5AFMB

Alpha7-achbp in complex with lobeline and fragment 4
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
207
structure length
207
Chain Sequence
b'GEFQRKLYKELVKNYNPDVIPTQRDRPVTVYFSLSLLQIMDVDEKNQVVDVVFWLQMSWTDHYLQWNVSEYPGVKQVSVPISSLWVPDLAAYNAISKPEVLTPQLALVNSSGHVQYLPSIRQRFSCDVSGVDTESGATCKLKFGSWTHHSRELDLQMQEADISGYIPYSRFELVGVTQKRSERFYECCKEPYPDVTFTVTFRKKGRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE-BINDING PROTEIN, NEURONAL ACETYLCHOLINE RECEPT
publication title Molecular Blueprint of Allosteric Binding Sites in a Homologue of the Agonist-Binding Domain of the Alpha7 Nicotinic Acetylcholine Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 41
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2015-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5afmB00
2YOEA 2Y57A 4BQTA 3C79A 5AFHA 3WTOA 5CFBA 2ZJVA 4A97A 5HEOA 3U8NA 3JADA 1I9BA 3RI5A 4D01A 4XHEA 3SQ6A 3LSVA 4F8HA 2XYSA 4HFBA 4ZJTA 4AFTA 2BR8A 2XQ9A 3P50A 3EAMA 2XQ8A 2QC1B 2YMDA 4COFA 4HQPA 5BRXA 3T4MA 4IL4A 4ZJSA 5HEUA 3GUAA 3TLUA 4EZ1A 3JAEA 3U8LA 4UM3S 5BP0A 3U8JA 5AINA 2BYPA 3UQ7A 3U8KA 3RQWA 4BFQA 3UUBA 3UU3A 3WTKA 3RIFA 2XNVA 3IGQA 5HCMA 2BYSA 4ZZCA 4WV9A 3WTJA 4QH4A 5AFJA 3UU5A 2VL0A 2Y54A 4LMKA 2Y58A 4UM3A 4PIRA 2Y7YA 2YKSA 5KE4A 2XZ5A 4UM3P 5AFMA 5J5GA 2BYNA 4TWDA 4TWFA 2W8FA 3SQ9A 4TNWA 2XQ7A 2YMEA 2WNCA 4Z90A 4DBMA 2WN9A 4Z91A 2BG9C 2C9TA 3PMZA 2ZJUA 4XK9A 3SH1A 5L4HA 3ZDGA 5LXBA 5TVCA 3UU8A 5HEJA 2BG9A 5IUXA 2XQAA 5AFKA 4AFHA 5KZUA 4NPPA 3RQUA 4HFEA 2XQ6A 4UM1A 2Y56A 4ILCA 4ILBA 5SYOA 4IL9A 4ZR6A 5J5IA 5BW2A 5L4EA 3WTIA 4QACA 3TLSA 3WTLA 4AFGA 3SIOA 4ZK4A 3C84A 2XYTA 5CO5A 2PH9A 4B5DA 4QAAA 4NZBA 3WIPA 4ZK1A 3EI0A 4UXUA 4TNVA 2BYRA 5LG3A 3WTMA 5J5FA 2YN6A 3RHWA 2BG9E 2PGZA 3UQ4A 4ALXA 3P4WA 3U8MA 4QABA 5HEHA 2WNJA 4IREA 4HFIA 5FJVA 3RIAA 4ZZBA 4UY2A 2W8GA 4ILAA 2X00D 1UX2A 3PEOA 4ZRUA 3TLTA 1UW6A 2XQ5A 5HEGA 4QH1A 2BYQA 5J0ZA 4HFHA 4HFCA 5AFLA 4FRRA 3ZKRA 4TWHA 2XNUA 5AFMB 5AFNA 3ZDHA 4QH5A 2XQ3A 3UU4A 5L47A 2WZYA 3WTNA 3TLVA 3EHZA 3UU6A 5JMEA 3TLWA 2XZ6A 2UZ6A 4A98A 2BR7A 4HFDA 4LMJA 2BG9B 2WNLA 3JAFA 5HCJA 5J5HA 2X00A 2XNTA 2XQ4A 1UV6A 4X5TA 2BJ0A 4LMLA 3WTHA
chains in the Genus database with same CATH superfamily
2YOEA 2Y57A 4BQTA 3C79A 5AFHA 3WTOA 5CFBA 2ZJVA 4A97A 5HEOA 3U8NA 3JADA 1I9BA 3RI5A 4D01A 4XHEA 3SQ6A 3LSVA 4F8HA 2XYSA 4HFBA 4ZJTA 4AFTA 2BR8A 2XQ9A 3P50A 3EAMA 2XQ8A 2QC1B 2YMDA 4COFA 4HQPA 5BRXA 3T4MA 4IL4A 4ZJSA 5HEUA 3GUAA 3TLUA 4EZ1A 3JAEA 3U8LA 4UM3S 5BP0A 3U8JA 5AINA 2BYPA 3UQ7A 3U8KA 3RQWA 4BFQA 3UUBA 3UU3A 3WTKA 3RIFA 2XNVA 3IGQA 5HCMA 2BYSA 4ZZCA 4WV9A 3WTJA 4QH4A 5AFJA 3UU5A 2VL0A 2Y54A 4LMKA 2Y58A 4UM3A 4PIRA 2Y7YA 2YKSA 5KE4A 2XZ5A 4UM3P 5AFMA 5J5GA 2BYNA 4TWDA 4TWFA 2W8FA 3SQ9A 4TNWA 2XQ7A 2YMEA 2WNCA 4Z90A 4DBMA 2WN9A 4Z91A 2BG9C 2C9TA 3PMZA 2ZJUA 4XK9A 3SH1A 5L4HA 3ZDGA 5LXBA 5TVCA 3UU8A 5HEJA 2BG9A 5IUXA 2XQAA 5AFKA 4AFHA 5KZUA 4NPPA 3RQUA 4HFEA 2XQ6A 4UM1A 2Y56A 4ILCA 4ILBA 5SYOA 4IL9A 4ZR6A 5J5IA 5BW2A 5L4EA 3WTIA 4QACA 3TLSA 3WTLA 4AFGA 3SIOA 4ZK4A 3C84A 2XYTA 5CO5A 2PH9A 4B5DA 4QAAA 4NZBA 3WIPA 4ZK1A 3EI0A 4UXUA 4TNVA 2BYRA 5LG3A 3WTMA 5J5FA 2YN6A 3RHWA 2BG9E 2PGZA 3UQ4A 4ALXA 3P4WA 3U8MA 4QABA 5HEHA 2WNJA 4IREA 4HFIA 5FJVA 3RIAA 4ZZBA 4UY2A 2W8GA 4ILAA 2X00D 1UX2A 3PEOA 4ZRUA 3TLTA 1UW6A 2XQ5A 5HEGA 4QH1A 2BYQA 5J0ZA 4HFHA 4HFCA 5AFLA 4FRRA 3ZKRA 4TWHA 2XNUA 5AFMB 5AFNA 3ZDHA 4QH5A 2XQ3A 3UU4A 5L47A 2WZYA 3WTNA 3TLVA 3EHZA 3UU6A 5JMEA 3TLWA 2XZ6A 2UZ6A 4A98A 2BR7A 4HFDA 4LMJA 2BG9B 2WNLA 3JAFA 5HCJA 5J5HA 2X00A 2XNTA 2XQ4A 1UV6A 4X5TA 2BJ0A 4LMLA 3WTHA
chains in the Genus database with same CATH topology
2YOEA 2Y57A 4BQTA 3C79A 5AFHA 3WTOA 5CFBA 2ZJVA 4A97A 5HEOA 3U8NA 3JADA 1I9BA 3RI5A 4D01A 4XHEA 3SQ6A 3LSVA 4F8HA 2XYSA 4HFBA 4ZJTA 4AFTA 2BR8A 2XQ9A 3P50A 3EAMA 2XQ8A 2QC1B 2YMDA 4COFA 4HQPA 5BRXA 3T4MA 4IL4A 4ZJSA 5HEUA 3GUAA 3TLUA 4EZ1A 3JAEA 3U8LA 4UM3S 5BP0A 3U8JA 5AINA 2BYPA 3UQ7A 3U8KA 3RQWA 4BFQA 3UUBA 3UU3A 3WTKA 3RIFA 2XNVA 3IGQA 5HCMA 2BYSA 4ZZCA 4WV9A 3WTJA 4QH4A 5AFJA 3UU5A 2VL0A 2Y54A 4LMKA 2Y58A 4UM3A 4PIRA 2Y7YA 2YKSA 5KE4A 2XZ5A 4UM3P 5AFMA 5J5GA 2BYNA 4TWDA 4TWFA 2W8FA 3SQ9A 4TNWA 2XQ7A 2YMEA 2WNCA 4Z90A 4DBMA 2WN9A 4Z91A 2BG9C 2C9TA 3PMZA 2ZJUA 4XK9A 3SH1A 5L4HA 3ZDGA 5LXBA 5TVCA 3UU8A 5HEJA 2BG9A 5IUXA 2XQAA 5AFKA 4AFHA 5KZUA 4NPPA 3RQUA 4HFEA 2XQ6A 4UM1A 2Y56A 4ILCA 4ILBA 5SYOA 4IL9A 4ZR6A 5J5IA 5BW2A 5L4EA 3WTIA 4QACA 3TLSA 3WTLA 4AFGA 3SIOA 4ZK4A 3C84A 2XYTA 5CO5A 2PH9A 4B5DA 4QAAA 4NZBA 3WIPA 4ZK1A 3EI0A 4UXUA 4TNVA 2BYRA 5LG3A 3WTMA 5J5FA 2YN6A 3RHWA 2BG9E 2PGZA 3UQ4A 4ALXA 3P4WA 3U8MA 4QABA 5HEHA 2WNJA 4IREA 4HFIA 5FJVA 3RIAA 4ZZBA 4UY2A 2W8GA 4ILAA 2X00D 1UX2A 3PEOA 4ZRUA 3TLTA 1UW6A 2XQ5A 5HEGA 4QH1A 2BYQA 5J0ZA 4HFHA 4HFCA 5AFLA 4FRRA 3ZKRA 4TWHA 2XNUA 5AFMB 5AFNA 3ZDHA 4QH5A 2XQ3A 3UU4A 5L47A 2WZYA 3WTNA 3TLVA 3EHZA 3UU6A 5JMEA 3TLWA 2XZ6A 2UZ6A 4A98A 2BR7A 4HFDA 4LMJA 2BG9B 2WNLA 3JAFA 5HCJA 5J5HA 2X00A 2XNTA 2XQ4A 1UV6A 4X5TA 2BJ0A 4LMLA 3WTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YOE A;  2Y57 A;  4BQT A;  3C79 A;  5AFH A;  3WTO A;  5CFB A;  2ZJV A;  4A97 A;  5HEO A;  3U8N A;  3JAD A;  1I9B A;  3RI5 A;  4D01 A;  4XHE A;  3SQ6 A;  3LSV A;  4F8H A;  2XYS A;  4HFB A;  4ZJT A;  4AFT A;  2BR8 A;  2XQ9 A;  3P50 A;  3EAM A;  2XQ8 A;  2QC1 B;  2YMD A;  4COF A;  4HQP A;  5BRX A;  3T4M A;  4IL4 A;  4ZJS A;  5HEU A;  3GUA A;  3TLU A;  4EZ1 A;  3JAE A;  3U8L A;  4UM3 S;  5BP0 A;  3U8J A;  5AIN A;  2BYP A;  3UQ7 A;  3U8K A;  3RQW A;  4BFQ A;  3UUB A;  3UU3 A;  3WTK A;  3RIF A;  2XNV A;  3IGQ A;  5HCM A;  2BYS A;  4ZZC A;  4WV9 A;  3WTJ A;  4QH4 A;  5AFJ A;  3UU5 A;  2VL0 A;  2Y54 A;  4LMK A;  2Y58 A;  4UM3 A;  4PIR A;  2Y7Y A;  2YKS A;  5KE4 A;  2XZ5 A;  4UM3 P;  5AFM A;  5J5G A;  2BYN A;  4TWD A;  4TWF A;  2W8F A;  3SQ9 A;  4TNW A;  2XQ7 A;  2YME A;  2WNC A;  4Z90 A;  4DBM A;  2WN9 A;  4Z91 A;  2BG9 C;  2C9T A;  3PMZ A;  2ZJU A;  4XK9 A;  3SH1 A;  5L4H A;  3ZDG A;  5LXB A;  5TVC A;  3UU8 A;  5HEJ A;  2BG9 A;  5IUX A;  2XQA A;  5AFK A;  4AFH A;  5KZU A;  4NPP A;  3RQU A;  4HFE A;  2XQ6 A;  4UM1 A;  2Y56 A;  4ILC A;  4ILB A;  5SYO A;  4IL9 A;  4ZR6 A;  5J5I A;  5BW2 A;  5L4E A;  3WTI A;  4QAC A;  3TLS A;  3WTL A;  4AFG A;  3SIO A;  4ZK4 A;  3C84 A;  2XYT A;  5CO5 A;  2PH9 A;  4B5D A;  4QAA A;  4NZB A;  3WIP A;  4ZK1 A;  3EI0 A;  4UXU A;  4TNV A;  2BYR A;  5LG3 A;  3WTM A;  5J5F A;  2YN6 A;  3RHW A;  2BG9 E;  2PGZ A;  3UQ4 A;  4ALX A;  3P4W A;  3U8M A;  4QAB A;  5HEH A;  2WNJ A;  4IRE A;  4HFI A;  5FJV A;  3RIA A;  4ZZB A;  4UY2 A;  2W8G A;  4ILA A;  2X00 D;  1UX2 A;  3PEO A;  4ZRU A;  3TLT A;  1UW6 A;  2XQ5 A;  5HEG A;  4QH1 A;  2BYQ A;  5J0Z A;  4HFH A;  4HFC A;  5AFL A;  4FRR A;  3ZKR A;  4TWH A;  2XNU A;  5AFM B;  5AFN A;  3ZDH A;  4QH5 A;  2XQ3 A;  3UU4 A;  5L47 A;  2WZY A;  3WTN A;  3TLV A;  3EHZ A;  3UU6 A;  5JME A;  3TLW A;  2XZ6 A;  2UZ6 A;  4A98 A;  2BR7 A;  4HFD A;  4LMJ A;  2BG9 B;  2WNL A;  3JAF A;  5HCJ A;  5J5H A;  2X00 A;  2XNT A;  2XQ4 A;  1UV6 A;  4X5T A;  2BJ0 A;  4LML A;  3WTH A; 
#chains in the Genus database with same CATH topology
 2YOE A;  2Y57 A;  4BQT A;  3C79 A;  5AFH A;  3WTO A;  5CFB A;  2ZJV A;  4A97 A;  5HEO A;  3U8N A;  3JAD A;  1I9B A;  3RI5 A;  4D01 A;  4XHE A;  3SQ6 A;  3LSV A;  4F8H A;  2XYS A;  4HFB A;  4ZJT A;  4AFT A;  2BR8 A;  2XQ9 A;  3P50 A;  3EAM A;  2XQ8 A;  2QC1 B;  2YMD A;  4COF A;  4HQP A;  5BRX A;  3T4M A;  4IL4 A;  4ZJS A;  5HEU A;  3GUA A;  3TLU A;  4EZ1 A;  3JAE A;  3U8L A;  4UM3 S;  5BP0 A;  3U8J A;  5AIN A;  2BYP A;  3UQ7 A;  3U8K A;  3RQW A;  4BFQ A;  3UUB A;  3UU3 A;  3WTK A;  3RIF A;  2XNV A;  3IGQ A;  5HCM A;  2BYS A;  4ZZC A;  4WV9 A;  3WTJ A;  4QH4 A;  5AFJ A;  3UU5 A;  2VL0 A;  2Y54 A;  4LMK A;  2Y58 A;  4UM3 A;  4PIR A;  2Y7Y A;  2YKS A;  5KE4 A;  2XZ5 A;  4UM3 P;  5AFM A;  5J5G A;  2BYN A;  4TWD A;  4TWF A;  2W8F A;  3SQ9 A;  4TNW A;  2XQ7 A;  2YME A;  2WNC A;  4Z90 A;  4DBM A;  2WN9 A;  4Z91 A;  2BG9 C;  2C9T A;  3PMZ A;  2ZJU A;  4XK9 A;  3SH1 A;  5L4H A;  3ZDG A;  5LXB A;  5TVC A;  3UU8 A;  5HEJ A;  2BG9 A;  5IUX A;  2XQA A;  5AFK A;  4AFH A;  5KZU A;  4NPP A;  3RQU A;  4HFE A;  2XQ6 A;  4UM1 A;  2Y56 A;  4ILC A;  4ILB A;  5SYO A;  4IL9 A;  4ZR6 A;  5J5I A;  5BW2 A;  5L4E A;  3WTI A;  4QAC A;  3TLS A;  3WTL A;  4AFG A;  3SIO A;  4ZK4 A;  3C84 A;  2XYT A;  5CO5 A;  2PH9 A;  4B5D A;  4QAA A;  4NZB A;  3WIP A;  4ZK1 A;  3EI0 A;  4UXU A;  4TNV A;  2BYR A;  5LG3 A;  3WTM A;  5J5F A;  2YN6 A;  3RHW A;  2BG9 E;  2PGZ A;  3UQ4 A;  4ALX A;  3P4W A;  3U8M A;  4QAB A;  5HEH A;  2WNJ A;  4IRE A;  4HFI A;  5FJV A;  3RIA A;  4ZZB A;  4UY2 A;  2W8G A;  4ILA A;  2X00 D;  1UX2 A;  3PEO A;  4ZRU A;  3TLT A;  1UW6 A;  2XQ5 A;  5HEG A;  4QH1 A;  2BYQ A;  5J0Z A;  4HFH A;  4HFC A;  5AFL A;  4FRR A;  3ZKR A;  4TWH A;  2XNU A;  5AFM B;  5AFN A;  3ZDH A;  4QH5 A;  2XQ3 A;  3UU4 A;  5L47 A;  2WZY A;  3WTN A;  3TLV A;  3EHZ A;  3UU6 A;  5JME A;  3TLW A;  2XZ6 A;  2UZ6 A;  4A98 A;  2BR7 A;  4HFD A;  4LMJ A;  2BG9 B;  2WNL A;  3JAF A;  5HCJ A;  5J5H A;  2X00 A;  2XNT A;  2XQ4 A;  1UV6 A;  4X5T A;  2BJ0 A;  4LML A;  3WTH A; 
#chains in the Genus database with same CATH homology
 2YOE A;  2Y57 A;  4BQT A;  3C79 A;  5AFH A;  3WTO A;  5CFB A;  2ZJV A;  4A97 A;  5HEO A;  3U8N A;  3JAD A;  1I9B A;  3RI5 A;  4D01 A;  4XHE A;  3SQ6 A;  3LSV A;  4F8H A;  2XYS A;  4HFB A;  4ZJT A;  4AFT A;  2BR8 A;  2XQ9 A;  3P50 A;  3EAM A;  2XQ8 A;  2QC1 B;  2YMD A;  4COF A;  4HQP A;  5BRX A;  3T4M A;  4IL4 A;  4ZJS A;  5HEU A;  3GUA A;  3TLU A;  4EZ1 A;  3JAE A;  3U8L A;  4UM3 S;  5BP0 A;  3U8J A;  5AIN A;  2BYP A;  3UQ7 A;  3U8K A;  3RQW A;  4BFQ A;  3UUB A;  3UU3 A;  3WTK A;  3RIF A;  2XNV A;  3IGQ A;  5HCM A;  2BYS A;  4ZZC A;  4WV9 A;  3WTJ A;  4QH4 A;  5AFJ A;  3UU5 A;  2VL0 A;  2Y54 A;  4LMK A;  2Y58 A;  4UM3 A;  4PIR A;  2Y7Y A;  2YKS A;  5KE4 A;  2XZ5 A;  4UM3 P;  5AFM A;  5J5G A;  2BYN A;  4TWD A;  4TWF A;  2W8F A;  3SQ9 A;  4TNW A;  2XQ7 A;  2YME A;  2WNC A;  4Z90 A;  4DBM A;  2WN9 A;  4Z91 A;  2BG9 C;  2C9T A;  3PMZ A;  2ZJU A;  4XK9 A;  3SH1 A;  5L4H A;  3ZDG A;  5LXB A;  5TVC A;  3UU8 A;  5HEJ A;  2BG9 A;  5IUX A;  2XQA A;  5AFK A;  4AFH A;  5KZU A;  4NPP A;  3RQU A;  4HFE A;  2XQ6 A;  4UM1 A;  2Y56 A;  4ILC A;  4ILB A;  5SYO A;  4IL9 A;  4ZR6 A;  5J5I A;  5BW2 A;  5L4E A;  3WTI A;  4QAC A;  3TLS A;  3WTL A;  4AFG A;  3SIO A;  4ZK4 A;  3C84 A;  2XYT A;  5CO5 A;  2PH9 A;  4B5D A;  4QAA A;  4NZB A;  3WIP A;  4ZK1 A;  3EI0 A;  4UXU A;  4TNV A;  2BYR A;  5LG3 A;  3WTM A;  5J5F A;  2YN6 A;  3RHW A;  2BG9 E;  2PGZ A;  3UQ4 A;  4ALX A;  3P4W A;  3U8M A;  4QAB A;  5HEH A;  2WNJ A;  4IRE A;  4HFI A;  5FJV A;  3RIA A;  4ZZB A;  4UY2 A;  2W8G A;  4ILA A;  2X00 D;  1UX2 A;  3PEO A;  4ZRU A;  3TLT A;  1UW6 A;  2XQ5 A;  5HEG A;  4QH1 A;  2BYQ A;  5J0Z A;  4HFH A;  4HFC A;  5AFL A;  4FRR A;  3ZKR A;  4TWH A;  2XNU A;  5AFM B;  5AFN A;  3ZDH A;  4QH5 A;  2XQ3 A;  3UU4 A;  5L47 A;  2WZY A;  3WTN A;  3TLV A;  3EHZ A;  3UU6 A;  5JME A;  3TLW A;  2XZ6 A;  2UZ6 A;  4A98 A;  2BR7 A;  4HFD A;  4LMJ A;  2BG9 B;  2WNL A;  3JAF A;  5HCJ A;  5J5H A;  2X00 A;  2XNT A;  2XQ4 A;  1UV6 A;  4X5T A;  2BJ0 A;  4LML A;  3WTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...