5AFMB

Alpha7-achbp in complex with lobeline and fragment 4
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
207
structure length
207
Chain Sequence
GEFQRKLYKELVKNYNPDVIPTQRDRPVTVYFSLSLLQIMDVDEKNQVVDVVFWLQMSWTDHYLQWNVSEYPGVKQVSVPISSLWVPDLAAYNAISKPEVLTPQLALVNSSGHVQYLPSIRQRFSCDVSGVDTESGATCKLKFGSWTHHSRELDLQMQEADISGYIPYSRFELVGVTQKRSERFYECCKEPYPDVTFTVTFRKKGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE-BINDING PROTEIN, NEURONAL ACETYLCHOLINE RECEPT
publication title Molecular Blueprint of Allosteric Binding Sites in a Homologue of the Agonist-Binding Domain of the Alpha7 Nicotinic Acetylcholine Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 41
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2015-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5afmB00
2Y56A 2XQ4A 2YMDA 4ILAA 3TLWA 3WTNA 4QH1A 4BQTA 4UY2A 3U8KA 5CFBA 2BYNA 4QH5A 3RIFA 4QAAA 3LSVA 4ZK1A 5HEJA 4WV9A 2BG9A 4B5DA 4QACA 4UM3S 3UQ7A 2VL0A 5KE4A 4QH4A 2X00D 2W8FA 4QABA 4FRRA 2X00A 4HFDA 4XHEA 2WNLA 2Y7YA 5J0ZA 4BFQA 1UX2A 2BR7A 4HFEA 2BYRA 5L4EA 3U8MA 2XNUA 3ZDGA 4X5TA 4Z90A 2BR8A 4A97A 5HCMA 4ILCA 4LMKA 3SQ6A 5LXBA 2XQ8A 4IL9A 2YOEA 4NZBA 2Y58A 5HCJA 4ZJTA 4UM1A 5IUXA 5L47A 2XQ7A 5HEGA 2BYQA 5AFMA 5BP0A 2PGZA 4TWDA 5FJVA 3U8JA 3SIOA 1UV6A 4AFHA 5AFHA 5HEOA 3RHWA 2WNCA 4UM3A 3RIAA 4HFIA 2XNTA 5J5GA 2XZ5A 4Z91A 4ZZCA 4AFTA 2XYTA 4ZRUA 3JAFA 3UQ4A 2W8GA 5BRXA 4IL4A 3EAMA 5J5IA 2XQ6A 3SQ9A 3TLVA 5KZUA 3ZDHA 5AFNA 2XQ5A 4ZZBA 3TLUA 4LMLA 3EHZA 5JMEA 2XQ3A 3JADA 5SYOA 2PH9A 2YKSA 2BG9C 2WZYA 2XQ9A 2ZJVA 2Y54A 3UU5A 4F8HA 2ZJUA 5J5FA 3WTIA 2YN6A 2C9TA 4A98A 4TNWA 4NPPA 3RQWA 1I9BA 3U8NA 3JAEA 2BG9B 4IREA 4TWHA 5AINA 1UW6A 3WTMA 4HQPA 4ILBA 2BYSA 4AFGA 4ZR6A 5BW2A 4XK9A 2BYPA 2XQAA 4TNVA 2YMEA 3U8LA 5LG3A 3GUAA 3PMZA 2BJ0A 4LMJA 3WTHA 4D01A 3ZKRA 2BG9E 3SH1A 2UZ6A 3WTLA 4HFCA 4PIRA 3TLTA 3P4WA 3TLSA 5AFMB 3RQUA 5AFKA 4EZ1A 2QC1B 2WNJA 4UM3P 5TVCA 4ZJSA 2Y57A 5L4HA 3C84A 2XZ6A 3EI0A 4COFA 2XYSA 4HFHA 5AFJA 3C79A 3PEOA 4TWFA 3IGQA 5CO5A 5HEHA 4ZK4A 4UXUA 5HEUA 3UU6A 4ALXA 4DBMA 3WIPA 5AFLA 3UU3A 3UU4A 3UUBA 2WN9A 3T4MA 3RI5A 2XNVA 3UU8A 3WTKA 5J5HA 3WTJA 4HFBA 3WTOA 3P50A
chains in the Genus database with same CATH superfamily
2Y56A 2XQ4A 2YMDA 4ILAA 3TLWA 3WTNA 4QH1A 4BQTA 4UY2A 3U8KA 5CFBA 2BYNA 4QH5A 3RIFA 4QAAA 3LSVA 4ZK1A 5HEJA 4WV9A 2BG9A 4B5DA 4QACA 4UM3S 3UQ7A 2VL0A 5KE4A 4QH4A 2X00D 2W8FA 4QABA 4FRRA 2X00A 4HFDA 4XHEA 2WNLA 2Y7YA 5J0ZA 4BFQA 1UX2A 2BR7A 4HFEA 2BYRA 5L4EA 3U8MA 2XNUA 3ZDGA 4X5TA 4Z90A 2BR8A 4A97A 5HCMA 4ILCA 4LMKA 3SQ6A 5LXBA 2XQ8A 4IL9A 2YOEA 4NZBA 2Y58A 5HCJA 4ZJTA 4UM1A 5IUXA 5L47A 2XQ7A 5HEGA 2BYQA 5AFMA 5BP0A 2PGZA 4TWDA 5FJVA 3U8JA 3SIOA 1UV6A 4AFHA 5AFHA 5HEOA 3RHWA 2WNCA 4UM3A 3RIAA 4HFIA 2XNTA 5J5GA 2XZ5A 4Z91A 4ZZCA 4AFTA 2XYTA 4ZRUA 3JAFA 3UQ4A 2W8GA 5BRXA 4IL4A 3EAMA 5J5IA 2XQ6A 3SQ9A 3TLVA 5KZUA 3ZDHA 5AFNA 2XQ5A 4ZZBA 3TLUA 4LMLA 3EHZA 5JMEA 2XQ3A 3JADA 5SYOA 2PH9A 2YKSA 2BG9C 2WZYA 2XQ9A 2ZJVA 2Y54A 3UU5A 4F8HA 2ZJUA 5J5FA 3WTIA 2YN6A 2C9TA 4A98A 4TNWA 4NPPA 3RQWA 1I9BA 3U8NA 3JAEA 2BG9B 4IREA 4TWHA 5AINA 1UW6A 3WTMA 4HQPA 4ILBA 2BYSA 4AFGA 4ZR6A 5BW2A 4XK9A 2BYPA 2XQAA 4TNVA 2YMEA 3U8LA 5LG3A 3GUAA 3PMZA 2BJ0A 4LMJA 3WTHA 4D01A 3ZKRA 2BG9E 3SH1A 2UZ6A 3WTLA 4HFCA 4PIRA 3TLTA 3P4WA 3TLSA 5AFMB 3RQUA 5AFKA 4EZ1A 2QC1B 2WNJA 4UM3P 5TVCA 4ZJSA 2Y57A 5L4HA 3C84A 2XZ6A 3EI0A 4COFA 2XYSA 4HFHA 5AFJA 3C79A 3PEOA 4TWFA 3IGQA 5CO5A 5HEHA 4ZK4A 4UXUA 5HEUA 3UU6A 4ALXA 4DBMA 3WIPA 5AFLA 3UU3A 3UU4A 3UUBA 2WN9A 3T4MA 3RI5A 2XNVA 3UU8A 3WTKA 5J5HA 3WTJA 4HFBA 3WTOA 3P50A
chains in the Genus database with same CATH topology
2Y56A 2XQ4A 2YMDA 4ILAA 3TLWA 3WTNA 4QH1A 4BQTA 4UY2A 3U8KA 5CFBA 2BYNA 4QH5A 3RIFA 4QAAA 3LSVA 4ZK1A 5HEJA 4WV9A 2BG9A 4B5DA 4QACA 4UM3S 3UQ7A 2VL0A 5KE4A 4QH4A 2X00D 2W8FA 4QABA 4FRRA 2X00A 4HFDA 4XHEA 2WNLA 2Y7YA 5J0ZA 4BFQA 1UX2A 2BR7A 4HFEA 2BYRA 5L4EA 3U8MA 2XNUA 3ZDGA 4X5TA 4Z90A 2BR8A 4A97A 5HCMA 4ILCA 4LMKA 3SQ6A 5LXBA 2XQ8A 4IL9A 2YOEA 4NZBA 2Y58A 5HCJA 4ZJTA 4UM1A 5IUXA 5L47A 2XQ7A 5HEGA 2BYQA 5AFMA 5BP0A 2PGZA 4TWDA 5FJVA 3U8JA 3SIOA 1UV6A 4AFHA 5AFHA 5HEOA 3RHWA 2WNCA 4UM3A 3RIAA 4HFIA 2XNTA 5J5GA 2XZ5A 4Z91A 4ZZCA 4AFTA 2XYTA 4ZRUA 3JAFA 3UQ4A 2W8GA 5BRXA 4IL4A 3EAMA 5J5IA 2XQ6A 3SQ9A 3TLVA 5KZUA 3ZDHA 5AFNA 2XQ5A 4ZZBA 3TLUA 4LMLA 3EHZA 5JMEA 2XQ3A 3JADA 5SYOA 2PH9A 2YKSA 2BG9C 2WZYA 2XQ9A 2ZJVA 2Y54A 3UU5A 4F8HA 2ZJUA 5J5FA 3WTIA 2YN6A 2C9TA 4A98A 4TNWA 4NPPA 3RQWA 1I9BA 3U8NA 3JAEA 2BG9B 4IREA 4TWHA 5AINA 1UW6A 3WTMA 4HQPA 4ILBA 2BYSA 4AFGA 4ZR6A 5BW2A 4XK9A 2BYPA 2XQAA 4TNVA 2YMEA 3U8LA 5LG3A 3GUAA 3PMZA 2BJ0A 4LMJA 3WTHA 4D01A 3ZKRA 2BG9E 3SH1A 2UZ6A 3WTLA 4HFCA 4PIRA 3TLTA 3P4WA 3TLSA 5AFMB 3RQUA 5AFKA 4EZ1A 2QC1B 2WNJA 4UM3P 5TVCA 4ZJSA 2Y57A 5L4HA 3C84A 2XZ6A 3EI0A 4COFA 2XYSA 4HFHA 5AFJA 3C79A 3PEOA 4TWFA 3IGQA 5CO5A 5HEHA 4ZK4A 4UXUA 5HEUA 3UU6A 4ALXA 4DBMA 3WIPA 5AFLA 3UU3A 3UU4A 3UUBA 2WN9A 3T4MA 3RI5A 2XNVA 3UU8A 3WTKA 5J5HA 3WTJA 4HFBA 3WTOA 3P50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y56 A;  2XQ4 A;  2YMD A;  4ILA A;  3TLW A;  3WTN A;  4QH1 A;  4BQT A;  4UY2 A;  3U8K A;  5CFB A;  2BYN A;  4QH5 A;  3RIF A;  4QAA A;  3LSV A;  4ZK1 A;  5HEJ A;  4WV9 A;  2BG9 A;  4B5D A;  4QAC A;  4UM3 S;  3UQ7 A;  2VL0 A;  5KE4 A;  4QH4 A;  2X00 D;  2W8F A;  4QAB A;  4FRR A;  2X00 A;  4HFD A;  4XHE A;  2WNL A;  2Y7Y A;  5J0Z A;  4BFQ A;  1UX2 A;  2BR7 A;  4HFE A;  2BYR A;  5L4E A;  3U8M A;  2XNU A;  3ZDG A;  4X5T A;  4Z90 A;  2BR8 A;  4A97 A;  5HCM A;  4ILC A;  4LMK A;  3SQ6 A;  5LXB A;  2XQ8 A;  4IL9 A;  2YOE A;  4NZB A;  2Y58 A;  5HCJ A;  4ZJT A;  4UM1 A;  5IUX A;  5L47 A;  2XQ7 A;  5HEG A;  2BYQ A;  5AFM A;  5BP0 A;  2PGZ A;  4TWD A;  5FJV A;  3U8J A;  3SIO A;  1UV6 A;  4AFH A;  5AFH A;  5HEO A;  3RHW A;  2WNC A;  4UM3 A;  3RIA A;  4HFI A;  2XNT A;  5J5G A;  2XZ5 A;  4Z91 A;  4ZZC A;  4AFT A;  2XYT A;  4ZRU A;  3JAF A;  3UQ4 A;  2W8G A;  5BRX A;  4IL4 A;  3EAM A;  5J5I A;  2XQ6 A;  3SQ9 A;  3TLV A;  5KZU A;  3ZDH A;  5AFN A;  2XQ5 A;  4ZZB A;  3TLU A;  4LML A;  3EHZ A;  5JME A;  2XQ3 A;  3JAD A;  5SYO A;  2PH9 A;  2YKS A;  2BG9 C;  2WZY A;  2XQ9 A;  2ZJV A;  2Y54 A;  3UU5 A;  4F8H A;  2ZJU A;  5J5F A;  3WTI A;  2YN6 A;  2C9T A;  4A98 A;  4TNW A;  4NPP A;  3RQW A;  1I9B A;  3U8N A;  3JAE A;  2BG9 B;  4IRE A;  4TWH A;  5AIN A;  1UW6 A;  3WTM A;  4HQP A;  4ILB A;  2BYS A;  4AFG A;  4ZR6 A;  5BW2 A;  4XK9 A;  2BYP A;  2XQA A;  4TNV A;  2YME A;  3U8L A;  5LG3 A;  3GUA A;  3PMZ A;  2BJ0 A;  4LMJ A;  3WTH A;  4D01 A;  3ZKR A;  2BG9 E;  3SH1 A;  2UZ6 A;  3WTL A;  4HFC A;  4PIR A;  3TLT A;  3P4W A;  3TLS A;  5AFM B;  3RQU A;  5AFK A;  4EZ1 A;  2QC1 B;  2WNJ A;  4UM3 P;  5TVC A;  4ZJS A;  2Y57 A;  5L4H A;  3C84 A;  2XZ6 A;  3EI0 A;  4COF A;  2XYS A;  4HFH A;  5AFJ A;  3C79 A;  3PEO A;  4TWF A;  3IGQ A;  5CO5 A;  5HEH A;  4ZK4 A;  4UXU A;  5HEU A;  3UU6 A;  4ALX A;  4DBM A;  3WIP A;  5AFL A;  3UU3 A;  3UU4 A;  3UUB A;  2WN9 A;  3T4M A;  3RI5 A;  2XNV A;  3UU8 A;  3WTK A;  5J5H A;  3WTJ A;  4HFB A;  3WTO A;  3P50 A; 
#chains in the Genus database with same CATH topology
 2Y56 A;  2XQ4 A;  2YMD A;  4ILA A;  3TLW A;  3WTN A;  4QH1 A;  4BQT A;  4UY2 A;  3U8K A;  5CFB A;  2BYN A;  4QH5 A;  3RIF A;  4QAA A;  3LSV A;  4ZK1 A;  5HEJ A;  4WV9 A;  2BG9 A;  4B5D A;  4QAC A;  4UM3 S;  3UQ7 A;  2VL0 A;  5KE4 A;  4QH4 A;  2X00 D;  2W8F A;  4QAB A;  4FRR A;  2X00 A;  4HFD A;  4XHE A;  2WNL A;  2Y7Y A;  5J0Z A;  4BFQ A;  1UX2 A;  2BR7 A;  4HFE A;  2BYR A;  5L4E A;  3U8M A;  2XNU A;  3ZDG A;  4X5T A;  4Z90 A;  2BR8 A;  4A97 A;  5HCM A;  4ILC A;  4LMK A;  3SQ6 A;  5LXB A;  2XQ8 A;  4IL9 A;  2YOE A;  4NZB A;  2Y58 A;  5HCJ A;  4ZJT A;  4UM1 A;  5IUX A;  5L47 A;  2XQ7 A;  5HEG A;  2BYQ A;  5AFM A;  5BP0 A;  2PGZ A;  4TWD A;  5FJV A;  3U8J A;  3SIO A;  1UV6 A;  4AFH A;  5AFH A;  5HEO A;  3RHW A;  2WNC A;  4UM3 A;  3RIA A;  4HFI A;  2XNT A;  5J5G A;  2XZ5 A;  4Z91 A;  4ZZC A;  4AFT A;  2XYT A;  4ZRU A;  3JAF A;  3UQ4 A;  2W8G A;  5BRX A;  4IL4 A;  3EAM A;  5J5I A;  2XQ6 A;  3SQ9 A;  3TLV A;  5KZU A;  3ZDH A;  5AFN A;  2XQ5 A;  4ZZB A;  3TLU A;  4LML A;  3EHZ A;  5JME A;  2XQ3 A;  3JAD A;  5SYO A;  2PH9 A;  2YKS A;  2BG9 C;  2WZY A;  2XQ9 A;  2ZJV A;  2Y54 A;  3UU5 A;  4F8H A;  2ZJU A;  5J5F A;  3WTI A;  2YN6 A;  2C9T A;  4A98 A;  4TNW A;  4NPP A;  3RQW A;  1I9B A;  3U8N A;  3JAE A;  2BG9 B;  4IRE A;  4TWH A;  5AIN A;  1UW6 A;  3WTM A;  4HQP A;  4ILB A;  2BYS A;  4AFG A;  4ZR6 A;  5BW2 A;  4XK9 A;  2BYP A;  2XQA A;  4TNV A;  2YME A;  3U8L A;  5LG3 A;  3GUA A;  3PMZ A;  2BJ0 A;  4LMJ A;  3WTH A;  4D01 A;  3ZKR A;  2BG9 E;  3SH1 A;  2UZ6 A;  3WTL A;  4HFC A;  4PIR A;  3TLT A;  3P4W A;  3TLS A;  5AFM B;  3RQU A;  5AFK A;  4EZ1 A;  2QC1 B;  2WNJ A;  4UM3 P;  5TVC A;  4ZJS A;  2Y57 A;  5L4H A;  3C84 A;  2XZ6 A;  3EI0 A;  4COF A;  2XYS A;  4HFH A;  5AFJ A;  3C79 A;  3PEO A;  4TWF A;  3IGQ A;  5CO5 A;  5HEH A;  4ZK4 A;  4UXU A;  5HEU A;  3UU6 A;  4ALX A;  4DBM A;  3WIP A;  5AFL A;  3UU3 A;  3UU4 A;  3UUB A;  2WN9 A;  3T4M A;  3RI5 A;  2XNV A;  3UU8 A;  3WTK A;  5J5H A;  3WTJ A;  4HFB A;  3WTO A;  3P50 A; 
#chains in the Genus database with same CATH homology
 2Y56 A;  2XQ4 A;  2YMD A;  4ILA A;  3TLW A;  3WTN A;  4QH1 A;  4BQT A;  4UY2 A;  3U8K A;  5CFB A;  2BYN A;  4QH5 A;  3RIF A;  4QAA A;  3LSV A;  4ZK1 A;  5HEJ A;  4WV9 A;  2BG9 A;  4B5D A;  4QAC A;  4UM3 S;  3UQ7 A;  2VL0 A;  5KE4 A;  4QH4 A;  2X00 D;  2W8F A;  4QAB A;  4FRR A;  2X00 A;  4HFD A;  4XHE A;  2WNL A;  2Y7Y A;  5J0Z A;  4BFQ A;  1UX2 A;  2BR7 A;  4HFE A;  2BYR A;  5L4E A;  3U8M A;  2XNU A;  3ZDG A;  4X5T A;  4Z90 A;  2BR8 A;  4A97 A;  5HCM A;  4ILC A;  4LMK A;  3SQ6 A;  5LXB A;  2XQ8 A;  4IL9 A;  2YOE A;  4NZB A;  2Y58 A;  5HCJ A;  4ZJT A;  4UM1 A;  5IUX A;  5L47 A;  2XQ7 A;  5HEG A;  2BYQ A;  5AFM A;  5BP0 A;  2PGZ A;  4TWD A;  5FJV A;  3U8J A;  3SIO A;  1UV6 A;  4AFH A;  5AFH A;  5HEO A;  3RHW A;  2WNC A;  4UM3 A;  3RIA A;  4HFI A;  2XNT A;  5J5G A;  2XZ5 A;  4Z91 A;  4ZZC A;  4AFT A;  2XYT A;  4ZRU A;  3JAF A;  3UQ4 A;  2W8G A;  5BRX A;  4IL4 A;  3EAM A;  5J5I A;  2XQ6 A;  3SQ9 A;  3TLV A;  5KZU A;  3ZDH A;  5AFN A;  2XQ5 A;  4ZZB A;  3TLU A;  4LML A;  3EHZ A;  5JME A;  2XQ3 A;  3JAD A;  5SYO A;  2PH9 A;  2YKS A;  2BG9 C;  2WZY A;  2XQ9 A;  2ZJV A;  2Y54 A;  3UU5 A;  4F8H A;  2ZJU A;  5J5F A;  3WTI A;  2YN6 A;  2C9T A;  4A98 A;  4TNW A;  4NPP A;  3RQW A;  1I9B A;  3U8N A;  3JAE A;  2BG9 B;  4IRE A;  4TWH A;  5AIN A;  1UW6 A;  3WTM A;  4HQP A;  4ILB A;  2BYS A;  4AFG A;  4ZR6 A;  5BW2 A;  4XK9 A;  2BYP A;  2XQA A;  4TNV A;  2YME A;  3U8L A;  5LG3 A;  3GUA A;  3PMZ A;  2BJ0 A;  4LMJ A;  3WTH A;  4D01 A;  3ZKR A;  2BG9 E;  3SH1 A;  2UZ6 A;  3WTL A;  4HFC A;  4PIR A;  3TLT A;  3P4W A;  3TLS A;  5AFM B;  3RQU A;  5AFK A;  4EZ1 A;  2QC1 B;  2WNJ A;  4UM3 P;  5TVC A;  4ZJS A;  2Y57 A;  5L4H A;  3C84 A;  2XZ6 A;  3EI0 A;  4COF A;  2XYS A;  4HFH A;  5AFJ A;  3C79 A;  3PEO A;  4TWF A;  3IGQ A;  5CO5 A;  5HEH A;  4ZK4 A;  4UXU A;  5HEU A;  3UU6 A;  4ALX A;  4DBM A;  3WIP A;  5AFL A;  3UU3 A;  3UU4 A;  3UUB A;  2WN9 A;  3T4M A;  3RI5 A;  2XNV A;  3UU8 A;  3WTK A;  5J5H A;  3WTJ A;  4HFB A;  3WTO A;  3P50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...