5AFUA

Cryo-em structure of dynein tail-dynactin-bicd2n complex
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
370
structure length
370
Chain Sequence
IANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKEQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Dynactin Complex and its Interaction with Dynein.
pubmed doi rcsb
molecule keywords DYNEIN TAIL
molecule tags Motor protein
total genus 85
structure length 370
sequence length 370
chains with identical sequence B, C, D, E, F, G, I
ec nomenclature
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5afuA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5afuA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 5afuA03
2A42A 4FWKA 5AZJA 3QICA 1V4SA 3CERA 2E1ZA 4I6MA 1BOTO 1GLEG 4BG9A 2QW9A 5AQTA 2NZTA 1BUPA 1V4TA 3HTVA 3SJHA 5KPZA 4BR2A 1X9JA 5BPNA 1HUXA 2F9TA 5AQSA 1DGKN 3VEVA 3VF4A 3ATUA 2P9NA 3B8AX 3DWLA 5BN9A 1JCGA 1MWKA 5AQGA 2P9PA 3QBWA 3O80A 4XH4A 1NGDA 2OANA 4M63C 4XH1A 3WQUA 3ZEUB 4CZHA 4JD2B 5CE3A 2QM1A 3EZWA 5AQHA 4DCHA 1NMDA 2E2NA 4H03B 2AA4A 4CBXA 4FWRA 4M7XA 3BP8A 1NGJA 2I7PA 4KBOA 4BRKA 4BVPA 4AM7A 3M3ZA 5E26A 2YJEA 3C0BA 4A62A 3DJCA 4H0PA 2A5XA 3VEWA 4B1ZA 2D4WA 4NO7A 3HI0A 4GY2B 1K8KA 1R59O 5AR0A 1E4FT 2QWPA 1DKGD 3CQYA 3FLCO 1ATNA 4HWIA 4B1XB 3WT0A 3F9MA 3DAWA 4PKGA 4CD1A 3M6GA 4IJNA 4H0XB 5JICA 5AQRA 3ZETA 1BU6O 4BRCA 4BR5A 3MN9A 5TKYA 1HLUA 3WXLA 5E84A 3RSEA 3UKRA 3MMVA 3CETA 2ZF5O 4B1YB 3A0IX 2E2OA 3HM8A 3KHYA 3TU5A 3MN6A 5AQFA 2CGLA 3VF6A 2Q31A 1HKBA 2P9UB 4BRAA 3HZ6A 4BRDA 4BC5A 5F1XA 4BRNA 3LDOA 3A5OC 3VEYA 5AQWA 1HKGA 2EWSA 4B1VA 4CZFA 5ELZA 3D2FA 1NGEA 1GLBG 4BREA 4J8FA 1SZ2A 4XH5A 5B8HA 3DXMA 2F9WA 4O5FA 3ULEB 5AQQA 4BVOA 1DEJA 3WXKA 4K25A 3O5BA 3HSCA 1Q18A 1NGIA 2VYPA 3GE1A 3O8MA 3H45C 3A5LC 4IXCA 2IVNA 2ASMA 4CBWA 3CHWA 1H1VA 1X3NA 2P9LA 4WQ4C 2P9KA 3OHRA 1BWFO 4CZKA 2Q97A 3U8XA 3L4IA 4RWTA 3CJCA 2FF3B 1TYQA 4MO5A 3VERA 3EKUA 2GWJA 5AZIA 3UKUB 3AY9A 4FSVA 3P4IA 1ESVA 1YVNA 3H3OB 1T44A 4IZ9A 2W41A 1KAYA 3A8YA 1T6DA 3LDQA 2E20A 1ATSA 4QS7A 1ZXOA 4BR7A 3SK3A 2ZWHA 2ITMA 4BRGA 5FPDA 4FO0A 4FWMA 4AM6A 5AQMA 4MLHA 2E2PA 2V52B 3ZX0A 1U6ZA 3WEEA 4CJ7A 3C7NB 2Q36A 3LDLA 3QBXA 5LJVA 2W40A 4BGBA 1WOQA 4FOEA 1ATRA 1NBWA 2NLXA 2A40A 2Q1NA 4I6MB 4PL7A 5I9EB 5BR9A 4BQLA 4PL8A 4QS8A 1Z05A 4H0OA 4H0YB 3R9PA 4ISGA 5ADXA 4WQ5C 2PAVA 3VEOA 1C0FA 5F2RA 3VEXA 4JHDA 3D2EA 5AQIA 5EY4A 4O8KA 3M1FA 2P9PB 4BR0A 1ZC6A 5AQXA 4BRMA 2V51B 3O4WA 4CZIA 4BRIA 2GTDA 3U9DA 4YDUC 3GG4A 2FF6A 4FWPA 1QHAA 4QS9A 4BC2A 4DB3A 3IDHA 4FWNA 3I33A 2CH6A 2QWNA 2FLOA 1HPMA 1NWKA 1XQSC 2V7YA 3U4LA 4DHYA 2P9IB 4CI6A 3R6MA 4A61A 1LOTB 3FZFA 3CJBA 4CZEA 4WQ5A 3TPQA 2YCHA 4IJAA 2IVOA 4H5WA 2QWRA 3L6QA 3ZEUA 3S41A 4FOIA 1NGAA 1HX1A 4FPBA 4JD2A 2GEMA 3GDQA 3D7EO 1GLCG 1SAZA 2CH5A 4PKIA 3A5MC 3AARA 1D4XA 2P9SB 3ENHA 4XEIA 4BRLA 1NGGA 2A6AA 5BRFA 2E1YA 3ZETB 1RFQA 2QWOA 2Q0RA 2ZGYA 4B1UB 4YDUA 3U9ZA 3DXKB 4CBUA 3CI5A 4H5RA 4Y0WA 3I8BA 5AQVA 2ASPA 4RCHA 3FZKA 2FXUA 4FWOA 4CD3A 1Z6RA 1HKCA 1HJOA 3QDKA 5BN8A 4JN4A 3J8AA 5LJWA 2V7ZA 3W3DA 1KAXA 4B1WB 4F9OA 5FPEA 3H6EA 1X3MA 3ENOA 3IMXA 1MA9B 1XC3A 3GBTA 5EOYA 3G25A 2HF4A 2A3ZA 1RDWX 1YAGA 2Q0UA 3UB5A 1E4GT 2FSKA 2P9LB 2P9KB 2WUSA 4BRHA 5BPMA 1WUAA 3FZLA 5AQPA 2GWKA 2HOEA 3H46O 3R8EA 3WXJA 3BF1A 1BDGA 5BPLA 2YHWA 3SMSA 3BUZB 5EVZA 3QMLA 2ZGZA 1IG8A 3MCPA 2HMPA 3ULEA 3H1VX 1EQYA 3FE1A 3VGLA 1U2VA 3QB0A 3GL1A 2QXLA 4Z94A 5AQZA 3VOVA 4FL9A 3O1BA 3CJ1A 3WEEB 1GLFO 1QZ6A 1NLVA 1RGIA 5KQ8A 3O08A 4WQ4A 3EL2A 4MLEA 5AZJB 4BR9A 5ADXH 4E1JA 3JXUA 3W0LA 4EIAA 5KPTA 2YI1A 4JNEA 5AFUA 3BEXA 4MO4A 3MK6A 3QFUA 1NGFA 4A2BA 2BUPA 1J6ZA 3O1WA 4BROA 5EX5A 2P9NB 3VGMA 3D2EB 3ZX2A 5JLHA 4H5TA 1IJJA 2AP1A 3C7NA 2E88A 1P8ZA 3SMPA 2D0OA 4FWQA 4BG8A 4BC3A 5AQNA 3AAPA 4IO8A 1JCFA 4IWVA 2PBDA 2YJFA 4H5NA 2KHOA 1T6CA 4PKHA 1JCEA 3KVGA 1YXQA 3WUHA 4L3QA 1QQOA 2VWBA 5FPMA 3QFPA 4JAXA 3LM2A 5JLFA 4ISEA 1TUYA 3IFRA 3FZMA 3UE5A 3LL3A 1K8KB 3L0QA 3H1QA 1GLLO 3FFKB 2QWMA 4CZJA 2IVPA 1GLAG 4CZGA 4C23A 3IUCA 4CZMA 3CJAA 2UYTA 3VEZA 1QQNA 2D0PA 3HBTA 4BQZA 1QQMA 3ID8A 4GNIA 4EHUA 1XUPO 1OKJA 1BO5O 4FPAA 2P9IA 3RSEB 3UKRB 2E8AA 1BG3A 2H3GX 3VESA 4FWSA 4BRPA 2QWLA 1NM1A 3KZBA 4H0TB 3VF2A 1KXPA 2YHYA 3MN5A 3ZX3A 4WYBA 3EN9A 5AQOA 1GLDG 3D2FB 1Y64A 2GUPA 1S22A 2P9SA 1GLJO 3DXMB 4K41A 5AQKA 2DPNA 5JMVA 5AQYA 5EXWA 4M7YA 3VETA 3CJ7A 4CZLA 3DXKA 3FGUA 4K42A 3CQXA 3GOIA 1SQKA 2P9UA 2CGJA 4BC4A 3VENA 4EFHA 1TYQB 3EO3A 4BRQA 2FSNA 3JS6A 1KAZA 5AQJA 5AZIB 3WXIA 5BRDA 3ATVA 3A5NC 2E2QA 1MDUB 2VCPA 2YHXA 3EKSA 3VPZA 1NGBA 1BA0A 1U2VB 3BF3A 2QWQA 3CJ9A 4FWLA 4K43A 4NB4A 3LDNA 5BREA 1G99A 3LDPA 1TUUA 2Q2RA 3MDQA 5F0XA 1NGCA 1LCUA 2ASOA 3VGKA 1QZ5A 3CIPA 5KPRA 4BR4A 2NRHA 3SLCA 4EAHD 2J4RA 1C0GA 4BRFA 5AFUH 2I7NA 4LC9B 2GELA 4HTLA 3H3NO 3UKUA 2D1KA 3FZHA 1MWMA 4B9QA 2FSJA 3O6WA 4H5VA 4EHTA 5KQDA 1BA1A 2IIRA 1ZBSA 5AQUA 3LM9A 1NGHA 1CZAN 3AAQA 5FPNA 4DQ8A 5LY3A 2BTFA 3FR0A 2HF3A 4H0VB 4A2AA 3WQTA 2A41A 5BRHA 1S3XA 4JHDB 4BGAA 3MN7A 4ISFA 4RTFD 1YUWA 2CGKA 5AQLA
chains in the Genus database with same CATH superfamily
5HBMA 3MX2A 3NGYA 4YOVA 3NHGA 3DRSA 4IKFA 3OYMA 3CERA 4BG9A 2QW9A 5AQTA 1BUPA 2P1JA 5KPZA 3AA4A 4CGFA 4JS4A 5AQSA 3QESA 3VEVA 1A5WA 3DWLA 3VQEA 1JCGA 2AJQA 1Q82O 3O80A 4PY5A 2NRRA 4CIGA 3OS2A 1NGDA 3RWUA 2KLAA 1U47A 3ZEUB 4B9NA 5CE3A 4AHTA 4DCHA 1W7AA 1NMDA 2E2NA 2NUBA 4FLUA 3J80O 2AA4A 4CK2A 1VRUA 4CBXA 2I7PA 4KBOA 3VQPA 1X9MA 1NK0A 1RT3A 5E26A 3C0BA 4H0PA 1TK8A 4B1ZA 3L2QA 4NO7A 1VSMA 3HI0A 1R59O 4FZYA 1L3VA 5D3GA 2QWPA 3CQYA 2VWKA 2IC3A 1HQUA 2QKBA 4DR4K 2HNDA 2O8BB 5GAEP 1NK6A 1CXUA 4ILJA 5AQRA 3ID6A 4BRCA 4BR5A 4FLXA 3WNFA 1W2BM 5TKYA 1RTDA 2HHWA 1XNRK 1CLQA 3MMVA 4JK8A 4CEZA 1TKXA 1KFSA 3KHYA 3TU5A 3MN6A 5AQFA 2XY8A 2CGLA 1N32K 1VK0A 3RMAA 4BC5A 3OW2M 2JLEA 2XY6A 1J53A 1NGEA 3C6TA 3CG7A 3KK7A 5B8HA 2X6SA 4J2DA 5IT9O 3OS0A 1NJYA 3G10A 3O5BA 4FJ7A 3BY5A 3PV8A 1C0UA 2QKKA 4CBWA 1J9AA 1X3NA 4WQ4C 4ID1A 3M8RA 4LH4A 4DV2K 4CZKA 3LZJA 2Q97A 4H4MA 3U8XA 3MXMA 3IS9A 3O9QA 1IG9A 4DR2K 3VERA 1WN7A 2FBTA 1RTJA 3UKUB 3VQ6A 2P5GA 1T6DA 4DF4A 1FW6A 3VN5A 1QTMA 4BR7A 3CMEN 4YOTA 2ITMA 4BRGA 3LWLA 3AVGA 4MLHA 4JI4K 3S3MA 4B9LA 4RG8A 3AA2A 1T05A 1IKYA 4CJ7A 3QEWA 3LDLA 3QINA 3WNGA 1J5EK 1EXQA 1WOQA 4FLVA 4FOEA 3A2FA 2NLXA 2OPSA 3RMCA 5I9EB 2OZMA 3NGIA 4GW6A 4BQLA 3SUQA 4A57A 3EE9A 3KLGA 1LAWA 3NF7A 4H0YB 4DV3K 1ZYQA 2HW3A 1NOZA 2IDOA 3WNHA 4JHDA 4YOUA 3D2EA 4ELUA 2PY5A 4BE1A 4LFAK 3ZT1A 2FBYA 1KLMA 1B9DA 2XHBA 3THXB 2IAJA 4BRMA 4YOYA 3K5NA 5I3UA 1VSKA 5C24A 3SBGA 2DTUA 2YX6A 2GTDA 3U9DA 1OVQA 3LP3A 4QS9A 4DF8A 4ZTFA 2W6LA 1HYVA 4JKGB 1NWKA 4DV5K 2HB5A 3C6UA 4YOXA 3FZFA 1YTUA 4B9UA 2W00A 1QSSA 4H5WA 3O3GA 4DTPA 2OTJN 3ZEUA 1S5JA 3VQ9A 2HHQA 3A5MC 3AARA 1D4XA 4BRLA 5BRFA 1BQNA 2ETJA 4G9ZA 2E1YA 3ZETB 1IH7A 4FJXA 2Q0RA 4CFAA 1EETA 1O13A 4B1UB 4AHUA 1SKRA 3U9ZA 3DXKB 3OBYA 1NK5A 5LL6Z 2ASPA 3FZKA 1Z6RA 3SAFA 4I9QA 2B4JA 4KHYA 3K9KA 3W3DA 2Z1HA 4B1WB 1NG9A 2O8BA 1LAVA 3ENOA 3IMXA 4DR7K 1VQNN 2Q3SA 3J81O 3G25A 3RR8A 4YHHK 2RHKA 4NXNK 1RDWX 3SCXA 1YAGA 4IDHA 2C1IA 2WUSA 1WUAA 3PIPL 3V9ZA 4F4KA 2O8CA 3BF1A 1BDGA 4FW1A 5BPLA 3OYBA 3SPZA 3SMSA 5EVZA 1NJIO 2XO7A 1S72N 3H1VX 1EQYA 4CK3A 3FE1A 2QK9A 3V1OA 3AO3A 3MCAB 1KTQA 2GBZA 2QXLA 3OA9A 3CFRA 3G4SN 2YHBA 5AQZA 1I3AA 4JI6K 4JI8K 4M3RA 3J7ZO 3TABA 3C65A 3CJ1A 4R5PA 4DS5A 2ZE2A 3PX6A 1K9MO 4KB0A 2WTUA 3K59A 3VQ4A 5ADXH 3EY1A 1IV0A 4Q5VA 4DR3K 4CEAA 2RPIA 1T7PA 3MK6A 2W6KA 1NGFA 3OYLA 3QEXA 3AVKA 5EX5A 3HRGA 3VGMA 1VSDA 3M5RA 2DY4A 1EKEA 1VQ8N 2DFHA 4FLYA 2E88A 3AO2A 1FKOA 4JV5K 2OTLN 4FWQA 4BG8A 4BC3A 1WAFA 1JCFA 3ZSRA 4C8KA 2PZSA 3OYEA 2VWJA 1VAZA 2P51A 1VQ4N 4CVNE 4CJRA 4PWDA 1T6CA 4FLTA 1I94K 4KHPK 1JCEA 3LALA 5HL7L 3F5TA 3L2WA 4JAXA 5H1SQ 4O5BA 1HNIA 5BR8K 3KIOA 3BZKA 3OJSA 5C0YA 1YTAA 3THXA 1GLLO 4CE9A 2QWMA 3MXJA 2OA8A 1GLAG 4N76A 3IG1A 4IOXA 1QQNA 1X9WA 2D0PA 1JLBA 1XHXA 1QQMA 4GNIA 4EHUA 3PSIA 1BO5O 4PUOA 4FPAA 5C12A 4HUGA 2H3GX 4O55A 3VESA 3G71N 1RBUA 2QWLA 1YJ9N 4K8ZA 3DLLL 4HHTA 2YHYA 3ZX3A 3L2VA 5LMUK 4CJUA 4KTZA 1S9EA 3PIOL 4IBNA 4DMNA 3F9KA 4X62K 4CFCA 1BI4B 3L3UA 1WSJA 4M7YA 4CZLA 4ZHRA 3DXKA 3O9RA 3SAGA 4K42A 3DI6A 5MLCQ 3GOIA 4Z4EA 3T1YK 4HTUA 4M3YA 1BHLA 3KK2A 2P9UA 3ALYA 4I7FA 4LD0A 2XRIA 4B8AB 1ASUA 3KD1E 2FSNA 3JS6A 5AZIB 5IWAK 2YV0X 3WXIA 3KJVA 1IKVA 2E2QA 3EKSA 3U3YA 1QQCA 1TK0A 2QWQA 4LY7A 1Q9XA 3LDNA 4CIEA 2UUBK 2Q2RA 1J54A 4X64K 3R3LA 3CIPA 5HRNA 4EAHD 3LP0A 3SUNA 1D9FA 3SI6A 3DLKA 4QAGA 4L8RB 4HTLA 4PHTX 3MEDA 3H3NO 1C1BA 4DUYK 4B9QA 3KLEA 4EHTA 4X66K 2O8DB 3O3HA 1VHXA 1NGHA 4DQ8A 3FR0A 1L3SA 4CJQA 3P38A 2O4GA 4PQUA 4H0VB 4Z4CA 4DSJA 1S3XA 1L3UA 4DFJA 3E01A 3DMJA 4ZTJA 2VG6A 5AQLA 2A42A 3QICA 3NCIA 4NCBA 4OGEA 3BGRA 2E1ZA 4I6MA 3L2UA 1GLEG 2DFFA 3T7ZA 4B9SA 4CCHA 1XWLA 3K5MA 5BPNA 3VF4A 4CFBA 1EWRA 4KTQA 1MWKA 4RW7A 1YIJN 2OANA 3K0SA 4M63C 4NLCA 1OVYA 2QA4N 5AQHA 1ZBUA 4F3OA 2FC0A 1FJGK 1NJZA 2GV9A 1VQ9N 4M7XA 1NGJA 1NU0A 3AA3A 4CJEA 4BVPA 1QVGM 2YJEA 3VEWA 4WE1A 1P90A 4QOZB 1BCOA 4DU4A 1DKGD 3AVAA 3V9SA 4FK2A 3FLCO 3SQ4A 1G15A 3F9MA 3DAWA 1NOYA 3M8SA 3KK3A 4IJNA 3THWA 2O4IA 3JYTA 4DSEA 5TKWA 3F2KA 4BECA 3WXLA 1ZBFA 2ZF5O 2WBNA 4C8NA 3A0IX 2E2OA 3HM8A 4B1YB 3S3OA 4C8LA 3VF6A 2Q31A 2BE2A 3CM6A 1W97L 4BRAA 4JKFA 1RBRA 4BRDA 3LDOA 3A5OC 4IG3A 4BREA 4FJJA 4IOCL 3KK1A 1SZ2A 4AHRA 3NF9A 4O5FA 1JLGA 1N33K 3CF5L 4DQPA 4A59A 2VYPA 4RW4A 2UUAK 2XY5A 2ASMA 3TAPA 2P9KA 3O4NA 1BWFO 4LF8K 3K2PA 4FJMA 4ID5A 3CJCA 2FF3B 2G8KA 4MO5A 2GWJA 5AZIA 1OH7A 3AY9A 3P4IA 1YVNA 3H3OB 1T44A 3PO5A 2W41A 3AVBA 4KREA 2OYQA 4Z4FA 4IFEA 3MEGA 2QXFA 4FWMA 5AQMA 4DV0K 3C95A 4FJHA 4IFYA 3WEEA 2PYLA 1L5UA 2Q36A 3QBXA 5LJVA 4BGBA 5EU7A 4DTMA 1YJNN 4RW9A 1ATRA 3L3VA 3SYZA 3DOLA 4PL7A 2O8DA 5BR9A 3EEQA 2F4VK 4PL8A 3ZSQA 1Z05A 4H0OA 2ZJQL 3R9PA 4B3OA 4H4OA 4FJIA 3KWIA 1UOCA 4ISGA 3VA0A 3TI0A 1C0FA 3VEXA 2X78A 5I42A 2RE2A 4O8KA 2P9PB 4BR0A 1S1VA 3DLBA 4EP5A 4OJRA 2E6LA 4CJWA 4E72A 3CYGA 1LV5A 2WC9A 1NMNA 4FWPA 1QHAA 4DB3A 5JVGL 1SL0A 1D9DA 1RT1A 2HSTA 4JI0K 3I33A 1SV5A 1HPMA 1SL2A 3IRXA 5SWMA 3VQDA 4CGDA 3LZIA 1OH8A 2F8SA 3EE8A 2WFBA 4LF6K 1NGAA 3GDQA 4DUZK 4HCBA 3D0PA 1SAZA 3ITHA 4PKIA 4IG0A 4XEIA 3ENHA 2A6AA 2QWOA 3TR8A 4AHCA 3OYCA 4CBUA 5C10A 4DQRA 3NDKA 3CI5A 4WCEL 1REVA 2ITGA 4Y0WA 3Q7CA 2KW4A 4FWOA 1CZBA 1DTQA 3TSUA 3SPYA 1VQMN 3HPHA 3THYB 1N6QA 1YHQN 4DG1A 3KWGA 2V7ZA 1KAXA 3SUPA 3MWPA 3OYAA 1X3MA 3M8PA 1C0TA 1MA9B 3CQ8A 1XC3A 4LF9K 2A1RA 3B6OA 3O9TA 2KZZA 1WSFA 2OCEA 4JI5K 2NRXA 1E4GT 1JJ2M 1FXXA 3ZT0A 2P9LB 4BRHA 3SQ2A 5BPMA 2ZM6K 4CJFA 3DOKA 4CEEA 5KRTA 3Q7BA 3NGZA 4ELTA 3K57A 2UXCK 3QMLA 2HMPA 4W5TA 3CCQN 3P31A 1W0HA 5FROA 4ILGB 3CC4N 3VGLA 3ZSOA 1U2VA 5M1KA 1MU2A 1VSIA 4ICLA 4MDBA 3ZLJA 4CF0A 4FL9A 1NNEA 3CD6N 1GLFO 1WBDA 3LP1A 1NLVA 5KQ8A 4CEOA 4WQ4A 3QIOA 1T03A 4CHYA 1VQON 5HRPA 4E7IA 4EIAA 3I0SA 5KPTA 4GV6A 3DRPA 5M1PA 2HHUA 2GX9A 3CMAN 3OYGA 4JYAK 1TK5A 3BEXA 4MO4A 5J2PA 3KLFA 2LSNA 3DRRA 4A2BA 4V19S 5M1OA 1J6ZA 5SZTA 1W9HA 3K5OA 1HQEA 4H5TA 3E9OA 2AP1A 1JLEA 1RDDA 2D0OA 4CJVA 3AAPA 4IO8A 4IWVA 4I9LA 4AQYK 3SV3A 3DLEA 4JRPA 4CECA 2KQ2A 2KHOA 4U67L 1SKSA 3SNNA 4FJ5A 4JI1K 3KVGA 1YXQA 1QQOA 1VSEA 2NRVA 5FPMA 3TAGA 3LM2A 4ISEA 2E4LA 1TUYA 4LSLA 3AO5A 4CJ3A 3BDPA 3FZMA 4A5BA 1N34K 1K8KB 3H1QA 4DR5K 1BCMA 3FFKB 3U6FA 3PX4A 2NNWA 4CZJA 2IVPA 4CZGA 4DU1A 4CESA 4DKWA 4CZMA 3ZSWA 4R79A 3NMUA 3ASMA 4BQZA 2ZQBA 3P83D 4DTOA 1XUPO 4C8MA 1KSPA 5FLXO 4W5QA 3RSEB 1S6PA 3N4QA 4TSXA 3VTHA 4BEBA 3NF6A 4FM1A 3ZCMA 4H0TB 3ZT4A 3NH1A 3MN5A 4I2QA 1RNHA 3MWTA 3D2FB 1IKWA 4K41A 5AQKA 5JMVA 4LSNA 5AQYA 5EXWA 1Z25A 1DTTA 3CJ7A 1YF5L 4OPJA 3FGUA 1O1WA 3EYZA 4DFKA 4CGGA 1HYSA 4DS4A 5T7BA 1JLAA 3OYFA 5GAGP 3VQAA 4CJ4A 3O9SA 3THYA 3U3GA 4JLHA 4EFHA 4M3XA 1TYQB 5DK5A 3EO3A 2HBJA 1S1WA 1XI1A 5BRDA 1BQMA 4Z0UA 2VCPA 2YHXA 4DR1K 3MEEA 3VQ7A 1TUUA 5F0XA 3ISNC 2ASOA 3ZSVA 1FKPA 3VGKA 3K9JA 4WFBL 3TAFA 2J4RA 3O4QA 4X65K 3LDSA 3V6DA 4BRFA 3H08A 5AFUH 4BWJA 3UKUA 2D1KA 1WB9A 4B9VA 3NFAA 2X6NA 3O6WA 5KQDA 1M90O 1RILA 1JLFA 4KH6A 1CZAN 3AAQA 1VQPN 3OYJA 2BTFA 2HF3A 1HNXK 3THVA 4FLZA 4CJKA 4CEDA 1N5YA 2P5OA 5JENA 3I0RA 5E41A 1YUWA 5AQGA 1LWCA 2CGKA 2BANA 1QE1A 4FWKA 1WSHA 2IGIA 3T69A 1RBVA 1GOAA 2RKIA 1TKZA 1KRPA 4CW7B 4KAZA 4N41A 4NCAA 2NZTA 4JK9A 3OYDA 4Z4HA 4BR2A 2F9TA 4DQSA 4K8XA 1SKWA 3ATUA 5BN9A 4DTUA 2F7TA 4G1QA 4DQIA 3V4IA 4XH1A 4CZHA 3WQUA 4FLWA 4KRFA 1K73O 4JD2B 3KKRA 2QM1A 2PFUA 1BL3A 1QVFM 3J7AP 5C25A 3QLHA 4RW6A 4H03B 4DSFA 3HSTB 1M1KO 4N5SA 4JKGA 4BRKA 3ZT3A 4Y1DA 3K5LA 3RTVA 4HUFA 3M3ZA 2G8IA 3DJCA 4NYFA 4E7LA 3ZT2A 4IEIA 3RVCA 4GV9A 1DLOA 2D4WA 3PO4A 1K8KA 3QEPA 3CPEA 1E4FT 1BIUA 3QEVA 2Y1IA 1ATNA 4HWIA 3SUOA 4PKGA 1RT6A 4H0XB 1EWQA 3N4PA 5KGWA 3ZETA 2X74A 3AVMA 4AF1A 4LFBK 1ASWA 3CCRN 1N8RO 5J1EA 5FRMA 4B3RK 4Q0BA 2OPRA 3RSEA 3CETA 2OPPA 1U49A 3CCUN 4F3TA 1F21A 2FBXA 4WFNL 5M1QA 3AVFA 3CC7N 3LPTA 1UWBA 5DMRA 1UA0A 3HVTA 1CXQA 3OBWA 4CGJA 4BRNA 4FJ8A 1A5XA 3VEYA 1HKGA 4B1VA 3TAQA 4K0KK 3D2FA 1VRTA 1S1TA 2EX3A 3RR7A 3L8BA 3ULEB 4BVOA 3WXKA 4K25A 3HSCA 1Q18A 5HP1A 1S6QA 3H45C 4RW8A 4DTSA 2IVNA 2PYJA 3WNEA 1H1VA 1KC8O 3LP2A 4JI3K 3C6AA 1VSJA 3VA3A 3V1RA 3L4IA 4M42A 4RWTA 5M1FA 4OPHA 1C6VA 1TYQA 3LAKA 3B6PA 3EKUA 4CERA 5M1NA 4ELVA 2YNFA 1ESVA 4IZ9A 1KAYA 3LDQA 1JL2A 4E0DA 1ATSA 4LH5A 2O8EB 4QS7A 2ZWHA 1Z26A 4CGIA 4FO0A 4AM6A 3ZX0A 2E2PA 3ENBA 1U6ZA 4CJ5A 5J2MA 2ATQA 5CZ2A 3C7NB 5HOOA 3CCEN 4CHPA 4J2AA 2HHHK 2W40A 4QCLA 4B8CA 3HPGA 3RRGA 1NBWA 2A40A 3HVRA 4Z4IA 1ZBLA 3MECA 1WSGA 4QS8A 4J2BA 1C1AA 5HROA 5ADXA 4WQ5C 2W42A 4B08A 1BIZA 4BY9C 5F2RA 4B9MA 1TVRA 2VQFK 3UIQA 1RTHA 5AQIA 5EY4A 3M1FA 5CYMA 1ZC6A 1QSYA 3AGRA 4EZ6A 2V51B 3O4WA 2VQEK 3KLHA 4B3TK 4CZIA 1RDBA 4BRIA 3BZCA 4YDUC 4BC2A 2FF6A 2HNZA 4GKKK 4YY3K 3MAQA 4Y1CA 4FWNA 2CH6A 4GKJK 4DTJA 1Q81O 3R6MA 4EZ9A 4A61A 1ASVA 3QEIA 2YNGA 3VQ5A 4WQ5A 4CF8A 3TPQA 5C15A 5JVHL 2YCHA 2QI2A 2KTQA 2QWRA 4HVJA 3AVHA 3L6QA 1VQLN 1HX1A 4FPBA 4JD2A 1HNZK 1GLCG 4GMJB 1RTIA 1XNQK 4DTXA 2P9SB 4JI2K 1X1PA 4CJTA 4FK4A 5GINA 4IDKA 2ZGYA 2F96A 1D5AA 4KHQA 4YDUA 4LF7K 1RDUA 3CC2N 3TTDA 2HHTA 2FXUA 1C1CA 5DM7L 1NK9A 1HKCA 3E66A 4JKBA 3QDKA 3TAMA 4JN4A 5BN8A 3NAEA 3J8AA 5LJWA 1NKCA 5CY4A 1EO1A 5FPEA 3H6EA 2D0AA 1GOBA 3VTIA 3AO1A 1BI4A 4JEPA 2B6AA 3SV4A 5EOYA 3V9XA 2HF4A 2A3ZA 4NYNA 3DM2A 2UU9K 1L3TA 1HNVA 2XY7A 4OO1J 2FSKA 3NF8A 3FZLA 3SAHA 1RCHA 3ZSXA 4CHOA 3OS1A 1T8EA 2YHWA 5CZ1A 1HJRA 1SS6A 3BUZB 3CFOA 1IG8A 4XIUA 3ULEA 5GAHP 3MXIA 2WOMA 4PA1A 5C2FA 3E9LA 4BE0A 1HR0K 3SQ1A 1VQKN 4JRQA 4Z94A 2JGUA 3HOSA 3PY8A 2Z1JA 3O1BA 3NH0A 4Z4GA 1RGIA 4AILC 1IBKK 4FZZA 3LPUA 3AO4A 4MLEA 5AZJB 4BR9A 4E1JA 1TKDA 2G8HA 4CK1A 5AJ3K 5C2DA 2YI1A 1D8YA 2O8EA 5HRSA 3HM9A 1QS4A 2BUPA 3V9WA 1OH5A 3O1WA 1U04A 2P9NB 4O4GA 3OTOK 3OY9A 3D2EB 3ZX2A 5JLHA 3E9PA 4M41A 3C7NA 2BH1A 3AA5X 5AQNA 4YNQA 1BGXT 2PBDA 4O0IA 3IAYA 3HP6A 1QHTA 3VQBA 4PKHA 1U45A 2JWLA 3KTQA 3SBTA 3AV9A 4JI7K 2RF2A 1TKTA 2VWBA 1HMVA 5JLFA 1NKBA 4DWIA 3LL3A 1SUQA 3L0QA 1R0AA 2Z1IA 2I5JA 4C23A 1RDAA 2BGGA 3VEZA 5JS2A 4CJPA 4XJXA 1TV6A 4JKHA 1XC9A 4WF9L 2QEXN 3D6RA 3OVNA 3P5JA 3UKRB 3QETA 1WSEA 5CR4A 3S9HA 5KTQA 1KVAA 1U48A 1KVCA 3KZBA 3VF2A 2ZJPL 1KXPA 5FRNA 4GVMA 4WYBA 3EN9A 5AQOA 4B9TA 1NJWA 4CJLA 5C42A 1Y64A 2GUPA 1S22A 2P9SA 4O0JA 3AVNA 3DXMB 4KO0A 3O3FA 3OYKA 2UXBK 1RBSA 1RBTA 4O44A 5HRRA 4DFPA 1C0MA 4FJLA 4OLAA 4F2RA 1LWFA 3V1QA 1WSIA 4GVEA 3CPWM 1DT9A 2CGJA 5CYQA 3NVKA 2O8CB 1NK7A 3V81A 3ZSYA 2HBKA 3PSFA 5KI6A 1HRHA 3T1HK 4OX9K 3CXCM 3KD5E 3VPZA 4C1NK 4NB4A 2KFZA 3CJ9A 5BREA 4BWMA 3MDQA 1NGCA 1KCFA 1QZ5A 3FFIA 4CGHA 5KPRA 1NK4A 1NJXA 3SLCA 2YHAA 3J7YP 4M3TA 4LF5K 1IO2A 1C0GA 2WONA 3JAMO 4OGCA 4LC9B 2KKZA 4FJ9A 1ZBHA 3AVJA 4CF1A 3HJFA 3HOTA 4W5NA 1UA1A 2DFEA 3SZ2A 1TAUA 1BA1A 3CCMN 2IIRA 2G8WA 5J2QA 1XHZA 5FPNA 1B9FA 3TARA 4FVMA 3WQTA 4KB1A 2A41A 5BRHA 3PX0A 4KHNA 3MN7A 4C8OA 4M3WA 2HBLA 4O8UA 5AZJA 2D0CA 1V4SA 4IFVA 1KLNA 1VQ6N 4KV8A 3ZYYX 2VG7A 4KHUA 1BOTO 2KZMA 3NH2A 4LFCK 3HTVA 1V4TA 2OZSA 3SJHA 4GV3A 1X9JA 1HUXA 1DGKN 3AVIA 3MX5A 2P9NA 3B8AX 3NE6A 3RMBA 4J2EA 4CHZA 4FK0A 1JXEA 2P9PA 3QBWA 4N47A 4XH4A 4OKKA 4KKOA 4NXMK 4KI6A 3EZWA 4B3MK 2UXDK 2R7YA 4FWRA 3HT3A 3BP8A 3SJJA 4B3SK 4AM7A 3QNNA 3CCLN 1EP4A 4A62A 2A5XA 4JKDA 3ZSZA 3RRHA 4GY2B 4FJGA 4DQQA 3SQ0A 1JLQA 2GUIA 3WT0A 4B1XB 4CD1A 1N36K 3M6GA 4FM0A 4BDYA 5JICA 4JKAA 4KI4A 2HMIA 3DYAA 5KGXA 3PLAA 2D5RA 1U4BA 1BU6O 1BISA 1WLJA 3MN9A 1HLUA 1XMQK 5E84A 3UKRA 4HUEA 3OJUA 1HKBA 3LWMA 2P9UB 4MDAA 5GADP 4DV4K 3HZ6A 4DV1K 5F1XA 5GIPA 1WAJA 5AQWA 2EWSA 4CZFA 1S9GA 4OPAA 4JKEA 5ELZA 1GLBG 4J8FA 4XH5A 4DSLA 4E89A 3I56N 5HLFA 3DXMA 1KD1O 2F9WA 5AQQA 1KVBA 1DEJA 4IOAL 2D0BA 1NGIA 1YI2N 3GE1A 4E1NA 3O8MA 3KLIA 3A5LC 3KKSA 4IXCA 3CHWA 2P9LA 3OHRA 4KTWA 3QERA 3I8DA 3JSMA 4AH9A 4E7HA 3OYNA 1YVUA 3C6HA 3AGKA 1WBBA 1K8AO 2VGNA 4FSVA 1EX4A 4E19A 1TL1A 4M45A 3A8YA 2HNYA 2E20A 1ZXOA 1OH6A 3SK3A 2NRWA 5FPDA 4DTNA 2O8FB 1JLCA 1NKEA 2V52B 2HHXA 2HHIA 5CHIA 5DM6L 4DLEA 2YNHA 4IEEA 1K6YA 2Q1NA 3QNOA 3WXMB 4UY8O 4I6MB 1KFDA 1LW0A 3I55N 1ILYA 3VQ8A 1VSLA 1Y97A 1TAQA 4FXDA 2JWKA 2PAVA 3VEOA 4FJKA 1Q86O 4E7KA 2NRTA 3NBPA 4YFUA 3AVCA 5AQXA 3HP9A 4BE7B 1WNSA 3G6EN 4JK7A 1UAXA 2YKMA 4U7BA 3CCSN 4DTRA 1ITGA 3GG4A 4KH4A 5J2NA 3IDHA 2QWNA 1LWEA 2FLOA 1XQSC 2V7YA 3U4LA 4DHYA 2P9IB 4CI6A 1LOTB 4DR6K 3CJBA 4OVLA 4CZEA 4IJAA 4FM2A 2IVOA 1IBMK 4IO9L 4NCGA 1SL1A 2QTDA 3S41A 4FOIA 2GEMA 3D7EO 1E3MA 4OKEA 1Q9YA 2CH5A 3THWB 1NGGA 4AHVA 4FYDA 1RFQA 2YNIA 4FCYA 3P39A 4CJSA 3CM5A 4DV6K 3TWHA 2HHVA 4H5RA 3I8BA 5AQVA 4RCHA 1S1XA 4KFBA 4CD3A 1VQ7N 1HJOA 1RT2A 1VSFA 2ZD1A 2HVIA 3HO1A 4FW2A 1FK9A 2RN2A 4F9OA 3TSPA 1J5OA 4DU3A 3GBTA 1Q7YO 1CZ9A 2ZJRL 4UQGA 3IKMA 1VQ5N 3P1GA 2Q0UA 3UB5A 3VQCA 2P9KB 3C94A 3O9UA 5AQPA 2GWKA 2HOEA 3H46O 3R8EA 3T1AA 3WXJA 1YJWN 1RDCA 1A5VA 2OPQA 3ULDA 2E5LK 1X9SA 2ZGZA 3MCPA 1IBLK 4A5AA 4KH5A 4JKCA 1YITN 4MFBA 1IKXA 3K58A 3QB0A 2E6MA 3L2RA 4DSKA 3GL1A 3TSQA 1KQSM 3VOVA 1LW2A 1RT7A 3WEEB 3DLHA 1QZ6A 4KPYA 2Z1GA 3LANA 4OLBA 3AVLA 3O08A 4I2PA 1RT5A 3EL2A 4F8RA 4BDPA 1JKHA 3JXUA 3W0LA 4CF2A 4JNEA 5AFUA 3M8QA 3QFUA 2BDPA 4CFDA 2O8FA 2B5JA 4BROA 4JS5A 1IJJA 4HCCA 1P8ZA 3SMPA 3G0ZA 2EHGA 2KFNA 2YJFA 4H5NA 2YKNA 3VMFB 1RT4A 5GIOA 3HXMA 4E3SA 4DLGA 4YORA 1B92A 3WUHA 4L3QA 2G8VA 3QFPA 1ZBIA 4CIFA 5FDLA 4F2SA 3IFRA 3UE5A 4N56A 1HYZA 3OYHA 4BACA 4DFMA 1JXBA 3RMDA 2VGMA 4ILHA 3QIPA 3CCVN 3T3FA 3IUCA 3HPOA 3CJAA 2UYTA 2HVHA 3HBTA 3NVMA 1TGOA 4CHQA 4KHSA 3ID8A 2C1GA 2F8TA 5LMNK 1GOCA 1T3VA 1OKJA 4E1MA 2P9IA 1TL3A 3EZ5A 2E8AA 1BG3A 3PUFA 4FZXC 4AHSA 3R1XA 4FWSA 4BRPA 3TAEA 4M3ZA 2Y1JA 4BDZA 1NM1A 4FJNA 4DSIA 1QSLA 3VQQA 2FBVA 1GLDG 4OPKA 2IOCA 1I39A 1GLJO 4LF4K 1VSHA 2DPNA 2IS3A 4E7JA 3HYFA 3VETA 1XMOK 4W5RA 3T19A 1JL1A 2G8FA 3CQXA 4OKJA 3DLRA 3OYIA 1SQKA 4CEQA 2A1SA 4KHWA 4YOWA 3F73A 2VG5A 5KRSA 3L4QA 4BC4A 3TTFA 3QO9A 3VENA 1HPZA 2HHSA 4BRQA 4CEFA 1KAZA 5AQJA 2NRZA 3ATVA 3A5NC 4C1NI 4CF9A 3CYMA 1MDUB 3DLGA 1U2VB 1BA0A 1NGBA 3BF3A 4FWLA 3CCJN 4K43A 3LAMA 3E1YA 5A2QO 1G99A 3LDPA 4W5OA 4FVUA 4H8KA 1LCUA 3D45A 4BR4A 2NRHA 4NLBA 5JS1A 2G8UA 3CFPA 3V9UA 4DV7K 1S1UA 4CEBA 3S3NA 2I7NA 2GELA 5K14A 1HNWK 3FZHA 1MWMA 4EP4A 2FSJA 4H5VA 3HK2A 3TANA 2HBMA 1ZBSA 5AQUA 3LM9A 4MQ3A 1NK8A 5LY3A 4BE2A 4A2AA 4CHNA 2UUCK 1YT3A 3HL8A 4JHDB 4WFAL 3TTCA 1Q8IA 4BGAA 3S5TA 4ISFA 4RTFD 4M3UA 5AR0A
chains in the Genus database with same CATH topology
2A42A 4O8UA 4FWKA 5AZJA 3QICA 3MX2A 1V4SA 3T69A 4YOVA 1VQ6N 3ZYYX 3CERA 2E1ZA 4I6MA 1BOTO 1GLEG 4BG9A 2QW9A 5AQTA 3T7ZA 2NZTA 1BUPA 1V4TA 3HTVA 4JK9A 3SJHA 4GV3A 5KPZA 4BR2A 1X9JA 5BPNA 1HUXA 2F9TA 5AQSA 1DGKN 3VEVA 3VF4A 3ATUA 3MX5A 2P9NA 3B8AX 3DWLA 5BN9A 1JCGA 1MWKA 2F7TA 5AQGA 1Q82O 2P9PA 3QBWA 3O80A 4XH4A 2NRRA 1NGDA 1YIJN 2OANA 2KLAA 4M63C 4XH1A 3WQUA 3ZEUB 4CZHA 1K73O 4NLCA 1OVYA 4JD2B 2QA4N 5CE3A 2QM1A 3EZWA 2PFUA 5AQHA 4DCHA 1NMDA 1QVFM 2E2NA 4H03B 1M1KO 2AA4A 4CBXA 4FWRA 4M7XA 1VQ9N 3BP8A 4JKGA 1NGJA 2I7PA 4KBOA 4BRKA 4BVPA 4AM7A 3M3ZA 1QVGM 3CCLN 5E26A 2YJEA 3C0BA 4A62A 3DJCA 4H0PA 2A5XA 3VEWA 4IEIA 3RVCA 4B1ZA 4GV9A 4JKDA 2D4WA 1P90A 4NO7A 3HI0A 4GY2B 1K8KA 1R59O 5AR0A 3CPEA 1E4FT 2QWPA 1DKGD 3CQYA 3FLCO 1ATNA 4HWIA 4B1XB 3WT0A 3F9MA 3DAWA 4PKGA 4CD1A 3M6GA 4IJNA 4H0XB 5GAEP 5JICA 4JKAA 3N4PA 3PLAA 4ILJA 5AQRA 3ID6A 3ZETA 1BU6O 4BRCA 4AF1A 4BR5A 3CCRN 1W2BM 5TKWA 1N8RO 3F2KA 3MN9A 5TKYA 1HLUA 4BECA 3WXLA 5E84A 3RSEA 3UKRA 3MMVA 3CETA 2ZF5O 4JK8A 2WBNA 4B1YB 3A0IX 2E2OA 3HM8A 3KHYA 4WFNL 3CCUN 3TU5A 3MN6A 5M1QA 5AQFA 3CC7N 2CGLA 3VF6A 2Q31A 1HKBA 1W97L 2P9UB 4BRAA 4MDAA 5GADP 4JKFA 3HZ6A 4BRDA 4BC5A 3OBWA 5F1XA 5GIPA 4BRNA 3LDOA 3OW2M 3A5OC 3VEYA 5AQWA 1HKGA 2EWSA 4B1VA 4CZFA 4OPAA 4JKEA 3D2FA 1NGEA 1GLBG 5ELZA 3KK7A 4BREA 4J8FA 4IOCL 1SZ2A 4XH5A 5B8HA 3I56N 3DXMA 1KD1O 2F9WA 4O5FA 3ULEB 5AQQA 4BVOA 1DEJA 3WXKA 4K25A 3CF5L 4IOAL 3O5BA 3HSCA 1Q18A 1NGIA 4A59A 1YI2N 2VYPA 3GE1A 3O8MA 3H45C 3A5LC 4IXCA 2IVNA 2ASMA 4CBWA 3CHWA 1H1VA 1KC8O 1X3NA 2P9LA 4WQ4C 2P9KA 3OHRA 1BWFO 4CZKA 2Q97A 3C6AA 3U8XA 3L4IA 3C6HA 4RWTA 3AGKA 3O9QA 5M1FA 3CJCA 1K8AO 4OPHA 2FF3B 1TYQA 4MO5A 3VERA 3EKUA 2VGNA 5M1NA 2GWJA 5AZIA 3UKUB 3AY9A 4FSVA 3P4IA 1ESVA 1YVNA 3H3OB 1T44A 4IZ9A 2W41A 1KAYA 3A8YA 1T6DA 3LDQA 2E20A 1ATSA 4QS7A 1ZXOA 4BR7A 3CMEN 3SK3A 4YOTA 2ZWHA 2NRWA 4IFEA 2ITMA 4BRGA 5FPDA 4FO0A 4FWMA 4AM6A 5AQMA 4MLHA 2E2PA 2V52B 3ZX0A 3ENBA 1U6ZA 5CHIA 3WEEA 5DM6L 4CJ7A 3C7NB 5HOOA 4IEEA 2Q36A 3CCEN 3LDLA 3QBXA 5LJVA 2W40A 4BGBA 1WOQA 1YJNN 4FOEA 1ATRA 1NBWA 2NLXA 2A40A 2Q1NA 4I6MB 3WXMB 4PL7A 5I9EB 4UY8O 5BR9A 4BQLA 3I55N 4PL8A 4QS8A 1Z05A 3EE9A 4A57A 1ILYA 4H0OA 4H0YB 2ZJQL 3R9PA 3KWIA 4ISGA 2JWKA 5ADXA 4WQ5C 2PAVA 3VEOA 4BY9C 1C0FA 5F2RA 3VEXA 1Q86O 4JHDA 4YOUA 3D2EA 5AQIA 2RE2A 5EY4A 4O8KA 2NRTA 2P9PB 3M1FA 4BR0A 1ZC6A 3AGRA 5AQXA 4BE7B 4BRMA 2V51B 3O4WA 4YOYA 3G6EN 4JK7A 3SBGA 2YX6A 4CZIA 4U7BA 4BRIA 2GTDA 2WC9A 3U9DA 3CCSN 4KH4A 3GG4A 2FF6A 4FWPA 1QHAA 4QS9A 4YDUC 4BC2A 4DB3A 5JVGL 2HSTA 3IDHA 4FWNA 3I33A 2CH6A 2QWNA 4JKGB 2FLOA 1HPMA 1NWKA 1XQSC 2V7YA 3U4LA 1Q81O 4DHYA 2P9IB 4CI6A 3R6MA 4A61A 1LOTB 4YOXA 3FZFA 3CJBA 4CZEA 3EE8A 4WQ5A 5JVHL 3TPQA 5C15A 2W00A 2YCHA 4IJAA 2IVOA 2QI2A 4IO9L 2WFBA 4H5WA 2QWRA 3L6QA 3ZEUA 2QTDA 3S41A 4FOIA 1NGAA 1HX1A 4FPBA 4JD2A 2GEMA 1VQLN 3GDQA 3D7EO 1GLCG 1SAZA 2CH5A 4PKIA 3A5MC 3AARA 1D4XA 2P9SB 3ENHA 4XEIA 4BRLA 1NGGA 2A6AA 5BRFA 5GINA 4G9ZA 2E1YA 3ZETB 1RFQA 2QWOA 2ZGYA 2Q0RA 1O13A 3P39A 4B1UB 4YDUA 3U9ZA 3DXKB 4CBUA 1RDUA 3OBYA 3CC2N 5C10A 3TTDA 3CI5A 4WCEL 4H5RA 4Y0WA 3I8BA 3Q7CA 5AQVA 2ASPA 4RCHA 3FZKA 2FXUA 4FWOA 3TSUA 4CD3A 5DM7L 1VQ7N 1Z6RA 3SAFA 1HKCA 1HJOA 3E66A 4JKBA 1VQMN 3QDKA 5BN8A 4JN4A 3J8AA 5LJWA 1YHQN 3K9KA 3KWGA 2V7ZA 3W3DA 1KAXA 4B1WB 4F9OA 1EO1A 5FPEA 3H6EA 3MWPA 3VTIA 1X3MA 3TSPA 3ENOA 3IMXA 1MA9B 4JEPA 1VQNN 1XC3A 3GBTA 5EOYA 1Q7YO 3G25A 2HF4A 3O9TA 2ZJRL 2A3ZA 3IKMA 1VQ5N 2RHKA 1RDWX 1YAGA 4IDHA 2Q0UA 2C1IA 3UB5A 2NRXA 1E4GT 1JJ2M 4OO1J 2FSKA 2P9LB 2P9KB 2WUSA 4BRHA 5BPMA 1WUAA 3O9UA 3PIPL 3FZLA 3SAHA 5AQPA 2GWKA 2HOEA 3H46O 3R8EA 1YJWN 3WXJA 3BF1A 1BDGA 5BPLA 3Q7BA 2YHWA 3SMSA 1SS6A 3BUZB 5EVZA 3QMLA 1NJIO 2ZGZA 1IG8A 3MCPA 2HMPA 3CCQN 3ULEA 5GAHP 1S72N 3P31A 4A5AA 3H1VX 4KH5A 1EQYA 3FE1A 4JKCA 4ILGB 3E9LA 5C2FA 3VGLA 3CC4N 1YITN 1U2VA 3QB0A 5M1KA 3MCAB 1VQKN 3GL1A 2QXLA 3OA9A 3G4SN 4Z94A 3TSQA 4MDBA 3HOSA 5AQZA 1KQSM 3VOVA 4FL9A 3J7ZO 3O1BA 3C65A 3CJ1A 3WEEB 3CD6N 1GLFO 1K9MO 1QZ6A 1NLVA 1RGIA 5KQ8A 3O08A 4WQ4A 3EL2A 4MLEA 1VQON 5AZJB 4BR9A 5ADXH 4E1JA 3JXUA 3W0LA 4EIAA 5KPTA 5C2DA 4GV6A 5M1PA 2YI1A 2GX9A 4JNEA 3CMAN 5AFUA 3BEXA 4MO4A 3MK6A 5AQLA 3QFUA 1NGFA 4A2BA 2BUPA 5M1OA 1J6ZA 3O1WA 4BROA 5EX5A 2P9NB 3HRGA 3VGMA 3M5RA 3D2EB 3ZX2A 5JLHA 4H5TA 3E9OA 3E9PA 1IJJA 2AP1A 3C7NA 2BH1A 1VQ8N 2E88A 1P8ZA 3SMPA 2OTLN 2D0OA 4FWQA 4BG8A 4BC3A 5AQNA 3AAPA 4IO8A 1JCFA 4IWVA 2PBDA 2YJFA 4H5NA 1VAZA 3VMFB 2OTJN 1VQ4N 2KHOA 4U67L 5GIOA 1T6CA 4PKHA 2JWLA 1JCEA 3SBTA 4YORA 3KVGA 1YXQA 3WUHA 5HL7L 4L3QA 1QQOA 2NRVA 2VWBA 3F5TA 5FPMA 3QFPA 4JAXA 3LM2A 5JLFA 5H1SQ 4ISEA 1TUYA 3IFRA 3FZMA 3UE5A 4A5BA 3LL3A 5C0YA 1K8KB 2VGMA 3L0QA 4ILHA 3H1QA 1GLLO 2QWMA 3FFKB 2NNWA 3CCVN 4CZJA 2IVPA 1GLAG 4CZGA 4DKWA 4C23A 3IUCA 4CZMA 4IOXA 3CJAA 2UYTA 3VEZA 4R79A 3NMUA 1QQNA 2D0PA 3HBTA 3NVMA 4BQZA 1QQMA 3ID8A 4GNIA 2C1GA 4EHUA 4XJXA 4JKHA 1T3VA 4WF9L 1XUPO 1OKJA 2QEXN 1BO5O 3D6RA 4FPAA 2P9IA 5C12A 3RSEB 3UKRB 2E8AA 1BG3A 2H3GX 3R1XA 3VESA 5CR4A 4FWSA 3G71N 4BRPA 3N4QA 3VTHA 4BEBA 2QWLA 1YJ9N 1NM1A 3DLLL 3KZBA 4H0TB 3VF2A 2ZJPL 1KXPA 2YHYA 3MN5A 3ZX3A 4WYBA 3EN9A 5AQOA 3MWTA 1GLDG 3D2FB 1Y64A 3PIOL 2GUPA 1S22A 2P9SA 1GLJO 3DXMB 4K41A 5AQKA 2DPNA 5JMVA 5AQYA 5EXWA 4M7YA 3VETA 3CJ7A 1YF5L 4CZLA 3DXKA 3FGUA 3O9RA 3SAGA 4K42A 3CQXA 5MLCQ 3GOIA 1SQKA 5GAGP 4YOWA 2P9UA 4GVEA 3O9SA 3L4QA 3CPWM 1DT9A 2CGJA 3NVKA 4BC4A 3TTFA 3VENA 4EFHA 2HBKA 1TYQB 3EO3A 4BRQA 2HBJA 2FSNA 3JS6A 1KAZA 5AQJA 2NRZA 5AZIB 3WXIA 5BRDA 3ATVA 3A5NC 4C1NI 2E2QA 1MDUB 3CXCM 2VCPA 2YHXA 3EKSA 3VPZA 4C1NK 1NGBA 1BA0A 1U2VB 3BF3A 2QWQA 3CJ9A 4FWLA 4K43A 4NB4A 3CCJN 3E1YA 3LDNA 1G99A 3LDPA 5BREA 1TUUA 4FVUA 2Q2RA 3MDQA 5F0XA 1NGCA 1LCUA 2ASOA 3R3LA 3VGKA 1QZ5A 3CIPA 5KPRA 4BR4A 2NRHA 3K9JA 4NLBA 3SLCA 4WFBL 4EAHD 2J4RA 1C0GA 4BRFA 5AFUH 2I7NA 4LC9B 2KKZA 2GELA 4HTLA 4PHTX 3H3NO 3UKUA 3HOTA 2D1KA 3FZHA 1MWMA 4B9QA 2FSJA 3O6WA 4H5VA 4EHTA 5KQDA 1M90O 1BA1A 3CCMN 2IIRA 2HBMA 1ZBSA 5AQUA 4KH6A 3LM9A 1NGHA 1CZAN 3AAQA 5FPNA 4DQ8A 1VQPN 5LY3A 2BTFA 3FR0A 2HF3A 3P38A 4H0VB 4A2AA 3WQTA 2A41A 5BRHA 1S3XA 4JHDB 4WFAL 3TTCA 4BGAA 3MN7A 4ISFA 4RTFD 1YUWA 2CGKA 2HBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A42 A;  4FWK A;  5AZJ A;  3QIC A;  1V4S A;  3CER A;  2E1Z A;  4I6M A;  1BOT O;  1GLE G;  4BG9 A;  2QW9 A;  5AQT A;  2NZT A;  1BUP A;  1V4T A;  3HTV A;  3SJH A;  5KPZ A;  4BR2 A;  1X9J A;  5BPN A;  1HUX A;  2F9T A;  5AQS A;  1DGK N;  3VEV A;  3VF4 A;  3ATU A;  2P9N A;  3B8A X;  3DWL A;  5BN9 A;  1JCG A;  1MWK A;  5AQG A;  2P9P A;  3QBW A;  3O80 A;  4XH4 A;  1NGD A;  2OAN A;  4M63 C;  4XH1 A;  3WQU A;  3ZEU B;  4CZH A;  4JD2 B;  5CE3 A;  2QM1 A;  3EZW A;  5AQH A;  4DCH A;  1NMD A;  2E2N A;  4H03 B;  2AA4 A;  4CBX A;  4FWR A;  4M7X A;  3BP8 A;  1NGJ A;  2I7P A;  4KBO A;  4BRK A;  4BVP A;  4AM7 A;  3M3Z A;  5E26 A;  2YJE A;  3C0B A;  4A62 A;  3DJC A;  4H0P A;  2A5X A;  3VEW A;  4B1Z A;  2D4W A;  4NO7 A;  3HI0 A;  4GY2 B;  1K8K A;  1R59 O;  5AR0 A;  1E4F T;  2QWP A;  1DKG D;  3CQY A;  3FLC O;  1ATN A;  4HWI A;  4B1X B;  3WT0 A;  3F9M A;  3DAW A;  4PKG A;  4CD1 A;  3M6G A;  4IJN A;  4H0X B;  5JIC A;  5AQR A;  3ZET A;  1BU6 O;  4BRC A;  4BR5 A;  3MN9 A;  5TKY A;  1HLU A;  3WXL A;  5E84 A;  3RSE A;  3UKR A;  3MMV A;  3CET A;  2ZF5 O;  4B1Y B;  3A0I X;  2E2O A;  3HM8 A;  3KHY A;  3TU5 A;  3MN6 A;  5AQF A;  2CGL A;  3VF6 A;  2Q31 A;  1HKB A;  2P9U B;  4BRA A;  3HZ6 A;  4BRD A;  4BC5 A;  5F1X A;  4BRN A;  3LDO A;  3A5O C;  3VEY A;  5AQW A;  1HKG A;  2EWS A;  4B1V A;  4CZF A;  5ELZ A;  3D2F A;  1NGE A;  1GLB G;  4BRE A;  4J8F A;  1SZ2 A;  4XH5 A;  5B8H A;  3DXM A;  2F9W A;  4O5F A;  3ULE B;  5AQQ A;  4BVO A;  1DEJ A;  3WXK A;  4K25 A;  3O5B A;  3HSC A;  1Q18 A;  1NGI A;  2VYP A;  3GE1 A;  3O8M A;  3H45 C;  3A5L C;  4IXC A;  2IVN A;  2ASM A;  4CBW A;  3CHW A;  1H1V A;  1X3N A;  2P9L A;  4WQ4 C;  2P9K A;  3OHR A;  1BWF O;  4CZK A;  2Q97 A;  3U8X A;  3L4I A;  4RWT A;  3CJC A;  2FF3 B;  1TYQ A;  4MO5 A;  3VER A;  3EKU A;  2GWJ A;  5AZI A;  3UKU B;  3AY9 A;  4FSV A;  3P4I A;  1ESV A;  1YVN A;  3H3O B;  1T44 A;  4IZ9 A;  2W41 A;  1KAY A;  3A8Y A;  1T6D A;  3LDQ A;  2E20 A;  1ATS A;  4QS7 A;  1ZXO A;  4BR7 A;  3SK3 A;  2ZWH A;  2ITM A;  4BRG A;  5FPD A;  4FO0 A;  4FWM A;  4AM6 A;  5AQM A;  4MLH A;  2E2P A;  2V52 B;  3ZX0 A;  1U6Z A;  3WEE A;  4CJ7 A;  3C7N B;  2Q36 A;  3LDL A;  3QBX A;  5LJV A;  2W40 A;  4BGB A;  1WOQ A;  4FOE A;  1ATR A;  1NBW A;  2NLX A;  2A40 A;  2Q1N A;  4I6M B;  4PL7 A;  5I9E B;  5BR9 A;  4BQL A;  4PL8 A;  4QS8 A;  1Z05 A;  4H0O A;  4H0Y B;  3R9P A;  4ISG A;  5ADX A;  4WQ5 C;  2PAV A;  3VEO A;  1C0F A;  5F2R A;  3VEX A;  4JHD A;  3D2E A;  5AQI A;  5EY4 A;  4O8K A;  3M1F A;  2P9P B;  4BR0 A;  1ZC6 A;  5AQX A;  4BRM A;  2V51 B;  3O4W A;  4CZI A;  4BRI A;  2GTD A;  3U9D A;  4YDU C;  3GG4 A;  2FF6 A;  4FWP A;  1QHA A;  4QS9 A;  4BC2 A;  4DB3 A;  3IDH A;  4FWN A;  3I33 A;  2CH6 A;  2QWN A;  2FLO A;  1HPM A;  1NWK A;  1XQS C;  2V7Y A;  3U4L A;  4DHY A;  2P9I B;  4CI6 A;  3R6M A;  4A61 A;  1LOT B;  3FZF A;  3CJB A;  4CZE A;  4WQ5 A;  3TPQ A;  2YCH A;  4IJA A;  2IVO A;  4H5W A;  2QWR A;  3L6Q A;  3ZEU A;  3S41 A;  4FOI A;  1NGA A;  1HX1 A;  4FPB A;  4JD2 A;  2GEM A;  3GDQ A;  3D7E O;  1GLC G;  1SAZ A;  2CH5 A;  4PKI A;  3A5M C;  3AAR A;  1D4X A;  2P9S B;  3ENH A;  4XEI A;  4BRL A;  1NGG A;  2A6A A;  5BRF A;  2E1Y A;  3ZET B;  1RFQ A;  2QWO A;  2Q0R A;  2ZGY A;  4B1U B;  4YDU A;  3U9Z A;  3DXK B;  4CBU A;  3CI5 A;  4H5R A;  4Y0W A;  3I8B A;  5AQV A;  2ASP A;  4RCH A;  3FZK A;  2FXU A;  4FWO A;  4CD3 A;  1Z6R A;  1HKC A;  1HJO A;  3QDK A;  5BN8 A;  4JN4 A;  3J8A A;  5LJW A;  2V7Z A;  3W3D A;  1KAX A;  4B1W B;  4F9O A;  5FPE A;  3H6E A;  1X3M A;  3ENO A;  3IMX A;  1MA9 B;  1XC3 A;  3GBT A;  5EOY A;  3G25 A;  2HF4 A;  2A3Z A;  1RDW X;  1YAG A;  2Q0U A;  3UB5 A;  1E4G T;  2FSK A;  2P9L B;  2P9K B;  2WUS A;  4BRH A;  5BPM A;  1WUA A;  3FZL A;  5AQP A;  2GWK A;  2HOE A;  3H46 O;  3R8E A;  3WXJ A;  3BF1 A;  1BDG A;  5BPL A;  2YHW A;  3SMS A;  3BUZ B;  5EVZ A;  3QML A;  2ZGZ A;  1IG8 A;  3MCP A;  2HMP A;  3ULE A;  3H1V X;  1EQY A;  3FE1 A;  3VGL A;  1U2V A;  3QB0 A;  3GL1 A;  2QXL A;  4Z94 A;  5AQZ A;  3VOV A;  4FL9 A;  3O1B A;  3CJ1 A;  3WEE B;  1GLF O;  1QZ6 A;  1NLV A;  1RGI A;  5KQ8 A;  3O08 A;  4WQ4 A;  3EL2 A;  4MLE A;  5AZJ B;  4BR9 A;  5ADX H;  4E1J A;  3JXU A;  3W0L A;  4EIA A;  5KPT A;  2YI1 A;  4JNE A;  5AFU A;  3BEX A;  4MO4 A;  3MK6 A;  3QFU A;  1NGF A;  4A2B A;  2BUP A;  1J6Z A;  3O1W A;  4BRO A;  5EX5 A;  2P9N B;  3VGM A;  3D2E B;  3ZX2 A;  5JLH A;  4H5T A;  1IJJ A;  2AP1 A;  3C7N A;  2E88 A;  1P8Z A;  3SMP A;  2D0O A;  4FWQ A;  4BG8 A;  4BC3 A;  5AQN A;  3AAP A;  4IO8 A;  1JCF A;  4IWV A;  2PBD A;  2YJF A;  4H5N A;  2KHO A;  1T6C A;  4PKH A;  1JCE A;  3KVG A;  1YXQ A;  3WUH A;  4L3Q A;  1QQO A;  2VWB A;  5FPM A;  3QFP A;  4JAX A;  3LM2 A;  5JLF A;  4ISE A;  1TUY A;  3IFR A;  3FZM A;  3UE5 A;  3LL3 A;  1K8K B;  3L0Q A;  3H1Q A;  1GLL O;  3FFK B;  2QWM A;  4CZJ A;  2IVP A;  1GLA G;  4CZG A;  4C23 A;  3IUC A;  4CZM A;  3CJA A;  2UYT A;  3VEZ A;  1QQN A;  2D0P A;  3HBT A;  4BQZ A;  1QQM A;  3ID8 A;  4GNI A;  4EHU A;  1XUP O;  1OKJ A;  1BO5 O;  4FPA A;  2P9I A;  3RSE B;  3UKR B;  2E8A A;  1BG3 A;  2H3G X;  3VES A;  4FWS A;  4BRP A;  2QWL A;  1NM1 A;  3KZB A;  4H0T B;  3VF2 A;  1KXP A;  2YHY A;  3MN5 A;  3ZX3 A;  4WYB A;  3EN9 A;  5AQO A;  1GLD G;  3D2F B;  1Y64 A;  2GUP A;  1S22 A;  2P9S A;  1GLJ O;  3DXM B;  4K41 A;  5AQK A;  2DPN A;  5JMV A;  5AQY A;  5EXW A;  4M7Y A;  3VET A;  3CJ7 A;  4CZL A;  3DXK A;  3FGU A;  4K42 A;  3CQX A;  3GOI A;  1SQK A;  2P9U A;  2CGJ A;  4BC4 A;  3VEN A;  4EFH A;  1TYQ B;  3EO3 A;  4BRQ A;  2FSN A;  3JS6 A;  1KAZ A;  5AQJ A;  5AZI B;  3WXI A;  5BRD A;  3ATV A;  3A5N C;  2E2Q A;  1MDU B;  2VCP A;  2YHX A;  3EKS A;  3VPZ A;  1NGB A;  1BA0 A;  1U2V B;  3BF3 A;  2QWQ A;  3CJ9 A;  4FWL A;  4K43 A;  4NB4 A;  3LDN A;  5BRE A;  1G99 A;  3LDP A;  1TUU A;  2Q2R A;  3MDQ A;  5F0X A;  1NGC A;  1LCU A;  2ASO A;  3VGK A;  1QZ5 A;  3CIP A;  5KPR A;  4BR4 A;  2NRH A;  3SLC A;  4EAH D;  2J4R A;  1C0G A;  4BRF A;  5AFU H;  2I7N A;  4LC9 B;  2GEL A;  4HTL A;  3H3N O;  3UKU A;  2D1K A;  3FZH A;  1MWM A;  4B9Q A;  2FSJ A;  3O6W A;  4H5V A;  4EHT A;  5KQD A;  1BA1 A;  2IIR A;  1ZBS A;  5AQU A;  3LM9 A;  1NGH A;  1CZA N;  3AAQ A;  5FPN A;  4DQ8 A;  5LY3 A;  2BTF A;  3FR0 A;  2HF3 A;  4H0V B;  4A2A A;  3WQT A;  2A41 A;  5BRH A;  1S3X A;  4JHD B;  4BGA A;  3MN7 A;  4ISF A;  4RTF D;  1YUW A;  2CGK A;  5AQL A; 
#chains in the Genus database with same CATH topology
 5HBM A;  3MX2 A;  3NGY A;  4YOV A;  3NHG A;  3DRS A;  4IKF A;  3OYM A;  3CER A;  4BG9 A;  2QW9 A;  5AQT A;  1BUP A;  2P1J A;  5KPZ A;  3AA4 A;  4CGF A;  4JS4 A;  5AQS A;  3QES A;  3VEV A;  1A5W A;  3DWL A;  3VQE A;  1JCG A;  2AJQ A;  1Q82 O;  3O80 A;  4PY5 A;  2NRR A;  4CIG A;  3OS2 A;  1NGD A;  3RWU A;  2KLA A;  1U47 A;  3ZEU B;  4B9N A;  5CE3 A;  4AHT A;  4DCH A;  1W7A A;  1NMD A;  2E2N A;  2NUB A;  4FLU A;  3J80 O;  2AA4 A;  4CK2 A;  1VRU A;  4CBX A;  2I7P A;  4KBO A;  3VQP A;  1X9M A;  1NK0 A;  1RT3 A;  5E26 A;  3C0B A;  4H0P A;  1TK8 A;  4B1Z A;  3L2Q A;  4NO7 A;  1VSM A;  3HI0 A;  1R59 O;  4FZY A;  1L3V A;  5D3G A;  2QWP A;  3CQY A;  2VWK A;  2IC3 A;  1HQU A;  2QKB A;  4DR4 K;  2HND A;  2O8B B;  5GAE P;  1NK6 A;  1CXU A;  4ILJ A;  5AQR A;  3ID6 A;  4BRC A;  4BR5 A;  4FLX A;  3WNF A;  1W2B M;  5TKY A;  1RTD A;  2HHW A;  1XNR K;  1CLQ A;  3MMV A;  4JK8 A;  4CEZ A;  1TKX A;  1KFS A;  3KHY A;  3TU5 A;  3MN6 A;  5AQF A;  2XY8 A;  2CGL A;  1N32 K;  1VK0 A;  3RMA A;  4BC5 A;  3OW2 M;  2JLE A;  2XY6 A;  1J53 A;  1NGE A;  3C6T A;  3CG7 A;  3KK7 A;  5B8H A;  2X6S A;  4J2D A;  5IT9 O;  3OS0 A;  1NJY A;  3G10 A;  3O5B A;  4FJ7 A;  3BY5 A;  3PV8 A;  1C0U A;  2QKK A;  4CBW A;  1J9A A;  1X3N A;  4WQ4 C;  4ID1 A;  3M8R A;  4LH4 A;  4DV2 K;  4CZK A;  3LZJ A;  2Q97 A;  4H4M A;  3U8X A;  3MXM A;  3IS9 A;  3O9Q A;  1IG9 A;  4DR2 K;  3VER A;  1WN7 A;  2FBT A;  1RTJ A;  3UKU B;  3VQ6 A;  2P5G A;  1T6D A;  4DF4 A;  1FW6 A;  3VN5 A;  1QTM A;  4BR7 A;  3CME N;  4YOT A;  2ITM A;  4BRG A;  3LWL A;  3AVG A;  4MLH A;  4JI4 K;  3S3M A;  4B9L A;  4RG8 A;  3AA2 A;  1T05 A;  1IKY A;  4CJ7 A;  3QEW A;  3LDL A;  3QIN A;  3WNG A;  1J5E K;  1EXQ A;  1WOQ A;  4FLV A;  4FOE A;  3A2F A;  2NLX A;  2OPS A;  3RMC A;  5I9E B;  2OZM A;  3NGI A;  4GW6 A;  4BQL A;  3SUQ A;  4A57 A;  3EE9 A;  3KLG A;  1LAW A;  3NF7 A;  4H0Y B;  4DV3 K;  1ZYQ A;  2HW3 A;  1NOZ A;  2IDO A;  3WNH A;  4JHD A;  4YOU A;  3D2E A;  4ELU A;  2PY5 A;  4BE1 A;  4LFA K;  3ZT1 A;  2FBY A;  1KLM A;  1B9D A;  2XHB A;  3THX B;  2IAJ A;  4BRM A;  4YOY A;  3K5N A;  5I3U A;  1VSK A;  5C24 A;  3SBG A;  2DTU A;  2YX6 A;  2GTD A;  3U9D A;  1OVQ A;  3LP3 A;  4QS9 A;  4DF8 A;  4ZTF A;  2W6L A;  1HYV A;  4JKG B;  1NWK A;  4DV5 K;  2HB5 A;  3C6U A;  4YOX A;  3FZF A;  1YTU A;  4B9U A;  2W00 A;  1QSS A;  4H5W A;  3O3G A;  4DTP A;  2OTJ N;  3ZEU A;  1S5J A;  3VQ9 A;  2HHQ A;  3A5M C;  3AAR A;  1D4X A;  4BRL A;  5BRF A;  1BQN A;  2ETJ A;  4G9Z A;  2E1Y A;  3ZET B;  1IH7 A;  4FJX A;  2Q0R A;  4CFA A;  1EET A;  1O13 A;  4B1U B;  4AHU A;  1SKR A;  3U9Z A;  3DXK B;  3OBY A;  1NK5 A;  5LL6 Z;  2ASP A;  3FZK A;  1Z6R A;  3SAF A;  4I9Q A;  2B4J A;  4KHY A;  3K9K A;  3W3D A;  2Z1H A;  4B1W B;  1NG9 A;  2O8B A;  1LAV A;  3ENO A;  3IMX A;  4DR7 K;  1VQN N;  2Q3S A;  3J81 O;  3G25 A;  3RR8 A;  4YHH K;  2RHK A;  4NXN K;  1RDW X;  3SCX A;  1YAG A;  4IDH A;  2C1I A;  2WUS A;  1WUA A;  3PIP L;  3V9Z A;  4F4K A;  2O8C A;  3BF1 A;  1BDG A;  4FW1 A;  5BPL A;  3OYB A;  3SPZ A;  3SMS A;  5EVZ A;  1NJI O;  2XO7 A;  1S72 N;  3H1V X;  1EQY A;  4CK3 A;  3FE1 A;  2QK9 A;  3V1O A;  3AO3 A;  3MCA B;  1KTQ A;  2GBZ A;  2QXL A;  3OA9 A;  3CFR A;  3G4S N;  2YHB A;  5AQZ A;  1I3A A;  4JI6 K;  4JI8 K;  4M3R A;  3J7Z O;  3TAB A;  3C65 A;  3CJ1 A;  4R5P A;  4DS5 A;  2ZE2 A;  3PX6 A;  1K9M O;  4KB0 A;  2WTU A;  3K59 A;  3VQ4 A;  5ADX H;  3EY1 A;  1IV0 A;  4Q5V A;  4DR3 K;  4CEA A;  2RPI A;  1T7P A;  3MK6 A;  2W6K A;  1NGF A;  3OYL A;  3QEX A;  3AVK A;  5EX5 A;  3HRG A;  3VGM A;  1VSD A;  3M5R A;  2DY4 A;  1EKE A;  1VQ8 N;  2DFH A;  4FLY A;  2E88 A;  3AO2 A;  1FKO A;  4JV5 K;  2OTL N;  4FWQ A;  4BG8 A;  4BC3 A;  1WAF A;  1JCF A;  3ZSR A;  4C8K A;  2PZS A;  3OYE A;  2VWJ A;  1VAZ A;  2P51 A;  1VQ4 N;  4CVN E;  4CJR A;  4PWD A;  1T6C A;  4FLT A;  1I94 K;  4KHP K;  1JCE A;  3LAL A;  5HL7 L;  3F5T A;  3L2W A;  4JAX A;  5H1S Q;  4O5B A;  1HNI A;  5BR8 K;  3KIO A;  3BZK A;  3OJS A;  5C0Y A;  1YTA A;  3THX A;  1GLL O;  4CE9 A;  2QWM A;  3MXJ A;  2OA8 A;  1GLA G;  4N76 A;  3IG1 A;  4IOX A;  1QQN A;  1X9W A;  2D0P A;  1JLB A;  1XHX A;  1QQM A;  4GNI A;  4EHU A;  3PSI A;  1BO5 O;  4PUO A;  4FPA A;  5C12 A;  4HUG A;  2H3G X;  4O55 A;  3VES A;  3G71 N;  1RBU A;  2QWL A;  1YJ9 N;  4K8Z A;  3DLL L;  4HHT A;  2YHY A;  3ZX3 A;  3L2V A;  5LMU K;  4CJU A;  4KTZ A;  1S9E A;  3PIO L;  4IBN A;  4DMN A;  3F9K A;  4X62 K;  4CFC A;  1BI4 B;  3L3U A;  1WSJ A;  4M7Y A;  4CZL A;  4ZHR A;  3DXK A;  3O9R A;  3SAG A;  4K42 A;  3DI6 A;  5MLC Q;  3GOI A;  4Z4E A;  3T1Y K;  4HTU A;  4M3Y A;  1BHL A;  3KK2 A;  2P9U A;  3ALY A;  4I7F A;  4LD0 A;  2XRI A;  4B8A B;  1ASU A;  3KD1 E;  2FSN A;  3JS6 A;  5AZI B;  5IWA K;  2YV0 X;  3WXI A;  3KJV A;  1IKV A;  2E2Q A;  3EKS A;  3U3Y A;  1QQC A;  1TK0 A;  2QWQ A;  4LY7 A;  1Q9X A;  3LDN A;  4CIE A;  2UUB K;  2Q2R A;  1J54 A;  4X64 K;  3R3L A;  3CIP A;  5HRN A;  4EAH D;  3LP0 A;  3SUN A;  1D9F A;  3SI6 A;  3DLK A;  4QAG A;  4L8R B;  4HTL A;  4PHT X;  3MED A;  3H3N O;  1C1B A;  4DUY K;  4B9Q A;  3KLE A;  4EHT A;  4X66 K;  2O8D B;  3O3H A;  1VHX A;  1NGH A;  4DQ8 A;  3FR0 A;  1L3S A;  4CJQ A;  3P38 A;  2O4G A;  4PQU A;  4H0V B;  4Z4C A;  4DSJ A;  1S3X A;  1L3U A;  4DFJ A;  3E01 A;  3DMJ A;  4ZTJ A;  2VG6 A;  5AQL A;  2A42 A;  3QIC A;  3NCI A;  4NCB A;  4OGE A;  3BGR A;  2E1Z A;  4I6M A;  3L2U A;  1GLE G;  2DFF A;  3T7Z A;  4B9S A;  4CCH A;  1XWL A;  3K5M A;  5BPN A;  3VF4 A;  4CFB A;  1EWR A;  4KTQ A;  1MWK A;  4RW7 A;  1YIJ N;  2OAN A;  3K0S A;  4M63 C;  4NLC A;  1OVY A;  2QA4 N;  5AQH A;  1ZBU A;  4F3O A;  2FC0 A;  1FJG K;  1NJZ A;  2GV9 A;  1VQ9 N;  4M7X A;  1NGJ A;  1NU0 A;  3AA3 A;  4CJE A;  4BVP A;  1QVG M;  2YJE A;  3VEW A;  4WE1 A;  1P90 A;  4QOZ B;  1BCO A;  4DU4 A;  1DKG D;  3AVA A;  3V9S A;  4FK2 A;  3FLC O;  3SQ4 A;  1G15 A;  3F9M A;  3DAW A;  1NOY A;  3M8S A;  3KK3 A;  4IJN A;  3THW A;  2O4I A;  3JYT A;  4DSE A;  5TKW A;  3F2K A;  4BEC A;  3WXL A;  1ZBF A;  2ZF5 O;  2WBN A;  4C8N A;  3A0I X;  2E2O A;  3HM8 A;  4B1Y B;  3S3O A;  4C8L A;  3VF6 A;  2Q31 A;  2BE2 A;  3CM6 A;  1W97 L;  4BRA A;  4JKF A;  1RBR A;  4BRD A;  3LDO A;  3A5O C;  4IG3 A;  4BRE A;  4FJJ A;  4IOC L;  3KK1 A;  1SZ2 A;  4AHR A;  3NF9 A;  4O5F A;  1JLG A;  1N33 K;  3CF5 L;  4DQP A;  4A59 A;  2VYP A;  4RW4 A;  2UUA K;  2XY5 A;  2ASM A;  3TAP A;  2P9K A;  3O4N A;  1BWF O;  4LF8 K;  3K2P A;  4FJM A;  4ID5 A;  3CJC A;  2FF3 B;  2G8K A;  4MO5 A;  2GWJ A;  5AZI A;  1OH7 A;  3AY9 A;  3P4I A;  1YVN A;  3H3O B;  1T44 A;  3PO5 A;  2W41 A;  3AVB A;  4KRE A;  2OYQ A;  4Z4F A;  4IFE A;  3MEG A;  2QXF A;  4FWM A;  5AQM A;  4DV0 K;  3C95 A;  4FJH A;  4IFY A;  3WEE A;  2PYL A;  1L5U A;  2Q36 A;  3QBX A;  5LJV A;  4BGB A;  5EU7 A;  4DTM A;  1YJN N;  4RW9 A;  1ATR A;  3L3V A;  3SYZ A;  3DOL A;  4PL7 A;  2O8D A;  5BR9 A;  3EEQ A;  2F4V K;  4PL8 A;  3ZSQ A;  1Z05 A;  4H0O A;  2ZJQ L;  3R9P A;  4B3O A;  4H4O A;  4FJI A;  3KWI A;  1UOC A;  4ISG A;  3VA0 A;  3TI0 A;  1C0F A;  3VEX A;  2X78 A;  5I42 A;  2RE2 A;  4O8K A;  2P9P B;  4BR0 A;  1S1V A;  3DLB A;  4EP5 A;  4OJR A;  2E6L A;  4CJW A;  4E72 A;  3CYG A;  1LV5 A;  2WC9 A;  1NMN A;  4FWP A;  1QHA A;  4DB3 A;  5JVG L;  1SL0 A;  1D9D A;  1RT1 A;  2HST A;  4JI0 K;  3I33 A;  1SV5 A;  1HPM A;  1SL2 A;  3IRX A;  5SWM A;  3VQD A;  4CGD A;  3LZI A;  1OH8 A;  2F8S A;  3EE8 A;  2WFB A;  4LF6 K;  1NGA A;  3GDQ A;  4DUZ K;  4HCB A;  3D0P A;  1SAZ A;  3ITH A;  4PKI A;  4IG0 A;  4XEI A;  3ENH A;  2A6A A;  2QWO A;  3TR8 A;  4AHC A;  3OYC A;  4CBU A;  5C10 A;  4DQR A;  3NDK A;  3CI5 A;  4WCE L;  1REV A;  2ITG A;  4Y0W A;  3Q7C A;  2KW4 A;  4FWO A;  1CZB A;  1DTQ A;  3TSU A;  3SPY A;  1VQM N;  3HPH A;  3THY B;  1N6Q A;  1YHQ N;  4DG1 A;  3KWG A;  2V7Z A;  1KAX A;  3SUP A;  3MWP A;  3OYA A;  1X3M A;  3M8P A;  1C0T A;  1MA9 B;  3CQ8 A;  1XC3 A;  4LF9 K;  2A1R A;  3B6O A;  3O9T A;  2KZZ A;  1WSF A;  2OCE A;  4JI5 K;  2NRX A;  1E4G T;  1JJ2 M;  1FXX A;  3ZT0 A;  2P9L B;  4BRH A;  3SQ2 A;  5BPM A;  2ZM6 K;  4CJF A;  3DOK A;  4CEE A;  5KRT A;  3Q7B A;  3NGZ A;  4ELT A;  3K57 A;  2UXC K;  3QML A;  2HMP A;  4W5T A;  3CCQ N;  3P31 A;  1W0H A;  5FRO A;  4ILG B;  3CC4 N;  3VGL A;  3ZSO A;  1U2V A;  5M1K A;  1MU2 A;  1VSI A;  4ICL A;  4MDB A;  3ZLJ A;  4CF0 A;  4FL9 A;  1NNE A;  3CD6 N;  1GLF O;  1WBD A;  3LP1 A;  1NLV A;  5KQ8 A;  4CEO A;  4WQ4 A;  3QIO A;  1T03 A;  4CHY A;  1VQO N;  5HRP A;  4E7I A;  4EIA A;  3I0S A;  5KPT A;  4GV6 A;  3DRP A;  5M1P A;  2HHU A;  2GX9 A;  3CMA N;  3OYG A;  4JYA K;  1TK5 A;  3BEX A;  4MO4 A;  5J2P A;  3KLF A;  2LSN A;  3DRR A;  4A2B A;  4V19 S;  5M1O A;  1J6Z A;  5SZT A;  1W9H A;  3K5O A;  1HQE A;  4H5T A;  3E9O A;  2AP1 A;  1JLE A;  1RDD A;  2D0O A;  4CJV A;  3AAP A;  4IO8 A;  4IWV A;  4I9L A;  4AQY K;  3SV3 A;  3DLE A;  4JRP A;  4CEC A;  2KQ2 A;  2KHO A;  4U67 L;  1SKS A;  3SNN A;  4FJ5 A;  4JI1 K;  3KVG A;  1YXQ A;  1QQO A;  1VSE A;  2NRV A;  5FPM A;  3TAG A;  3LM2 A;  4ISE A;  2E4L A;  1TUY A;  4LSL A;  3AO5 A;  4CJ3 A;  3BDP A;  3FZM A;  4A5B A;  1N34 K;  1K8K B;  3H1Q A;  4DR5 K;  1BCM A;  3FFK B;  3U6F A;  3PX4 A;  2NNW A;  4CZJ A;  2IVP A;  4CZG A;  4DU1 A;  4CES A;  4DKW A;  4CZM A;  3ZSW A;  4R79 A;  3NMU A;  3ASM A;  4BQZ A;  2ZQB A;  3P83 D;  4DTO A;  1XUP O;  4C8M A;  1KSP A;  5FLX O;  4W5Q A;  3RSE B;  1S6P A;  3N4Q A;  4TSX A;  3VTH A;  4BEB A;  3NF6 A;  4FM1 A;  3ZCM A;  4H0T B;  3ZT4 A;  3NH1 A;  3MN5 A;  4I2Q A;  1RNH A;  3MWT A;  3D2F B;  1IKW A;  4K41 A;  5AQK A;  5JMV A;  4LSN A;  5AQY A;  5EXW A;  1Z25 A;  1DTT A;  3CJ7 A;  1YF5 L;  4OPJ A;  3FGU A;  1O1W A;  3EYZ A;  4DFK A;  4CGG A;  1HYS A;  4DS4 A;  5T7B A;  1JLA A;  3OYF A;  5GAG P;  3VQA A;  4CJ4 A;  3O9S A;  3THY A;  3U3G A;  4JLH A;  4EFH A;  4M3X A;  1TYQ B;  5DK5 A;  3EO3 A;  2HBJ A;  1S1W A;  1XI1 A;  5BRD A;  1BQM A;  4Z0U A;  2VCP A;  2YHX A;  4DR1 K;  3MEE A;  3VQ7 A;  1TUU A;  5F0X A;  3ISN C;  2ASO A;  3ZSV A;  1FKP A;  3VGK A;  3K9J A;  4WFB L;  3TAF A;  2J4R A;  3O4Q A;  4X65 K;  3LDS A;  3V6D A;  4BRF A;  3H08 A;  5AFU H;  4BWJ A;  3UKU A;  2D1K A;  1WB9 A;  4B9V A;  3NFA A;  2X6N A;  3O6W A;  5KQD A;  1M90 O;  1RIL A;  1JLF A;  4KH6 A;  1CZA N;  3AAQ A;  1VQP N;  3OYJ A;  2BTF A;  2HF3 A;  1HNX K;  3THV A;  4FLZ A;  4CJK A;  4CED A;  1N5Y A;  2P5O A;  5JEN A;  3I0R A;  5E41 A;  1YUW A;  5AQG A;  1LWC A;  2CGK A;  2BAN A;  1QE1 A;  4FWK A;  1WSH A;  2IGI A;  3T69 A;  1RBV A;  1GOA A;  2RKI A;  1TKZ A;  1KRP A;  4CW7 B;  4KAZ A;  4N41 A;  4NCA A;  2NZT A;  4JK9 A;  3OYD A;  4Z4H A;  4BR2 A;  2F9T A;  4DQS A;  4K8X A;  1SKW A;  3ATU A;  5BN9 A;  4DTU A;  2F7T A;  4G1Q A;  4DQI A;  3V4I A;  4XH1 A;  4CZH A;  3WQU A;  4FLW A;  4KRF A;  1K73 O;  4JD2 B;  3KKR A;  2QM1 A;  2PFU A;  1BL3 A;  1QVF M;  3J7A P;  5C25 A;  3QLH A;  4RW6 A;  4H03 B;  4DSF A;  3HST B;  1M1K O;  4N5S A;  4JKG A;  4BRK A;  3ZT3 A;  4Y1D A;  3K5L A;  3RTV A;  4HUF A;  3M3Z A;  2G8I A;  3DJC A;  4NYF A;  4E7L A;  3ZT2 A;  4IEI A;  3RVC A;  4GV9 A;  1DLO A;  2D4W A;  3PO4 A;  1K8K A;  3QEP A;  3CPE A;  1E4F T;  1BIU A;  3QEV A;  2Y1I A;  1ATN A;  4HWI A;  3SUO A;  4PKG A;  1RT6 A;  4H0X B;  1EWQ A;  3N4P A;  5KGW A;  3ZET A;  2X74 A;  3AVM A;  4AF1 A;  4LFB K;  1ASW A;  3CCR N;  1N8R O;  5J1E A;  5FRM A;  4B3R K;  4Q0B A;  2OPR A;  3RSE A;  3CET A;  2OPP A;  1U49 A;  3CCU N;  4F3T A;  1F21 A;  2FBX A;  4WFN L;  5M1Q A;  3AVF A;  3CC7 N;  3LPT A;  1UWB A;  5DMR A;  1UA0 A;  3HVT A;  1CXQ A;  3OBW A;  4CGJ A;  4BRN A;  4FJ8 A;  1A5X A;  3VEY A;  1HKG A;  4B1V A;  3TAQ A;  4K0K K;  3D2F A;  1VRT A;  1S1T A;  2EX3 A;  3RR7 A;  3L8B A;  3ULE B;  4BVO A;  3WXK A;  4K25 A;  3HSC A;  1Q18 A;  5HP1 A;  1S6Q A;  3H45 C;  4RW8 A;  4DTS A;  2IVN A;  2PYJ A;  3WNE A;  1H1V A;  1KC8 O;  3LP2 A;  4JI3 K;  3C6A A;  1VSJ A;  3VA3 A;  3V1R A;  3L4I A;  4M42 A;  4RWT A;  5M1F A;  4OPH A;  1C6V A;  1TYQ A;  3LAK A;  3B6P A;  3EKU A;  4CER A;  5M1N A;  4ELV A;  2YNF A;  1ESV A;  4IZ9 A;  1KAY A;  3LDQ A;  1JL2 A;  4E0D A;  1ATS A;  4LH5 A;  2O8E B;  4QS7 A;  2ZWH A;  1Z26 A;  4CGI A;  4FO0 A;  4AM6 A;  3ZX0 A;  2E2P A;  3ENB A;  1U6Z A;  4CJ5 A;  5J2M A;  2ATQ A;  5CZ2 A;  3C7N B;  5HOO A;  3CCE N;  4CHP A;  4J2A A;  2HHH K;  2W40 A;  4QCL A;  4B8C A;  3HPG A;  3RRG A;  1NBW A;  2A40 A;  3HVR A;  4Z4I A;  1ZBL A;  3MEC A;  1WSG A;  4QS8 A;  4J2B A;  1C1A A;  5HRO A;  5ADX A;  4WQ5 C;  2W42 A;  4B08 A;  1BIZ A;  4BY9 C;  5F2R A;  4B9M A;  1TVR A;  2VQF K;  3UIQ A;  1RTH A;  5AQI A;  5EY4 A;  3M1F A;  5CYM A;  1ZC6 A;  1QSY A;  3AGR A;  4EZ6 A;  2V51 B;  3O4W A;  2VQE K;  3KLH A;  4B3T K;  4CZI A;  1RDB A;  4BRI A;  3BZC A;  4YDU C;  4BC2 A;  2FF6 A;  2HNZ A;  4GKK K;  4YY3 K;  3MAQ A;  4Y1C A;  4FWN A;  2CH6 A;  4GKJ K;  4DTJ A;  1Q81 O;  3R6M A;  4EZ9 A;  4A61 A;  1ASV A;  3QEI A;  2YNG A;  3VQ5 A;  4WQ5 A;  4CF8 A;  3TPQ A;  5C15 A;  5JVH L;  2YCH A;  2QI2 A;  2KTQ A;  2QWR A;  4HVJ A;  3AVH A;  3L6Q A;  1VQL N;  1HX1 A;  4FPB A;  4JD2 A;  1HNZ K;  1GLC G;  4GMJ B;  1RTI A;  1XNQ K;  4DTX A;  2P9S B;  4JI2 K;  1X1P A;  4CJT A;  4FK4 A;  5GIN A;  4IDK A;  2ZGY A;  2F96 A;  1D5A A;  4KHQ A;  4YDU A;  4LF7 K;  1RDU A;  3CC2 N;  3TTD A;  2HHT A;  2FXU A;  1C1C A;  5DM7 L;  1NK9 A;  1HKC A;  3E66 A;  4JKB A;  3QDK A;  3TAM A;  4JN4 A;  5BN8 A;  3NAE A;  3J8A A;  5LJW A;  1NKC A;  5CY4 A;  1EO1 A;  5FPE A;  3H6E A;  2D0A A;  1GOB A;  3VTI A;  3AO1 A;  1BI4 A;  4JEP A;  2B6A A;  3SV4 A;  5EOY A;  3V9X A;  2HF4 A;  2A3Z A;  4NYN A;  3DM2 A;  2UU9 K;  1L3T A;  1HNV A;  2XY7 A;  4OO1 J;  2FSK A;  3NF8 A;  3FZL A;  3SAH A;  1RCH A;  3ZSX A;  4CHO A;  3OS1 A;  1T8E A;  2YHW A;  5CZ1 A;  1HJR A;  1SS6 A;  3BUZ B;  3CFO A;  1IG8 A;  4XIU A;  3ULE A;  5GAH P;  3MXI A;  2WOM A;  4PA1 A;  5C2F A;  3E9L A;  4BE0 A;  1HR0 K;  3SQ1 A;  1VQK N;  4JRQ A;  4Z94 A;  2JGU A;  3HOS A;  3PY8 A;  2Z1J A;  3O1B A;  3NH0 A;  4Z4G A;  1RGI A;  4AIL C;  1IBK K;  4FZZ A;  3LPU A;  3AO4 A;  4MLE A;  5AZJ B;  4BR9 A;  4E1J A;  1TKD A;  2G8H A;  4CK1 A;  5AJ3 K;  5C2D A;  2YI1 A;  1D8Y A;  2O8E A;  5HRS A;  3HM9 A;  1QS4 A;  2BUP A;  3V9W A;  1OH5 A;  3O1W A;  1U04 A;  2P9N B;  4O4G A;  3OTO K;  3OY9 A;  3D2E B;  3ZX2 A;  5JLH A;  3E9P A;  4M41 A;  3C7N A;  2BH1 A;  3AA5 X;  5AQN A;  4YNQ A;  1BGX T;  2PBD A;  4O0I A;  3IAY A;  3HP6 A;  1QHT A;  3VQB A;  4PKH A;  1U45 A;  2JWL A;  3KTQ A;  3SBT A;  3AV9 A;  4JI7 K;  2RF2 A;  1TKT A;  2VWB A;  1HMV A;  5JLF A;  1NKB A;  4DWI A;  3LL3 A;  1SUQ A;  3L0Q A;  1R0A A;  2Z1I A;  2I5J A;  4C23 A;  1RDA A;  2BGG A;  3VEZ A;  5JS2 A;  4CJP A;  4XJX A;  1TV6 A;  4JKH A;  1XC9 A;  4WF9 L;  2QEX N;  3D6R A;  3OVN A;  3P5J A;  3UKR B;  3QET A;  1WSE A;  5CR4 A;  3S9H A;  5KTQ A;  1KVA A;  1U48 A;  1KVC A;  3KZB A;  3VF2 A;  2ZJP L;  1KXP A;  5FRN A;  4GVM A;  4WYB A;  3EN9 A;  5AQO A;  4B9T A;  1NJW A;  4CJL A;  5C42 A;  1Y64 A;  2GUP A;  1S22 A;  2P9S A;  4O0J A;  3AVN A;  3DXM B;  4KO0 A;  3O3F A;  3OYK A;  2UXB K;  1RBS A;  1RBT A;  4O44 A;  5HRR A;  4DFP A;  1C0M A;  4FJL A;  4OLA A;  4F2R A;  1LWF A;  3V1Q A;  1WSI A;  4GVE A;  3CPW M;  1DT9 A;  2CGJ A;  5CYQ A;  3NVK A;  2O8C B;  1NK7 A;  3V81 A;  3ZSY A;  2HBK A;  3PSF A;  5KI6 A;  1HRH A;  3T1H K;  4OX9 K;  3CXC M;  3KD5 E;  3VPZ A;  4C1N K;  4NB4 A;  2KFZ A;  3CJ9 A;  5BRE A;  4BWM A;  3MDQ A;  1NGC A;  1KCF A;  1QZ5 A;  3FFI A;  4CGH A;  5KPR A;  1NK4 A;  1NJX A;  3SLC A;  2YHA A;  3J7Y P;  4M3T A;  4LF5 K;  1IO2 A;  1C0G A;  2WON A;  3JAM O;  4OGC A;  4LC9 B;  2KKZ A;  4FJ9 A;  1ZBH A;  3AVJ A;  4CF1 A;  3HJF A;  3HOT A;  4W5N A;  1UA1 A;  2DFE A;  3SZ2 A;  1TAU A;  1BA1 A;  3CCM N;  2IIR A;  2G8W A;  5J2Q A;  1XHZ A;  5FPN A;  1B9F A;  3TAR A;  4FVM A;  3WQT A;  4KB1 A;  2A41 A;  5BRH A;  3PX0 A;  4KHN A;  3MN7 A;  4C8O A;  4M3W A;  2HBL A;  4O8U A;  5AZJ A;  2D0C A;  1V4S A;  4IFV A;  1KLN A;  1VQ6 N;  4KV8 A;  3ZYY X;  2VG7 A;  4KHU A;  1BOT O;  2KZM A;  3NH2 A;  4LFC K;  3HTV A;  1V4T A;  2OZS A;  3SJH A;  4GV3 A;  1X9J A;  1HUX A;  1DGK N;  3AVI A;  3MX5 A;  2P9N A;  3B8A X;  3NE6 A;  3RMB A;  4J2E A;  4CHZ A;  4FK0 A;  1JXE A;  2P9P A;  3QBW A;  4N47 A;  4XH4 A;  4OKK A;  4KKO A;  4NXM K;  4KI6 A;  3EZW A;  4B3M K;  2UXD K;  2R7Y A;  4FWR A;  3HT3 A;  3BP8 A;  3SJJ A;  4B3S K;  4AM7 A;  3QNN A;  3CCL N;  1EP4 A;  4A62 A;  2A5X A;  4JKD A;  3ZSZ A;  3RRH A;  4GY2 B;  4FJG A;  4DQQ A;  3SQ0 A;  1JLQ A;  2GUI A;  3WT0 A;  4B1X B;  4CD1 A;  1N36 K;  3M6G A;  4FM0 A;  4BDY A;  5JIC A;  4JKA A;  4KI4 A;  2HMI A;  3DYA A;  5KGX A;  3PLA A;  2D5R A;  1U4B A;  1BU6 O;  1BIS A;  1WLJ A;  3MN9 A;  1HLU A;  1XMQ K;  5E84 A;  3UKR A;  4HUE A;  3OJU A;  1HKB A;  3LWM A;  2P9U B;  4MDA A;  5GAD P;  4DV4 K;  3HZ6 A;  4DV1 K;  5F1X A;  5GIP A;  1WAJ A;  5AQW A;  2EWS A;  4CZF A;  1S9G A;  4OPA A;  4JKE A;  5ELZ A;  1GLB G;  4J8F A;  4XH5 A;  4DSL A;  4E89 A;  3I56 N;  5HLF A;  3DXM A;  1KD1 O;  2F9W A;  5AQQ A;  1KVB A;  1DEJ A;  4IOA L;  2D0B A;  1NGI A;  1YI2 N;  3GE1 A;  4E1N A;  3O8M A;  3KLI A;  3A5L C;  3KKS A;  4IXC A;  3CHW A;  2P9L A;  3OHR A;  4KTW A;  3QER A;  3I8D A;  3JSM A;  4AH9 A;  4E7H A;  3OYN A;  1YVU A;  3C6H A;  3AGK A;  1WBB A;  1K8A O;  2VGN A;  4FSV A;  1EX4 A;  4E19 A;  1TL1 A;  4M45 A;  3A8Y A;  2HNY A;  2E20 A;  1ZXO A;  1OH6 A;  3SK3 A;  2NRW A;  5FPD A;  4DTN A;  2O8F B;  1JLC A;  1NKE A;  2V52 B;  2HHX A;  2HHI A;  5CHI A;  5DM6 L;  4DLE A;  2YNH A;  4IEE A;  1K6Y A;  2Q1N A;  3QNO A;  3WXM B;  4UY8 O;  4I6M B;  1KFD A;  1LW0 A;  3I55 N;  1ILY A;  3VQ8 A;  1VSL A;  1Y97 A;  1TAQ A;  4FXD A;  2JWK A;  2PAV A;  3VEO A;  4FJK A;  1Q86 O;  4E7K A;  2NRT A;  3NBP A;  4YFU A;  3AVC A;  5AQX A;  3HP9 A;  4BE7 B;  1WNS A;  3G6E N;  4JK7 A;  1UAX A;  2YKM A;  4U7B A;  3CCS N;  4DTR A;  1ITG A;  3GG4 A;  4KH4 A;  5J2N A;  3IDH A;  2QWN A;  1LWE A;  2FLO A;  1XQS C;  2V7Y A;  3U4L A;  4DHY A;  2P9I B;  4CI6 A;  1LOT B;  4DR6 K;  3CJB A;  4OVL A;  4CZE A;  4IJA A;  4FM2 A;  2IVO A;  1IBM K;  4IO9 L;  4NCG A;  1SL1 A;  2QTD A;  3S41 A;  4FOI A;  2GEM A;  3D7E O;  1E3M A;  4OKE A;  1Q9Y A;  2CH5 A;  3THW B;  1NGG A;  4AHV A;  4FYD A;  1RFQ A;  2YNI A;  4FCY A;  3P39 A;  4CJS A;  3CM5 A;  4DV6 K;  3TWH A;  2HHV A;  4H5R A;  3I8B A;  5AQV A;  4RCH A;  1S1X A;  4KFB A;  4CD3 A;  1VQ7 N;  1HJO A;  1RT2 A;  1VSF A;  2ZD1 A;  2HVI A;  3HO1 A;  4FW2 A;  1FK9 A;  2RN2 A;  4F9O A;  3TSP A;  1J5O A;  4DU3 A;  3GBT A;  1Q7Y O;  1CZ9 A;  2ZJR L;  4UQG A;  3IKM A;  1VQ5 N;  3P1G A;  2Q0U A;  3UB5 A;  3VQC A;  2P9K B;  3C94 A;  3O9U A;  5AQP A;  2GWK A;  2HOE A;  3H46 O;  3R8E A;  3T1A A;  3WXJ A;  1YJW N;  1RDC A;  1A5V A;  2OPQ A;  3ULD A;  2E5L K;  1X9S A;  2ZGZ A;  3MCP A;  1IBL K;  4A5A A;  4KH5 A;  4JKC A;  1YIT N;  4MFB A;  1IKX A;  3K58 A;  3QB0 A;  2E6M A;  3L2R A;  4DSK A;  3GL1 A;  3TSQ A;  1KQS M;  3VOV A;  1LW2 A;  1RT7 A;  3WEE B;  3DLH A;  1QZ6 A;  4KPY A;  2Z1G A;  3LAN A;  4OLB A;  3AVL A;  3O08 A;  4I2P A;  1RT5 A;  3EL2 A;  4F8R A;  4BDP A;  1JKH A;  3JXU A;  3W0L A;  4CF2 A;  4JNE A;  5AFU A;  3M8Q A;  3QFU A;  2BDP A;  4CFD A;  2O8F A;  2B5J A;  4BRO A;  4JS5 A;  1IJJ A;  4HCC A;  1P8Z A;  3SMP A;  3G0Z A;  2EHG A;  2KFN A;  2YJF A;  4H5N A;  2YKN A;  3VMF B;  1RT4 A;  5GIO A;  3HXM A;  4E3S A;  4DLG A;  4YOR A;  1B92 A;  3WUH A;  4L3Q A;  2G8V A;  3QFP A;  1ZBI A;  4CIF A;  5FDL A;  4F2S A;  3IFR A;  3UE5 A;  4N56 A;  1HYZ A;  3OYH A;  4BAC A;  4DFM A;  1JXB A;  3RMD A;  2VGM A;  4ILH A;  3QIP A;  3CCV N;  3T3F A;  3IUC A;  3HPO A;  3CJA A;  2UYT A;  2HVH A;  3HBT A;  3NVM A;  1TGO A;  4CHQ A;  4KHS A;  3ID8 A;  2C1G A;  2F8T A;  5LMN K;  1GOC A;  1T3V A;  1OKJ A;  4E1M A;  2P9I A;  1TL3 A;  3EZ5 A;  2E8A A;  1BG3 A;  3PUF A;  4FZX C;  4AHS A;  3R1X A;  4FWS A;  4BRP A;  3TAE A;  4M3Z A;  2Y1J A;  4BDZ A;  1NM1 A;  4FJN A;  4DSI A;  1QSL A;  3VQQ A;  2FBV A;  1GLD G;  4OPK A;  2IOC A;  1I39 A;  1GLJ O;  4LF4 K;  1VSH A;  2DPN A;  2IS3 A;  4E7J A;  3HYF A;  3VET A;  1XMO K;  4W5R A;  3T19 A;  1JL1 A;  2G8F A;  3CQX A;  4OKJ A;  3DLR A;  3OYI A;  1SQK A;  4CEQ A;  2A1S A;  4KHW A;  4YOW A;  3F73 A;  2VG5 A;  5KRS A;  3L4Q A;  4BC4 A;  3TTF A;  3QO9 A;  3VEN A;  1HPZ A;  2HHS A;  4BRQ A;  4CEF A;  1KAZ A;  5AQJ A;  2NRZ A;  3ATV A;  3A5N C;  4C1N I;  4CF9 A;  3CYM A;  1MDU B;  3DLG A;  1U2V B;  1BA0 A;  1NGB A;  3BF3 A;  4FWL A;  3CCJ N;  4K43 A;  3LAM A;  3E1Y A;  5A2Q O;  1G99 A;  3LDP A;  4W5O A;  4FVU A;  4H8K A;  1LCU A;  3D45 A;  4BR4 A;  2NRH A;  4NLB A;  5JS1 A;  2G8U A;  3CFP A;  3V9U A;  4DV7 K;  1S1U A;  4CEB A;  3S3N A;  2I7N A;  2GEL A;  5K14 A;  1HNW K;  3FZH A;  1MWM A;  4EP4 A;  2FSJ A;  4H5V A;  3HK2 A;  3TAN A;  2HBM A;  1ZBS A;  5AQU A;  3LM9 A;  4MQ3 A;  1NK8 A;  5LY3 A;  4BE2 A;  4A2A A;  4CHN A;  2UUC K;  1YT3 A;  3HL8 A;  4JHD B;  4WFA L;  3TTC A;  1Q8I A;  4BGA A;  3S5T A;  4ISF A;  4RTF D;  4M3U A;  5AR0 A; 
#chains in the Genus database with same CATH homology
 2A42 A;  4O8U A;  4FWK A;  5AZJ A;  3QIC A;  3MX2 A;  1V4S A;  3T69 A;  4YOV A;  1VQ6 N;  3ZYY X;  3CER A;  2E1Z A;  4I6M A;  1BOT O;  1GLE G;  4BG9 A;  2QW9 A;  5AQT A;  3T7Z A;  2NZT A;  1BUP A;  1V4T A;  3HTV A;  4JK9 A;  3SJH A;  4GV3 A;  5KPZ A;  4BR2 A;  1X9J A;  5BPN A;  1HUX A;  2F9T A;  5AQS A;  1DGK N;  3VEV A;  3VF4 A;  3ATU A;  3MX5 A;  2P9N A;  3B8A X;  3DWL A;  5BN9 A;  1JCG A;  1MWK A;  2F7T A;  5AQG A;  1Q82 O;  2P9P A;  3QBW A;  3O80 A;  4XH4 A;  2NRR A;  1NGD A;  1YIJ N;  2OAN A;  2KLA A;  4M63 C;  4XH1 A;  3WQU A;  3ZEU B;  4CZH A;  1K73 O;  4NLC A;  1OVY A;  4JD2 B;  2QA4 N;  5CE3 A;  2QM1 A;  3EZW A;  2PFU A;  5AQH A;  4DCH A;  1NMD A;  1QVF M;  2E2N A;  4H03 B;  1M1K O;  2AA4 A;  4CBX A;  4FWR A;  4M7X A;  1VQ9 N;  3BP8 A;  4JKG A;  1NGJ A;  2I7P A;  4KBO A;  4BRK A;  4BVP A;  4AM7 A;  3M3Z A;  1QVG M;  3CCL N;  5E26 A;  2YJE A;  3C0B A;  4A62 A;  3DJC A;  4H0P A;  2A5X A;  3VEW A;  4IEI A;  3RVC A;  4B1Z A;  4GV9 A;  4JKD A;  2D4W A;  1P90 A;  4NO7 A;  3HI0 A;  4GY2 B;  1K8K A;  1R59 O;  5AR0 A;  3CPE A;  1E4F T;  2QWP A;  1DKG D;  3CQY A;  3FLC O;  1ATN A;  4HWI A;  4B1X B;  3WT0 A;  3F9M A;  3DAW A;  4PKG A;  4CD1 A;  3M6G A;  4IJN A;  4H0X B;  5GAE P;  5JIC A;  4JKA A;  3N4P A;  3PLA A;  4ILJ A;  5AQR A;  3ID6 A;  3ZET A;  1BU6 O;  4BRC A;  4AF1 A;  4BR5 A;  3CCR N;  1W2B M;  5TKW A;  1N8R O;  3F2K A;  3MN9 A;  5TKY A;  1HLU A;  4BEC A;  3WXL A;  5E84 A;  3RSE A;  3UKR A;  3MMV A;  3CET A;  2ZF5 O;  4JK8 A;  2WBN A;  4B1Y B;  3A0I X;  2E2O A;  3HM8 A;  3KHY A;  4WFN L;  3CCU N;  3TU5 A;  3MN6 A;  5M1Q A;  5AQF A;  3CC7 N;  2CGL A;  3VF6 A;  2Q31 A;  1HKB A;  1W97 L;  2P9U B;  4BRA A;  4MDA A;  5GAD P;  4JKF A;  3HZ6 A;  4BRD A;  4BC5 A;  3OBW A;  5F1X A;  5GIP A;  4BRN A;  3LDO A;  3OW2 M;  3A5O C;  3VEY A;  5AQW A;  1HKG A;  2EWS A;  4B1V A;  4CZF A;  4OPA A;  4JKE A;  3D2F A;  1NGE A;  1GLB G;  5ELZ A;  3KK7 A;  4BRE A;  4J8F A;  4IOC L;  1SZ2 A;  4XH5 A;  5B8H A;  3I56 N;  3DXM A;  1KD1 O;  2F9W A;  4O5F A;  3ULE B;  5AQQ A;  4BVO A;  1DEJ A;  3WXK A;  4K25 A;  3CF5 L;  4IOA L;  3O5B A;  3HSC A;  1Q18 A;  1NGI A;  4A59 A;  1YI2 N;  2VYP A;  3GE1 A;  3O8M A;  3H45 C;  3A5L C;  4IXC A;  2IVN A;  2ASM A;  4CBW A;  3CHW A;  1H1V A;  1KC8 O;  1X3N A;  2P9L A;  4WQ4 C;  2P9K A;  3OHR A;  1BWF O;  4CZK A;  2Q97 A;  3C6A A;  3U8X A;  3L4I A;  3C6H A;  4RWT A;  3AGK A;  3O9Q A;  5M1F A;  3CJC A;  1K8A O;  4OPH A;  2FF3 B;  1TYQ A;  4MO5 A;  3VER A;  3EKU A;  2VGN A;  5M1N A;  2GWJ A;  5AZI A;  3UKU B;  3AY9 A;  4FSV A;  3P4I A;  1ESV A;  1YVN A;  3H3O B;  1T44 A;  4IZ9 A;  2W41 A;  1KAY A;  3A8Y A;  1T6D A;  3LDQ A;  2E20 A;  1ATS A;  4QS7 A;  1ZXO A;  4BR7 A;  3CME N;  3SK3 A;  4YOT A;  2ZWH A;  2NRW A;  4IFE A;  2ITM A;  4BRG A;  5FPD A;  4FO0 A;  4FWM A;  4AM6 A;  5AQM A;  4MLH A;  2E2P A;  2V52 B;  3ZX0 A;  3ENB A;  1U6Z A;  5CHI A;  3WEE A;  5DM6 L;  4CJ7 A;  3C7N B;  5HOO A;  4IEE A;  2Q36 A;  3CCE N;  3LDL A;  3QBX A;  5LJV A;  2W40 A;  4BGB A;  1WOQ A;  1YJN N;  4FOE A;  1ATR A;  1NBW A;  2NLX A;  2A40 A;  2Q1N A;  4I6M B;  3WXM B;  4PL7 A;  5I9E B;  4UY8 O;  5BR9 A;  4BQL A;  3I55 N;  4PL8 A;  4QS8 A;  1Z05 A;  3EE9 A;  4A57 A;  1ILY A;  4H0O A;  4H0Y B;  2ZJQ L;  3R9P A;  3KWI A;  4ISG A;  2JWK A;  5ADX A;  4WQ5 C;  2PAV A;  3VEO A;  4BY9 C;  1C0F A;  5F2R A;  3VEX A;  1Q86 O;  4JHD A;  4YOU A;  3D2E A;  5AQI A;  2RE2 A;  5EY4 A;  4O8K A;  2NRT A;  2P9P B;  3M1F A;  4BR0 A;  1ZC6 A;  3AGR A;  5AQX A;  4BE7 B;  4BRM A;  2V51 B;  3O4W A;  4YOY A;  3G6E N;  4JK7 A;  3SBG A;  2YX6 A;  4CZI A;  4U7B A;  4BRI A;  2GTD A;  2WC9 A;  3U9D A;  3CCS N;  4KH4 A;  3GG4 A;  2FF6 A;  4FWP A;  1QHA A;  4QS9 A;  4YDU C;  4BC2 A;  4DB3 A;  5JVG L;  2HST A;  3IDH A;  4FWN A;  3I33 A;  2CH6 A;  2QWN A;  4JKG B;  2FLO A;  1HPM A;  1NWK A;  1XQS C;  2V7Y A;  3U4L A;  1Q81 O;  4DHY A;  2P9I B;  4CI6 A;  3R6M A;  4A61 A;  1LOT B;  4YOX A;  3FZF A;  3CJB A;  4CZE A;  3EE8 A;  4WQ5 A;  5JVH L;  3TPQ A;  5C15 A;  2W00 A;  2YCH A;  4IJA A;  2IVO A;  2QI2 A;  4IO9 L;  2WFB A;  4H5W A;  2QWR A;  3L6Q A;  3ZEU A;  2QTD A;  3S41 A;  4FOI A;  1NGA A;  1HX1 A;  4FPB A;  4JD2 A;  2GEM A;  1VQL N;  3GDQ A;  3D7E O;  1GLC G;  1SAZ A;  2CH5 A;  4PKI A;  3A5M C;  3AAR A;  1D4X A;  2P9S B;  3ENH A;  4XEI A;  4BRL A;  1NGG A;  2A6A A;  5BRF A;  5GIN A;  4G9Z A;  2E1Y A;  3ZET B;  1RFQ A;  2QWO A;  2ZGY A;  2Q0R A;  1O13 A;  3P39 A;  4B1U B;  4YDU A;  3U9Z A;  3DXK B;  4CBU A;  1RDU A;  3OBY A;  3CC2 N;  5C10 A;  3TTD A;  3CI5 A;  4WCE L;  4H5R A;  4Y0W A;  3I8B A;  3Q7C A;  5AQV A;  2ASP A;  4RCH A;  3FZK A;  2FXU A;  4FWO A;  3TSU A;  4CD3 A;  5DM7 L;  1VQ7 N;  1Z6R A;  3SAF A;  1HKC A;  1HJO A;  3E66 A;  4JKB A;  1VQM N;  3QDK A;  5BN8 A;  4JN4 A;  3J8A A;  5LJW A;  1YHQ N;  3K9K A;  3KWG A;  2V7Z A;  3W3D A;  1KAX A;  4B1W B;  4F9O A;  1EO1 A;  5FPE A;  3H6E A;  3MWP A;  3VTI A;  1X3M A;  3TSP A;  3ENO A;  3IMX A;  1MA9 B;  4JEP A;  1VQN N;  1XC3 A;  3GBT A;  5EOY A;  1Q7Y O;  3G25 A;  2HF4 A;  3O9T A;  2ZJR L;  2A3Z A;  3IKM A;  1VQ5 N;  2RHK A;  1RDW X;  1YAG A;  4IDH A;  2Q0U A;  2C1I A;  3UB5 A;  2NRX A;  1E4G T;  1JJ2 M;  4OO1 J;  2FSK A;  2P9L B;  2P9K B;  2WUS A;  4BRH A;  5BPM A;  1WUA A;  3O9U A;  3PIP L;  3FZL A;  3SAH A;  5AQP A;  2GWK A;  2HOE A;  3H46 O;  3R8E A;  1YJW N;  3WXJ A;  3BF1 A;  1BDG A;  5BPL A;  3Q7B A;  2YHW A;  3SMS A;  1SS6 A;  3BUZ B;  5EVZ A;  3QML A;  1NJI O;  2ZGZ A;  1IG8 A;  3MCP A;  2HMP A;  3CCQ N;  3ULE A;  5GAH P;  1S72 N;  3P31 A;  4A5A A;  3H1V X;  4KH5 A;  1EQY A;  3FE1 A;  4JKC A;  4ILG B;  3E9L A;  5C2F A;  3VGL A;  3CC4 N;  1YIT N;  1U2V A;  3QB0 A;  5M1K A;  3MCA B;  1VQK N;  3GL1 A;  2QXL A;  3OA9 A;  3G4S N;  4Z94 A;  3TSQ A;  4MDB A;  3HOS A;  5AQZ A;  1KQS M;  3VOV A;  4FL9 A;  3J7Z O;  3O1B A;  3C65 A;  3CJ1 A;  3WEE B;  3CD6 N;  1GLF O;  1K9M O;  1QZ6 A;  1NLV A;  1RGI A;  5KQ8 A;  3O08 A;  4WQ4 A;  3EL2 A;  4MLE A;  1VQO N;  5AZJ B;  4BR9 A;  5ADX H;  4E1J A;  3JXU A;  3W0L A;  4EIA A;  5KPT A;  5C2D A;  4GV6 A;  5M1P A;  2YI1 A;  2GX9 A;  4JNE A;  3CMA N;  5AFU A;  3BEX A;  4MO4 A;  3MK6 A;  5AQL A;  3QFU A;  1NGF A;  4A2B A;  2BUP A;  5M1O A;  1J6Z A;  3O1W A;  4BRO A;  5EX5 A;  2P9N B;  3HRG A;  3VGM A;  3M5R A;  3D2E B;  3ZX2 A;  5JLH A;  4H5T A;  3E9O A;  3E9P A;  1IJJ A;  2AP1 A;  3C7N A;  2BH1 A;  1VQ8 N;  2E88 A;  1P8Z A;  3SMP A;  2OTL N;  2D0O A;  4FWQ A;  4BG8 A;  4BC3 A;  5AQN A;  3AAP A;  4IO8 A;  1JCF A;  4IWV A;  2PBD A;  2YJF A;  4H5N A;  1VAZ A;  3VMF B;  2OTJ N;  1VQ4 N;  2KHO A;  4U67 L;  5GIO A;  1T6C A;  4PKH A;  2JWL A;  1JCE A;  3SBT A;  4YOR A;  3KVG A;  1YXQ A;  3WUH A;  5HL7 L;  4L3Q A;  1QQO A;  2NRV A;  2VWB A;  3F5T A;  5FPM A;  3QFP A;  4JAX A;  3LM2 A;  5JLF A;  5H1S Q;  4ISE A;  1TUY A;  3IFR A;  3FZM A;  3UE5 A;  4A5B A;  3LL3 A;  5C0Y A;  1K8K B;  2VGM A;  3L0Q A;  4ILH A;  3H1Q A;  1GLL O;  2QWM A;  3FFK B;  2NNW A;  3CCV N;  4CZJ A;  2IVP A;  1GLA G;  4CZG A;  4DKW A;  4C23 A;  3IUC A;  4CZM A;  4IOX A;  3CJA A;  2UYT A;  3VEZ A;  4R79 A;  3NMU A;  1QQN A;  2D0P A;  3HBT A;  3NVM A;  4BQZ A;  1QQM A;  3ID8 A;  4GNI A;  2C1G A;  4EHU A;  4XJX A;  4JKH A;  1T3V A;  4WF9 L;  1XUP O;  1OKJ A;  2QEX N;  1BO5 O;  3D6R A;  4FPA A;  2P9I A;  5C12 A;  3RSE B;  3UKR B;  2E8A A;  1BG3 A;  2H3G X;  3R1X A;  3VES A;  5CR4 A;  4FWS A;  3G71 N;  4BRP A;  3N4Q A;  3VTH A;  4BEB A;  2QWL A;  1YJ9 N;  1NM1 A;  3DLL L;  3KZB A;  4H0T B;  3VF2 A;  2ZJP L;  1KXP A;  2YHY A;  3MN5 A;  3ZX3 A;  4WYB A;  3EN9 A;  5AQO A;  3MWT A;  1GLD G;  3D2F B;  1Y64 A;  3PIO L;  2GUP A;  1S22 A;  2P9S A;  1GLJ O;  3DXM B;  4K41 A;  5AQK A;  2DPN A;  5JMV A;  5AQY A;  5EXW A;  4M7Y A;  3VET A;  3CJ7 A;  1YF5 L;  4CZL A;  3DXK A;  3FGU A;  3O9R A;  3SAG A;  4K42 A;  3CQX A;  5MLC Q;  3GOI A;  1SQK A;  5GAG P;  4YOW A;  2P9U A;  4GVE A;  3O9S A;  3L4Q A;  3CPW M;  1DT9 A;  2CGJ A;  3NVK A;  4BC4 A;  3TTF A;  3VEN A;  4EFH A;  2HBK A;  1TYQ B;  3EO3 A;  4BRQ A;  2HBJ A;  2FSN A;  3JS6 A;  1KAZ A;  5AQJ A;  2NRZ A;  5AZI B;  3WXI A;  5BRD A;  3ATV A;  3A5N C;  4C1N I;  2E2Q A;  1MDU B;  3CXC M;  2VCP A;  2YHX A;  3EKS A;  3VPZ A;  4C1N K;  1NGB A;  1BA0 A;  1U2V B;  3BF3 A;  2QWQ A;  3CJ9 A;  4FWL A;  4K43 A;  4NB4 A;  3CCJ N;  3E1Y A;  3LDN A;  1G99 A;  3LDP A;  5BRE A;  1TUU A;  4FVU A;  2Q2R A;  3MDQ A;  5F0X A;  1NGC A;  1LCU A;  2ASO A;  3R3L A;  3VGK A;  1QZ5 A;  3CIP A;  5KPR A;  4BR4 A;  2NRH A;  3K9J A;  4NLB A;  3SLC A;  4WFB L;  4EAH D;  2J4R A;  1C0G A;  4BRF A;  5AFU H;  2I7N A;  4LC9 B;  2KKZ A;  2GEL A;  4HTL A;  4PHT X;  3H3N O;  3UKU A;  3HOT A;  2D1K A;  3FZH A;  1MWM A;  4B9Q A;  2FSJ A;  3O6W A;  4H5V A;  4EHT A;  5KQD A;  1M90 O;  1BA1 A;  3CCM N;  2IIR A;  2HBM A;  1ZBS A;  5AQU A;  4KH6 A;  3LM9 A;  1NGH A;  1CZA N;  3AAQ A;  5FPN A;  4DQ8 A;  1VQP N;  5LY3 A;  2BTF A;  3FR0 A;  2HF3 A;  3P38 A;  4H0V B;  4A2A A;  3WQT A;  2A41 A;  5BRH A;  1S3X A;  4JHD B;  4WFA L;  3TTC A;  4BGA A;  3MN7 A;  4ISF A;  4RTF D;  1YUW A;  2CGK A;  2HBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...