5AFLA

Alpha7-achbp in complex with lobeline and fragment 3
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
205
structure length
205
Chain Sequence
GEFQRKLYKELVKNYNPDVIPTQRDRPVTVYFSLSLLQIMDVDEKNQVVDVVFWLQMSWTDHYLQWNVSEYPGVKQVSVPISSLWVPDLAAYNAISKPEVLTPQLALVNSSGHVQYLPSIRQRFSCDVSGVDTESGATCKLKFGSWTHHSRELDLQMQEADISGYIPYSRFELVGVTQKRSERFYECCKEPYPDVTFTVTFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE-BINDING PROTEIN, NEURONAL ACETYLCHOLINE RECEPT
publication title Molecular Blueprint of Allosteric Binding Sites in a Homologue of the Agonist-Binding Domain of the Alpha7 Nicotinic Acetylcholine Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 47
structure length 205
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5aflA00
4ILAA 2W8GA 4ZZBA 4D01A 3WTJA 5HCMA 2XQAA 2YMDA 2WNCA 5FJVA 3TLWA 4UM1A 3WIPA 3WTMA 2YKSA 3U8MA 5SYOA 3TLTA 3P50A 2Y7YA 4ZK1A 5AFLA 4BQTA 2XNUA 5HEHA 2XQ8A 1I9BA 4TWDA 3RI5A 3JADA 3UQ4A 4AFTA 3UU4A 3T4MA 2BR7A 3C79A 2BYPA 4NPPA 3RIAA 3TLUA 4BFQA 2PGZA 4HFHA 2Y57A 5CFBA 2BG9C 2XQ6A 4HFBA 4ILCA 2WNLA 5HEJA 3UU6A 4F8HA 2XNTA 3RQWA 2WN9A 3WTNA 4ZRUA 4A97A 4ZJSA 4COFA 3UU5A 2X00A 2XNVA 4AFGA 5J5IA 2XYSA 5L4EA 3RQUA 3TLVA 4QABA 2XZ6A 2WZYA 5AFJA 3U8NA 2QC1B 2Y56A 4QACA 3UUBA 3WTOA 3GUAA 4TWFA 4ZJTA 2X00D 4ALXA 1UW6A 5L4HA 4EZ1A 4QH5A 5AFKA 3JAEA 5LG3A 3SQ9A 4X5TA 4LMLA 5J5GA 3SQ6A 4TWHA 4UY2A 3SH1A 4LMJA 2XYTA 2ZJUA 2ZJVA 4UM3S 3EI0A 4HFCA 2XZ5A 5BP0A 2BYRA 2PH9A 2C9TA 2BG9A 4XK9A 5J5FA 2YMEA 3IGQA 3PEOA 2Y54A 3EAMA 5TVCA 3WTHA 2UZ6A 4A98A 2BG9E 2VL0A 3EHZA 2Y58A 3P4WA 4IL4A 3WTIA 5IUXA 4HFDA 4LMKA 4QH1A 5LXBA 5BRXA 5J5HA 4Z90A 5KE4A 2BG9B 4UM3P 4IL9A 2YOEA 3SIOA 5AFMA 4HFEA 5AINA 5HCJA 3WTKA 2BR8A 4QH4A 5KZUA 3U8JA 3UU3A 3JAFA 5J0ZA 2XQ7A 5HEOA 3RIFA 3TLSA 5AFNA 5AFMB 3ZDHA 4TNVA 3RHWA 1UV6A 1UX2A 5HEGA 2XQ9A 2WNJA 4Z91A 3UQ7A 4WV9A 2BYSA 3WTLA 5BW2A 5HEUA 4ZR6A 3UU8A 4AFHA 4PIRA 4XHEA 2BYQA 5CO5A 3LSVA 2W8FA 2BJ0A 2YN6A 4NZBA 4QAAA 3PMZA 4UM3A 4DBMA 3ZDGA 4ZZCA 4ZK4A 4TNWA 3ZKRA 3C84A 4IREA 4ILBA 2XQ5A 5JMEA 5L47A 4FRRA 3U8LA 3U8KA 5AFHA 4HQPA 4B5DA 2BYNA 2XQ4A 2XQ3A 4UXUA 4HFIA
chains in the Genus database with same CATH superfamily
4ILAA 2W8GA 4ZZBA 4D01A 3WTJA 5HCMA 2XQAA 2YMDA 2WNCA 5FJVA 3TLWA 4UM1A 3WIPA 3WTMA 2YKSA 3U8MA 5SYOA 3TLTA 3P50A 2Y7YA 4ZK1A 5AFLA 4BQTA 2XNUA 5HEHA 2XQ8A 1I9BA 4TWDA 3RI5A 3JADA 3UQ4A 4AFTA 3UU4A 3T4MA 2BR7A 3C79A 2BYPA 4NPPA 3RIAA 3TLUA 4BFQA 2PGZA 4HFHA 2Y57A 5CFBA 2BG9C 2XQ6A 4HFBA 4ILCA 2WNLA 5HEJA 3UU6A 4F8HA 2XNTA 3RQWA 2WN9A 3WTNA 4ZRUA 4A97A 4ZJSA 4COFA 3UU5A 2X00A 2XNVA 4AFGA 5J5IA 2XYSA 5L4EA 3RQUA 3TLVA 4QABA 2XZ6A 2WZYA 5AFJA 3U8NA 2QC1B 2Y56A 4QACA 3UUBA 3WTOA 3GUAA 4TWFA 4ZJTA 2X00D 4ALXA 1UW6A 5L4HA 4EZ1A 4QH5A 5AFKA 3JAEA 5LG3A 3SQ9A 4X5TA 4LMLA 5J5GA 3SQ6A 4TWHA 4UY2A 3SH1A 4LMJA 2XYTA 2ZJUA 2ZJVA 4UM3S 3EI0A 4HFCA 2XZ5A 5BP0A 2BYRA 2PH9A 2C9TA 2BG9A 4XK9A 5J5FA 2YMEA 3IGQA 3PEOA 2Y54A 3EAMA 5TVCA 3WTHA 2UZ6A 4A98A 2BG9E 2VL0A 3EHZA 2Y58A 3P4WA 4IL4A 3WTIA 5IUXA 4HFDA 4LMKA 4QH1A 5LXBA 5BRXA 5J5HA 4Z90A 5KE4A 2BG9B 4UM3P 4IL9A 2YOEA 3SIOA 5AFMA 4HFEA 5AINA 5HCJA 3WTKA 2BR8A 4QH4A 5KZUA 3U8JA 3UU3A 3JAFA 5J0ZA 2XQ7A 5HEOA 3RIFA 3TLSA 5AFNA 5AFMB 3ZDHA 4TNVA 3RHWA 1UV6A 1UX2A 5HEGA 2XQ9A 2WNJA 4Z91A 3UQ7A 4WV9A 2BYSA 3WTLA 5BW2A 5HEUA 4ZR6A 3UU8A 4AFHA 4PIRA 4XHEA 2BYQA 5CO5A 3LSVA 2W8FA 2BJ0A 2YN6A 4NZBA 4QAAA 3PMZA 4UM3A 4DBMA 3ZDGA 4ZZCA 4ZK4A 4TNWA 3ZKRA 3C84A 4IREA 4ILBA 2XQ5A 5JMEA 5L47A 4FRRA 3U8LA 3U8KA 5AFHA 4HQPA 4B5DA 2BYNA 2XQ4A 2XQ3A 4UXUA 4HFIA
chains in the Genus database with same CATH topology
4ILAA 2W8GA 4ZZBA 4D01A 3WTJA 5HCMA 2XQAA 2YMDA 2WNCA 5FJVA 3TLWA 4UM1A 3WIPA 3WTMA 2YKSA 3U8MA 5SYOA 3TLTA 3P50A 2Y7YA 4ZK1A 5AFLA 4BQTA 2XNUA 5HEHA 2XQ8A 1I9BA 4TWDA 3RI5A 3JADA 3UQ4A 4AFTA 3UU4A 3T4MA 2BR7A 3C79A 2BYPA 4NPPA 3RIAA 3TLUA 4BFQA 2PGZA 4HFHA 2Y57A 5CFBA 2BG9C 2XQ6A 4HFBA 4ILCA 2WNLA 5HEJA 3UU6A 4F8HA 2XNTA 3RQWA 2WN9A 3WTNA 4ZRUA 4A97A 4ZJSA 4COFA 3UU5A 2X00A 2XNVA 4AFGA 5J5IA 2XYSA 5L4EA 3RQUA 3TLVA 4QABA 2XZ6A 2WZYA 5AFJA 3U8NA 2QC1B 2Y56A 4QACA 3UUBA 3WTOA 3GUAA 4TWFA 4ZJTA 2X00D 4ALXA 1UW6A 5L4HA 4EZ1A 4QH5A 5AFKA 3JAEA 5LG3A 3SQ9A 4X5TA 4LMLA 5J5GA 3SQ6A 4TWHA 4UY2A 3SH1A 4LMJA 2XYTA 2ZJUA 2ZJVA 4UM3S 3EI0A 4HFCA 2XZ5A 5BP0A 2BYRA 2PH9A 2C9TA 2BG9A 4XK9A 5J5FA 2YMEA 3IGQA 3PEOA 2Y54A 3EAMA 5TVCA 3WTHA 2UZ6A 4A98A 2BG9E 2VL0A 3EHZA 2Y58A 3P4WA 4IL4A 3WTIA 5IUXA 4HFDA 4LMKA 4QH1A 5LXBA 5BRXA 5J5HA 4Z90A 5KE4A 2BG9B 4UM3P 4IL9A 2YOEA 3SIOA 5AFMA 4HFEA 5AINA 5HCJA 3WTKA 2BR8A 4QH4A 5KZUA 3U8JA 3UU3A 3JAFA 5J0ZA 2XQ7A 5HEOA 3RIFA 3TLSA 5AFNA 5AFMB 3ZDHA 4TNVA 3RHWA 1UV6A 1UX2A 5HEGA 2XQ9A 2WNJA 4Z91A 3UQ7A 4WV9A 2BYSA 3WTLA 5BW2A 5HEUA 4ZR6A 3UU8A 4AFHA 4PIRA 4XHEA 2BYQA 5CO5A 3LSVA 2W8FA 2BJ0A 2YN6A 4NZBA 4QAAA 3PMZA 4UM3A 4DBMA 3ZDGA 4ZZCA 4ZK4A 4TNWA 3ZKRA 3C84A 4IREA 4ILBA 2XQ5A 5JMEA 5L47A 4FRRA 3U8LA 3U8KA 5AFHA 4HQPA 4B5DA 2BYNA 2XQ4A 2XQ3A 4UXUA 4HFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILA A;  2W8G A;  4ZZB A;  4D01 A;  3WTJ A;  5HCM A;  2XQA A;  2YMD A;  2WNC A;  5FJV A;  3TLW A;  4UM1 A;  3WIP A;  3WTM A;  2YKS A;  3U8M A;  5SYO A;  3TLT A;  3P50 A;  2Y7Y A;  4ZK1 A;  5AFL A;  4BQT A;  2XNU A;  5HEH A;  2XQ8 A;  1I9B A;  4TWD A;  3RI5 A;  3JAD A;  3UQ4 A;  4AFT A;  3UU4 A;  3T4M A;  2BR7 A;  3C79 A;  2BYP A;  4NPP A;  3RIA A;  3TLU A;  4BFQ A;  2PGZ A;  4HFH A;  2Y57 A;  5CFB A;  2BG9 C;  2XQ6 A;  4HFB A;  4ILC A;  2WNL A;  5HEJ A;  3UU6 A;  4F8H A;  2XNT A;  3RQW A;  2WN9 A;  3WTN A;  4ZRU A;  4A97 A;  4ZJS A;  4COF A;  3UU5 A;  2X00 A;  2XNV A;  4AFG A;  5J5I A;  2XYS A;  5L4E A;  3RQU A;  3TLV A;  4QAB A;  2XZ6 A;  2WZY A;  5AFJ A;  3U8N A;  2QC1 B;  2Y56 A;  4QAC A;  3UUB A;  3WTO A;  3GUA A;  4TWF A;  4ZJT A;  2X00 D;  4ALX A;  1UW6 A;  5L4H A;  4EZ1 A;  4QH5 A;  5AFK A;  3JAE A;  5LG3 A;  3SQ9 A;  4X5T A;  4LML A;  5J5G A;  3SQ6 A;  4TWH A;  4UY2 A;  3SH1 A;  4LMJ A;  2XYT A;  2ZJU A;  2ZJV A;  4UM3 S;  3EI0 A;  4HFC A;  2XZ5 A;  5BP0 A;  2BYR A;  2PH9 A;  2C9T A;  2BG9 A;  4XK9 A;  5J5F A;  2YME A;  3IGQ A;  3PEO A;  2Y54 A;  3EAM A;  5TVC A;  3WTH A;  2UZ6 A;  4A98 A;  2BG9 E;  2VL0 A;  3EHZ A;  2Y58 A;  3P4W A;  4IL4 A;  3WTI A;  5IUX A;  4HFD A;  4LMK A;  4QH1 A;  5LXB A;  5BRX A;  5J5H A;  4Z90 A;  5KE4 A;  2BG9 B;  4UM3 P;  4IL9 A;  2YOE A;  3SIO A;  5AFM A;  4HFE A;  5AIN A;  5HCJ A;  3WTK A;  2BR8 A;  4QH4 A;  5KZU A;  3U8J A;  3UU3 A;  3JAF A;  5J0Z A;  2XQ7 A;  5HEO A;  3RIF A;  3TLS A;  5AFN A;  5AFM B;  3ZDH A;  4TNV A;  3RHW A;  1UV6 A;  1UX2 A;  5HEG A;  2XQ9 A;  2WNJ A;  4Z91 A;  3UQ7 A;  4WV9 A;  2BYS A;  3WTL A;  5BW2 A;  5HEU A;  4ZR6 A;  3UU8 A;  4AFH A;  4PIR A;  4XHE A;  2BYQ A;  5CO5 A;  3LSV A;  2W8F A;  2BJ0 A;  2YN6 A;  4NZB A;  4QAA A;  3PMZ A;  4UM3 A;  4DBM A;  3ZDG A;  4ZZC A;  4ZK4 A;  4TNW A;  3ZKR A;  3C84 A;  4IRE A;  4ILB A;  2XQ5 A;  5JME A;  5L47 A;  4FRR A;  3U8L A;  3U8K A;  5AFH A;  4HQP A;  4B5D A;  2BYN A;  2XQ4 A;  2XQ3 A;  4UXU A;  4HFI A; 
#chains in the Genus database with same CATH topology
 4ILA A;  2W8G A;  4ZZB A;  4D01 A;  3WTJ A;  5HCM A;  2XQA A;  2YMD A;  2WNC A;  5FJV A;  3TLW A;  4UM1 A;  3WIP A;  3WTM A;  2YKS A;  3U8M A;  5SYO A;  3TLT A;  3P50 A;  2Y7Y A;  4ZK1 A;  5AFL A;  4BQT A;  2XNU A;  5HEH A;  2XQ8 A;  1I9B A;  4TWD A;  3RI5 A;  3JAD A;  3UQ4 A;  4AFT A;  3UU4 A;  3T4M A;  2BR7 A;  3C79 A;  2BYP A;  4NPP A;  3RIA A;  3TLU A;  4BFQ A;  2PGZ A;  4HFH A;  2Y57 A;  5CFB A;  2BG9 C;  2XQ6 A;  4HFB A;  4ILC A;  2WNL A;  5HEJ A;  3UU6 A;  4F8H A;  2XNT A;  3RQW A;  2WN9 A;  3WTN A;  4ZRU A;  4A97 A;  4ZJS A;  4COF A;  3UU5 A;  2X00 A;  2XNV A;  4AFG A;  5J5I A;  2XYS A;  5L4E A;  3RQU A;  3TLV A;  4QAB A;  2XZ6 A;  2WZY A;  5AFJ A;  3U8N A;  2QC1 B;  2Y56 A;  4QAC A;  3UUB A;  3WTO A;  3GUA A;  4TWF A;  4ZJT A;  2X00 D;  4ALX A;  1UW6 A;  5L4H A;  4EZ1 A;  4QH5 A;  5AFK A;  3JAE A;  5LG3 A;  3SQ9 A;  4X5T A;  4LML A;  5J5G A;  3SQ6 A;  4TWH A;  4UY2 A;  3SH1 A;  4LMJ A;  2XYT A;  2ZJU A;  2ZJV A;  4UM3 S;  3EI0 A;  4HFC A;  2XZ5 A;  5BP0 A;  2BYR A;  2PH9 A;  2C9T A;  2BG9 A;  4XK9 A;  5J5F A;  2YME A;  3IGQ A;  3PEO A;  2Y54 A;  3EAM A;  5TVC A;  3WTH A;  2UZ6 A;  4A98 A;  2BG9 E;  2VL0 A;  3EHZ A;  2Y58 A;  3P4W A;  4IL4 A;  3WTI A;  5IUX A;  4HFD A;  4LMK A;  4QH1 A;  5LXB A;  5BRX A;  5J5H A;  4Z90 A;  5KE4 A;  2BG9 B;  4UM3 P;  4IL9 A;  2YOE A;  3SIO A;  5AFM A;  4HFE A;  5AIN A;  5HCJ A;  3WTK A;  2BR8 A;  4QH4 A;  5KZU A;  3U8J A;  3UU3 A;  3JAF A;  5J0Z A;  2XQ7 A;  5HEO A;  3RIF A;  3TLS A;  5AFN A;  5AFM B;  3ZDH A;  4TNV A;  3RHW A;  1UV6 A;  1UX2 A;  5HEG A;  2XQ9 A;  2WNJ A;  4Z91 A;  3UQ7 A;  4WV9 A;  2BYS A;  3WTL A;  5BW2 A;  5HEU A;  4ZR6 A;  3UU8 A;  4AFH A;  4PIR A;  4XHE A;  2BYQ A;  5CO5 A;  3LSV A;  2W8F A;  2BJ0 A;  2YN6 A;  4NZB A;  4QAA A;  3PMZ A;  4UM3 A;  4DBM A;  3ZDG A;  4ZZC A;  4ZK4 A;  4TNW A;  3ZKR A;  3C84 A;  4IRE A;  4ILB A;  2XQ5 A;  5JME A;  5L47 A;  4FRR A;  3U8L A;  3U8K A;  5AFH A;  4HQP A;  4B5D A;  2BYN A;  2XQ4 A;  2XQ3 A;  4UXU A;  4HFI A; 
#chains in the Genus database with same CATH homology
 4ILA A;  2W8G A;  4ZZB A;  4D01 A;  3WTJ A;  5HCM A;  2XQA A;  2YMD A;  2WNC A;  5FJV A;  3TLW A;  4UM1 A;  3WIP A;  3WTM A;  2YKS A;  3U8M A;  5SYO A;  3TLT A;  3P50 A;  2Y7Y A;  4ZK1 A;  5AFL A;  4BQT A;  2XNU A;  5HEH A;  2XQ8 A;  1I9B A;  4TWD A;  3RI5 A;  3JAD A;  3UQ4 A;  4AFT A;  3UU4 A;  3T4M A;  2BR7 A;  3C79 A;  2BYP A;  4NPP A;  3RIA A;  3TLU A;  4BFQ A;  2PGZ A;  4HFH A;  2Y57 A;  5CFB A;  2BG9 C;  2XQ6 A;  4HFB A;  4ILC A;  2WNL A;  5HEJ A;  3UU6 A;  4F8H A;  2XNT A;  3RQW A;  2WN9 A;  3WTN A;  4ZRU A;  4A97 A;  4ZJS A;  4COF A;  3UU5 A;  2X00 A;  2XNV A;  4AFG A;  5J5I A;  2XYS A;  5L4E A;  3RQU A;  3TLV A;  4QAB A;  2XZ6 A;  2WZY A;  5AFJ A;  3U8N A;  2QC1 B;  2Y56 A;  4QAC A;  3UUB A;  3WTO A;  3GUA A;  4TWF A;  4ZJT A;  2X00 D;  4ALX A;  1UW6 A;  5L4H A;  4EZ1 A;  4QH5 A;  5AFK A;  3JAE A;  5LG3 A;  3SQ9 A;  4X5T A;  4LML A;  5J5G A;  3SQ6 A;  4TWH A;  4UY2 A;  3SH1 A;  4LMJ A;  2XYT A;  2ZJU A;  2ZJV A;  4UM3 S;  3EI0 A;  4HFC A;  2XZ5 A;  5BP0 A;  2BYR A;  2PH9 A;  2C9T A;  2BG9 A;  4XK9 A;  5J5F A;  2YME A;  3IGQ A;  3PEO A;  2Y54 A;  3EAM A;  5TVC A;  3WTH A;  2UZ6 A;  4A98 A;  2BG9 E;  2VL0 A;  3EHZ A;  2Y58 A;  3P4W A;  4IL4 A;  3WTI A;  5IUX A;  4HFD A;  4LMK A;  4QH1 A;  5LXB A;  5BRX A;  5J5H A;  4Z90 A;  5KE4 A;  2BG9 B;  4UM3 P;  4IL9 A;  2YOE A;  3SIO A;  5AFM A;  4HFE A;  5AIN A;  5HCJ A;  3WTK A;  2BR8 A;  4QH4 A;  5KZU A;  3U8J A;  3UU3 A;  3JAF A;  5J0Z A;  2XQ7 A;  5HEO A;  3RIF A;  3TLS A;  5AFN A;  5AFM B;  3ZDH A;  4TNV A;  3RHW A;  1UV6 A;  1UX2 A;  5HEG A;  2XQ9 A;  2WNJ A;  4Z91 A;  3UQ7 A;  4WV9 A;  2BYS A;  3WTL A;  5BW2 A;  5HEU A;  4ZR6 A;  3UU8 A;  4AFH A;  4PIR A;  4XHE A;  2BYQ A;  5CO5 A;  3LSV A;  2W8F A;  2BJ0 A;  2YN6 A;  4NZB A;  4QAA A;  3PMZ A;  4UM3 A;  4DBM A;  3ZDG A;  4ZZC A;  4ZK4 A;  4TNW A;  3ZKR A;  3C84 A;  4IRE A;  4ILB A;  2XQ5 A;  5JME A;  5L47 A;  4FRR A;  3U8L A;  3U8K A;  5AFH A;  4HQP A;  4B5D A;  2BYN A;  2XQ4 A;  2XQ3 A;  4UXU A;  4HFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...