5AFNA

Alpha7-achbp in complex with lobeline and fragment 5
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
205
structure length
205
Chain Sequence
GEFQRKLYKELVKNYNPDVIPTQRDRPVTVYFSLSLLQIMDVDEKNQVVDVVFWLQMSWTDHYLQWNVSEYPGVKQVSVPISSLWVPDLAAYNAISKPEVLTPQLALVNSSGHVQYLPSIRQRFSCDVSGVDTESGATCKLKFGSWTHHSRELDLQMQEADISGYIPYSRFELVGVTQKRSERFYECCKEPYPDVTFTVTFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE-BINDING PROTEIN, NEURONAL ACETYLCHOLINE RECEPT
publication title Molecular Blueprint of Allosteric Binding Sites in a Homologue of the Agonist-Binding Domain of the Alpha7 Nicotinic Acetylcholine Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 46
structure length 205
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5afnA00
4Z90A 3ZDGA 4ZJTA 3SQ6A 2BG9E 2YMEA 4ILBA 5AFLA 2XQ3A 4ILAA 5KE4A 5KZUA 4AFTA 3EI0A 4UM3A 3JAEA 5BP0A 4ZK1A 4UM3P 4QH5A 5BW2A 2BJ0A 4ZZBA 4NPPA 4NZBA 4HFIA 2BG9C 2XQ5A 3U8JA 3WTJA 2W8GA 4FRRA 4D01A 5AFMB 5LXBA 2WNCA 1UV6A 2XNUA 2XYSA 5FJVA 4A97A 2VL0A 3UU6A 4BFQA 2BYNA 5BRXA 5J5FA 4EZ1A 2YOEA 5L4HA 5AFMA 3UU5A 4IL9A 3WTHA 3RQWA 2ZJVA 4AFHA 2PGZA 4LMKA 5IUXA 4HFCA 3T4MA 3TLWA 3EAMA 5AFNA 4F8HA 3UU4A 4A98A 5AFHA 3P50A 4PIRA 2BYSA 1UW6A 5AFJA 5JMEA 4UM3S 3P4WA 2XQ7A 4B5DA 2XQ8A 5HEHA 2WN9A 4LMJA 5HCJA 3SIOA 4TNVA 4UM1A 3U8MA 2PH9A 4XK9A 2BR8A 3U8NA 2YMDA 2XNTA 3WTNA 2XQAA 2XZ5A 4Z91A 4DBMA 4ALXA 4HFEA 2XYTA 4LMLA 3PMZA 3TLTA 2X00D 5HEGA 4HFHA 4QABA 2Y58A 3WIPA 3U8KA 4TWDA 3RHWA 4IL4A 4HFDA 4BQTA 5J0ZA 2WNJA 4ZRUA 2XQ6A 2XZ6A 3RIAA 3ZDHA 4COFA 3SH1A 3LSVA 3RIFA 2Y7YA 2Y54A 4QAAA 3U8LA 3EHZA 3TLSA 2XNVA 2QC1B 2XQ4A 2ZJUA 5AINA 2BR7A 3UQ4A 2BG9A 5CFBA 4IREA 4QH4A 4ILCA 3TLVA 3C79A 5HCMA 3WTMA 2C9TA 4TWHA 5HEUA 2XQ9A 2YKSA 2YN6A 3RI5A 4UY2A 5SYOA 2W8FA 4ZZCA 2BYPA 3JAFA 5J5HA 5L47A 4HFBA 4WV9A 3UU8A 4TWFA 3WTIA 2X00A 5HEOA 3RQUA 3UU3A 3TLUA 3UUBA 3ZKRA 3WTOA 4QH1A 1UX2A 2Y57A 4ZJSA 2BG9B 4ZR6A 2UZ6A 3WTKA 2WZYA 5L4EA 2BYQA 3GUAA 4QACA 5AFKA 4X5TA 4AFGA 5LG3A 5HEJA 2Y56A 4ZK4A 4XHEA 5J5IA 2BYRA 3PEOA 3SQ9A 3WTLA 5J5GA 3JADA 4UXUA 3UQ7A 2WNLA 4TNWA 5CO5A 1I9BA 3C84A 4HQPA 3IGQA 5TVCA
chains in the Genus database with same CATH superfamily
4Z90A 3ZDGA 4ZJTA 3SQ6A 2BG9E 2YMEA 4ILBA 5AFLA 2XQ3A 4ILAA 5KE4A 5KZUA 4AFTA 3EI0A 4UM3A 3JAEA 5BP0A 4ZK1A 4UM3P 4QH5A 5BW2A 2BJ0A 4ZZBA 4NPPA 4NZBA 4HFIA 2BG9C 2XQ5A 3U8JA 3WTJA 2W8GA 4FRRA 4D01A 5AFMB 5LXBA 2WNCA 1UV6A 2XNUA 2XYSA 5FJVA 4A97A 2VL0A 3UU6A 4BFQA 2BYNA 5BRXA 5J5FA 4EZ1A 2YOEA 5L4HA 5AFMA 3UU5A 4IL9A 3WTHA 3RQWA 2ZJVA 4AFHA 2PGZA 4LMKA 5IUXA 4HFCA 3T4MA 3TLWA 3EAMA 5AFNA 4F8HA 3UU4A 4A98A 5AFHA 3P50A 4PIRA 2BYSA 1UW6A 5AFJA 5JMEA 4UM3S 3P4WA 2XQ7A 4B5DA 2XQ8A 5HEHA 2WN9A 4LMJA 5HCJA 3SIOA 4TNVA 4UM1A 3U8MA 2PH9A 4XK9A 2BR8A 3U8NA 2YMDA 2XNTA 3WTNA 2XQAA 2XZ5A 4Z91A 4DBMA 4ALXA 4HFEA 2XYTA 4LMLA 3PMZA 3TLTA 2X00D 5HEGA 4HFHA 4QABA 2Y58A 3WIPA 3U8KA 4TWDA 3RHWA 4IL4A 4HFDA 4BQTA 5J0ZA 2WNJA 4ZRUA 2XQ6A 2XZ6A 3RIAA 3ZDHA 4COFA 3SH1A 3LSVA 3RIFA 2Y7YA 2Y54A 4QAAA 3U8LA 3EHZA 3TLSA 2XNVA 2QC1B 2XQ4A 2ZJUA 5AINA 2BR7A 3UQ4A 2BG9A 5CFBA 4IREA 4QH4A 4ILCA 3TLVA 3C79A 5HCMA 3WTMA 2C9TA 4TWHA 5HEUA 2XQ9A 2YKSA 2YN6A 3RI5A 4UY2A 5SYOA 2W8FA 4ZZCA 2BYPA 3JAFA 5J5HA 5L47A 4HFBA 4WV9A 3UU8A 4TWFA 3WTIA 2X00A 5HEOA 3RQUA 3UU3A 3TLUA 3UUBA 3ZKRA 3WTOA 4QH1A 1UX2A 2Y57A 4ZJSA 2BG9B 4ZR6A 2UZ6A 3WTKA 2WZYA 5L4EA 2BYQA 3GUAA 4QACA 5AFKA 4X5TA 4AFGA 5LG3A 5HEJA 2Y56A 4ZK4A 4XHEA 5J5IA 2BYRA 3PEOA 3SQ9A 3WTLA 5J5GA 3JADA 4UXUA 3UQ7A 2WNLA 4TNWA 5CO5A 1I9BA 3C84A 4HQPA 3IGQA 5TVCA
chains in the Genus database with same CATH topology
4Z90A 3ZDGA 4ZJTA 3SQ6A 2BG9E 2YMEA 4ILBA 5AFLA 2XQ3A 4ILAA 5KE4A 5KZUA 4AFTA 3EI0A 4UM3A 3JAEA 5BP0A 4ZK1A 4UM3P 4QH5A 5BW2A 2BJ0A 4ZZBA 4NPPA 4NZBA 4HFIA 2BG9C 2XQ5A 3U8JA 3WTJA 2W8GA 4FRRA 4D01A 5AFMB 5LXBA 2WNCA 1UV6A 2XNUA 2XYSA 5FJVA 4A97A 2VL0A 3UU6A 4BFQA 2BYNA 5BRXA 5J5FA 4EZ1A 2YOEA 5L4HA 5AFMA 3UU5A 4IL9A 3WTHA 3RQWA 2ZJVA 4AFHA 2PGZA 4LMKA 5IUXA 4HFCA 3T4MA 3TLWA 3EAMA 5AFNA 4F8HA 3UU4A 4A98A 5AFHA 3P50A 4PIRA 2BYSA 1UW6A 5AFJA 5JMEA 4UM3S 3P4WA 2XQ7A 4B5DA 2XQ8A 5HEHA 2WN9A 4LMJA 5HCJA 3SIOA 4TNVA 4UM1A 3U8MA 2PH9A 4XK9A 2BR8A 3U8NA 2YMDA 2XNTA 3WTNA 2XQAA 2XZ5A 4Z91A 4DBMA 4ALXA 4HFEA 2XYTA 4LMLA 3PMZA 3TLTA 2X00D 5HEGA 4HFHA 4QABA 2Y58A 3WIPA 3U8KA 4TWDA 3RHWA 4IL4A 4HFDA 4BQTA 5J0ZA 2WNJA 4ZRUA 2XQ6A 2XZ6A 3RIAA 3ZDHA 4COFA 3SH1A 3LSVA 3RIFA 2Y7YA 2Y54A 4QAAA 3U8LA 3EHZA 3TLSA 2XNVA 2QC1B 2XQ4A 2ZJUA 5AINA 2BR7A 3UQ4A 2BG9A 5CFBA 4IREA 4QH4A 4ILCA 3TLVA 3C79A 5HCMA 3WTMA 2C9TA 4TWHA 5HEUA 2XQ9A 2YKSA 2YN6A 3RI5A 4UY2A 5SYOA 2W8FA 4ZZCA 2BYPA 3JAFA 5J5HA 5L47A 4HFBA 4WV9A 3UU8A 4TWFA 3WTIA 2X00A 5HEOA 3RQUA 3UU3A 3TLUA 3UUBA 3ZKRA 3WTOA 4QH1A 1UX2A 2Y57A 4ZJSA 2BG9B 4ZR6A 2UZ6A 3WTKA 2WZYA 5L4EA 2BYQA 3GUAA 4QACA 5AFKA 4X5TA 4AFGA 5LG3A 5HEJA 2Y56A 4ZK4A 4XHEA 5J5IA 2BYRA 3PEOA 3SQ9A 3WTLA 5J5GA 3JADA 4UXUA 3UQ7A 2WNLA 4TNWA 5CO5A 1I9BA 3C84A 4HQPA 3IGQA 5TVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z90 A;  3ZDG A;  4ZJT A;  3SQ6 A;  2BG9 E;  2YME A;  4ILB A;  5AFL A;  2XQ3 A;  4ILA A;  5KE4 A;  5KZU A;  4AFT A;  3EI0 A;  4UM3 A;  3JAE A;  5BP0 A;  4ZK1 A;  4UM3 P;  4QH5 A;  5BW2 A;  2BJ0 A;  4ZZB A;  4NPP A;  4NZB A;  4HFI A;  2BG9 C;  2XQ5 A;  3U8J A;  3WTJ A;  2W8G A;  4FRR A;  4D01 A;  5AFM B;  5LXB A;  2WNC A;  1UV6 A;  2XNU A;  2XYS A;  5FJV A;  4A97 A;  2VL0 A;  3UU6 A;  4BFQ A;  2BYN A;  5BRX A;  5J5F A;  4EZ1 A;  2YOE A;  5L4H A;  5AFM A;  3UU5 A;  4IL9 A;  3WTH A;  3RQW A;  2ZJV A;  4AFH A;  2PGZ A;  4LMK A;  5IUX A;  4HFC A;  3T4M A;  3TLW A;  3EAM A;  5AFN A;  4F8H A;  3UU4 A;  4A98 A;  5AFH A;  3P50 A;  4PIR A;  2BYS A;  1UW6 A;  5AFJ A;  5JME A;  4UM3 S;  3P4W A;  2XQ7 A;  4B5D A;  2XQ8 A;  5HEH A;  2WN9 A;  4LMJ A;  5HCJ A;  3SIO A;  4TNV A;  4UM1 A;  3U8M A;  2PH9 A;  4XK9 A;  2BR8 A;  3U8N A;  2YMD A;  2XNT A;  3WTN A;  2XQA A;  2XZ5 A;  4Z91 A;  4DBM A;  4ALX A;  4HFE A;  2XYT A;  4LML A;  3PMZ A;  3TLT A;  2X00 D;  5HEG A;  4HFH A;  4QAB A;  2Y58 A;  3WIP A;  3U8K A;  4TWD A;  3RHW A;  4IL4 A;  4HFD A;  4BQT A;  5J0Z A;  2WNJ A;  4ZRU A;  2XQ6 A;  2XZ6 A;  3RIA A;  3ZDH A;  4COF A;  3SH1 A;  3LSV A;  3RIF A;  2Y7Y A;  2Y54 A;  4QAA A;  3U8L A;  3EHZ A;  3TLS A;  2XNV A;  2QC1 B;  2XQ4 A;  2ZJU A;  5AIN A;  2BR7 A;  3UQ4 A;  2BG9 A;  5CFB A;  4IRE A;  4QH4 A;  4ILC A;  3TLV A;  3C79 A;  5HCM A;  3WTM A;  2C9T A;  4TWH A;  5HEU A;  2XQ9 A;  2YKS A;  2YN6 A;  3RI5 A;  4UY2 A;  5SYO A;  2W8F A;  4ZZC A;  2BYP A;  3JAF A;  5J5H A;  5L47 A;  4HFB A;  4WV9 A;  3UU8 A;  4TWF A;  3WTI A;  2X00 A;  5HEO A;  3RQU A;  3UU3 A;  3TLU A;  3UUB A;  3ZKR A;  3WTO A;  4QH1 A;  1UX2 A;  2Y57 A;  4ZJS A;  2BG9 B;  4ZR6 A;  2UZ6 A;  3WTK A;  2WZY A;  5L4E A;  2BYQ A;  3GUA A;  4QAC A;  5AFK A;  4X5T A;  4AFG A;  5LG3 A;  5HEJ A;  2Y56 A;  4ZK4 A;  4XHE A;  5J5I A;  2BYR A;  3PEO A;  3SQ9 A;  3WTL A;  5J5G A;  3JAD A;  4UXU A;  3UQ7 A;  2WNL A;  4TNW A;  5CO5 A;  1I9B A;  3C84 A;  4HQP A;  3IGQ A;  5TVC A; 
#chains in the Genus database with same CATH topology
 4Z90 A;  3ZDG A;  4ZJT A;  3SQ6 A;  2BG9 E;  2YME A;  4ILB A;  5AFL A;  2XQ3 A;  4ILA A;  5KE4 A;  5KZU A;  4AFT A;  3EI0 A;  4UM3 A;  3JAE A;  5BP0 A;  4ZK1 A;  4UM3 P;  4QH5 A;  5BW2 A;  2BJ0 A;  4ZZB A;  4NPP A;  4NZB A;  4HFI A;  2BG9 C;  2XQ5 A;  3U8J A;  3WTJ A;  2W8G A;  4FRR A;  4D01 A;  5AFM B;  5LXB A;  2WNC A;  1UV6 A;  2XNU A;  2XYS A;  5FJV A;  4A97 A;  2VL0 A;  3UU6 A;  4BFQ A;  2BYN A;  5BRX A;  5J5F A;  4EZ1 A;  2YOE A;  5L4H A;  5AFM A;  3UU5 A;  4IL9 A;  3WTH A;  3RQW A;  2ZJV A;  4AFH A;  2PGZ A;  4LMK A;  5IUX A;  4HFC A;  3T4M A;  3TLW A;  3EAM A;  5AFN A;  4F8H A;  3UU4 A;  4A98 A;  5AFH A;  3P50 A;  4PIR A;  2BYS A;  1UW6 A;  5AFJ A;  5JME A;  4UM3 S;  3P4W A;  2XQ7 A;  4B5D A;  2XQ8 A;  5HEH A;  2WN9 A;  4LMJ A;  5HCJ A;  3SIO A;  4TNV A;  4UM1 A;  3U8M A;  2PH9 A;  4XK9 A;  2BR8 A;  3U8N A;  2YMD A;  2XNT A;  3WTN A;  2XQA A;  2XZ5 A;  4Z91 A;  4DBM A;  4ALX A;  4HFE A;  2XYT A;  4LML A;  3PMZ A;  3TLT A;  2X00 D;  5HEG A;  4HFH A;  4QAB A;  2Y58 A;  3WIP A;  3U8K A;  4TWD A;  3RHW A;  4IL4 A;  4HFD A;  4BQT A;  5J0Z A;  2WNJ A;  4ZRU A;  2XQ6 A;  2XZ6 A;  3RIA A;  3ZDH A;  4COF A;  3SH1 A;  3LSV A;  3RIF A;  2Y7Y A;  2Y54 A;  4QAA A;  3U8L A;  3EHZ A;  3TLS A;  2XNV A;  2QC1 B;  2XQ4 A;  2ZJU A;  5AIN A;  2BR7 A;  3UQ4 A;  2BG9 A;  5CFB A;  4IRE A;  4QH4 A;  4ILC A;  3TLV A;  3C79 A;  5HCM A;  3WTM A;  2C9T A;  4TWH A;  5HEU A;  2XQ9 A;  2YKS A;  2YN6 A;  3RI5 A;  4UY2 A;  5SYO A;  2W8F A;  4ZZC A;  2BYP A;  3JAF A;  5J5H A;  5L47 A;  4HFB A;  4WV9 A;  3UU8 A;  4TWF A;  3WTI A;  2X00 A;  5HEO A;  3RQU A;  3UU3 A;  3TLU A;  3UUB A;  3ZKR A;  3WTO A;  4QH1 A;  1UX2 A;  2Y57 A;  4ZJS A;  2BG9 B;  4ZR6 A;  2UZ6 A;  3WTK A;  2WZY A;  5L4E A;  2BYQ A;  3GUA A;  4QAC A;  5AFK A;  4X5T A;  4AFG A;  5LG3 A;  5HEJ A;  2Y56 A;  4ZK4 A;  4XHE A;  5J5I A;  2BYR A;  3PEO A;  3SQ9 A;  3WTL A;  5J5G A;  3JAD A;  4UXU A;  3UQ7 A;  2WNL A;  4TNW A;  5CO5 A;  1I9B A;  3C84 A;  4HQP A;  3IGQ A;  5TVC A; 
#chains in the Genus database with same CATH homology
 4Z90 A;  3ZDG A;  4ZJT A;  3SQ6 A;  2BG9 E;  2YME A;  4ILB A;  5AFL A;  2XQ3 A;  4ILA A;  5KE4 A;  5KZU A;  4AFT A;  3EI0 A;  4UM3 A;  3JAE A;  5BP0 A;  4ZK1 A;  4UM3 P;  4QH5 A;  5BW2 A;  2BJ0 A;  4ZZB A;  4NPP A;  4NZB A;  4HFI A;  2BG9 C;  2XQ5 A;  3U8J A;  3WTJ A;  2W8G A;  4FRR A;  4D01 A;  5AFM B;  5LXB A;  2WNC A;  1UV6 A;  2XNU A;  2XYS A;  5FJV A;  4A97 A;  2VL0 A;  3UU6 A;  4BFQ A;  2BYN A;  5BRX A;  5J5F A;  4EZ1 A;  2YOE A;  5L4H A;  5AFM A;  3UU5 A;  4IL9 A;  3WTH A;  3RQW A;  2ZJV A;  4AFH A;  2PGZ A;  4LMK A;  5IUX A;  4HFC A;  3T4M A;  3TLW A;  3EAM A;  5AFN A;  4F8H A;  3UU4 A;  4A98 A;  5AFH A;  3P50 A;  4PIR A;  2BYS A;  1UW6 A;  5AFJ A;  5JME A;  4UM3 S;  3P4W A;  2XQ7 A;  4B5D A;  2XQ8 A;  5HEH A;  2WN9 A;  4LMJ A;  5HCJ A;  3SIO A;  4TNV A;  4UM1 A;  3U8M A;  2PH9 A;  4XK9 A;  2BR8 A;  3U8N A;  2YMD A;  2XNT A;  3WTN A;  2XQA A;  2XZ5 A;  4Z91 A;  4DBM A;  4ALX A;  4HFE A;  2XYT A;  4LML A;  3PMZ A;  3TLT A;  2X00 D;  5HEG A;  4HFH A;  4QAB A;  2Y58 A;  3WIP A;  3U8K A;  4TWD A;  3RHW A;  4IL4 A;  4HFD A;  4BQT A;  5J0Z A;  2WNJ A;  4ZRU A;  2XQ6 A;  2XZ6 A;  3RIA A;  3ZDH A;  4COF A;  3SH1 A;  3LSV A;  3RIF A;  2Y7Y A;  2Y54 A;  4QAA A;  3U8L A;  3EHZ A;  3TLS A;  2XNV A;  2QC1 B;  2XQ4 A;  2ZJU A;  5AIN A;  2BR7 A;  3UQ4 A;  2BG9 A;  5CFB A;  4IRE A;  4QH4 A;  4ILC A;  3TLV A;  3C79 A;  5HCM A;  3WTM A;  2C9T A;  4TWH A;  5HEU A;  2XQ9 A;  2YKS A;  2YN6 A;  3RI5 A;  4UY2 A;  5SYO A;  2W8F A;  4ZZC A;  2BYP A;  3JAF A;  5J5H A;  5L47 A;  4HFB A;  4WV9 A;  3UU8 A;  4TWF A;  3WTI A;  2X00 A;  5HEO A;  3RQU A;  3UU3 A;  3TLU A;  3UUB A;  3ZKR A;  3WTO A;  4QH1 A;  1UX2 A;  2Y57 A;  4ZJS A;  2BG9 B;  4ZR6 A;  2UZ6 A;  3WTK A;  2WZY A;  5L4E A;  2BYQ A;  3GUA A;  4QAC A;  5AFK A;  4X5T A;  4AFG A;  5LG3 A;  5HEJ A;  2Y56 A;  4ZK4 A;  4XHE A;  5J5I A;  2BYR A;  3PEO A;  3SQ9 A;  3WTL A;  5J5G A;  3JAD A;  4UXU A;  3UQ7 A;  2WNL A;  4TNW A;  5CO5 A;  1I9B A;  3C84 A;  4HQP A;  3IGQ A;  5TVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...