5AFNA

Alpha7-achbp in complex with lobeline and fragment 5
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
205
structure length
205
Chain Sequence
GEFQRKLYKELVKNYNPDVIPTQRDRPVTVYFSLSLLQIMDVDEKNQVVDVVFWLQMSWTDHYLQWNVSEYPGVKQVSVPISSLWVPDLAAYNAISKPEVLTPQLALVNSSGHVQYLPSIRQRFSCDVSGVDTESGATCKLKFGSWTHHSRELDLQMQEADISGYIPYSRFELVGVTQKRSERFYECCKEPYPDVTFTVTFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Blueprint of Allosteric Binding Sites in a Homologue of the Agonist-Binding Domain of the Alpha7 Nicotinic Acetylcholine Receptor.
pubmed doi rcsb
molecule keywords ACETYLCHOLINE-BINDING PROTEIN, NEURONAL ACETYLCHOLINE RECEPT
molecule tags Transport protein
source organism Homo sapiens
total genus 46
structure length 205
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5afnA00
3U8KA 2WNCA 3C79A 5HEOA 4ILAA 3RIFA 5L47A 4WV9A 4EZ1A 2XQ6A 2XYTA 2UZ6A 2Y57A 4NZBA 2BYNA 3EAMA 2WNLA 3RI5A 4TWDA 5AINA 3WTIA 4UM3S 5BP0A 2YKSA 5AFKA 3U8MA 4PIRA 3WTKA 3UU4A 2BYSA 4FRRA 5J5FA 5LG3A 2VL0A 4QAAA 3WTNA 5IUXA 1UW6A 4IL9A 5AFNA 4ZJSA 3RIAA 2WNJA 2Y58A 4AFHA 2XYSA 4ZJTA 3WTHA 3PEOA 4BFQA 4LMKA 4QABA 2PGZA 4UXUA 4LMLA 3UU3A 4D01A 5HEUA 4COFA 5AFMA 5HEJA 4HFBA 4ZK1A 2YMDA 5LXBA 4ZR6A 2XQ4A 4XK9A 3WTJA 2C9TA 5SYOA 5AFHA 3U8NA 2XQ3A 3T4MA 3JAFA 2BR8A 3JADA 3TLUA 3TLWA 3TLVA 4UM3P 3UU5A 2XQAA 4UM3A 5J0ZA 3WTOA 2XQ9A 4ILCA 2ZJVA 3TLTA 5BW2A 5HEHA 2Y54A 4ZRUA 2WN9A 4HFHA 5CFBA 5FJVA 2BYRA 3UU8A 2XNVA 5J5IA 4F8HA 4HFIA 4QACA 4ILBA 2BR7A 3WTLA 4ALXA 2BG9B 2BG9E 3GUAA 3U8LA 4AFGA 5L4HA 3UU6A 3P50A 4A97A 3RHWA 2Y56A 5CO5A 2XNUA 4HFEA 4QH1A 3RQUA 3UQ4A 4NPPA 4ZK4A 3UUBA 2X00A 5JMEA 2Y7YA 4IL4A 5HEGA 5TVCA 3SQ9A 5AFJA 2ZJUA 3JAEA 3SH1A 2YN6A 3IGQA 2QC1B 2XNTA 4LMJA 1UX2A 4HFCA 2PH9A 2BJ0A 2XQ5A 2YMEA 5L4EA 3U8JA 2BYQA 3EI0A 4TNWA 2XQ7A 2YOEA 3ZDGA 3LSVA 2BG9C 3SQ6A 2W8GA 4ZZCA 4X5TA 2BYPA 2WZYA 5J5GA 2W8FA 3SIOA 4B5DA 4QH5A 2XQ8A 3UQ7A 5J5HA 3P4WA 3ZKRA 4A98A 3PMZA 3C84A 4IREA 4UM1A 5BRXA 3TLSA 3EHZA 2XZ6A 3RQWA 4Z90A 5AFMB 4QH4A 4XHEA 5KE4A 4Z91A 4TWHA 5HCMA 4TWFA 1UV6A 4UY2A 3ZDHA 4DBMA 1I9BA 2XZ5A 3WTMA 4TNVA 2BG9A 3WIPA 4HFDA 5AFLA 4BQTA 4AFTA 4ZZBA 2X00D 5HCJA 5KZUA 4HQPA
chains in the Genus database with same CATH superfamily
3U8KA 2WNCA 3C79A 5HEOA 4ILAA 3RIFA 5L47A 4WV9A 4EZ1A 2XQ6A 2XYTA 2UZ6A 2Y57A 4NZBA 2BYNA 3EAMA 2WNLA 3RI5A 4TWDA 5AINA 3WTIA 4UM3S 5BP0A 2YKSA 5AFKA 3U8MA 4PIRA 3WTKA 3UU4A 2BYSA 4FRRA 5J5FA 5LG3A 2VL0A 4QAAA 3WTNA 5IUXA 1UW6A 4IL9A 5AFNA 4ZJSA 3RIAA 2WNJA 2Y58A 4AFHA 2XYSA 4ZJTA 3WTHA 3PEOA 4BFQA 4LMKA 4QABA 2PGZA 4UXUA 4LMLA 3UU3A 4D01A 5HEUA 4COFA 5AFMA 5HEJA 4HFBA 4ZK1A 2YMDA 5LXBA 4ZR6A 2XQ4A 4XK9A 3WTJA 2C9TA 5SYOA 5AFHA 3U8NA 2XQ3A 3T4MA 3JAFA 2BR8A 3JADA 3TLUA 3TLWA 3TLVA 4UM3P 3UU5A 2XQAA 4UM3A 5J0ZA 3WTOA 2XQ9A 4ILCA 2ZJVA 3TLTA 5BW2A 5HEHA 2Y54A 4ZRUA 2WN9A 4HFHA 5CFBA 5FJVA 2BYRA 3UU8A 2XNVA 5J5IA 4F8HA 4HFIA 4QACA 4ILBA 2BR7A 3WTLA 4ALXA 2BG9B 2BG9E 3GUAA 3U8LA 4AFGA 5L4HA 3UU6A 3P50A 4A97A 3RHWA 2Y56A 5CO5A 2XNUA 4HFEA 4QH1A 3RQUA 3UQ4A 4NPPA 4ZK4A 3UUBA 2X00A 5JMEA 2Y7YA 4IL4A 5HEGA 5TVCA 3SQ9A 5AFJA 2ZJUA 3JAEA 3SH1A 2YN6A 3IGQA 2QC1B 2XNTA 4LMJA 1UX2A 4HFCA 2PH9A 2BJ0A 2XQ5A 2YMEA 5L4EA 3U8JA 2BYQA 3EI0A 4TNWA 2XQ7A 2YOEA 3ZDGA 3LSVA 2BG9C 3SQ6A 2W8GA 4ZZCA 4X5TA 2BYPA 2WZYA 5J5GA 2W8FA 3SIOA 4B5DA 4QH5A 2XQ8A 3UQ7A 5J5HA 3P4WA 3ZKRA 4A98A 3PMZA 3C84A 4IREA 4UM1A 5BRXA 3TLSA 3EHZA 2XZ6A 3RQWA 4Z90A 5AFMB 4QH4A 4XHEA 5KE4A 4Z91A 4TWHA 5HCMA 4TWFA 1UV6A 4UY2A 3ZDHA 4DBMA 1I9BA 2XZ5A 3WTMA 4TNVA 2BG9A 3WIPA 4HFDA 5AFLA 4BQTA 4AFTA 4ZZBA 2X00D 5HCJA 5KZUA 4HQPA
chains in the Genus database with same CATH topology
3U8KA 2WNCA 3C79A 5HEOA 4ILAA 3RIFA 5L47A 4WV9A 4EZ1A 2XQ6A 2XYTA 2UZ6A 2Y57A 4NZBA 2BYNA 3EAMA 2WNLA 3RI5A 4TWDA 5AINA 3WTIA 4UM3S 5BP0A 2YKSA 5AFKA 3U8MA 4PIRA 3WTKA 3UU4A 2BYSA 4FRRA 5J5FA 5LG3A 2VL0A 4QAAA 3WTNA 5IUXA 1UW6A 4IL9A 5AFNA 4ZJSA 3RIAA 2WNJA 2Y58A 4AFHA 2XYSA 4ZJTA 3WTHA 3PEOA 4BFQA 4LMKA 4QABA 2PGZA 4UXUA 4LMLA 3UU3A 4D01A 5HEUA 4COFA 5AFMA 5HEJA 4HFBA 4ZK1A 2YMDA 5LXBA 4ZR6A 2XQ4A 4XK9A 3WTJA 2C9TA 5SYOA 5AFHA 3U8NA 2XQ3A 3T4MA 3JAFA 2BR8A 3JADA 3TLUA 3TLWA 3TLVA 4UM3P 3UU5A 2XQAA 4UM3A 5J0ZA 3WTOA 2XQ9A 4ILCA 2ZJVA 3TLTA 5BW2A 5HEHA 2Y54A 4ZRUA 2WN9A 4HFHA 5CFBA 5FJVA 2BYRA 3UU8A 2XNVA 5J5IA 4F8HA 4HFIA 4QACA 4ILBA 2BR7A 3WTLA 4ALXA 2BG9B 2BG9E 3GUAA 3U8LA 4AFGA 5L4HA 3UU6A 3P50A 4A97A 3RHWA 2Y56A 5CO5A 2XNUA 4HFEA 4QH1A 3RQUA 3UQ4A 4NPPA 4ZK4A 3UUBA 2X00A 5JMEA 2Y7YA 4IL4A 5HEGA 5TVCA 3SQ9A 5AFJA 2ZJUA 3JAEA 3SH1A 2YN6A 3IGQA 2QC1B 2XNTA 4LMJA 1UX2A 4HFCA 2PH9A 2BJ0A 2XQ5A 2YMEA 5L4EA 3U8JA 2BYQA 3EI0A 4TNWA 2XQ7A 2YOEA 3ZDGA 3LSVA 2BG9C 3SQ6A 2W8GA 4ZZCA 4X5TA 2BYPA 2WZYA 5J5GA 2W8FA 3SIOA 4B5DA 4QH5A 2XQ8A 3UQ7A 5J5HA 3P4WA 3ZKRA 4A98A 3PMZA 3C84A 4IREA 4UM1A 5BRXA 3TLSA 3EHZA 2XZ6A 3RQWA 4Z90A 5AFMB 4QH4A 4XHEA 5KE4A 4Z91A 4TWHA 5HCMA 4TWFA 1UV6A 4UY2A 3ZDHA 4DBMA 1I9BA 2XZ5A 3WTMA 4TNVA 2BG9A 3WIPA 4HFDA 5AFLA 4BQTA 4AFTA 4ZZBA 2X00D 5HCJA 5KZUA 4HQPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U8K A;  2WNC A;  3C79 A;  5HEO A;  4ILA A;  3RIF A;  5L47 A;  4WV9 A;  4EZ1 A;  2XQ6 A;  2XYT A;  2UZ6 A;  2Y57 A;  4NZB A;  2BYN A;  3EAM A;  2WNL A;  3RI5 A;  4TWD A;  5AIN A;  3WTI A;  4UM3 S;  5BP0 A;  2YKS A;  5AFK A;  3U8M A;  4PIR A;  3WTK A;  3UU4 A;  2BYS A;  4FRR A;  5J5F A;  5LG3 A;  2VL0 A;  4QAA A;  3WTN A;  5IUX A;  1UW6 A;  4IL9 A;  5AFN A;  4ZJS A;  3RIA A;  2WNJ A;  2Y58 A;  4AFH A;  2XYS A;  4ZJT A;  3WTH A;  3PEO A;  4BFQ A;  4LMK A;  4QAB A;  2PGZ A;  4UXU A;  4LML A;  3UU3 A;  4D01 A;  5HEU A;  4COF A;  5AFM A;  5HEJ A;  4HFB A;  4ZK1 A;  2YMD A;  5LXB A;  4ZR6 A;  2XQ4 A;  4XK9 A;  3WTJ A;  2C9T A;  5SYO A;  5AFH A;  3U8N A;  2XQ3 A;  3T4M A;  3JAF A;  2BR8 A;  3JAD A;  3TLU A;  3TLW A;  3TLV A;  4UM3 P;  3UU5 A;  2XQA A;  4UM3 A;  5J0Z A;  3WTO A;  2XQ9 A;  4ILC A;  2ZJV A;  3TLT A;  5BW2 A;  5HEH A;  2Y54 A;  4ZRU A;  2WN9 A;  4HFH A;  5CFB A;  5FJV A;  2BYR A;  3UU8 A;  2XNV A;  5J5I A;  4F8H A;  4HFI A;  4QAC A;  4ILB A;  2BR7 A;  3WTL A;  4ALX A;  2BG9 B;  2BG9 E;  3GUA A;  3U8L A;  4AFG A;  5L4H A;  3UU6 A;  3P50 A;  4A97 A;  3RHW A;  2Y56 A;  5CO5 A;  2XNU A;  4HFE A;  4QH1 A;  3RQU A;  3UQ4 A;  4NPP A;  4ZK4 A;  3UUB A;  2X00 A;  5JME A;  2Y7Y A;  4IL4 A;  5HEG A;  5TVC A;  3SQ9 A;  5AFJ A;  2ZJU A;  3JAE A;  3SH1 A;  2YN6 A;  3IGQ A;  2QC1 B;  2XNT A;  4LMJ A;  1UX2 A;  4HFC A;  2PH9 A;  2BJ0 A;  2XQ5 A;  2YME A;  5L4E A;  3U8J A;  2BYQ A;  3EI0 A;  4TNW A;  2XQ7 A;  2YOE A;  3ZDG A;  3LSV A;  2BG9 C;  3SQ6 A;  2W8G A;  4ZZC A;  4X5T A;  2BYP A;  2WZY A;  5J5G A;  2W8F A;  3SIO A;  4B5D A;  4QH5 A;  2XQ8 A;  3UQ7 A;  5J5H A;  3P4W A;  3ZKR A;  4A98 A;  3PMZ A;  3C84 A;  4IRE A;  4UM1 A;  5BRX A;  3TLS A;  3EHZ A;  2XZ6 A;  3RQW A;  4Z90 A;  5AFM B;  4QH4 A;  4XHE A;  5KE4 A;  4Z91 A;  4TWH A;  5HCM A;  4TWF A;  1UV6 A;  4UY2 A;  3ZDH A;  4DBM A;  1I9B A;  2XZ5 A;  3WTM A;  4TNV A;  2BG9 A;  3WIP A;  4HFD A;  5AFL A;  4BQT A;  4AFT A;  4ZZB A;  2X00 D;  5HCJ A;  5KZU A;  4HQP A; 
#chains in the Genus database with same CATH topology
 3U8K A;  2WNC A;  3C79 A;  5HEO A;  4ILA A;  3RIF A;  5L47 A;  4WV9 A;  4EZ1 A;  2XQ6 A;  2XYT A;  2UZ6 A;  2Y57 A;  4NZB A;  2BYN A;  3EAM A;  2WNL A;  3RI5 A;  4TWD A;  5AIN A;  3WTI A;  4UM3 S;  5BP0 A;  2YKS A;  5AFK A;  3U8M A;  4PIR A;  3WTK A;  3UU4 A;  2BYS A;  4FRR A;  5J5F A;  5LG3 A;  2VL0 A;  4QAA A;  3WTN A;  5IUX A;  1UW6 A;  4IL9 A;  5AFN A;  4ZJS A;  3RIA A;  2WNJ A;  2Y58 A;  4AFH A;  2XYS A;  4ZJT A;  3WTH A;  3PEO A;  4BFQ A;  4LMK A;  4QAB A;  2PGZ A;  4UXU A;  4LML A;  3UU3 A;  4D01 A;  5HEU A;  4COF A;  5AFM A;  5HEJ A;  4HFB A;  4ZK1 A;  2YMD A;  5LXB A;  4ZR6 A;  2XQ4 A;  4XK9 A;  3WTJ A;  2C9T A;  5SYO A;  5AFH A;  3U8N A;  2XQ3 A;  3T4M A;  3JAF A;  2BR8 A;  3JAD A;  3TLU A;  3TLW A;  3TLV A;  4UM3 P;  3UU5 A;  2XQA A;  4UM3 A;  5J0Z A;  3WTO A;  2XQ9 A;  4ILC A;  2ZJV A;  3TLT A;  5BW2 A;  5HEH A;  2Y54 A;  4ZRU A;  2WN9 A;  4HFH A;  5CFB A;  5FJV A;  2BYR A;  3UU8 A;  2XNV A;  5J5I A;  4F8H A;  4HFI A;  4QAC A;  4ILB A;  2BR7 A;  3WTL A;  4ALX A;  2BG9 B;  2BG9 E;  3GUA A;  3U8L A;  4AFG A;  5L4H A;  3UU6 A;  3P50 A;  4A97 A;  3RHW A;  2Y56 A;  5CO5 A;  2XNU A;  4HFE A;  4QH1 A;  3RQU A;  3UQ4 A;  4NPP A;  4ZK4 A;  3UUB A;  2X00 A;  5JME A;  2Y7Y A;  4IL4 A;  5HEG A;  5TVC A;  3SQ9 A;  5AFJ A;  2ZJU A;  3JAE A;  3SH1 A;  2YN6 A;  3IGQ A;  2QC1 B;  2XNT A;  4LMJ A;  1UX2 A;  4HFC A;  2PH9 A;  2BJ0 A;  2XQ5 A;  2YME A;  5L4E A;  3U8J A;  2BYQ A;  3EI0 A;  4TNW A;  2XQ7 A;  2YOE A;  3ZDG A;  3LSV A;  2BG9 C;  3SQ6 A;  2W8G A;  4ZZC A;  4X5T A;  2BYP A;  2WZY A;  5J5G A;  2W8F A;  3SIO A;  4B5D A;  4QH5 A;  2XQ8 A;  3UQ7 A;  5J5H A;  3P4W A;  3ZKR A;  4A98 A;  3PMZ A;  3C84 A;  4IRE A;  4UM1 A;  5BRX A;  3TLS A;  3EHZ A;  2XZ6 A;  3RQW A;  4Z90 A;  5AFM B;  4QH4 A;  4XHE A;  5KE4 A;  4Z91 A;  4TWH A;  5HCM A;  4TWF A;  1UV6 A;  4UY2 A;  3ZDH A;  4DBM A;  1I9B A;  2XZ5 A;  3WTM A;  4TNV A;  2BG9 A;  3WIP A;  4HFD A;  5AFL A;  4BQT A;  4AFT A;  4ZZB A;  2X00 D;  5HCJ A;  5KZU A;  4HQP A; 
#chains in the Genus database with same CATH homology
 3U8K A;  2WNC A;  3C79 A;  5HEO A;  4ILA A;  3RIF A;  5L47 A;  4WV9 A;  4EZ1 A;  2XQ6 A;  2XYT A;  2UZ6 A;  2Y57 A;  4NZB A;  2BYN A;  3EAM A;  2WNL A;  3RI5 A;  4TWD A;  5AIN A;  3WTI A;  4UM3 S;  5BP0 A;  2YKS A;  5AFK A;  3U8M A;  4PIR A;  3WTK A;  3UU4 A;  2BYS A;  4FRR A;  5J5F A;  5LG3 A;  2VL0 A;  4QAA A;  3WTN A;  5IUX A;  1UW6 A;  4IL9 A;  5AFN A;  4ZJS A;  3RIA A;  2WNJ A;  2Y58 A;  4AFH A;  2XYS A;  4ZJT A;  3WTH A;  3PEO A;  4BFQ A;  4LMK A;  4QAB A;  2PGZ A;  4UXU A;  4LML A;  3UU3 A;  4D01 A;  5HEU A;  4COF A;  5AFM A;  5HEJ A;  4HFB A;  4ZK1 A;  2YMD A;  5LXB A;  4ZR6 A;  2XQ4 A;  4XK9 A;  3WTJ A;  2C9T A;  5SYO A;  5AFH A;  3U8N A;  2XQ3 A;  3T4M A;  3JAF A;  2BR8 A;  3JAD A;  3TLU A;  3TLW A;  3TLV A;  4UM3 P;  3UU5 A;  2XQA A;  4UM3 A;  5J0Z A;  3WTO A;  2XQ9 A;  4ILC A;  2ZJV A;  3TLT A;  5BW2 A;  5HEH A;  2Y54 A;  4ZRU A;  2WN9 A;  4HFH A;  5CFB A;  5FJV A;  2BYR A;  3UU8 A;  2XNV A;  5J5I A;  4F8H A;  4HFI A;  4QAC A;  4ILB A;  2BR7 A;  3WTL A;  4ALX A;  2BG9 B;  2BG9 E;  3GUA A;  3U8L A;  4AFG A;  5L4H A;  3UU6 A;  3P50 A;  4A97 A;  3RHW A;  2Y56 A;  5CO5 A;  2XNU A;  4HFE A;  4QH1 A;  3RQU A;  3UQ4 A;  4NPP A;  4ZK4 A;  3UUB A;  2X00 A;  5JME A;  2Y7Y A;  4IL4 A;  5HEG A;  5TVC A;  3SQ9 A;  5AFJ A;  2ZJU A;  3JAE A;  3SH1 A;  2YN6 A;  3IGQ A;  2QC1 B;  2XNT A;  4LMJ A;  1UX2 A;  4HFC A;  2PH9 A;  2BJ0 A;  2XQ5 A;  2YME A;  5L4E A;  3U8J A;  2BYQ A;  3EI0 A;  4TNW A;  2XQ7 A;  2YOE A;  3ZDG A;  3LSV A;  2BG9 C;  3SQ6 A;  2W8G A;  4ZZC A;  4X5T A;  2BYP A;  2WZY A;  5J5G A;  2W8F A;  3SIO A;  4B5D A;  4QH5 A;  2XQ8 A;  3UQ7 A;  5J5H A;  3P4W A;  3ZKR A;  4A98 A;  3PMZ A;  3C84 A;  4IRE A;  4UM1 A;  5BRX A;  3TLS A;  3EHZ A;  2XZ6 A;  3RQW A;  4Z90 A;  5AFM B;  4QH4 A;  4XHE A;  5KE4 A;  4Z91 A;  4TWH A;  5HCM A;  4TWF A;  1UV6 A;  4UY2 A;  3ZDH A;  4DBM A;  1I9B A;  2XZ5 A;  3WTM A;  4TNV A;  2BG9 A;  3WIP A;  4HFD A;  5AFL A;  4BQT A;  4AFT A;  4ZZB A;  2X00 D;  5HCJ A;  5KZU A;  4HQP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...