA00
4BQTA 5BP0A 3UU5A 2XQ4A 4ILCA 3U8MA 4ZRUA 5L4EA 4HFCA 4IREA 5J5GA 4TNWA 2BYPA 2Y57A 2XQ6A 5J5HA 5AFLA 5HCMA 5BRXA 4QACA 4A97A 5BW2A 3UU3A 2XYSA 3UUBA 3WTHA 4TWDA 4X5TA 5J5FA 5AINA 2BJ0A 5AFJA 4HFDA 3WTIA 3SQ6A 1UV6A 4UM3S 5HEGA 2WNCA 3SIOA 3TLSA 2UZ6A 3ZKRA 3P4WA 5CO5A 4B5DA 4EZ1A 3PMZA 4NZBA 5IUXA 4QAAA 2BR8A 4UXUA 4Z90A 4QH1A 3WTOA 3JADA 3RQWA 2XQ8A 3WIPA 2BYQA 2WN9A 3WTNA 4AFHA 2YMEA 3C79A 3RIFA 4UY2A 4ZZCA 4BFQA 5HEJA 2BG9B 2XZ6A 4A98A 2YN6A 2X00D 5LG3A 5AFHA 5KZUA 4D01A 4Z91A 2BYSA 3TLTA 5HEOA 2WNLA 3WTLA 2BG9A 2QC1B 2BG9C 5HEHA 4TWFA 4TWHA 4HFIA 3PEOA 1UX2A 2ZJUA 3ZDHA 2XQ3A 2ZJVA 2BYNA 2XNVA 2WNJA 2BR7A 4AFGA 4AFTA 5SYOA 2VL0A 2Y54A 3ZDGA 3UQ4A 5AFNA 3SH1A 5J0ZA 3JAFA 4IL9A 2Y58A 4LMKA 4WV9A 5TVCA 3UU4A 5AFKA 3LSVA 2X00A 4XHEA 3TLWA 2BYRA 5LXBA 2XYTA 2XNTA 3RQUA 3U8KA 4UM1A 4ALXA 3UU6A 4ZR6A 4LMJA 4QH5A 4COFA 4HFBA 2BG9E 2XQAA 5KE4A 4ILAA 4HFHA 3GUAA 3UU8A 2PGZA 2Y56A 3IGQA 4NPPA 4UM3A 3JAEA 3RI5A 4LMLA 2W8GA 3TLUA 2XQ5A 3TLVA 3RHWA 3U8NA 5J5IA 2PH9A 4QH4A 4DBMA 5CFBA 3RIAA 2W8FA 2WZYA 2XZ5A 2YMDA 4HQPA 4HFEA 4ILBA 4XK9A 5AFMB 2C9TA 5JMEA 5HCJA 5L4HA 2YKSA 2Y7YA 4TNVA 4ZZBA 5FJVA 4QABA 3U8LA 3UQ7A 2XQ7A 3P50A 2XNUA 2XQ9A 3EAMA 4FRRA 4ZJSA 5AFMA 3EI0A 3U8JA 5HEUA 1I9BA 3T4MA 3C84A 4PIRA 4IL4A 3SQ9A 3WTKA 4UM3P 4ZK4A 4F8HA 4ZJTA 3WTMA 3EHZA 1UW6A 5L47A 2YOEA 4ZK1A 3WTJA
chains in the Genus database with same CATH superfamily
4BQTA 5BP0A 3UU5A 2XQ4A 4ILCA 3U8MA 4ZRUA 5L4EA 4HFCA 4IREA 5J5GA 4TNWA 2BYPA 2Y57A 2XQ6A 5J5HA 5AFLA 5HCMA 5BRXA 4QACA 4A97A 5BW2A 3UU3A 2XYSA 3UUBA 3WTHA 4TWDA 4X5TA 5J5FA 5AINA 2BJ0A 5AFJA 4HFDA 3WTIA 3SQ6A 1UV6A 4UM3S 5HEGA 2WNCA 3SIOA 3TLSA 2UZ6A 3ZKRA 3P4WA 5CO5A 4B5DA 4EZ1A 3PMZA 4NZBA 5IUXA 4QAAA 2BR8A 4UXUA 4Z90A 4QH1A 3WTOA 3JADA 3RQWA 2XQ8A 3WIPA 2BYQA 2WN9A 3WTNA 4AFHA 2YMEA 3C79A 3RIFA 4UY2A 4ZZCA 4BFQA 5HEJA 2BG9B 2XZ6A 4A98A 2YN6A 2X00D 5LG3A 5AFHA 5KZUA 4D01A 4Z91A 2BYSA 3TLTA 5HEOA 2WNLA 3WTLA 2BG9A 2QC1B 2BG9C 5HEHA 4TWFA 4TWHA 4HFIA 3PEOA 1UX2A 2ZJUA 3ZDHA 2XQ3A 2ZJVA 2BYNA 2XNVA 2WNJA 2BR7A 4AFGA 4AFTA 5SYOA 2VL0A 2Y54A 3ZDGA 3UQ4A 5AFNA 3SH1A 5J0ZA 3JAFA 4IL9A 2Y58A 4LMKA 4WV9A 5TVCA 3UU4A 5AFKA 3LSVA 2X00A 4XHEA 3TLWA 2BYRA 5LXBA 2XYTA 2XNTA 3RQUA 3U8KA 4UM1A 4ALXA 3UU6A 4ZR6A 4LMJA 4QH5A 4COFA 4HFBA 2BG9E 2XQAA 5KE4A 4ILAA 4HFHA 3GUAA 3UU8A 2PGZA 2Y56A 3IGQA 4NPPA 4UM3A 3JAEA 3RI5A 4LMLA 2W8GA 3TLUA 2XQ5A 3TLVA 3RHWA 3U8NA 5J5IA 2PH9A 4QH4A 4DBMA 5CFBA 3RIAA 2W8FA 2WZYA 2XZ5A 2YMDA 4HQPA 4HFEA 4ILBA 4XK9A 5AFMB 2C9TA 5JMEA 5HCJA 5L4HA 2YKSA 2Y7YA 4TNVA 4ZZBA 5FJVA 4QABA 3U8LA 3UQ7A 2XQ7A 3P50A 2XNUA 2XQ9A 3EAMA 4FRRA 4ZJSA 5AFMA 3EI0A 3U8JA 5HEUA 1I9BA 3T4MA 3C84A 4PIRA 4IL4A 3SQ9A 3WTKA 4UM3P 4ZK4A 4F8HA 4ZJTA 3WTMA 3EHZA 1UW6A 5L47A 2YOEA 4ZK1A 3WTJA
chains in the Genus database with same CATH topology
4BQTA 5BP0A 3UU5A 2XQ4A 4ILCA 3U8MA 4ZRUA 5L4EA 4HFCA 4IREA 5J5GA 4TNWA 2BYPA 2Y57A 2XQ6A 5J5HA 5AFLA 5HCMA 5BRXA 4QACA 4A97A 5BW2A 3UU3A 2XYSA 3UUBA 3WTHA 4TWDA 4X5TA 5J5FA 5AINA 2BJ0A 5AFJA 4HFDA 3WTIA 3SQ6A 1UV6A 4UM3S 5HEGA 2WNCA 3SIOA 3TLSA 2UZ6A 3ZKRA 3P4WA 5CO5A 4B5DA 4EZ1A 3PMZA 4NZBA 5IUXA 4QAAA 2BR8A 4UXUA 4Z90A 4QH1A 3WTOA 3JADA 3RQWA 2XQ8A 3WIPA 2BYQA 2WN9A 3WTNA 4AFHA 2YMEA 3C79A 3RIFA 4UY2A 4ZZCA 4BFQA 5HEJA 2BG9B 2XZ6A 4A98A 2YN6A 2X00D 5LG3A 5AFHA 5KZUA 4D01A 4Z91A 2BYSA 3TLTA 5HEOA 2WNLA 3WTLA 2BG9A 2QC1B 2BG9C 5HEHA 4TWFA 4TWHA 4HFIA 3PEOA 1UX2A 2ZJUA 3ZDHA 2XQ3A 2ZJVA 2BYNA 2XNVA 2WNJA 2BR7A 4AFGA 4AFTA 5SYOA 2VL0A 2Y54A 3ZDGA 3UQ4A 5AFNA 3SH1A 5J0ZA 3JAFA 4IL9A 2Y58A 4LMKA 4WV9A 5TVCA 3UU4A 5AFKA 3LSVA 2X00A 4XHEA 3TLWA 2BYRA 5LXBA 2XYTA 2XNTA 3RQUA 3U8KA 4UM1A 4ALXA 3UU6A 4ZR6A 4LMJA 4QH5A 4COFA 4HFBA 2BG9E 2XQAA 5KE4A 4ILAA 4HFHA 3GUAA 3UU8A 2PGZA 2Y56A 3IGQA 4NPPA 4UM3A 3JAEA 3RI5A 4LMLA 2W8GA 3TLUA 2XQ5A 3TLVA 3RHWA 3U8NA 5J5IA 2PH9A 4QH4A 4DBMA 5CFBA 3RIAA 2W8FA 2WZYA 2XZ5A 2YMDA 4HQPA 4HFEA 4ILBA 4XK9A 5AFMB 2C9TA 5JMEA 5HCJA 5L4HA 2YKSA 2Y7YA 4TNVA 4ZZBA 5FJVA 4QABA 3U8LA 3UQ7A 2XQ7A 3P50A 2XNUA 2XQ9A 3EAMA 4FRRA 4ZJSA 5AFMA 3EI0A 3U8JA 5HEUA 1I9BA 3T4MA 3C84A 4PIRA 4IL4A 3SQ9A 3WTKA 4UM3P 4ZK4A 4F8HA 4ZJTA 3WTMA 3EHZA 1UW6A 5L47A 2YOEA 4ZK1A 3WTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BQT A;  5BP0 A;  3UU5 A;  2XQ4 A;  4ILC A;  3U8M A;  4ZRU A;  5L4E A;  4HFC A;  4IRE A;  5J5G A;  4TNW A;  2BYP A;  2Y57 A;  2XQ6 A;  5J5H A;  5AFL A;  5HCM A;  5BRX A;  4QAC A;  4A97 A;  5BW2 A;  3UU3 A;  2XYS A;  3UUB A;  3WTH A;  4TWD A;  4X5T A;  5J5F A;  5AIN A;  2BJ0 A;  5AFJ A;  4HFD A;  3WTI A;  3SQ6 A;  1UV6 A;  4UM3 S;  5HEG A;  2WNC A;  3SIO A;  3TLS A;  2UZ6 A;  3ZKR A;  3P4W A;  5CO5 A;  4B5D A;  4EZ1 A;  3PMZ A;  4NZB A;  5IUX A;  4QAA A;  2BR8 A;  4UXU A;  4Z90 A;  4QH1 A;  3WTO A;  3JAD A;  3RQW A;  2XQ8 A;  3WIP A;  2BYQ A;  2WN9 A;  3WTN A;  4AFH A;  2YME A;  3C79 A;  3RIF A;  4UY2 A;  4ZZC A;  4BFQ A;  5HEJ A;  2BG9 B;  2XZ6 A;  4A98 A;  2YN6 A;  2X00 D;  5LG3 A;  5AFH A;  5KZU A;  4D01 A;  4Z91 A;  2BYS A;  3TLT A;  5HEO A;  2WNL A;  3WTL A;  2BG9 A;  2QC1 B;  2BG9 C;  5HEH A;  4TWF A;  4TWH A;  4HFI A;  3PEO A;  1UX2 A;  2ZJU A;  3ZDH A;  2XQ3 A;  2ZJV A;  2BYN A;  2XNV A;  2WNJ A;  2BR7 A;  4AFG A;  4AFT A;  5SYO A;  2VL0 A;  2Y54 A;  3ZDG A;  3UQ4 A;  5AFN A;  3SH1 A;  5J0Z A;  3JAF A;  4IL9 A;  2Y58 A;  4LMK A;  4WV9 A;  5TVC A;  3UU4 A;  5AFK A;  3LSV A;  2X00 A;  4XHE A;  3TLW A;  2BYR A;  5LXB A;  2XYT A;  2XNT A;  3RQU A;  3U8K A;  4UM1 A;  4ALX A;  3UU6 A;  4ZR6 A;  4LMJ A;  4QH5 A;  4COF A;  4HFB A;  2BG9 E;  2XQA A;  5KE4 A;  4ILA A;  4HFH A;  3GUA A;  3UU8 A;  2PGZ A;  2Y56 A;  3IGQ A;  4NPP A;  4UM3 A;  3JAE A;  3RI5 A;  4LML A;  2W8G A;  3TLU A;  2XQ5 A;  3TLV A;  3RHW A;  3U8N A;  5J5I A;  2PH9 A;  4QH4 A;  4DBM A;  5CFB A;  3RIA A;  2W8F A;  2WZY A;  2XZ5 A;  2YMD A;  4HQP A;  4HFE A;  4ILB A;  4XK9 A;  5AFM B;  2C9T A;  5JME A;  5HCJ A;  5L4H A;  2YKS A;  2Y7Y A;  4TNV A;  4ZZB A;  5FJV A;  4QAB A;  3U8L A;  3UQ7 A;  2XQ7 A;  3P50 A;  2XNU A;  2XQ9 A;  3EAM A;  4FRR A;  4ZJS A;  5AFM A;  3EI0 A;  3U8J A;  5HEU A;  1I9B A;  3T4M A;  3C84 A;  4PIR A;  4IL4 A;  3SQ9 A;  3WTK A;  4UM3 P;  4ZK4 A;  4F8H A;  4ZJT A;  3WTM A;  3EHZ A;  1UW6 A;  5L47 A;  2YOE A;  4ZK1 A;  3WTJ A; 
#chains in the Genus database with same CATH topology
 4BQT A;  5BP0 A;  3UU5 A;  2XQ4 A;  4ILC A;  3U8M A;  4ZRU A;  5L4E A;  4HFC A;  4IRE A;  5J5G A;  4TNW A;  2BYP A;  2Y57 A;  2XQ6 A;  5J5H A;  5AFL A;  5HCM A;  5BRX A;  4QAC A;  4A97 A;  5BW2 A;  3UU3 A;  2XYS A;  3UUB A;  3WTH A;  4TWD A;  4X5T A;  5J5F A;  5AIN A;  2BJ0 A;  5AFJ A;  4HFD A;  3WTI A;  3SQ6 A;  1UV6 A;  4UM3 S;  5HEG A;  2WNC A;  3SIO A;  3TLS A;  2UZ6 A;  3ZKR A;  3P4W A;  5CO5 A;  4B5D A;  4EZ1 A;  3PMZ A;  4NZB A;  5IUX A;  4QAA A;  2BR8 A;  4UXU A;  4Z90 A;  4QH1 A;  3WTO A;  3JAD A;  3RQW A;  2XQ8 A;  3WIP A;  2BYQ A;  2WN9 A;  3WTN A;  4AFH A;  2YME A;  3C79 A;  3RIF A;  4UY2 A;  4ZZC A;  4BFQ A;  5HEJ A;  2BG9 B;  2XZ6 A;  4A98 A;  2YN6 A;  2X00 D;  5LG3 A;  5AFH A;  5KZU A;  4D01 A;  4Z91 A;  2BYS A;  3TLT A;  5HEO A;  2WNL A;  3WTL A;  2BG9 A;  2QC1 B;  2BG9 C;  5HEH A;  4TWF A;  4TWH A;  4HFI A;  3PEO A;  1UX2 A;  2ZJU A;  3ZDH A;  2XQ3 A;  2ZJV A;  2BYN A;  2XNV A;  2WNJ A;  2BR7 A;  4AFG A;  4AFT A;  5SYO A;  2VL0 A;  2Y54 A;  3ZDG A;  3UQ4 A;  5AFN A;  3SH1 A;  5J0Z A;  3JAF A;  4IL9 A;  2Y58 A;  4LMK A;  4WV9 A;  5TVC A;  3UU4 A;  5AFK A;  3LSV A;  2X00 A;  4XHE A;  3TLW A;  2BYR A;  5LXB A;  2XYT A;  2XNT A;  3RQU A;  3U8K A;  4UM1 A;  4ALX A;  3UU6 A;  4ZR6 A;  4LMJ A;  4QH5 A;  4COF A;  4HFB A;  2BG9 E;  2XQA A;  5KE4 A;  4ILA A;  4HFH A;  3GUA A;  3UU8 A;  2PGZ A;  2Y56 A;  3IGQ A;  4NPP A;  4UM3 A;  3JAE A;  3RI5 A;  4LML A;  2W8G A;  3TLU A;  2XQ5 A;  3TLV A;  3RHW A;  3U8N A;  5J5I A;  2PH9 A;  4QH4 A;  4DBM A;  5CFB A;  3RIA A;  2W8F A;  2WZY A;  2XZ5 A;  2YMD A;  4HQP A;  4HFE A;  4ILB A;  4XK9 A;  5AFM B;  2C9T A;  5JME A;  5HCJ A;  5L4H A;  2YKS A;  2Y7Y A;  4TNV A;  4ZZB A;  5FJV A;  4QAB A;  3U8L A;  3UQ7 A;  2XQ7 A;  3P50 A;  2XNU A;  2XQ9 A;  3EAM A;  4FRR A;  4ZJS A;  5AFM A;  3EI0 A;  3U8J A;  5HEU A;  1I9B A;  3T4M A;  3C84 A;  4PIR A;  4IL4 A;  3SQ9 A;  3WTK A;  4UM3 P;  4ZK4 A;  4F8H A;  4ZJT A;  3WTM A;  3EHZ A;  1UW6 A;  5L47 A;  2YOE A;  4ZK1 A;  3WTJ A; 
#chains in the Genus database with same CATH homology
 4BQT A;  5BP0 A;  3UU5 A;  2XQ4 A;  4ILC A;  3U8M A;  4ZRU A;  5L4E A;  4HFC A;  4IRE A;  5J5G A;  4TNW A;  2BYP A;  2Y57 A;  2XQ6 A;  5J5H A;  5AFL A;  5HCM A;  5BRX A;  4QAC A;  4A97 A;  5BW2 A;  3UU3 A;  2XYS A;  3UUB A;  3WTH A;  4TWD A;  4X5T A;  5J5F A;  5AIN A;  2BJ0 A;  5AFJ A;  4HFD A;  3WTI A;  3SQ6 A;  1UV6 A;  4UM3 S;  5HEG A;  2WNC A;  3SIO A;  3TLS A;  2UZ6 A;  3ZKR A;  3P4W A;  5CO5 A;  4B5D A;  4EZ1 A;  3PMZ A;  4NZB A;  5IUX A;  4QAA A;  2BR8 A;  4UXU A;  4Z90 A;  4QH1 A;  3WTO A;  3JAD A;  3RQW A;  2XQ8 A;  3WIP A;  2BYQ A;  2WN9 A;  3WTN A;  4AFH A;  2YME A;  3C79 A;  3RIF A;  4UY2 A;  4ZZC A;  4BFQ A;  5HEJ A;  2BG9 B;  2XZ6 A;  4A98 A;  2YN6 A;  2X00 D;  5LG3 A;  5AFH A;  5KZU A;  4D01 A;  4Z91 A;  2BYS A;  3TLT A;  5HEO A;  2WNL A;  3WTL A;  2BG9 A;  2QC1 B;  2BG9 C;  5HEH A;  4TWF A;  4TWH A;  4HFI A;  3PEO A;  1UX2 A;  2ZJU A;  3ZDH A;  2XQ3 A;  2ZJV A;  2BYN A;  2XNV A;  2WNJ A;  2BR7 A;  4AFG A;  4AFT A;  5SYO A;  2VL0 A;  2Y54 A;  3ZDG A;  3UQ4 A;  5AFN A;  3SH1 A;  5J0Z A;  3JAF A;  4IL9 A;  2Y58 A;  4LMK A;  4WV9 A;  5TVC A;  3UU4 A;  5AFK A;  3LSV A;  2X00 A;  4XHE A;  3TLW A;  2BYR A;  5LXB A;  2XYT A;  2XNT A;  3RQU A;  3U8K A;  4UM1 A;  4ALX A;  3UU6 A;  4ZR6 A;  4LMJ A;  4QH5 A;  4COF A;  4HFB A;  2BG9 E;  2XQA A;  5KE4 A;  4ILA A;  4HFH A;  3GUA A;  3UU8 A;  2PGZ A;  2Y56 A;  3IGQ A;  4NPP A;  4UM3 A;  3JAE A;  3RI5 A;  4LML A;  2W8G A;  3TLU A;  2XQ5 A;  3TLV A;  3RHW A;  3U8N A;  5J5I A;  2PH9 A;  4QH4 A;  4DBM A;  5CFB A;  3RIA A;  2W8F A;  2WZY A;  2XZ5 A;  2YMD A;  4HQP A;  4HFE A;  4ILB A;  4XK9 A;  5AFM B;  2C9T A;  5JME A;  5HCJ A;  5L4H A;  2YKS A;  2Y7Y A;  4TNV A;  4ZZB A;  5FJV A;  4QAB A;  3U8L A;  3UQ7 A;  2XQ7 A;  3P50 A;  2XNU A;  2XQ9 A;  3EAM A;  4FRR A;  4ZJS A;  5AFM A;  3EI0 A;  3U8J A;  5HEU A;  1I9B A;  3T4M A;  3C84 A;  4PIR A;  4IL4 A;  3SQ9 A;  3WTK A;  4UM3 P;  4ZK4 A;  4F8H A;  4ZJT A;  3WTM A;  3EHZ A;  1UW6 A;  5L47 A;  2YOE A;  4ZK1 A;  3WTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...