5AFUA

Cryo-em structure of dynein tail-dynactin-bicd2n complex
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
370
structure length
370
Chain Sequence
b'IANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKEQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DYNEIN TAIL
publication title The Structure of the Dynactin Complex and its Interaction with Dynein.
pubmed doi rcsb
molecule tags Motor protein
total genus 85
structure length 370
sequence length 370
chains with identical sequence B, C, D, E, F, G, I
ec nomenclature
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5afuA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5afuA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 5afuA03
3WEEA 4CZMA 4J8FA 5BREA 1ZXOA 4PKIA 4EAHD 5AQRA 5AQFA 4BR4A 2ZGZA 3U8XA 1YAGA 4FPBA 3WXLA 3A5NC 1XQSC 2ASOA 1E4GT 3RSEA 2WUSA 4JN4A 4O5FA 3WXIA 5JLHA 3QICA 3ULEB 3QFPA 3SLCA 4HWIA 3O1BA 4PKHA 3ZX2A 2A6AA 1YVNA 3HSCA 1K8KB 4B1YB 1GLFO 4ISFA 5BRHA 4I6MB 1QQOA 4M7XA 2P9KA 2QWQA 2CGKA 1NGIA 1T6CA 1GLLO 2PBDA 5EOYA 5EY4A 1BU6O 1CZAN 3LDPA 2A40A 3FZLA 5AQJA 4BRLA 1NGEA 2DPNA 3HZ6A 3CJCA 3VOVA 4CZJA 3VEVA 4QS8A 1XUPO 3FR0A 1HKGA 2P9NB 2E2QA 3A0IX 2AP1A 1GLJO 2YHXA 3CETA 1XC3A 4GY2B 5AFUH 3CERA 2P9PB 2QXLA 4B1XB 4CI6A 1GLEG 3FGUA 3ZEUA 4BG9A 1TUYA 1V4SA 1JCEA 1BA0A 3QBXA 4DB3A 2QWOA 3WT0A 2UYTA 2W40A 4H5TA 3W0LA 1NGHA 2GUPA 2V51B 3G25A 3MN6A 1C0GA 3KZBA 3ENHA 4BRFA 5KPRA 1QQNA 3UE5A 4H5WA 1QQMA 3VGLA 1NGBA 2PAVA 4B9QA 3CQYA 3EZWA 2HF4A 5BN9A 5I9EB 3R8EA 1GLAG 1NGDA 1QZ6A 3ZX3A 3EN9A 4FWNA 4CZEA 2FSKA 3HBTA 1QZ5A 2YI1A 4L3QA 3LDLA 4WQ4C 4Z94A 5FPDA 1KXPA 2GWJA 2FF3B 3LM2A 3O1WA 4FWRA 4H0PA 3JS6A 5BPMA 1ATNA 5AQYA 5EX5A 4CD3A 5AR0A 4JNEA 3EL2A 2GELA 3P4IA 3VEYA 1BOTO 2Q97A 4XH4A 2E2OA 5AZIB 3C7NA 1DKGD 2J4RA 4BC5A 4BRPA 2E8AA 2ASMA 2GWKA 4DQ8A 3J8AA 2A5XA 3GBTA 4IWVA 2CGLA 3D2EA 4BGBA 3VF2A 1BUPA 3DXMB 3SMPA 2OANA 2E20A 4FWLA 4FWKA 3UKRB 1HJOA 2A42A 1X3NA 4BGAA 1SQKA 3M3ZA 4QS7A 3ULEA 1U2VB 1J6ZA 3MN5A 2F9WA 2Q31A 3QFUA 1Z05A 5F2RA 3GOIA 3GL1A 2CGJA 3BEXA 2NRHA 3R6MA 5FPNA 3LDOA 4B1UB 1K8KA 2Q0UA 3D7EO 4H0VB 4I6MA 3O6WA 4JAXA 4BC2A 3CJ9A 3CJ7A 3FZMA 4JD2B 5AQXA 1S3XA 1NMDA 4BRMA 3H1QA 2V7ZA 4MLEA 4F9OA 3ID8A 1NGJA 4BC3A 4LC9B 3QB0A 4H0TB 3HM8A 1H1VA 3I33A 2P9NA 3KHYA 1S22A 4IJNA 1MDUB 4IZ9A 4CJ7A 5AQUA 1HPMA 5BPNA 2YJEA 3IDHA 4BG8A 4RTFD 2P9PA 3S41A 3KVGA 4O8KA 3GG4A 4PKGA 5AZJB 1LCUA 3FLCO 3LDNA 3DXKB 1JCGA 5AQOA 5AQPA 2Q36A 4EIAA 5KQDA 4CZHA 3W3DA 3I8BA 2D0OA 3U4LA 2IVPA 3H46O 4MLHA 3UB5A 4AM7A 1NBWA 2IVNA 2V52B 3IMXA 5ADXA 3WXKA 2VCPA 4FPAA 5JLFA 1WUAA 3GE1A 2QWRA 3CHWA 2CH5A 1TYQB 4XH1A 3O08A 2E2PA 1YXQA 4K43A 5JICA 1GLBG 5KPTA 5AQMA 1HX1A 4EHUA 3WXJA 3A5OC 1RGIA 1ATSA 1KAYA 1X3MA 4YDUC 5AQZA 3MN7A 3LDQA 2BTFA 3U9ZA 1D4XA 3BP8A 3TU5A 1OKJA 1KAZA 4K41A 4M7YA 3B8AX 4IO8A 3VEOA 5AQGA 3VETA 3EO3A 4BR5A 2NZTA 2ASPA 5FPMA 3CIPA 3JXUA 5AQNA 2D1KA 4H0XB 3AAPA 2QWLA 5TKYA 3VF4A 4NB4A 5AZIA 4BROA 1DGKN 3BUZB 2I7PA 1Q18A 2QW9A 3MDQA 4XH5A 4BRIA 1DEJA 4BRNA 2V7YA 1GLDG 1NM1A 2HOEA 3H6EA 3L6QA 2QWMA 5JMVA 4BREA 2IVOA 1QHAA 1U6ZA 2A3ZA 4CBXA 3AARA 3VGKA 4CZGA 1RDWX 1NLVA 3C0BA 3HI0A 3DXMA 3VESA 3FFKB 4PL7A 5AQWA 3UKRA 4JHDB 2FF6A 1NGCA 2W41A 3SJHA 2QWPA 2P9IB 4QS9A 2QWNA 3EKUA 4EFHA 1U2VA 3A8YA 1RFQA 2E88A 4DCHA 1NGFA 3GDQA 5LJWA 3O80A 3MMVA 4BRGA 2E2NA 5BRDA 3O4WA 1HKCA 2FSNA 2FLOA 1C0FA 2BUPA 2P9SB 2AA4A 4FWPA 1SZ2A 3TPQA 1HLUA 3ATUA 3CJ1A 4CBUA 2FXUA 5B8HA 1T44A 3VENA 4M63C 4HTLA 4JD2A 1R59O 4H03B 2P9UB 2YHYA 3MN9A 4FWOA 4RCHA 1MWKA 4CZFA 3L0QA 4WQ4A 3M6GA 3UKUB 5ADXH 4FO0A 4BRDA 4BR2A 3IUCA 4MO4A 2EWSA 1ZBSA 5AQKA 4H5NA 5LJVA 1V4TA 1IG8A 2E1ZA 5AZJA 3R9PA 5BRFA 4GNIA 5E26A 3OHRA 3VERA 3DXKA 4H0YB 4FSVA 4FOIA 1YUWA 1NGGA 3QDKA 4KBOA 3CQXA 3WQUA 2IIRA 3ZETB 2P9LB 2F9TA 3D2FB 4H0OA 4A2BA 4CD1A 4CZIA 5BPLA 1GLCG 2VYPA 2NLXA 1BWFO 4BVOA 2D0PA 4FOEA 4MO5A 4BVPA 4BR9A 4BRAA 3FZKA 4BRCA 4E1JA 2FSJA 3O5BA 1TYQA 2D4WA 3WEEB 4B1ZA 3WUHA 3VEZA 5KQ8A 3BF3A 3DJCA 4B1WB 5AQSA 3RSEB 4RWTA 1KAXA 4A61A 1LOTB 3VPZA 3BF1A 2GTDA 2H3GX 2ITMA 2YHWA 3LL3A 2Q2RA 1WOQA 1G99A 3H1VX 2YCHA 1TUUA 4H5RA 4BR7A 4EHTA 4C23A 1HKBA 3WQTA 2A41A 2P9KB 2ZF5O 3CJBA 4Y0WA 4A2AA 2E1YA 1T6DA 1MWMA 2Q1NA 4WQ5C 3H3OB 1MA9B 1ESVA 3H3NO 4FWSA 5AQIA 3H45C 5AQQA 4JHDA 1E4FT 2GEMA 2P9IA 3FZFA 4FL9A 1ZC6A 4H5VA 3IFRA 4BRQA 2ZGYA 3F9MA 4A62A 4B1VA 2ZWHA 5E84A 3ZEUB 4DHYA 1BO5O 5FPEA 2QM1A 4IXCA 3ENOA 3VEXA 1Y64A 1NGAA 3DAWA 3VGMA 5F0XA 3MCPA 1HUXA 2Q0RA 2P9SA 3LM9A 2YJFA 5ELZA 5KPZA 4BR0A 4K25A 4BC4A 3O8MA 4FWMA 3U9DA 5AQVA 2P9UA 4CZKA 4YDUA 5EVZA 3ZX0A 4BRHA 4CZLA 1BDGA 3QBWA 5AFUA 3UKUA 3M1FA 3AY9A 5BR9A 2HMPA 5BN8A 3CI5A 5AQTA 2CH6A 4FWQA 1JCFA 1BA1A 4PL8A 3L4IA 5AQHA 3SK3A 4WQ5A 3A5LC 4CBWA 2HF3A 4BQLA 3DWLA 4AM6A 4ISEA 1BG3A 1Z6RA 2VWBA 3HTVA 3VEWA 3EKSA 2KHOA 3VF6A 4WYBA 5CE3A 1X9JA 3ZETA 2P9LA 3A5MC 3AAQA 3D2FA 1P8ZA 4IJAA 1IJJA 3QMLA 3C7NB 3CJAA 3FE1A 4XEIA 3MK6A 5EXWA 5F1XA 5LY3A 4BRKA 4NO7A 1EQYA 1ATRA 3D2EB 3FZHA 4ISGA 1SAZA 3SMSA 5AQLA 4K42A 1NWKA 3ATVA 2I7NA 4BQZA
chains in the Genus database with same CATH superfamily
3WEEA 4BDYA 2OTJN 4PKIA 4JKDA 2NRVA 3U8XA 2W6LA 2BE2A 4AHUA 2ASOA 1VQLN 1HNXK 4DSKA 4FVUA 2WUSA 4O5FA 3WXIA 1S6QA 3G10A 3ULEB 4ELTA 3O1BA 2UUCK 4NYNA 3WNFA 4CEEA 4Z4IA 2A6AA 4C8LA 1KFDA 5K14A 3I0SA 1HMVA 4PWDA 1Q86O 4CHPA 1GLFO 3QEWA 1TK5A 5BRHA 4I6MB 2P9KA 4MFBA 1NK0A 2QWQA 3NBPA 1T6CA 4IOXA 3VQ8A 3LDPA 2A40A 5AQJA 2HHSA 3AA4A 4BRLA 1NGEA 3VEVA 4JS5A 4QS8A 5CR4A 2G8HA 1NKEA 1LWCA 4YOYA 5FROA 3ZT1A 1YJWN 4IG3A 1RDAA 3CETA 1XC3A 4GY2B 5AFUH 3KLEA 4CI6A 1XWLA 1OVQA 4BG9A 3F9KA 1TUYA 4DV1K 3ULDA 4DB3A 1RBSA 4IG0A 1JLCA 2QWOA 3WT0A 4B8AB 3T69A 2XO7A 4H5TA 3CCUN 3G25A 4B3SK 3LDSA 3O9QA 3ZLJA 3ENHA 1VHXA 4E7JA 4WFBL 5HROA 3TSPA 4W5TA 1QQNA 4FZYA 1J9AA 3UE5A 4H5WA 1NGBA 4YOUA 4H4OA 4B9QA 3QESA 3MX5A 5BN9A 1WB9A 3R8EA 1X9MA 4XJXA 1VQ9N 2IS3A 3MEEA 4CZEA 3PO4A 3HBTA 1LW0A 4DTNA 3LDLA 4AILC 2UXBK 4NLCA 4WQ4C 3SBTA 3LM2A 4RW9A 2XRIA 5C2DA 2HBMA 4H0PA 5AQYA 4A5BA 3G4SN 3MX2A 1Y97A 3JSMA 3VEYA 4BE7B 2F4VK 4BDPA 2ZJPL 1VQ6N 1GOAA 4ZTJA 3LPUA 3RMDA 3GBTA 4B9VA 4JK9A 4BGBA 1FXXA 5J2NA 3AGRA 4FWKA 3NF9A 4LH4A 3UKRB 4DR1K 3OYNA 3VMFB 1ASWA 4BGAA 3O9UA 4QS7A 5C42A 3ULEA 5C0YA 1U2VB 1JKHA 3T7ZA 5F2RA 3ALYA 2CGJA 1F21A 1KFSA 2NRHA 3R6MA 1SKSA 2F96A 3LDOA 3QNNA 1NNEA 1WBBA 4I6MA 4CECA 3DLBA 1WBDA 2ZQBA 4JD2B 4HCBA 3SCXA 4F9OA 3ID8A 2HHUA 3QEIA 1S1XA 1RBUA 4IEIA 1H1VA 3DRPA 4IFEA 2OPSA 4CJ7A 1D8YA 1HPMA 4KHSA 4JI2K 4NXMK 3RMBA 5C24A 4BG8A 3S41A 3OYKA 3JYTA 3QO9A 5AZJB 2YKMA 4E3SA 2D0AA 4JI0K 1JCGA 4EIAA 4CZHA 4NCBA 3W3DA 4C8NA 2FBVA 4LF4K 3LWLA 3H46O 4FZZA 4IEEA 1VSEA 4GV6A 1VRUA 2DFFA 4FPAA 3HOSA 5JLFA 5HLFA 2ITGA 4KHNA 4LSNA 4BACA 3GE1A 4ILJA 2E6MA 3CHWA 4A5AA 5TKWA 3G6EN 4W5OA 2E2PA 2Q3SA 1GLBG 1HX1A 4EHUA 1QHTA 3QEVA 1ATSA 3HPOA 1X3MA 4CEBA 1VSDA 3LDQA 5HRNA 3I0RA 3BP8A 1OKJA 1KAZA 3SQ2A 1TK0A 4M3YA 3S3OA 4DUYK 4NCAA 3IAYA 4FM1A 2QWLA 1EX4A 2I7PA 1Q18A 2QW9A 5CYQA 3AO5A 4K8ZA 3E9PA 1RTHA 1S5JA 2IVOA 3CYGA 1LAVA 4CBXA 2D5RA 5CY4A 4CZGA 1RDWX 3HI0A 3C0BA 3VESA 4FK4A 3CG7A 3SUPA 4CIGA 3UKRA 3K58A 2FF6A 1UWBA 2QWPA 4QS9A 2QK9A 1JLQA 1WN7A 1U2VA 3A8YA 2E88A 4DCHA 1SL2A 4CJWA 3GDQA 5LJWA 5BRDA 4WE1A 3VQPA 4CCHA 1IG9A 3V81A 3O4WA 1NJXA 2BUPA 4X66K 2AA4A 3PLAA 3SPZA 3TPQA 4LFCK 3MECA 1T44A 3VENA 4AHRA 4JD2A 4RW4A 3SI6A 3CCEN 3MXMA 2IDOA 4H03B 2P9UB 2YHYA 1NJZA 4JEPA 4FWOA 1Q82O 1MWKA 1SKRA 3M6GA 2W42A 3TTDA 3VQDA 3OY9A 4BRDA 3IUCA 3O9TA 3RR7A 2NRRA 2OPPA 4MO4A 3O9RA 3TAFA 2OTLN 4H5NA 1EWRA 5LJVA 1RBRA 4CEAA 1IKXA 5AZJA 4W5NA 4FSVA 3AVMA 4FJ9A 3QDKA 5DK5A 4BDZA 2G8IA 1TL1A 1SS6A 2P9LB 4A2BA 2PYJA 3NF8A 3K5MA 4FCYA 4JI8K 3T1AA 2JWKA 2O4GA 2Z1HA 2UUAK 3VA0A 4JK7A 4E1JA 5J1EA 2NRWA 5KQ8A 1YTUA 1QTMA 1JXBA 3KWIA 4OJRA 4B1WB 3ISNC 3J81O 4RWTA 4FZXC 3SQ0A 4CJ4A 2GTDA 4E1MA 1JLBA 4GVMA 3ZSWA 2YHWA 1W0HA 1FW6A 2Q2RA 1IKWA 1KVCA 3H1VX 3KLGA 1XNQK 3EY1A 1DLOA 1TUUA 4LH5A 4G1QA 4EHTA 1NKCA 4C23A 2EHGA 5KRTA 4DLEA 3LAMA 1QSYA 4KTQA 3WQTA 3CJBA 1D9DA 1UA0A 3PY8A 3U6FA 3ZSZA 1VSMA 4KI6A 1T6DA 4KFBA 3LP1A 2HBKA 3KTQA 3T19A 1ESVA 3H3NO 4MDAA 4FWSA 2P5GA 3OS2A 3PIPL 3DRRA 4YHHK 3CCQN 1ZC6A 1T7PA 3IFRA 4HUEA 5E84A 3ZEUB 2WONA 3CFPA 3ENOA 3VEXA 4CEOA 1Y64A 1S9EA 2Q0RA 2O8FB 2YJFA 5CZ2A 4K25A 2BANA 4DMNA 2Z1GA 4FWMA 4WCEL 3U9DA 1VQ8N 2RHKA 2P9UA 4DU3A 1X9WA 5EVZA 2OPRA 4BRHA 3CCMN 3M1FA 3CMEN 3CI5A 5AQTA 3S9HA 4DSLA 5IT9O 2YKNA 4Q5VA 3ENBA 5J2PA 5T7BA 2G8UA 1JCFA 1RTIA 5C25A 5AQHA 5GINA 3MCAB 2C1IA 3N4QA 2QEXN 2HHVA 2HHIA 4FM0A 1K73O 3KKSA 4Y1DA 5CE3A 3V1QA 2P9LA 3QMLA 2E5LK 3SJJA 5EXWA 4IFYA 4CJVA 5F1XA 3QNOA 5LY3A 4BRKA 1NJIO 3D2EB 1WSEA 3FZHA 1SAZA 3VQQA 4K42A 4BQZA 3M8QA 1L3TA 1ZXOA 4E1NA 3MEGA 1REVA 2XY5A 3ZCMA 1XQSC 3DYAA 4DV0K 1YIJN 3EE8A 2RF2A 4JN4A 1TKDA 3OYAA 3QICA 4H4MA 3SLCA 4DFKA 3RVCA 4HWIA 4LF6K 1CXUA 4E7LA 3MEDA 4CFDA 1KQSM 3ZSVA 1YVNA 3OBWA 1KVBA 1IH7A 2B4JA 4ID1A 1KCFA 4ISFA 3P38A 4FJ7A 3PV8A 3LAKA 1J54A 3AO2A 4JKBA 3OJSA 4FYDA 4JLHA 3TAEA 1YI2N 1VAZA 3PX0A 3HZ6A 3ZT4A 4CZJA 4B9MA 1RT3A 3DLLL 4AH9A 2F8TA 2E2QA 3A0IX 4E7HA 3ID6A 2P9PB 2QXLA 4B1XB 1K6YA 3ZEUA 2HSTA 3E66A 3TR8A 2V51B 5BR8K 2KZMA 2QKBA 3QINA 2O8FA 1C0GA 1LWEA 4U7BA 4LFAK 4BRFA 3C95A 1VQPN 5KPRA 3NH2A 4Y1CA 4OKEA 3TSQA 2QA4N 3PX6A 4E72A 3AVHA 3C6HA 3CQYA 1VQKN 1QE1A 5I9EB 3OYMA 1QZ6A 1VK0A 2FSKA 4I7FA 4O8UA 1QZ5A 2YI1A 4PHTX 3R1XA 4KB1A 2GWJA 4IBNA 3AVKA 4OO1J 5A2QO 4DFJA 3DI6A 3JS6A 4JKEA 4CEFA 5AR0A 5LMUK 1M1KO 4JNEA 4O0JA 1BOTO 2Q97A 1JLEA 3VQ9A 3NCIA 4M3RA 4DQQA 4YOTA 5KGWA 1DKGD 3HSTB 2E8AA 5KRSA 4FJGA 1ZBFA 1TAUA 2A5XA 2CGLA 3D2EA 4E0DA 3CXCM 4KPYA 4KHWA 3VF2A 1J5EK 4CJTA 2OANA 4FJXA 2E20A 4ZHRA 4DS4A 3HYFA 1HJOA 5GADP 1X3NA 3KLIA 2KTQA 3V9UA 4DR4K 1J6ZA 2Q31A 4B3OA 3QFUA 1Z05A 4DTUA 2UU9K 3SAHA 4YOVA 1HNVA 2VQFK 4FW1A 4DQPA 2Q0UA 1LWFA 4ELVA 4IDKA 3EYZA 4FJKA 4JAXA 3F73A 4BC2A 1TAQA 3CJ9A 5AQXA 1RT7A 4LF5K 1S3XA 4OKJA 4MLEA 1S1VA 5D3GA 2Y1JA 4BC3A 4LC9B 4BE2A 4IDHA 4DFPA 4U67L 3VN5A 3IDHA 1Q9XA 4RTFD 3DLHA 2P9PA 3KVGA 4O8KA 4CFBA 2ZM6K 4FJHA 2AJQA 1DTTA 3LDNA 4KAZA 3DXKB 5AQOA 4Z0UA 4BWJA 4RG8A 2D0OA 3T1HK 4CGHA 2IVPA 4DV4K 3K5OA 4MLHA 1IO2A 2IVNA 2V52B 3IMXA 5ADXA 2YNHA 1NOZA 5FRNA 4CIEA 2VCPA 4DU4A 2ATQA 3ZT3A 4JKAA 4M42A 1BL3A 4XH1A 3O08A 4K43A 5JICA 5AQMA 1XHZA 3O4QA 3KLFA 4YDUC 5AQZA 3AVIA 3HRGA 2ZE2A 4FXDA 4F8RA 1D9FA 2A1SA 5AQGA 3EO3A 1TKZA 2NZTA 4CK1A 2B5JA 3JXUA 4H0XB 5HRPA 5TKYA 3ZSRA 3VF4A 3BUZB 4JI3K 1XNRK 4BRIA 3E9OA 4M41A 1S72N 1GLDG 3VQCA 2GBZA 5JMVA 2A1RA 3SNNA 4BREA 1N32K 3CCRN 2A3ZA 1YJ9N 3AVAA 3KK7A 4JKHA 3NAEA 3FFKB 4PL7A 1Q9YA 1NGCA 1TGOA 2P9IB 2RN2A 3EKUA 4KHUA 1WSHA 4RW8A 1NK9A 4JI7K 1RFQA 1NGFA 2E6LA 4E7KA 4DQRA 2PY5A 3O80A 3MMVA 4Z4CA 1KD1O 2FBXA 3V9ZA 4E89A 3TTFA 1C0FA 4FWPA 3P39A 1SZ2A 1VSFA 4KO0A 4CBUA 2RE2A 4M3XA 2HW3A 2FXUA 5B8HA 1EO1A 4M63C 4HTLA 5CHIA 4UQGA 1VQMN 4J2DA 2I5JA 3QLHA 3L0QA 4JKGB 4CEZA 3HT3A 4FO0A 4BR2A 4BECA 4CGDA 4X65K 3OS1A 4J2AA 4DV3K 2EWSA 1KSPA 1ZBSA 1I94K 3C6UA 1T05A 4M45A 2JWLA 1NMNA 3ZSQA 2G8KA 3VERA 1HNWK 3DXKA 4H0YB 4FOIA 3VQBA 3I8DA 4O4GA 4B3TK 4B9SA 4ILHA 4KBOA 3RWUA 3AVNA 3ITHA 3WQUA 5JVGL 3OYFA 4GV3A 4CZIA 2HNZA 1GLCG 3I56N 5HRSA 1BWFO 4BVPA 4BR9A 4BRAA 4NYFA 2VGNA 4BRCA 3O5BA 2IC3A 1VQNN 4B1ZA 3VEZA 3EZ5A 4Q0BA 4B9TA 4LY7A 3TTCA 2PYLA 3UIQA 3RSEB 5C2FA 4YORA 1BCOA 3D45A 3V9SA 4A61A 3NGYA 2VG7A 4AHSA 1LOTB 4DV5K 3VPZA 4KB0A 4O5BA 4JV5K 3DOKA 2H3GX 4DR3K 2ITMA 1WNSA 3BY5A 4AF1A 4CGGA 1G99A 3CFOA 4CJ5A 1UOCA 4HTUA 3AA5X 3V4IA 1CZ9A 2A41A 4HVJA 1NU0A 4N56A 2WOMA 4BWMA 3OYBA 3L3VA 3V1RA 1MWMA 1HYVA 1L3SA 3V9XA 3NHGA 4WQ5C 1MA9B 1SL0A 1ASUA 2W6KA 3H45C 1B9DA 4N5SA 1E4FT 1O13A 2GEMA 1N33K 2P9IA 4FL9A 2XY7A 1RDUA 4F4KA 2ZWHA 2KFZA 1BO5O 1QS4A 4GVEA 4FLVA 1J5OA 4DUZK 5DM6L 3VGMA 4CJEA 5F0XA 2HHTA 1HNIA 3KKRA 4OPAA 1XMQK 1ITGA 4FLXA 5AQVA 3TAMA 2HHQA 4CZKA 4KH6A 1N8RO 1NG9A 1BDGA 4IOCL 3QBWA 4JKGA 5AFUA 1RILA 3AY9A 1G15A 2HMPA 3CM5A 4KH5A 2FC0A 5CZ1A 4FM2A 3HOTA 2DTUA 1ZBLA 3OVNA 4FWQA 2O8CB 1BA1A 4PL8A 1X1PA 2BH1A 1XHXA 2HF3A 4BQLA 3PX4A 1RTJA 3DWLA 4OGEA 3CYMA 3QETA 1BIZA 3VEWA 1RT2A 5KTQA 4DR6K 1QSSA 1X9JA 4TSXA 3AAQA 1P8ZA 4KHPK 3O3FA 3CJAA 3FE1A 4KI4A 3RMCA 3TSUA 1EQYA 1ATRA 4CJSA 4ISGA 3SMSA 5AQLA 3E01A 1NWKA 1EXQA 3ATVA 4CZMA 3J7YP 4JI5K 4J8FA 5BREA 1N6QA 3NGIA 1N5YA 1M90O 1CXQA 5AQFA 4LSLA 4F3OA 1YAGA 3WXLA 3A5NC 3RSEA 3CCLN 3LZIA 3NF7A 4DF8A 5JLHA 1Z25A 4I2QA 1NKBA 3VTHA 3ZX2A 1HPZA 3HSCA 3P83D 4B1YB 3BDPA 3SUOA 3J80O 3AV9A 1I39A 3NVKA 4OLAA 2F8SA 1ZYQA 1GOBA 1GOCA 1BU6O 1CZAN 3WNGA 4CF9A 2XY6A 3VOVA 1ZBHA 1XUPO 1HKGA 4EZ9A 3SZ2A 4JI1K 2P9NB 4CESA 4KKOA 1NK8A 2AP1A 4IO9L 1DT9A 1GLJO 4Z4EA 3L8BA 3KD1E 5HRRA 3FGUA 1EKEA 1JCEA 2G8VA 2UYTA 2KKZA 3W0LA 5FRMA 2HVIA 3L4QA 1FK9A 3V9WA 3K0SA 1TK8A 1BHLA 4B9NA 1T8EA 4JKFA 2ETJA 1QQMA 3VGLA 4K8XA 2YV0X 4N76A 3DOLA 1FKOA 2HVHA 1HNZK 1RDDA 5SWMA 1NGDA 4FJ8A 1XMOK 1NOYA 3ZX3A 2JGUA 3SAFA 4FWNA 3OYDA 3KIOA 3BZCA 3TAGA 4L3QA 3NMUA 1NJYA 4ID5A 4AHVA 3F2KA 2OPQA 2O8CA 3AO1A 4DV2K 3KK1A 5FPDA 3SQ1A 1KXPA 1OVYA 2FF3B 1N34K 3O1WA 4DLGA 4C8MA 5EX5A 4PY5A 1SUQA 3EL2A 1IKYA 4DTSA 4XH4A 1A5XA 5AZIB 2LSNA 4CJLA 3F5TA 3SUQA 2J4RA 1CZBA 4KV8A 4BC5A 2QI2A 4FVMA 4DQ8A 3J8AA 2ZJQL 2KFNA 3RRHA 3D6RA 4FK2A 3HO1A 4I9LA 3SUNA 4I9QA 4CK2A 3DXMB 3SMPA 3EE9A 4B08A 3HM9A 4FJMA 2A42A 1YVUA 1JLGA 3M3ZA 4M3TA 4PA1A 2F9WA 3SBGA 5M1OA 1CLQA 3A2FA 3GOIA 2R7YA 1B9FA 4N41A 1T3VA 4LF7K 5GIOA 3PSIA 3PIOL 4OGCA 5FLXO 1YITN 2GUIA 2IAJA 2VG5A 4H0VB 5C10A 4FLUA 2G8WA 5LMNK 3MAQA 4DU1A 4M3UA 1Q7YO 1LV5A 3DLGA 1WSJA 4BRMA 3H1QA 4OPJA 2V7ZA 1S9GA 4CE9A 4CGJA 4H0TB 3DRSA 3I33A 4HUGA 2P9NA 3IRXA 1VSJA 3KHYA 4IZ9A 1MDUB 2VWKA 3HVTA 1WLJA 5AQUA 1S1TA 2Z1IA 4DTXA 2YJEA 2DFEA 4OLBA 3GG4A 2NUBA 4HHTA 1LCUA 3N4PA 3L2RA 5GIPA 4QAGA 2X74A 5KQDA 3T3FA 3U4LA 3TWHA 1RT1A 4AM7A 3UB5A 5JS2A 3P5JA 3WXKA 1WUAA 1Q81O 1NJWA 4GMJB 2CH5A 1YXQA 3IS9A 4GW6A 1YHQN 1XI1A 3WXJA 1HYZA 1KAYA 3OW2M 3MN7A 1OH8A 2NRXA 3CC4N 4EZ6A 2YHAA 4Z4GA 3C6TA 1D4XA 3U9ZA 3OYEA 2VQEK 4M7YA 4K41A 1TKTA 3VEOA 5KGXA 4F3TA 4FJ5A 4BEBA 3VETA 3O9SA 4BR5A 4C1NI 5FPMA 3T1YK 3SPYA 2D1KA 1WAJA 3ZT2A 4BROA 5AZIA 4XH5A 3VQAA 3BGRA 2YNGA 1C1AA 5LL6Z 2V7YA 3D0PA 4BE1A 1NM1A 2HOEA 3H6EA 4FJJA 3L6QA 4CEQA 3OYLA 5JS1A 3OYJA 1QHAA 1IBMK 3AVLA 3DXMA 1HRHA 3I55N 3M8RA 5AQWA 2OA8A 4FJLA 3LALA 2W41A 2HHXA 2EX3A 3TI0A 1HQUA 4FJNA 1RT5A 5J2MA 1C0UA 5KI6A 1J53A 2UUBK 4DSJA 3THYB 3B6PA 1HKCA 4FLZA 3NE6A 3NH1A 5CYMA 4DTJA 3E9LA 1QVFM 1TL3A 3OYCA 1S1UA 1R59O 3VA3A 4BY9C 4WQ4A 4E19A 4DQIA 1WSIA 4IFVA 4DV6K 1W2BM 4JI4K 4B8CA 5AQKA 1V4TA 1IG8A 4HCCA 1TVRA 3LP3A 4DTRA 3R9PA 5BRFA 4JYAK 4GNIA 5E26A 4FW2A 5HL7L 1YUWA 3IKMA 1NGGA 3V1OA 2HBLA 4WFAL 4DR2K 3S3MA 2IIRA 3ZETB 4CD1A 2F9TA 1U04A 4DR7K 1K9MO 2DFHA 4BVOA 2D0PA 4FOEA 3R3LA 1IV0A 3C65A 1BQNA 3CCVN 3WUHA 2X6NA 3NVMA 4CERA 2X6SA 3DJCA 4FLYA 3K9KA 4JRQA 2NRZA 2KZZA 1C0TA 3CM6A 4GKKK 3BF1A 1RT4A 4O55A 1YJNN 4W5QA 5FDLA 3CC7N 4IOAL 3AVCA 2YCHA 2KLAA 3L3UA 2W00A 2B6AA 5H1SQ 3VQ5A 4W5RA 4MQ3A 2PZSA 4Y0WA 3P31A 4A2AA 4DSEA 2BGGA 2QTDA 2Q1NA 1P90A 4XIUA 3HPGA 4CJUA 3H3OB 1U45A 3H08A 2WFBA 1WSGA 3FFIA 2GV9A 4AHCA 4H5VA 1BI4B 4BRQA 2ZGYA 4A62A 4B1VA 1K8AO 3VTIA 3HP6A 5FPEA 2QM1A 4QCLA 4IXCA 5DMRA 2Z1JA 1T03A 1E3MA 1NGAA 4UY8O 3HK2A 4CIFA 3THYA 3Q7BA 3MCPA 3LPTA 4CF1A 3K5LA 3LM9A 5ELZA 1C1BA 5KPZA 2YNIA 4BR0A 3O3HA 4BC4A 1U4BA 2DY4A 1FJGK 2D0BA 5M1PA 3Q7CA 3WNHA 3ZX0A 4CZLA 1RT6A 4CEDA 3MWTA 1KTQA 5BR9A 4LF8K 3RTVA 3L2WA 3VQ7A 4DTOA 5HP1A 3OYHA 1HJRA 2CH6A 4KTZA 4H8KA 5HOOA 1U48A 5C12A 3AO3A 4DTMA 4Z4HA 4FK0A 4WQ5A 1N36K 2P51A 3AA2A 4CBWA 2HB5A 4AM6A 4ISEA 1BG3A 4CHZA 2VWBA 3HTVA 3EKSA 2KHOA 3THWB 2UXDK 2F7TA 2O8EB 3SV3A 3ZETA 4JKCA 1IBLK 4DKWA 1YTAA 3C7NB 4YOXA 3MK6A 4OPKA 4KHYA 4NO7A 2C1GA 1A5VA 1WAFA 2NNWA 4RW6A 2WBNA 1UAXA 3B6OA 4KH4A 1U49A 2I7NA 2JLEA 3NFAA 4DTPA 4EAHD 1NK5A 5AQRA 1KLMA 4BR4A 2ZGZA 3ZSXA 4FPBA 4DR5K 2XY8A 4CF0A 1E4GT 1L3VA 1A5WA 3QIPA 1OH5A 3QFPA 4WF9L 4PKHA 3HXMA 2E4LA 1VSHA 4JI6K 1W7AA 4O44A 1C6VA 1K8KB 5GAHP 3CPEA 1QVGM 1QQOA 4M7XA 2ZD1A 2CGKA 3THXB 1NGIA 4NXNK 1GLLO 4FLWA 4J2BA 1B92A 2PBDA 5EOYA 5EY4A 3HP9A 3VQ4A 3FZLA 5M1FA 1RDBA 1ZBUA 2X78A 2DPNA 3TARA 3CJCA 3NH0A 1C0MA 1MU2A 3FR0A 4CW7B 4K0KK 4CJFA 3TAQA 4CHNA 5I42A 1BI4A 2YHXA 3K59A 3PSFA 3CD6N 3CERA 3LP0A 1GLEG 4OVLA 1TKXA 1V4SA 3ZSOA 1BA0A 4CFCA 3QBXA 4KHQA 2W40A 4A57A 4X62K 1NGHA 2GUPA 3MN6A 2Y1IA 1EWQA 3KZBA 2KQ2A 2WTUA 5GAEP 1LW2A 3KK3A 5IWAK 3PUFA 1U47A 2XHBA 2PAVA 1O1WA 3TANA 3EZWA 1S6PA 2HF4A 3M5RA 4ELUA 1GLAG 3EEQA 1KLNA 3EN9A 4DQSA 4LFBK 3OA9A 1YT3A 4BE0A 4NCGA 3HVRA 4IKFA 4EP5A 2KW4A 4Z94A 3G0ZA 3NF6A 4DSIA 4FWRA 5BPMA 1ATNA 4F2SA 3U3GA 3OJUA 3IG1A 4CD3A 3K2PA 4I2PA 2GELA 3P4IA 3THWA 2O8EA 2E2OA 2P5OA 1VQ5N 1VSIA 3C7NA 3RMAA 4BRPA 1Z26A 4CGFA 2ASMA 2YNFA 3VQEA 2GWKA 3LZJA 3KWGA 4PUOA 4IWVA 2D0CA 1VQ4N 4G9ZA 2O4IA 1BUPA 2VG6A 1HQEA 4CJKA 2IGIA 4FWLA 3ZT0A 3SYZA 4DV7K 4JRPA 3CF5L 3OYGA 1SQKA 5M1QA 3NGZA 3MN5A 3RRGA 3ZYYX 4E7IA 2FBYA 4Z4FA 4A59A 3GL1A 3K9JA 1XC9A 3BEXA 1R0AA 1ILYA 4MDBA 1RCHA 5FPNA 4HUFA 5J2QA 4B1UB 1K8KA 3D7EO 4FLTA 4YNQA 1WSFA 3O6WA 3THXA 3CJ7A 3FZMA 4C1NK 1TV6A 2YX6A 1NMDA 4M3ZA 1RNHA 4RW7A 4CVNE 4CJQA 1NGJA 3QB0A 3HM8A 4C8OA 4M3WA 1S22A 4IJNA 3C6AA 3MXJA 2QXFA 2O8BB 5BPNA 4DF4A 3LP2A 4PKGA 3CCJN 2OYQA 2HNDA 1BGXT 3FLCO 3OYIA 4N47A 1BQMA 5AQPA 2Q36A 1IKVA 3AVJA 3JAMO 3J7AP 3I8BA 3QIOA 3E1YA 1D5AA 4X64K 3SAGA 1NBWA 3QEXA 4AQYK 3WNEA 5HBMA 2QWRA 2UXCK 4QOZB 1TYQB 1HR0K 5KPTA 3A5OC 1RGIA 4B9UA 1IBKK 2OCEA 2BTFA 4B9LA 5E41A 3TU5A 3DM2A 3B8AX 4IO8A 1JLAA 1W97L 3ZSYA 1I3AA 3BZKA 2ASPA 3CIPA 4O0IA 5AQNA 3ASMA 4PQUA 3TAPA 4CF8A 3AAPA 4NB4A 1DGKN 1X9SA 3MDQA 4DS5A 2FBTA 1DEJA 4BRNA 2QWMA 3L2QA 1OH7A 1SKWA 5C15A 1U6ZA 2HNYA 3AARA 3VGKA 2RPIA 1NLVA 3O4NA 2HBJA 1JXEA 2GX9A 1QQCA 3CPWM 3SV4A 3AVBA 4JHDB 3SJHA 4B3MK 4B3RK 2QWNA 3WXMB 4EFHA 3J7ZO 1EP4A 4CF2A 1RBVA 1L3UA 4CJPA 4BRGA 2E2NA 1ASVA 2PFUA 4JK8A 1SL1A 2VWJA 4EP4A 2FSNA 2FLOA 4CHYA 2P9SB 4GV9A 1VSLA 1S1WA 1HLUA 3ATUA 3CJ1A 3THVA 3KLHA 2G8FA 3M8SA 1HYSA 4C8KA 3AA3A 3QERA 4ZTFA 1L5UA 1QSLA 3MN9A 4RCHA 1RBTA 4CZFA 3OBYA 1VQON 3UKUB 3CQ8A 5ADXH 3KJVA 1KRPA 4J2EA 3DLEA 3LWMA 4JS4A 3NDKA 2O8BA 5SZTA 1Q8IA 4DWIA 4ILGB 2E1ZA 2NRTA 2O8DB 5JVHL 3OHRA 3L2UA 2VGMA 2HHHK 3CMAN 3HPHA 3CC2N 3CQXA 1VSKA 3D2FB 4H0OA 4KTWA 3PO5A 4NLBA 3KD5E 5BPLA 2VYPA 2NLXA 1RDCA 1C1CA 4MO5A 3VQ6A 4F2RA 1EETA 3FZKA 4CJ3A 5I3UA 2FSJA 1TYQA 2D4WA 3WEEB 3K57A 3BF3A 4CK3A 4YY3K 1NK6A 3MXIA 2ZJRL 4DG1A 1DTQA 4YOWA 5AQSA 3AO4A 3LANA 3DMJA 4DFMA 5JENA 1YF5L 5GAGP 4CJRA 1KAXA 4R79A 2P1JA 4OX9K 4R5PA 3S3NA 3SQ4A 3LL3A 3HJFA 1WOQA 5EU7A 2HMIA 2HHWA 2OZSA 4CFAA 3AVFA 4H5RA 4BR7A 1JJ2M 2YHBA 1HKBA 5M1NA 3DLKA 2ZF5O 2P9KB 1RTDA 4CHQA 4DSFA 3V6DA 4V19S 2E1YA 1W9HA 2QKKA 4CGIA 4FJIA 4LF9K 4YFUA 3G71N 4OPHA 1NK4A 5AQIA 3M8PA 5AJ3K 3TABA 5AQQA 4JHDA 2BDPA 3U3YA 3FZFA 3L2VA 5M1KA 2RKIA 3F9MA 4GKJK 4DHYA 4L8RB 3C94A 1VQ7N 3HL8A 1BISA 3DAWA 4ICLA 3MWPA 1HUXA 2P9SA 1SV5A 3O8MA 3CCSN 4KREA 3OTOK 4LD0A 1LAWA 1JL1A 2WC9A 4WFNL 4YDUA 1KC8O 3UKUA 1ZBIA 5BN8A 4AHTA 3OS0A 3L4IA 1UA1A 1FKPA 1JLFA 3SK3A 1NK7A 3KK2A 3O3GA 2IOCA 3A5LC 2O8DA 3P1GA 1BCMA 1Z6RA 3AVGA 1OH6A 3DLRA 1KVAA 3VF6A 1VRTA 4WYBA 3RR8A 5MLCQ 4KRFA 4CHOA 3A5MC 3D2FA 4IJAA 3QEPA 3AGKA 1IJJA 4XEIA 3K5NA 1BIUA 4OKKA 5DM7L 2OZMA 1JL2A 3CFRA 3S5TA
chains in the Genus database with same CATH topology
3WEEA 4CZMA 4J8FA 5BREA 2OTJN 1ZXOA 4PKIA 4EAHD 1M90O 5AQRA 4JKDA 2NRVA 2ZGZA 5AQFA 3U8XA 4BR4A 1YAGA 4FPBA 3WXLA 3A5NC 1XQSC 2ASOA 1VQLN 1E4GT 3RSEA 3CCLN 1YIJN 3EE8A 4FVUA 2WUSA 4JN4A 4O5FA 3WXIA 5JLHA 3QICA 3ULEB 3QFPA 3SLCA 3RVCA 4HWIA 3O1BA 4WF9L 4PKHA 3VTHA 3ZX2A 1KQSM 2A6AA 1YVNA 3HSCA 3OBWA 1K8KB 4B1YB 1Q86O 5GAHP 3CPEA 1GLFO 3P38A 4ISFA 5BRHA 4I6MB 1QQOA 1QVGM 4M7XA 3NVKA 2P9KA 2QWQA 4JKBA 2CGKA 1NGIA 1T6CA 1GLLO 4IOXA 2PBDA 5EOYA 5EY4A 1YI2N 1BU6O 1CZAN 3LDPA 1VAZA 2A40A 3FZLA 5AQJA 5M1FA 4BRLA 1NGEA 2DPNA 3HZ6A 3CJCA 3VOVA 4CZJA 3VEVA 4QS8A 5CR4A 1XUPO 3FR0A 1HKGA 3DLLL 4YOYA 2P9NB 1YJWN 2E2QA 3A0IX 2AP1A 4IO9L 1DT9A 1GLJO 3ID6A 2YHXA 3CETA 1XC3A 4GY2B 5AFUH 3CD6N 3CERA 2P9PB 2QXLA 4B1XB 4CI6A 1GLEG 3FGUA 3ZEUA 4BG9A 1TUYA 1V4SA 1JCEA 1BA0A 2HSTA 3QBXA 4DB3A 2QWOA 3WT0A 2UYTA 2W40A 3E66A 4A57A 3T69A 2KKZA 4H5TA 3W0LA 1NGHA 2GUPA 2V51B 3G25A 3CCUN 3MN6A 3L4QA 3O9QA 1C0GA 3KZBA 4U7BA 3ENHA 4BRFA 1VQPN 5GAEP 4WFBL 5KPRA 3TSPA 4JKFA 1QQNA 3UE5A 3TSQA 2QA4N 4H5WA 1QQMA 3VGLA 1NGBA 2PAVA 3C6HA 4YOUA 4B9QA 3CQYA 3EZWA 1VQKN 3MX5A 2HF4A 3M5RA 5BN9A 5I9EB 3R8EA 1GLAG 1NGDA 1QZ6A 4XJXA 3ZX3A 1VQ9N 3SAFA 3EN9A 4FWNA 4CZEA 2FSKA 3HBTA 4O8UA 1QZ5A 2YI1A 3OA9A 4PHTX 4L3QA 3NMUA 3LDLA 3F2KA 4NLCA 3R1XA 4WQ4C 3SBTA 4Z94A 5FPDA 1KXPA 2GWJA 1OVYA 2FF3B 3LM2A 4OO1J 3O1WA 2HBMA 4FWRA 4H0PA 3JS6A 5C2DA 5BPMA 1ATNA 5AQYA 4JKEA 5EX5A 4A5BA 4CD3A 5AR0A 3G4SN 3MX2A 1M1KO 4JNEA 3EL2A 2GELA 3P4IA 3VEYA 1BOTO 2Q97A 4XH4A 4BE7B 2E2OA 2ZJPL 5AZIB 1VQ5N 1VQ6N 4YOTA 3C7NA 3F5TA 1DKGD 2J4RA 4BC5A 4BRPA 2E8AA 2ASMA 2QI2A 2GWKA 4DQ8A 3J8AA 3KWGA 2ZJQL 2A5XA 3GBTA 4IWVA 2CGLA 3D2EA 1VQ4N 3D6RA 3CXCM 4G9ZA 4JK9A 4BGBA 3VF2A 1BUPA 3DXMB 3SMPA 2OANA 3AGRA 3EE9A 2E20A 4FWLA 4FWKA 3UKRB 1HJOA 5GADP 2A42A 3VMFB 1X3NA 4BGAA 3CF5L 1SQKA 3O9UA 3M3ZA 5M1QA 4QS7A 3ULEA 5C0YA 1U2VB 3T7ZA 1J6ZA 3MN5A 2F9WA 2Q31A 3SBGA 3ZYYX 3QFUA 5M1OA 1Z05A 5F2RA 3GOIA 4A59A 3GL1A 3K9JA 3SAHA 1T3VA 2CGJA 3BEXA 4YOVA 1ILYA 4MDBA 5GIOA 2NRHA 3R6MA 3PIOL 5FPNA 3LDOA 4B1UB 1K8KA 1YITN 2Q0UA 3D7EO 4H0VB 5C10A 4I6MA 3O6WA 4JAXA 4BC2A 3CJ9A 3CJ7A 3FZMA 4JD2B 5AQXA 4C1NK 1Q7YO 1S3XA 2YX6A 1NMDA 4BRMA 3H1QA 2V7ZA 4MLEA 4F9OA 3ID8A 1NGJA 4BC3A 4LC9B 3QB0A 4H0TB 4IDHA 3HM8A 4IEIA 4U67L 1H1VA 3I33A 2P9NA 3KHYA 4IFEA 1S22A 4IJNA 1MDUB 4IZ9A 4CJ7A 5AQUA 1HPMA 3C6AA 5BPNA 2YJEA 3IDHA 4BG8A 4RTFD 2P9PA 3S41A 3KVGA 4O8KA 3GG4A 4PKGA 3CCJN 5AZJB 1LCUA 3N4PA 3FLCO 3LDNA 5GIPA 3DXKB 1JCGA 5AQOA 5AQPA 2Q36A 4EIAA 5KQDA 4CZHA 3W3DA 3I8BA 2D0OA 3U4LA 2IVPA 3E1YA 3H46O 4MLHA 3UB5A 4AM7A 3SAGA 4IEEA 1NBWA 4GV6A 2IVNA 2V52B 3IMXA 5ADXA 3WXKA 2VCPA 4FPAA 5JLFA 3HOSA 1WUAA 1Q81O 3GE1A 4JKAA 2QWRA 4ILJA 3CHWA 4A5AA 2CH5A 5TKWA 1TYQB 4XH1A 3G6EN 3O08A 2E2PA 1YXQA 4K43A 5JICA 1GLBG 5KPTA 5AQMA 1HX1A 4EHUA 1YHQN 3WXJA 3A5OC 1RGIA 1ATSA 1KAYA 1X3MA 4YDUC 5AQZA 3OW2M 3MN7A 2NRXA 3HRGA 3LDQA 3CC4N 2BTFA 3U9ZA 1D4XA 3BP8A 3TU5A 1OKJA 1KAZA 4K41A 4M7YA 3B8AX 4IO8A 1W97L 3VEOA 5AQGA 4BEBA 3VETA 3EO3A 3O9SA 4BR5A 4C1NI 2NZTA 2ASPA 5FPMA 3CIPA 3JXUA 5AQNA 2D1KA 4H0XB 3AAPA 2QWLA 5TKYA 3VF4A 4NB4A 5AZIA 4BROA 1DGKN 3BUZB 2I7PA 1Q18A 2QW9A 3MDQA 4XH5A 4BRIA 3E9OA 1DEJA 4BRNA 3E9PA 1S72N 2V7YA 1GLDG 1NM1A 2HOEA 3H6EA 3L6QA 2QWMA 5JMVA 5C15A 4BREA 2IVOA 3CCRN 1QHAA 1U6ZA 2A3ZA 1YJ9N 4CBXA 3AARA 3VGKA 4CZGA 1RDWX 3KK7A 1NLVA 3C0BA 3HI0A 3DXMA 4JKHA 3VESA 3I55N 3FFKB 2HBJA 4PL7A 2GX9A 3CPWM 5AQWA 3UKRA 4JHDB 2FF6A 1NGCA 2W41A 3SJHA 2QWPA 2P9IB 4QS9A 2QWNA 3EKUA 3WXMB 4EFHA 3J7ZO 1U2VA 3A8YA 1RFQA 2E88A 4DCHA 1NGFA 3GDQA 5LJWA 3O80A 3MMVA 4BRGA 2E2NA 5BRDA 2PFUA 1KD1O 4JK8A 3O4WA 1HKCA 2FSNA 2FLOA 1C0FA 3TTFA 2BUPA 2P9SB 2AA4A 4FWPA 3P39A 4GV9A 3PLAA 1SZ2A 3TPQA 1HLUA 3ATUA 3CJ1A 3E9LA 4CBUA 2RE2A 1QVFM 2FXUA 5B8HA 1T44A 3VENA 1EO1A 4M63C 4HTLA 4JD2A 1R59O 4BY9C 3CCEN 5CHIA 4H03B 1VQMN 2P9UB 2YHYA 3MN9A 4JEPA 4FWOA 1Q82O 4RCHA 1MWKA 4CZFA 3OBYA 3L0QA 4WQ4A 1VQON 3M6GA 4JKGB 3UKUB 3TTDA 5ADXH 4FO0A 4BRDA 4BR2A 4BECA 3IUCA 3O9TA 2NRRA 1W2BM 4MO4A 2EWSA 1ZBSA 3O9RA 2OTLN 5AQKA 4H5NA 5LJVA 4ILGB 1V4TA 1IG8A 2JWLA 2E1ZA 2NRTA 5AZJA 3R9PA 5BRFA 4GNIA 5JVHL 5E26A 3OHRA 3VERA 3DXKA 2VGMA 4H0YB 4FSVA 4FOIA 5HL7L 1YUWA 3IKMA 1NGGA 3CMAN 3QDKA 4ILHA 2HBLA 4KBOA 3CC2N 4WFAL 3CQXA 3WQUA 5JVGL 1SS6A 2IIRA 2P9LB 2F9TA 3D2FB 4H0OA 3ZETB 4A2BA 4CD1A 4NLBA 4CZIA 4GV3A 5BPLA 1GLCG 2VYPA 3I56N 2NLXA 1K9MO 1BWFO 4BVOA 2D0PA 2JWKA 4FOEA 4MO5A 4BVPA 4BR9A 3R3LA 4BRAA 3C65A 3CCVN 2VGNA 4JK7A 3FZKA 4BRCA 4E1JA 2FSJA 3O5BA 1TYQA 2D4WA 3WEEB 4B1ZA 1VQNN 3WUHA 2NRWA 3VEZA 3NVMA 5KQ8A 3BF3A 3KWIA 2ZJRL 3DJCA 3TTCA 4B1WB 4YOWA 5AQSA 3K9KA 3RSEB 4YORA 5C2FA 4RWTA 2NRZA 1YF5L 5GAGP 1KAXA 4A61A 4R79A 1LOTB 3VPZA 3BF1A 2GTDA 1YJNN 2H3GX 2ITMA 2YHWA 1KC8O 3LL3A 4AF1A 2Q2RA 1WOQA 1G99A 3CC7N 4IOAL 3H1VX 2YCHA 1TUUA 4H5RA 4BR7A 2KLAA 4EHTA 2W00A 1JJ2M 4C23A 1HKBA 5H1SQ 5M1NA 3WQTA 2A41A 2P9KB 2ZF5O 3CJBA 4Y0WA 3P31A 4A2AA 2E1YA 1T6DA 1MWMA 2QTDA 2Q1NA 2HBKA 1P90A 3G71N 4WQ5C 3H3OB 1MA9B 4OPHA 1ESVA 3H3NO 4MDAA 4FWSA 5AQIA 3H45C 2WFBA 5AQQA 4JHDA 1E4FT 3PIPL 1O13A 2GEMA 3CCQN 2P9IA 3FZFA 4FL9A 1ZC6A 4H5VA 5M1KA 1RDUA 3IFRA 4BRQA 2ZGYA 3F9MA 4A62A 4B1VA 2ZWHA 5E84A 1K8AO 3VTIA 3ZEUB 4DHYA 1BO5O 5FPEA 2QM1A 1VQ7N 4IXCA 3ENOA 3VEXA 4GVEA 1Y64A 1NGAA 4UY8O 3DAWA 5DM6L 3VGMA 5F0XA 3Q7BA 3MCPA 3MWPA 1HUXA 2Q0RA 2P9SA 4OPAA 3LM9A 2YJFA 5ELZA 5KPZA 4BR0A 4K25A 4BC4A 3O8MA 4FWMA 4WCEL 3CCSN 3U9DA 5AQVA 1VQ8N 2RHKA 2P9UA 2WC9A 4WFNL 4CZKA 4YDUA 4KH6A 5EVZA 3Q7CA 5M1PA 3ZX0A 4BRHA 1BDGA 4CZLA 1N8RO 3CCMN 4IOCL 3QBWA 4JKGA 5AFUA 3MWTA 3UKUA 3M1FA 3AY9A 5BR9A 3CMEN 2HMPA 5BN8A 4KH5A 3CI5A 5AQTA 3HOTA 2CH6A 5HOOA 3ENBA 5C12A 4FWQA 1JCFA 1BA1A 4PL8A 3L4IA 5AQHA 3SK3A 4WQ5A 2BH1A 5GINA 3MCAB 3A5LC 3N4QA 2QEXN 2C1IA 4CBWA 2HF3A 4BQLA 3DWLA 4AM6A 4ISEA 1BG3A 1Z6RA 2VWBA 1K73O 3HTVA 3VEWA 3EKSA 2KHOA 3VF6A 2F7TA 4WYBA 5CE3A 5MLCQ 1X9JA 3ZETA 3AAQA 2P9LA 3A5MC 3D2FA 1P8ZA 4IJAA 4JKCA 4DKWA 3AGKA 1IJJA 3QMLA 3C7NB 3CJAA 3FE1A 4XEIA 4YOXA 3TSUA 3MK6A 5EXWA 5F1XA 5LY3A 4BRKA 5DM7L 1NJIO 4NO7A 1EQYA 1ATRA 2C1GA 3D2EB 3FZHA 4ISGA 1SAZA 2NNWA 3SMSA 2WBNA 4K42A 5AQLA 4KH4A 1NWKA 3ATVA 2I7NA 4BQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WEE A;  4CZM A;  4J8F A;  5BRE A;  1ZXO A;  4PKI A;  4EAH D;  5AQR A;  5AQF A;  4BR4 A;  2ZGZ A;  3U8X A;  1YAG A;  4FPB A;  3WXL A;  3A5N C;  1XQS C;  2ASO A;  1E4G T;  3RSE A;  2WUS A;  4JN4 A;  4O5F A;  3WXI A;  5JLH A;  3QIC A;  3ULE B;  3QFP A;  3SLC A;  4HWI A;  3O1B A;  4PKH A;  3ZX2 A;  2A6A A;  1YVN A;  3HSC A;  1K8K B;  4B1Y B;  1GLF O;  4ISF A;  5BRH A;  4I6M B;  1QQO A;  4M7X A;  2P9K A;  2QWQ A;  2CGK A;  1NGI A;  1T6C A;  1GLL O;  2PBD A;  5EOY A;  5EY4 A;  1BU6 O;  1CZA N;  3LDP A;  2A40 A;  3FZL A;  5AQJ A;  4BRL A;  1NGE A;  2DPN A;  3HZ6 A;  3CJC A;  3VOV A;  4CZJ A;  3VEV A;  4QS8 A;  1XUP O;  3FR0 A;  1HKG A;  2P9N B;  2E2Q A;  3A0I X;  2AP1 A;  1GLJ O;  2YHX A;  3CET A;  1XC3 A;  4GY2 B;  5AFU H;  3CER A;  2P9P B;  2QXL A;  4B1X B;  4CI6 A;  1GLE G;  3FGU A;  3ZEU A;  4BG9 A;  1TUY A;  1V4S A;  1JCE A;  1BA0 A;  3QBX A;  4DB3 A;  2QWO A;  3WT0 A;  2UYT A;  2W40 A;  4H5T A;  3W0L A;  1NGH A;  2GUP A;  2V51 B;  3G25 A;  3MN6 A;  1C0G A;  3KZB A;  3ENH A;  4BRF A;  5KPR A;  1QQN A;  3UE5 A;  4H5W A;  1QQM A;  3VGL A;  1NGB A;  2PAV A;  4B9Q A;  3CQY A;  3EZW A;  2HF4 A;  5BN9 A;  5I9E B;  3R8E A;  1GLA G;  1NGD A;  1QZ6 A;  3ZX3 A;  3EN9 A;  4FWN A;  4CZE A;  2FSK A;  3HBT A;  1QZ5 A;  2YI1 A;  4L3Q A;  3LDL A;  4WQ4 C;  4Z94 A;  5FPD A;  1KXP A;  2GWJ A;  2FF3 B;  3LM2 A;  3O1W A;  4FWR A;  4H0P A;  3JS6 A;  5BPM A;  1ATN A;  5AQY A;  5EX5 A;  4CD3 A;  5AR0 A;  4JNE A;  3EL2 A;  2GEL A;  3P4I A;  3VEY A;  1BOT O;  2Q97 A;  4XH4 A;  2E2O A;  5AZI B;  3C7N A;  1DKG D;  2J4R A;  4BC5 A;  4BRP A;  2E8A A;  2ASM A;  2GWK A;  4DQ8 A;  3J8A A;  2A5X A;  3GBT A;  4IWV A;  2CGL A;  3D2E A;  4BGB A;  3VF2 A;  1BUP A;  3DXM B;  3SMP A;  2OAN A;  2E20 A;  4FWL A;  4FWK A;  3UKR B;  1HJO A;  2A42 A;  1X3N A;  4BGA A;  1SQK A;  3M3Z A;  4QS7 A;  3ULE A;  1U2V B;  1J6Z A;  3MN5 A;  2F9W A;  2Q31 A;  3QFU A;  1Z05 A;  5F2R A;  3GOI A;  3GL1 A;  2CGJ A;  3BEX A;  2NRH A;  3R6M A;  5FPN A;  3LDO A;  4B1U B;  1K8K A;  2Q0U A;  3D7E O;  4H0V B;  4I6M A;  3O6W A;  4JAX A;  4BC2 A;  3CJ9 A;  3CJ7 A;  3FZM A;  4JD2 B;  5AQX A;  1S3X A;  1NMD A;  4BRM A;  3H1Q A;  2V7Z A;  4MLE A;  4F9O A;  3ID8 A;  1NGJ A;  4BC3 A;  4LC9 B;  3QB0 A;  4H0T B;  3HM8 A;  1H1V A;  3I33 A;  2P9N A;  3KHY A;  1S22 A;  4IJN A;  1MDU B;  4IZ9 A;  4CJ7 A;  5AQU A;  1HPM A;  5BPN A;  2YJE A;  3IDH A;  4BG8 A;  4RTF D;  2P9P A;  3S41 A;  3KVG A;  4O8K A;  3GG4 A;  4PKG A;  5AZJ B;  1LCU A;  3FLC O;  3LDN A;  3DXK B;  1JCG A;  5AQO A;  5AQP A;  2Q36 A;  4EIA A;  5KQD A;  4CZH A;  3W3D A;  3I8B A;  2D0O A;  3U4L A;  2IVP A;  3H46 O;  4MLH A;  3UB5 A;  4AM7 A;  1NBW A;  2IVN A;  2V52 B;  3IMX A;  5ADX A;  3WXK A;  2VCP A;  4FPA A;  5JLF A;  1WUA A;  3GE1 A;  2QWR A;  3CHW A;  2CH5 A;  1TYQ B;  4XH1 A;  3O08 A;  2E2P A;  1YXQ A;  4K43 A;  5JIC A;  1GLB G;  5KPT A;  5AQM A;  1HX1 A;  4EHU A;  3WXJ A;  3A5O C;  1RGI A;  1ATS A;  1KAY A;  1X3M A;  4YDU C;  5AQZ A;  3MN7 A;  3LDQ A;  2BTF A;  3U9Z A;  1D4X A;  3BP8 A;  3TU5 A;  1OKJ A;  1KAZ A;  4K41 A;  4M7Y A;  3B8A X;  4IO8 A;  3VEO A;  5AQG A;  3VET A;  3EO3 A;  4BR5 A;  2NZT A;  2ASP A;  5FPM A;  3CIP A;  3JXU A;  5AQN A;  2D1K A;  4H0X B;  3AAP A;  2QWL A;  5TKY A;  3VF4 A;  4NB4 A;  5AZI A;  4BRO A;  1DGK N;  3BUZ B;  2I7P A;  1Q18 A;  2QW9 A;  3MDQ A;  4XH5 A;  4BRI A;  1DEJ A;  4BRN A;  2V7Y A;  1GLD G;  1NM1 A;  2HOE A;  3H6E A;  3L6Q A;  2QWM A;  5JMV A;  4BRE A;  2IVO A;  1QHA A;  1U6Z A;  2A3Z A;  4CBX A;  3AAR A;  3VGK A;  4CZG A;  1RDW X;  1NLV A;  3C0B A;  3HI0 A;  3DXM A;  3VES A;  3FFK B;  4PL7 A;  5AQW A;  3UKR A;  4JHD B;  2FF6 A;  1NGC A;  2W41 A;  3SJH A;  2QWP A;  2P9I B;  4QS9 A;  2QWN A;  3EKU A;  4EFH A;  1U2V A;  3A8Y A;  1RFQ A;  2E88 A;  4DCH A;  1NGF A;  3GDQ A;  5LJW A;  3O80 A;  3MMV A;  4BRG A;  2E2N A;  5BRD A;  3O4W A;  1HKC A;  2FSN A;  2FLO A;  1C0F A;  2BUP A;  2P9S B;  2AA4 A;  4FWP A;  1SZ2 A;  3TPQ A;  1HLU A;  3ATU A;  3CJ1 A;  4CBU A;  2FXU A;  5B8H A;  1T44 A;  3VEN A;  4M63 C;  4HTL A;  4JD2 A;  1R59 O;  4H03 B;  2P9U B;  2YHY A;  3MN9 A;  4FWO A;  4RCH A;  1MWK A;  4CZF A;  3L0Q A;  4WQ4 A;  3M6G A;  3UKU B;  5ADX H;  4FO0 A;  4BRD A;  4BR2 A;  3IUC A;  4MO4 A;  2EWS A;  1ZBS A;  5AQK A;  4H5N A;  5LJV A;  1V4T A;  1IG8 A;  2E1Z A;  5AZJ A;  3R9P A;  5BRF A;  4GNI A;  5E26 A;  3OHR A;  3VER A;  3DXK A;  4H0Y B;  4FSV A;  4FOI A;  1YUW A;  1NGG A;  3QDK A;  4KBO A;  3CQX A;  3WQU A;  2IIR A;  3ZET B;  2P9L B;  2F9T A;  3D2F B;  4H0O A;  4A2B A;  4CD1 A;  4CZI A;  5BPL A;  1GLC G;  2VYP A;  2NLX A;  1BWF O;  4BVO A;  2D0P A;  4FOE A;  4MO5 A;  4BVP A;  4BR9 A;  4BRA A;  3FZK A;  4BRC A;  4E1J A;  2FSJ A;  3O5B A;  1TYQ A;  2D4W A;  3WEE B;  4B1Z A;  3WUH A;  3VEZ A;  5KQ8 A;  3BF3 A;  3DJC A;  4B1W B;  5AQS A;  3RSE B;  4RWT A;  1KAX A;  4A61 A;  1LOT B;  3VPZ A;  3BF1 A;  2GTD A;  2H3G X;  2ITM A;  2YHW A;  3LL3 A;  2Q2R A;  1WOQ A;  1G99 A;  3H1V X;  2YCH A;  1TUU A;  4H5R A;  4BR7 A;  4EHT A;  4C23 A;  1HKB A;  3WQT A;  2A41 A;  2P9K B;  2ZF5 O;  3CJB A;  4Y0W A;  4A2A A;  2E1Y A;  1T6D A;  1MWM A;  2Q1N A;  4WQ5 C;  3H3O B;  1MA9 B;  1ESV A;  3H3N O;  4FWS A;  5AQI A;  3H45 C;  5AQQ A;  4JHD A;  1E4F T;  2GEM A;  2P9I A;  3FZF A;  4FL9 A;  1ZC6 A;  4H5V A;  3IFR A;  4BRQ A;  2ZGY A;  3F9M A;  4A62 A;  4B1V A;  2ZWH A;  5E84 A;  3ZEU B;  4DHY A;  1BO5 O;  5FPE A;  2QM1 A;  4IXC A;  3ENO A;  3VEX A;  1Y64 A;  1NGA A;  3DAW A;  3VGM A;  5F0X A;  3MCP A;  1HUX A;  2Q0R A;  2P9S A;  3LM9 A;  2YJF A;  5ELZ A;  5KPZ A;  4BR0 A;  4K25 A;  4BC4 A;  3O8M A;  4FWM A;  3U9D A;  5AQV A;  2P9U A;  4CZK A;  4YDU A;  5EVZ A;  3ZX0 A;  4BRH A;  4CZL A;  1BDG A;  3QBW A;  5AFU A;  3UKU A;  3M1F A;  3AY9 A;  5BR9 A;  2HMP A;  5BN8 A;  3CI5 A;  5AQT A;  2CH6 A;  4FWQ A;  1JCF A;  1BA1 A;  4PL8 A;  3L4I A;  5AQH A;  3SK3 A;  4WQ5 A;  3A5L C;  4CBW A;  2HF3 A;  4BQL A;  3DWL A;  4AM6 A;  4ISE A;  1BG3 A;  1Z6R A;  2VWB A;  3HTV A;  3VEW A;  3EKS A;  2KHO A;  3VF6 A;  4WYB A;  5CE3 A;  1X9J A;  3ZET A;  2P9L A;  3A5M C;  3AAQ A;  3D2F A;  1P8Z A;  4IJA A;  1IJJ A;  3QML A;  3C7N B;  3CJA A;  3FE1 A;  4XEI A;  3MK6 A;  5EXW A;  5F1X A;  5LY3 A;  4BRK A;  4NO7 A;  1EQY A;  1ATR A;  3D2E B;  3FZH A;  4ISG A;  1SAZ A;  3SMS A;  5AQL A;  4K42 A;  1NWK A;  3ATV A;  2I7N A;  4BQZ A; 
#chains in the Genus database with same CATH topology
 3WEE A;  4BDY A;  2OTJ N;  4PKI A;  4JKD A;  2NRV A;  3U8X A;  2W6L A;  2BE2 A;  4AHU A;  2ASO A;  1VQL N;  1HNX K;  4DSK A;  4FVU A;  2WUS A;  4O5F A;  3WXI A;  1S6Q A;  3G10 A;  3ULE B;  4ELT A;  3O1B A;  2UUC K;  4NYN A;  3WNF A;  4CEE A;  4Z4I A;  2A6A A;  4C8L A;  1KFD A;  5K14 A;  3I0S A;  1HMV A;  4PWD A;  1Q86 O;  4CHP A;  1GLF O;  3QEW A;  1TK5 A;  5BRH A;  4I6M B;  2P9K A;  4MFB A;  1NK0 A;  2QWQ A;  3NBP A;  1T6C A;  4IOX A;  3VQ8 A;  3LDP A;  2A40 A;  5AQJ A;  2HHS A;  3AA4 A;  4BRL A;  1NGE A;  3VEV A;  4JS5 A;  4QS8 A;  5CR4 A;  2G8H A;  1NKE A;  1LWC A;  4YOY A;  5FRO A;  3ZT1 A;  1YJW N;  4IG3 A;  1RDA A;  3CET A;  1XC3 A;  4GY2 B;  5AFU H;  3KLE A;  4CI6 A;  1XWL A;  1OVQ A;  4BG9 A;  3F9K A;  1TUY A;  4DV1 K;  3ULD A;  4DB3 A;  1RBS A;  4IG0 A;  1JLC A;  2QWO A;  3WT0 A;  4B8A B;  3T69 A;  2XO7 A;  4H5T A;  3CCU N;  3G25 A;  4B3S K;  3LDS A;  3O9Q A;  3ZLJ A;  3ENH A;  1VHX A;  4E7J A;  4WFB L;  5HRO A;  3TSP A;  4W5T A;  1QQN A;  4FZY A;  1J9A A;  3UE5 A;  4H5W A;  1NGB A;  4YOU A;  4H4O A;  4B9Q A;  3QES A;  3MX5 A;  5BN9 A;  1WB9 A;  3R8E A;  1X9M A;  4XJX A;  1VQ9 N;  2IS3 A;  3MEE A;  4CZE A;  3PO4 A;  3HBT A;  1LW0 A;  4DTN A;  3LDL A;  4AIL C;  2UXB K;  4NLC A;  4WQ4 C;  3SBT A;  3LM2 A;  4RW9 A;  2XRI A;  5C2D A;  2HBM A;  4H0P A;  5AQY A;  4A5B A;  3G4S N;  3MX2 A;  1Y97 A;  3JSM A;  3VEY A;  4BE7 B;  2F4V K;  4BDP A;  2ZJP L;  1VQ6 N;  1GOA A;  4ZTJ A;  3LPU A;  3RMD A;  3GBT A;  4B9V A;  4JK9 A;  4BGB A;  1FXX A;  5J2N A;  3AGR A;  4FWK A;  3NF9 A;  4LH4 A;  3UKR B;  4DR1 K;  3OYN A;  3VMF B;  1ASW A;  4BGA A;  3O9U A;  4QS7 A;  5C42 A;  3ULE A;  5C0Y A;  1U2V B;  1JKH A;  3T7Z A;  5F2R A;  3ALY A;  2CGJ A;  1F21 A;  1KFS A;  2NRH A;  3R6M A;  1SKS A;  2F96 A;  3LDO A;  3QNN A;  1NNE A;  1WBB A;  4I6M A;  4CEC A;  3DLB A;  1WBD A;  2ZQB A;  4JD2 B;  4HCB A;  3SCX A;  4F9O A;  3ID8 A;  2HHU A;  3QEI A;  1S1X A;  1RBU A;  4IEI A;  1H1V A;  3DRP A;  4IFE A;  2OPS A;  4CJ7 A;  1D8Y A;  1HPM A;  4KHS A;  4JI2 K;  4NXM K;  3RMB A;  5C24 A;  4BG8 A;  3S41 A;  3OYK A;  3JYT A;  3QO9 A;  5AZJ B;  2YKM A;  4E3S A;  2D0A A;  4JI0 K;  1JCG A;  4EIA A;  4CZH A;  4NCB A;  3W3D A;  4C8N A;  2FBV A;  4LF4 K;  3LWL A;  3H46 O;  4FZZ A;  4IEE A;  1VSE A;  4GV6 A;  1VRU A;  2DFF A;  4FPA A;  3HOS A;  5JLF A;  5HLF A;  2ITG A;  4KHN A;  4LSN A;  4BAC A;  3GE1 A;  4ILJ A;  2E6M A;  3CHW A;  4A5A A;  5TKW A;  3G6E N;  4W5O A;  2E2P A;  2Q3S A;  1GLB G;  1HX1 A;  4EHU A;  1QHT A;  3QEV A;  1ATS A;  3HPO A;  1X3M A;  4CEB A;  1VSD A;  3LDQ A;  5HRN A;  3I0R A;  3BP8 A;  1OKJ A;  1KAZ A;  3SQ2 A;  1TK0 A;  4M3Y A;  3S3O A;  4DUY K;  4NCA A;  3IAY A;  4FM1 A;  2QWL A;  1EX4 A;  2I7P A;  1Q18 A;  2QW9 A;  5CYQ A;  3AO5 A;  4K8Z A;  3E9P A;  1RTH A;  1S5J A;  2IVO A;  3CYG A;  1LAV A;  4CBX A;  2D5R A;  5CY4 A;  4CZG A;  1RDW X;  3HI0 A;  3C0B A;  3VES A;  4FK4 A;  3CG7 A;  3SUP A;  4CIG A;  3UKR A;  3K58 A;  2FF6 A;  1UWB A;  2QWP A;  4QS9 A;  2QK9 A;  1JLQ A;  1WN7 A;  1U2V A;  3A8Y A;  2E88 A;  4DCH A;  1SL2 A;  4CJW A;  3GDQ A;  5LJW A;  5BRD A;  4WE1 A;  3VQP A;  4CCH A;  1IG9 A;  3V81 A;  3O4W A;  1NJX A;  2BUP A;  4X66 K;  2AA4 A;  3PLA A;  3SPZ A;  3TPQ A;  4LFC K;  3MEC A;  1T44 A;  3VEN A;  4AHR A;  4JD2 A;  4RW4 A;  3SI6 A;  3CCE N;  3MXM A;  2IDO A;  4H03 B;  2P9U B;  2YHY A;  1NJZ A;  4JEP A;  4FWO A;  1Q82 O;  1MWK A;  1SKR A;  3M6G A;  2W42 A;  3TTD A;  3VQD A;  3OY9 A;  4BRD A;  3IUC A;  3O9T A;  3RR7 A;  2NRR A;  2OPP A;  4MO4 A;  3O9R A;  3TAF A;  2OTL N;  4H5N A;  1EWR A;  5LJV A;  1RBR A;  4CEA A;  1IKX A;  5AZJ A;  4W5N A;  4FSV A;  3AVM A;  4FJ9 A;  3QDK A;  5DK5 A;  4BDZ A;  2G8I A;  1TL1 A;  1SS6 A;  2P9L B;  4A2B A;  2PYJ A;  3NF8 A;  3K5M A;  4FCY A;  4JI8 K;  3T1A A;  2JWK A;  2O4G A;  2Z1H A;  2UUA K;  3VA0 A;  4JK7 A;  4E1J A;  5J1E A;  2NRW A;  5KQ8 A;  1YTU A;  1QTM A;  1JXB A;  3KWI A;  4OJR A;  4B1W B;  3ISN C;  3J81 O;  4RWT A;  4FZX C;  3SQ0 A;  4CJ4 A;  2GTD A;  4E1M A;  1JLB A;  4GVM A;  3ZSW A;  2YHW A;  1W0H A;  1FW6 A;  2Q2R A;  1IKW A;  1KVC A;  3H1V X;  3KLG A;  1XNQ K;  3EY1 A;  1DLO A;  1TUU A;  4LH5 A;  4G1Q A;  4EHT A;  1NKC A;  4C23 A;  2EHG A;  5KRT A;  4DLE A;  3LAM A;  1QSY A;  4KTQ A;  3WQT A;  3CJB A;  1D9D A;  1UA0 A;  3PY8 A;  3U6F A;  3ZSZ A;  1VSM A;  4KI6 A;  1T6D A;  4KFB A;  3LP1 A;  2HBK A;  3KTQ A;  3T19 A;  1ESV A;  3H3N O;  4MDA A;  4FWS A;  2P5G A;  3OS2 A;  3PIP L;  3DRR A;  4YHH K;  3CCQ N;  1ZC6 A;  1T7P A;  3IFR A;  4HUE A;  5E84 A;  3ZEU B;  2WON A;  3CFP A;  3ENO A;  3VEX A;  4CEO A;  1Y64 A;  1S9E A;  2Q0R A;  2O8F B;  2YJF A;  5CZ2 A;  4K25 A;  2BAN A;  4DMN A;  2Z1G A;  4FWM A;  4WCE L;  3U9D A;  1VQ8 N;  2RHK A;  2P9U A;  4DU3 A;  1X9W A;  5EVZ A;  2OPR A;  4BRH A;  3CCM N;  3M1F A;  3CME N;  3CI5 A;  5AQT A;  3S9H A;  4DSL A;  5IT9 O;  2YKN A;  4Q5V A;  3ENB A;  5J2P A;  5T7B A;  2G8U A;  1JCF A;  1RTI A;  5C25 A;  5AQH A;  5GIN A;  3MCA B;  2C1I A;  3N4Q A;  2QEX N;  2HHV A;  2HHI A;  4FM0 A;  1K73 O;  3KKS A;  4Y1D A;  5CE3 A;  3V1Q A;  2P9L A;  3QML A;  2E5L K;  3SJJ A;  5EXW A;  4IFY A;  4CJV A;  5F1X A;  3QNO A;  5LY3 A;  4BRK A;  1NJI O;  3D2E B;  1WSE A;  3FZH A;  1SAZ A;  3VQQ A;  4K42 A;  4BQZ A;  3M8Q A;  1L3T A;  1ZXO A;  4E1N A;  3MEG A;  1REV A;  2XY5 A;  3ZCM A;  1XQS C;  3DYA A;  4DV0 K;  1YIJ N;  3EE8 A;  2RF2 A;  4JN4 A;  1TKD A;  3OYA A;  3QIC A;  4H4M A;  3SLC A;  4DFK A;  3RVC A;  4HWI A;  4LF6 K;  1CXU A;  4E7L A;  3MED A;  4CFD A;  1KQS M;  3ZSV A;  1YVN A;  3OBW A;  1KVB A;  1IH7 A;  2B4J A;  4ID1 A;  1KCF A;  4ISF A;  3P38 A;  4FJ7 A;  3PV8 A;  3LAK A;  1J54 A;  3AO2 A;  4JKB A;  3OJS A;  4FYD A;  4JLH A;  3TAE A;  1YI2 N;  1VAZ A;  3PX0 A;  3HZ6 A;  3ZT4 A;  4CZJ A;  4B9M A;  1RT3 A;  3DLL L;  4AH9 A;  2F8T A;  2E2Q A;  3A0I X;  4E7H A;  3ID6 A;  2P9P B;  2QXL A;  4B1X B;  1K6Y A;  3ZEU A;  2HST A;  3E66 A;  3TR8 A;  2V51 B;  5BR8 K;  2KZM A;  2QKB A;  3QIN A;  2O8F A;  1C0G A;  1LWE A;  4U7B A;  4LFA K;  4BRF A;  3C95 A;  1VQP N;  5KPR A;  3NH2 A;  4Y1C A;  4OKE A;  3TSQ A;  2QA4 N;  3PX6 A;  4E72 A;  3AVH A;  3C6H A;  3CQY A;  1VQK N;  1QE1 A;  5I9E B;  3OYM A;  1QZ6 A;  1VK0 A;  2FSK A;  4I7F A;  4O8U A;  1QZ5 A;  2YI1 A;  4PHT X;  3R1X A;  4KB1 A;  2GWJ A;  4IBN A;  3AVK A;  4OO1 J;  5A2Q O;  4DFJ A;  3DI6 A;  3JS6 A;  4JKE A;  4CEF A;  5AR0 A;  5LMU K;  1M1K O;  4JNE A;  4O0J A;  1BOT O;  2Q97 A;  1JLE A;  3VQ9 A;  3NCI A;  4M3R A;  4DQQ A;  4YOT A;  5KGW A;  1DKG D;  3HST B;  2E8A A;  5KRS A;  4FJG A;  1ZBF A;  1TAU A;  2A5X A;  2CGL A;  3D2E A;  4E0D A;  3CXC M;  4KPY A;  4KHW A;  3VF2 A;  1J5E K;  4CJT A;  2OAN A;  4FJX A;  2E20 A;  4ZHR A;  4DS4 A;  3HYF A;  1HJO A;  5GAD P;  1X3N A;  3KLI A;  2KTQ A;  3V9U A;  4DR4 K;  1J6Z A;  2Q31 A;  4B3O A;  3QFU A;  1Z05 A;  4DTU A;  2UU9 K;  3SAH A;  4YOV A;  1HNV A;  2VQF K;  4FW1 A;  4DQP A;  2Q0U A;  1LWF A;  4ELV A;  4IDK A;  3EYZ A;  4FJK A;  4JAX A;  3F73 A;  4BC2 A;  1TAQ A;  3CJ9 A;  5AQX A;  1RT7 A;  4LF5 K;  1S3X A;  4OKJ A;  4MLE A;  1S1V A;  5D3G A;  2Y1J A;  4BC3 A;  4LC9 B;  4BE2 A;  4IDH A;  4DFP A;  4U67 L;  3VN5 A;  3IDH A;  1Q9X A;  4RTF D;  3DLH A;  2P9P A;  3KVG A;  4O8K A;  4CFB A;  2ZM6 K;  4FJH A;  2AJQ A;  1DTT A;  3LDN A;  4KAZ A;  3DXK B;  5AQO A;  4Z0U A;  4BWJ A;  4RG8 A;  2D0O A;  3T1H K;  4CGH A;  2IVP A;  4DV4 K;  3K5O A;  4MLH A;  1IO2 A;  2IVN A;  2V52 B;  3IMX A;  5ADX A;  2YNH A;  1NOZ A;  5FRN A;  4CIE A;  2VCP A;  4DU4 A;  2ATQ A;  3ZT3 A;  4JKA A;  4M42 A;  1BL3 A;  4XH1 A;  3O08 A;  4K43 A;  5JIC A;  5AQM A;  1XHZ A;  3O4Q A;  3KLF A;  4YDU C;  5AQZ A;  3AVI A;  3HRG A;  2ZE2 A;  4FXD A;  4F8R A;  1D9F A;  2A1S A;  5AQG A;  3EO3 A;  1TKZ A;  2NZT A;  4CK1 A;  2B5J A;  3JXU A;  4H0X B;  5HRP A;  5TKY A;  3ZSR A;  3VF4 A;  3BUZ B;  4JI3 K;  1XNR K;  4BRI A;  3E9O A;  4M41 A;  1S72 N;  1GLD G;  3VQC A;  2GBZ A;  5JMV A;  2A1R A;  3SNN A;  4BRE A;  1N32 K;  3CCR N;  2A3Z A;  1YJ9 N;  3AVA A;  3KK7 A;  4JKH A;  3NAE A;  3FFK B;  4PL7 A;  1Q9Y A;  1NGC A;  1TGO A;  2P9I B;  2RN2 A;  3EKU A;  4KHU A;  1WSH A;  4RW8 A;  1NK9 A;  4JI7 K;  1RFQ A;  1NGF A;  2E6L A;  4E7K A;  4DQR A;  2PY5 A;  3O80 A;  3MMV A;  4Z4C A;  1KD1 O;  2FBX A;  3V9Z A;  4E89 A;  3TTF A;  1C0F A;  4FWP A;  3P39 A;  1SZ2 A;  1VSF A;  4KO0 A;  4CBU A;  2RE2 A;  4M3X A;  2HW3 A;  2FXU A;  5B8H A;  1EO1 A;  4M63 C;  4HTL A;  5CHI A;  4UQG A;  1VQM N;  4J2D A;  2I5J A;  3QLH A;  3L0Q A;  4JKG B;  4CEZ A;  3HT3 A;  4FO0 A;  4BR2 A;  4BEC A;  4CGD A;  4X65 K;  3OS1 A;  4J2A A;  4DV3 K;  2EWS A;  1KSP A;  1ZBS A;  1I94 K;  3C6U A;  1T05 A;  4M45 A;  2JWL A;  1NMN A;  3ZSQ A;  2G8K A;  3VER A;  1HNW K;  3DXK A;  4H0Y B;  4FOI A;  3VQB A;  3I8D A;  4O4G A;  4B3T K;  4B9S A;  4ILH A;  4KBO A;  3RWU A;  3AVN A;  3ITH A;  3WQU A;  5JVG L;  3OYF A;  4GV3 A;  4CZI A;  2HNZ A;  1GLC G;  3I56 N;  5HRS A;  1BWF O;  4BVP A;  4BR9 A;  4BRA A;  4NYF A;  2VGN A;  4BRC A;  3O5B A;  2IC3 A;  1VQN N;  4B1Z A;  3VEZ A;  3EZ5 A;  4Q0B A;  4B9T A;  4LY7 A;  3TTC A;  2PYL A;  3UIQ A;  3RSE B;  5C2F A;  4YOR A;  1BCO A;  3D45 A;  3V9S A;  4A61 A;  3NGY A;  2VG7 A;  4AHS A;  1LOT B;  4DV5 K;  3VPZ A;  4KB0 A;  4O5B A;  4JV5 K;  3DOK A;  2H3G X;  4DR3 K;  2ITM A;  1WNS A;  3BY5 A;  4AF1 A;  4CGG A;  1G99 A;  3CFO A;  4CJ5 A;  1UOC A;  4HTU A;  3AA5 X;  3V4I A;  1CZ9 A;  2A41 A;  4HVJ A;  1NU0 A;  4N56 A;  2WOM A;  4BWM A;  3OYB A;  3L3V A;  3V1R A;  1MWM A;  1HYV A;  1L3S A;  3V9X A;  3NHG A;  4WQ5 C;  1MA9 B;  1SL0 A;  1ASU A;  2W6K A;  3H45 C;  1B9D A;  4N5S A;  1E4F T;  1O13 A;  2GEM A;  1N33 K;  2P9I A;  4FL9 A;  2XY7 A;  1RDU A;  4F4K A;  2ZWH A;  2KFZ A;  1BO5 O;  1QS4 A;  4GVE A;  4FLV A;  1J5O A;  4DUZ K;  5DM6 L;  3VGM A;  4CJE A;  5F0X A;  2HHT A;  1HNI A;  3KKR A;  4OPA A;  1XMQ K;  1ITG A;  4FLX A;  5AQV A;  3TAM A;  2HHQ A;  4CZK A;  4KH6 A;  1N8R O;  1NG9 A;  1BDG A;  4IOC L;  3QBW A;  4JKG A;  5AFU A;  1RIL A;  3AY9 A;  1G15 A;  2HMP A;  3CM5 A;  4KH5 A;  2FC0 A;  5CZ1 A;  4FM2 A;  3HOT A;  2DTU A;  1ZBL A;  3OVN A;  4FWQ A;  2O8C B;  1BA1 A;  4PL8 A;  1X1P A;  2BH1 A;  1XHX A;  2HF3 A;  4BQL A;  3PX4 A;  1RTJ A;  3DWL A;  4OGE A;  3CYM A;  3QET A;  1BIZ A;  3VEW A;  1RT2 A;  5KTQ A;  4DR6 K;  1QSS A;  1X9J A;  4TSX A;  3AAQ A;  1P8Z A;  4KHP K;  3O3F A;  3CJA A;  3FE1 A;  4KI4 A;  3RMC A;  3TSU A;  1EQY A;  1ATR A;  4CJS A;  4ISG A;  3SMS A;  5AQL A;  3E01 A;  1NWK A;  1EXQ A;  3ATV A;  4CZM A;  3J7Y P;  4JI5 K;  4J8F A;  5BRE A;  1N6Q A;  3NGI A;  1N5Y A;  1M90 O;  1CXQ A;  5AQF A;  4LSL A;  4F3O A;  1YAG A;  3WXL A;  3A5N C;  3RSE A;  3CCL N;  3LZI A;  3NF7 A;  4DF8 A;  5JLH A;  1Z25 A;  4I2Q A;  1NKB A;  3VTH A;  3ZX2 A;  1HPZ A;  3HSC A;  3P83 D;  4B1Y B;  3BDP A;  3SUO A;  3J80 O;  3AV9 A;  1I39 A;  3NVK A;  4OLA A;  2F8S A;  1ZYQ A;  1GOB A;  1GOC A;  1BU6 O;  1CZA N;  3WNG A;  4CF9 A;  2XY6 A;  3VOV A;  1ZBH A;  1XUP O;  1HKG A;  4EZ9 A;  3SZ2 A;  4JI1 K;  2P9N B;  4CES A;  4KKO A;  1NK8 A;  2AP1 A;  4IO9 L;  1DT9 A;  1GLJ O;  4Z4E A;  3L8B A;  3KD1 E;  5HRR A;  3FGU A;  1EKE A;  1JCE A;  2G8V A;  2UYT A;  2KKZ A;  3W0L A;  5FRM A;  2HVI A;  3L4Q A;  1FK9 A;  3V9W A;  3K0S A;  1TK8 A;  1BHL A;  4B9N A;  1T8E A;  4JKF A;  2ETJ A;  1QQM A;  3VGL A;  4K8X A;  2YV0 X;  4N76 A;  3DOL A;  1FKO A;  2HVH A;  1HNZ K;  1RDD A;  5SWM A;  1NGD A;  4FJ8 A;  1XMO K;  1NOY A;  3ZX3 A;  2JGU A;  3SAF A;  4FWN A;  3OYD A;  3KIO A;  3BZC A;  3TAG A;  4L3Q A;  3NMU A;  1NJY A;  4ID5 A;  4AHV A;  3F2K A;  2OPQ A;  2O8C A;  3AO1 A;  4DV2 K;  3KK1 A;  5FPD A;  3SQ1 A;  1KXP A;  1OVY A;  2FF3 B;  1N34 K;  3O1W A;  4DLG A;  4C8M A;  5EX5 A;  4PY5 A;  1SUQ A;  3EL2 A;  1IKY A;  4DTS A;  4XH4 A;  1A5X A;  5AZI B;  2LSN A;  4CJL A;  3F5T A;  3SUQ A;  2J4R A;  1CZB A;  4KV8 A;  4BC5 A;  2QI2 A;  4FVM A;  4DQ8 A;  3J8A A;  2ZJQ L;  2KFN A;  3RRH A;  3D6R A;  4FK2 A;  3HO1 A;  4I9L A;  3SUN A;  4I9Q A;  4CK2 A;  3DXM B;  3SMP A;  3EE9 A;  4B08 A;  3HM9 A;  4FJM A;  2A42 A;  1YVU A;  1JLG A;  3M3Z A;  4M3T A;  4PA1 A;  2F9W A;  3SBG A;  5M1O A;  1CLQ A;  3A2F A;  3GOI A;  2R7Y A;  1B9F A;  4N41 A;  1T3V A;  4LF7 K;  5GIO A;  3PSI A;  3PIO L;  4OGC A;  5FLX O;  1YIT N;  2GUI A;  2IAJ A;  2VG5 A;  4H0V B;  5C10 A;  4FLU A;  2G8W A;  5LMN K;  3MAQ A;  4DU1 A;  4M3U A;  1Q7Y O;  1LV5 A;  3DLG A;  1WSJ A;  4BRM A;  3H1Q A;  4OPJ A;  2V7Z A;  1S9G A;  4CE9 A;  4CGJ A;  4H0T B;  3DRS A;  3I33 A;  4HUG A;  2P9N A;  3IRX A;  1VSJ A;  3KHY A;  4IZ9 A;  1MDU B;  2VWK A;  3HVT A;  1WLJ A;  5AQU A;  1S1T A;  2Z1I A;  4DTX A;  2YJE A;  2DFE A;  4OLB A;  3GG4 A;  2NUB A;  4HHT A;  1LCU A;  3N4P A;  3L2R A;  5GIP A;  4QAG A;  2X74 A;  5KQD A;  3T3F A;  3U4L A;  3TWH A;  1RT1 A;  4AM7 A;  3UB5 A;  5JS2 A;  3P5J A;  3WXK A;  1WUA A;  1Q81 O;  1NJW A;  4GMJ B;  2CH5 A;  1YXQ A;  3IS9 A;  4GW6 A;  1YHQ N;  1XI1 A;  3WXJ A;  1HYZ A;  1KAY A;  3OW2 M;  3MN7 A;  1OH8 A;  2NRX A;  3CC4 N;  4EZ6 A;  2YHA A;  4Z4G A;  3C6T A;  1D4X A;  3U9Z A;  3OYE A;  2VQE K;  4M7Y A;  4K41 A;  1TKT A;  3VEO A;  5KGX A;  4F3T A;  4FJ5 A;  4BEB A;  3VET A;  3O9S A;  4BR5 A;  4C1N I;  5FPM A;  3T1Y K;  3SPY A;  2D1K A;  1WAJ A;  3ZT2 A;  4BRO A;  5AZI A;  4XH5 A;  3VQA A;  3BGR A;  2YNG A;  1C1A A;  5LL6 Z;  2V7Y A;  3D0P A;  4BE1 A;  1NM1 A;  2HOE A;  3H6E A;  4FJJ A;  3L6Q A;  4CEQ A;  3OYL A;  5JS1 A;  3OYJ A;  1QHA A;  1IBM K;  3AVL A;  3DXM A;  1HRH A;  3I55 N;  3M8R A;  5AQW A;  2OA8 A;  4FJL A;  3LAL A;  2W41 A;  2HHX A;  2EX3 A;  3TI0 A;  1HQU A;  4FJN A;  1RT5 A;  5J2M A;  1C0U A;  5KI6 A;  1J53 A;  2UUB K;  4DSJ A;  3THY B;  3B6P A;  1HKC A;  4FLZ A;  3NE6 A;  3NH1 A;  5CYM A;  4DTJ A;  3E9L A;  1QVF M;  1TL3 A;  3OYC A;  1S1U A;  1R59 O;  3VA3 A;  4BY9 C;  4WQ4 A;  4E19 A;  4DQI A;  1WSI A;  4IFV A;  4DV6 K;  1W2B M;  4JI4 K;  4B8C A;  5AQK A;  1V4T A;  1IG8 A;  4HCC A;  1TVR A;  3LP3 A;  4DTR A;  3R9P A;  5BRF A;  4JYA K;  4GNI A;  5E26 A;  4FW2 A;  5HL7 L;  1YUW A;  3IKM A;  1NGG A;  3V1O A;  2HBL A;  4WFA L;  4DR2 K;  3S3M A;  2IIR A;  3ZET B;  4CD1 A;  2F9T A;  1U04 A;  4DR7 K;  1K9M O;  2DFH A;  4BVO A;  2D0P A;  4FOE A;  3R3L A;  1IV0 A;  3C65 A;  1BQN A;  3CCV N;  3WUH A;  2X6N A;  3NVM A;  4CER A;  2X6S A;  3DJC A;  4FLY A;  3K9K A;  4JRQ A;  2NRZ A;  2KZZ A;  1C0T A;  3CM6 A;  4GKK K;  3BF1 A;  1RT4 A;  4O55 A;  1YJN N;  4W5Q A;  5FDL A;  3CC7 N;  4IOA L;  3AVC A;  2YCH A;  2KLA A;  3L3U A;  2W00 A;  2B6A A;  5H1S Q;  3VQ5 A;  4W5R A;  4MQ3 A;  2PZS A;  4Y0W A;  3P31 A;  4A2A A;  4DSE A;  2BGG A;  2QTD A;  2Q1N A;  1P90 A;  4XIU A;  3HPG A;  4CJU A;  3H3O B;  1U45 A;  3H08 A;  2WFB A;  1WSG A;  3FFI A;  2GV9 A;  4AHC A;  4H5V A;  1BI4 B;  4BRQ A;  2ZGY A;  4A62 A;  4B1V A;  1K8A O;  3VTI A;  3HP6 A;  5FPE A;  2QM1 A;  4QCL A;  4IXC A;  5DMR A;  2Z1J A;  1T03 A;  1E3M A;  1NGA A;  4UY8 O;  3HK2 A;  4CIF A;  3THY A;  3Q7B A;  3MCP A;  3LPT A;  4CF1 A;  3K5L A;  3LM9 A;  5ELZ A;  1C1B A;  5KPZ A;  2YNI A;  4BR0 A;  3O3H A;  4BC4 A;  1U4B A;  2DY4 A;  1FJG K;  2D0B A;  5M1P A;  3Q7C A;  3WNH A;  3ZX0 A;  4CZL A;  1RT6 A;  4CED A;  3MWT A;  1KTQ A;  5BR9 A;  4LF8 K;  3RTV A;  3L2W A;  3VQ7 A;  4DTO A;  5HP1 A;  3OYH A;  1HJR A;  2CH6 A;  4KTZ A;  4H8K A;  5HOO A;  1U48 A;  5C12 A;  3AO3 A;  4DTM A;  4Z4H A;  4FK0 A;  4WQ5 A;  1N36 K;  2P51 A;  3AA2 A;  4CBW A;  2HB5 A;  4AM6 A;  4ISE A;  1BG3 A;  4CHZ A;  2VWB A;  3HTV A;  3EKS A;  2KHO A;  3THW B;  2UXD K;  2F7T A;  2O8E B;  3SV3 A;  3ZET A;  4JKC A;  1IBL K;  4DKW A;  1YTA A;  3C7N B;  4YOX A;  3MK6 A;  4OPK A;  4KHY A;  4NO7 A;  2C1G A;  1A5V A;  1WAF A;  2NNW A;  4RW6 A;  2WBN A;  1UAX A;  3B6O A;  4KH4 A;  1U49 A;  2I7N A;  2JLE A;  3NFA A;  4DTP A;  4EAH D;  1NK5 A;  5AQR A;  1KLM A;  4BR4 A;  2ZGZ A;  3ZSX A;  4FPB A;  4DR5 K;  2XY8 A;  4CF0 A;  1E4G T;  1L3V A;  1A5W A;  3QIP A;  1OH5 A;  3QFP A;  4WF9 L;  4PKH A;  3HXM A;  2E4L A;  1VSH A;  4JI6 K;  1W7A A;  4O44 A;  1C6V A;  1K8K B;  5GAH P;  3CPE A;  1QVG M;  1QQO A;  4M7X A;  2ZD1 A;  2CGK A;  3THX B;  1NGI A;  4NXN K;  1GLL O;  4FLW A;  4J2B A;  1B92 A;  2PBD A;  5EOY A;  5EY4 A;  3HP9 A;  3VQ4 A;  3FZL A;  5M1F A;  1RDB A;  1ZBU A;  2X78 A;  2DPN A;  3TAR A;  3CJC A;  3NH0 A;  1C0M A;  1MU2 A;  3FR0 A;  4CW7 B;  4K0K K;  4CJF A;  3TAQ A;  4CHN A;  5I42 A;  1BI4 A;  2YHX A;  3K59 A;  3PSF A;  3CD6 N;  3CER A;  3LP0 A;  1GLE G;  4OVL A;  1TKX A;  1V4S A;  3ZSO A;  1BA0 A;  4CFC A;  3QBX A;  4KHQ A;  2W40 A;  4A57 A;  4X62 K;  1NGH A;  2GUP A;  3MN6 A;  2Y1I A;  1EWQ A;  3KZB A;  2KQ2 A;  2WTU A;  5GAE P;  1LW2 A;  3KK3 A;  5IWA K;  3PUF A;  1U47 A;  2XHB A;  2PAV A;  1O1W A;  3TAN A;  3EZW A;  1S6P A;  2HF4 A;  3M5R A;  4ELU A;  1GLA G;  3EEQ A;  1KLN A;  3EN9 A;  4DQS A;  4LFB K;  3OA9 A;  1YT3 A;  4BE0 A;  4NCG A;  3HVR A;  4IKF A;  4EP5 A;  2KW4 A;  4Z94 A;  3G0Z A;  3NF6 A;  4DSI A;  4FWR A;  5BPM A;  1ATN A;  4F2S A;  3U3G A;  3OJU A;  3IG1 A;  4CD3 A;  3K2P A;  4I2P A;  2GEL A;  3P4I A;  3THW A;  2O8E A;  2E2O A;  2P5O A;  1VQ5 N;  1VSI A;  3C7N A;  3RMA A;  4BRP A;  1Z26 A;  4CGF A;  2ASM A;  2YNF A;  3VQE A;  2GWK A;  3LZJ A;  3KWG A;  4PUO A;  4IWV A;  2D0C A;  1VQ4 N;  4G9Z A;  2O4I A;  1BUP A;  2VG6 A;  1HQE A;  4CJK A;  2IGI A;  4FWL A;  3ZT0 A;  3SYZ A;  4DV7 K;  4JRP A;  3CF5 L;  3OYG A;  1SQK A;  5M1Q A;  3NGZ A;  3MN5 A;  3RRG A;  3ZYY X;  4E7I A;  2FBY A;  4Z4F A;  4A59 A;  3GL1 A;  3K9J A;  1XC9 A;  3BEX A;  1R0A A;  1ILY A;  4MDB A;  1RCH A;  5FPN A;  4HUF A;  5J2Q A;  4B1U B;  1K8K A;  3D7E O;  4FLT A;  4YNQ A;  1WSF A;  3O6W A;  3THX A;  3CJ7 A;  3FZM A;  4C1N K;  1TV6 A;  2YX6 A;  1NMD A;  4M3Z A;  1RNH A;  4RW7 A;  4CVN E;  4CJQ A;  1NGJ A;  3QB0 A;  3HM8 A;  4C8O A;  4M3W A;  1S22 A;  4IJN A;  3C6A A;  3MXJ A;  2QXF A;  2O8B B;  5BPN A;  4DF4 A;  3LP2 A;  4PKG A;  3CCJ N;  2OYQ A;  2HND A;  1BGX T;  3FLC O;  3OYI A;  4N47 A;  1BQM A;  5AQP A;  2Q36 A;  1IKV A;  3AVJ A;  3JAM O;  3J7A P;  3I8B A;  3QIO A;  3E1Y A;  1D5A A;  4X64 K;  3SAG A;  1NBW A;  3QEX A;  4AQY K;  3WNE A;  5HBM A;  2QWR A;  2UXC K;  4QOZ B;  1TYQ B;  1HR0 K;  5KPT A;  3A5O C;  1RGI A;  4B9U A;  1IBK K;  2OCE A;  2BTF A;  4B9L A;  5E41 A;  3TU5 A;  3DM2 A;  3B8A X;  4IO8 A;  1JLA A;  1W97 L;  3ZSY A;  1I3A A;  3BZK A;  2ASP A;  3CIP A;  4O0I A;  5AQN A;  3ASM A;  4PQU A;  3TAP A;  4CF8 A;  3AAP A;  4NB4 A;  1DGK N;  1X9S A;  3MDQ A;  4DS5 A;  2FBT A;  1DEJ A;  4BRN A;  2QWM A;  3L2Q A;  1OH7 A;  1SKW A;  5C15 A;  1U6Z A;  2HNY A;  3AAR A;  3VGK A;  2RPI A;  1NLV A;  3O4N A;  2HBJ A;  1JXE A;  2GX9 A;  1QQC A;  3CPW M;  3SV4 A;  3AVB A;  4JHD B;  3SJH A;  4B3M K;  4B3R K;  2QWN A;  3WXM B;  4EFH A;  3J7Z O;  1EP4 A;  4CF2 A;  1RBV A;  1L3U A;  4CJP A;  4BRG A;  2E2N A;  1ASV A;  2PFU A;  4JK8 A;  1SL1 A;  2VWJ A;  4EP4 A;  2FSN A;  2FLO A;  4CHY A;  2P9S B;  4GV9 A;  1VSL A;  1S1W A;  1HLU A;  3ATU A;  3CJ1 A;  3THV A;  3KLH A;  2G8F A;  3M8S A;  1HYS A;  4C8K A;  3AA3 A;  3QER A;  4ZTF A;  1L5U A;  1QSL A;  3MN9 A;  4RCH A;  1RBT A;  4CZF A;  3OBY A;  1VQO N;  3UKU B;  3CQ8 A;  5ADX H;  3KJV A;  1KRP A;  4J2E A;  3DLE A;  3LWM A;  4JS4 A;  3NDK A;  2O8B A;  5SZT A;  1Q8I A;  4DWI A;  4ILG B;  2E1Z A;  2NRT A;  2O8D B;  5JVH L;  3OHR A;  3L2U A;  2VGM A;  2HHH K;  3CMA N;  3HPH A;  3CC2 N;  3CQX A;  1VSK A;  3D2F B;  4H0O A;  4KTW A;  3PO5 A;  4NLB A;  3KD5 E;  5BPL A;  2VYP A;  2NLX A;  1RDC A;  1C1C A;  4MO5 A;  3VQ6 A;  4F2R A;  1EET A;  3FZK A;  4CJ3 A;  5I3U A;  2FSJ A;  1TYQ A;  2D4W A;  3WEE B;  3K57 A;  3BF3 A;  4CK3 A;  4YY3 K;  1NK6 A;  3MXI A;  2ZJR L;  4DG1 A;  1DTQ A;  4YOW A;  5AQS A;  3AO4 A;  3LAN A;  3DMJ A;  4DFM A;  5JEN A;  1YF5 L;  5GAG P;  4CJR A;  1KAX A;  4R79 A;  2P1J A;  4OX9 K;  4R5P A;  3S3N A;  3SQ4 A;  3LL3 A;  3HJF A;  1WOQ A;  5EU7 A;  2HMI A;  2HHW A;  2OZS A;  4CFA A;  3AVF A;  4H5R A;  4BR7 A;  1JJ2 M;  2YHB A;  1HKB A;  5M1N A;  3DLK A;  2ZF5 O;  2P9K B;  1RTD A;  4CHQ A;  4DSF A;  3V6D A;  4V19 S;  2E1Y A;  1W9H A;  2QKK A;  4CGI A;  4FJI A;  4LF9 K;  4YFU A;  3G71 N;  4OPH A;  1NK4 A;  5AQI A;  3M8P A;  5AJ3 K;  3TAB A;  5AQQ A;  4JHD A;  2BDP A;  3U3Y A;  3FZF A;  3L2V A;  5M1K A;  2RKI A;  3F9M A;  4GKJ K;  4DHY A;  4L8R B;  3C94 A;  1VQ7 N;  3HL8 A;  1BIS A;  3DAW A;  4ICL A;  3MWP A;  1HUX A;  2P9S A;  1SV5 A;  3O8M A;  3CCS N;  4KRE A;  3OTO K;  4LD0 A;  1LAW A;  1JL1 A;  2WC9 A;  4WFN L;  4YDU A;  1KC8 O;  3UKU A;  1ZBI A;  5BN8 A;  4AHT A;  3OS0 A;  3L4I A;  1UA1 A;  1FKP A;  1JLF A;  3SK3 A;  1NK7 A;  3KK2 A;  3O3G A;  2IOC A;  3A5L C;  2O8D A;  3P1G A;  1BCM A;  1Z6R A;  3AVG A;  1OH6 A;  3DLR A;  1KVA A;  3VF6 A;  1VRT A;  4WYB A;  3RR8 A;  5MLC Q;  4KRF A;  4CHO A;  3A5M C;  3D2F A;  4IJA A;  3QEP A;  3AGK A;  1IJJ A;  4XEI A;  3K5N A;  1BIU A;  4OKK A;  5DM7 L;  2OZM A;  1JL2 A;  3CFR A;  3S5T A; 
#chains in the Genus database with same CATH homology
 3WEE A;  4CZM A;  4J8F A;  5BRE A;  2OTJ N;  1ZXO A;  4PKI A;  4EAH D;  1M90 O;  5AQR A;  4JKD A;  2NRV A;  2ZGZ A;  5AQF A;  3U8X A;  4BR4 A;  1YAG A;  4FPB A;  3WXL A;  3A5N C;  1XQS C;  2ASO A;  1VQL N;  1E4G T;  3RSE A;  3CCL N;  1YIJ N;  3EE8 A;  4FVU A;  2WUS A;  4JN4 A;  4O5F A;  3WXI A;  5JLH A;  3QIC A;  3ULE B;  3QFP A;  3SLC A;  3RVC A;  4HWI A;  3O1B A;  4WF9 L;  4PKH A;  3VTH A;  3ZX2 A;  1KQS M;  2A6A A;  1YVN A;  3HSC A;  3OBW A;  1K8K B;  4B1Y B;  1Q86 O;  5GAH P;  3CPE A;  1GLF O;  3P38 A;  4ISF A;  5BRH A;  4I6M B;  1QQO A;  1QVG M;  4M7X A;  3NVK A;  2P9K A;  2QWQ A;  4JKB A;  2CGK A;  1NGI A;  1T6C A;  1GLL O;  4IOX A;  2PBD A;  5EOY A;  5EY4 A;  1YI2 N;  1BU6 O;  1CZA N;  3LDP A;  1VAZ A;  2A40 A;  3FZL A;  5AQJ A;  5M1F A;  4BRL A;  1NGE A;  2DPN A;  3HZ6 A;  3CJC A;  3VOV A;  4CZJ A;  3VEV A;  4QS8 A;  5CR4 A;  1XUP O;  3FR0 A;  1HKG A;  3DLL L;  4YOY A;  2P9N B;  1YJW N;  2E2Q A;  3A0I X;  2AP1 A;  4IO9 L;  1DT9 A;  1GLJ O;  3ID6 A;  2YHX A;  3CET A;  1XC3 A;  4GY2 B;  5AFU H;  3CD6 N;  3CER A;  2P9P B;  2QXL A;  4B1X B;  4CI6 A;  1GLE G;  3FGU A;  3ZEU A;  4BG9 A;  1TUY A;  1V4S A;  1JCE A;  1BA0 A;  2HST A;  3QBX A;  4DB3 A;  2QWO A;  3WT0 A;  2UYT A;  2W40 A;  3E66 A;  4A57 A;  3T69 A;  2KKZ A;  4H5T A;  3W0L A;  1NGH A;  2GUP A;  2V51 B;  3G25 A;  3CCU N;  3MN6 A;  3L4Q A;  3O9Q A;  1C0G A;  3KZB A;  4U7B A;  3ENH A;  4BRF A;  1VQP N;  5GAE P;  4WFB L;  5KPR A;  3TSP A;  4JKF A;  1QQN A;  3UE5 A;  3TSQ A;  2QA4 N;  4H5W A;  1QQM A;  3VGL A;  1NGB A;  2PAV A;  3C6H A;  4YOU A;  4B9Q A;  3CQY A;  3EZW A;  1VQK N;  3MX5 A;  2HF4 A;  3M5R A;  5BN9 A;  5I9E B;  3R8E A;  1GLA G;  1NGD A;  1QZ6 A;  4XJX A;  3ZX3 A;  1VQ9 N;  3SAF A;  3EN9 A;  4FWN A;  4CZE A;  2FSK A;  3HBT A;  4O8U A;  1QZ5 A;  2YI1 A;  3OA9 A;  4PHT X;  4L3Q A;  3NMU A;  3LDL A;  3F2K A;  4NLC A;  3R1X A;  4WQ4 C;  3SBT A;  4Z94 A;  5FPD A;  1KXP A;  2GWJ A;  1OVY A;  2FF3 B;  3LM2 A;  4OO1 J;  3O1W A;  2HBM A;  4FWR A;  4H0P A;  3JS6 A;  5C2D A;  5BPM A;  1ATN A;  5AQY A;  4JKE A;  5EX5 A;  4A5B A;  4CD3 A;  5AR0 A;  3G4S N;  3MX2 A;  1M1K O;  4JNE A;  3EL2 A;  2GEL A;  3P4I A;  3VEY A;  1BOT O;  2Q97 A;  4XH4 A;  4BE7 B;  2E2O A;  2ZJP L;  5AZI B;  1VQ5 N;  1VQ6 N;  4YOT A;  3C7N A;  3F5T A;  1DKG D;  2J4R A;  4BC5 A;  4BRP A;  2E8A A;  2ASM A;  2QI2 A;  2GWK A;  4DQ8 A;  3J8A A;  3KWG A;  2ZJQ L;  2A5X A;  3GBT A;  4IWV A;  2CGL A;  3D2E A;  1VQ4 N;  3D6R A;  3CXC M;  4G9Z A;  4JK9 A;  4BGB A;  3VF2 A;  1BUP A;  3DXM B;  3SMP A;  2OAN A;  3AGR A;  3EE9 A;  2E20 A;  4FWL A;  4FWK A;  3UKR B;  1HJO A;  5GAD P;  2A42 A;  3VMF B;  1X3N A;  4BGA A;  3CF5 L;  1SQK A;  3O9U A;  3M3Z A;  5M1Q A;  4QS7 A;  3ULE A;  5C0Y A;  1U2V B;  3T7Z A;  1J6Z A;  3MN5 A;  2F9W A;  2Q31 A;  3SBG A;  3ZYY X;  3QFU A;  5M1O A;  1Z05 A;  5F2R A;  3GOI A;  4A59 A;  3GL1 A;  3K9J A;  3SAH A;  1T3V A;  2CGJ A;  3BEX A;  4YOV A;  1ILY A;  4MDB A;  5GIO A;  2NRH A;  3R6M A;  3PIO L;  5FPN A;  3LDO A;  4B1U B;  1K8K A;  1YIT N;  2Q0U A;  3D7E O;  4H0V B;  5C10 A;  4I6M A;  3O6W A;  4JAX A;  4BC2 A;  3CJ9 A;  3CJ7 A;  3FZM A;  4JD2 B;  5AQX A;  4C1N K;  1Q7Y O;  1S3X A;  2YX6 A;  1NMD A;  4BRM A;  3H1Q A;  2V7Z A;  4MLE A;  4F9O A;  3ID8 A;  1NGJ A;  4BC3 A;  4LC9 B;  3QB0 A;  4H0T B;  4IDH A;  3HM8 A;  4IEI A;  4U67 L;  1H1V A;  3I33 A;  2P9N A;  3KHY A;  4IFE A;  1S22 A;  4IJN A;  1MDU B;  4IZ9 A;  4CJ7 A;  5AQU A;  1HPM A;  3C6A A;  5BPN A;  2YJE A;  3IDH A;  4BG8 A;  4RTF D;  2P9P A;  3S41 A;  3KVG A;  4O8K A;  3GG4 A;  4PKG A;  3CCJ N;  5AZJ B;  1LCU A;  3N4P A;  3FLC O;  3LDN A;  5GIP A;  3DXK B;  1JCG A;  5AQO A;  5AQP A;  2Q36 A;  4EIA A;  5KQD A;  4CZH A;  3W3D A;  3I8B A;  2D0O A;  3U4L A;  2IVP A;  3E1Y A;  3H46 O;  4MLH A;  3UB5 A;  4AM7 A;  3SAG A;  4IEE A;  1NBW A;  4GV6 A;  2IVN A;  2V52 B;  3IMX A;  5ADX A;  3WXK A;  2VCP A;  4FPA A;  5JLF A;  3HOS A;  1WUA A;  1Q81 O;  3GE1 A;  4JKA A;  2QWR A;  4ILJ A;  3CHW A;  4A5A A;  2CH5 A;  5TKW A;  1TYQ B;  4XH1 A;  3G6E N;  3O08 A;  2E2P A;  1YXQ A;  4K43 A;  5JIC A;  1GLB G;  5KPT A;  5AQM A;  1HX1 A;  4EHU A;  1YHQ N;  3WXJ A;  3A5O C;  1RGI A;  1ATS A;  1KAY A;  1X3M A;  4YDU C;  5AQZ A;  3OW2 M;  3MN7 A;  2NRX A;  3HRG A;  3LDQ A;  3CC4 N;  2BTF A;  3U9Z A;  1D4X A;  3BP8 A;  3TU5 A;  1OKJ A;  1KAZ A;  4K41 A;  4M7Y A;  3B8A X;  4IO8 A;  1W97 L;  3VEO A;  5AQG A;  4BEB A;  3VET A;  3EO3 A;  3O9S A;  4BR5 A;  4C1N I;  2NZT A;  2ASP A;  5FPM A;  3CIP A;  3JXU A;  5AQN A;  2D1K A;  4H0X B;  3AAP A;  2QWL A;  5TKY A;  3VF4 A;  4NB4 A;  5AZI A;  4BRO A;  1DGK N;  3BUZ B;  2I7P A;  1Q18 A;  2QW9 A;  3MDQ A;  4XH5 A;  4BRI A;  3E9O A;  1DEJ A;  4BRN A;  3E9P A;  1S72 N;  2V7Y A;  1GLD G;  1NM1 A;  2HOE A;  3H6E A;  3L6Q A;  2QWM A;  5JMV A;  5C15 A;  4BRE A;  2IVO A;  3CCR N;  1QHA A;  1U6Z A;  2A3Z A;  1YJ9 N;  4CBX A;  3AAR A;  3VGK A;  4CZG A;  1RDW X;  3KK7 A;  1NLV A;  3C0B A;  3HI0 A;  3DXM A;  4JKH A;  3VES A;  3I55 N;  3FFK B;  2HBJ A;  4PL7 A;  2GX9 A;  3CPW M;  5AQW A;  3UKR A;  4JHD B;  2FF6 A;  1NGC A;  2W41 A;  3SJH A;  2QWP A;  2P9I B;  4QS9 A;  2QWN A;  3EKU A;  3WXM B;  4EFH A;  3J7Z O;  1U2V A;  3A8Y A;  1RFQ A;  2E88 A;  4DCH A;  1NGF A;  3GDQ A;  5LJW A;  3O80 A;  3MMV A;  4BRG A;  2E2N A;  5BRD A;  2PFU A;  1KD1 O;  4JK8 A;  3O4W A;  1HKC A;  2FSN A;  2FLO A;  1C0F A;  3TTF A;  2BUP A;  2P9S B;  2AA4 A;  4FWP A;  3P39 A;  4GV9 A;  3PLA A;  1SZ2 A;  3TPQ A;  1HLU A;  3ATU A;  3CJ1 A;  3E9L A;  4CBU A;  2RE2 A;  1QVF M;  2FXU A;  5B8H A;  1T44 A;  3VEN A;  1EO1 A;  4M63 C;  4HTL A;  4JD2 A;  1R59 O;  4BY9 C;  3CCE N;  5CHI A;  4H03 B;  1VQM N;  2P9U B;  2YHY A;  3MN9 A;  4JEP A;  4FWO A;  1Q82 O;  4RCH A;  1MWK A;  4CZF A;  3OBY A;  3L0Q A;  4WQ4 A;  1VQO N;  3M6G A;  4JKG B;  3UKU B;  3TTD A;  5ADX H;  4FO0 A;  4BRD A;  4BR2 A;  4BEC A;  3IUC A;  3O9T A;  2NRR A;  1W2B M;  4MO4 A;  2EWS A;  1ZBS A;  3O9R A;  2OTL N;  5AQK A;  4H5N A;  5LJV A;  4ILG B;  1V4T A;  1IG8 A;  2JWL A;  2E1Z A;  2NRT A;  5AZJ A;  3R9P A;  5BRF A;  4GNI A;  5JVH L;  5E26 A;  3OHR A;  3VER A;  3DXK A;  2VGM A;  4H0Y B;  4FSV A;  4FOI A;  5HL7 L;  1YUW A;  3IKM A;  1NGG A;  3CMA N;  3QDK A;  4ILH A;  2HBL A;  4KBO A;  3CC2 N;  4WFA L;  3CQX A;  3WQU A;  5JVG L;  1SS6 A;  2IIR A;  2P9L B;  2F9T A;  3D2F B;  4H0O A;  3ZET B;  4A2B A;  4CD1 A;  4NLB A;  4CZI A;  4GV3 A;  5BPL A;  1GLC G;  2VYP A;  3I56 N;  2NLX A;  1K9M O;  1BWF O;  4BVO A;  2D0P A;  2JWK A;  4FOE A;  4MO5 A;  4BVP A;  4BR9 A;  3R3L A;  4BRA A;  3C65 A;  3CCV N;  2VGN A;  4JK7 A;  3FZK A;  4BRC A;  4E1J A;  2FSJ A;  3O5B A;  1TYQ A;  2D4W A;  3WEE B;  4B1Z A;  1VQN N;  3WUH A;  2NRW A;  3VEZ A;  3NVM A;  5KQ8 A;  3BF3 A;  3KWI A;  2ZJR L;  3DJC A;  3TTC A;  4B1W B;  4YOW A;  5AQS A;  3K9K A;  3RSE B;  4YOR A;  5C2F A;  4RWT A;  2NRZ A;  1YF5 L;  5GAG P;  1KAX A;  4A61 A;  4R79 A;  1LOT B;  3VPZ A;  3BF1 A;  2GTD A;  1YJN N;  2H3G X;  2ITM A;  2YHW A;  1KC8 O;  3LL3 A;  4AF1 A;  2Q2R A;  1WOQ A;  1G99 A;  3CC7 N;  4IOA L;  3H1V X;  2YCH A;  1TUU A;  4H5R A;  4BR7 A;  2KLA A;  4EHT A;  2W00 A;  1JJ2 M;  4C23 A;  1HKB A;  5H1S Q;  5M1N A;  3WQT A;  2A41 A;  2P9K B;  2ZF5 O;  3CJB A;  4Y0W A;  3P31 A;  4A2A A;  2E1Y A;  1T6D A;  1MWM A;  2QTD A;  2Q1N A;  2HBK A;  1P90 A;  3G71 N;  4WQ5 C;  3H3O B;  1MA9 B;  4OPH A;  1ESV A;  3H3N O;  4MDA A;  4FWS A;  5AQI A;  3H45 C;  2WFB A;  5AQQ A;  4JHD A;  1E4F T;  3PIP L;  1O13 A;  2GEM A;  3CCQ N;  2P9I A;  3FZF A;  4FL9 A;  1ZC6 A;  4H5V A;  5M1K A;  1RDU A;  3IFR A;  4BRQ A;  2ZGY A;  3F9M A;  4A62 A;  4B1V A;  2ZWH A;  5E84 A;  1K8A O;  3VTI A;  3ZEU B;  4DHY A;  1BO5 O;  5FPE A;  2QM1 A;  1VQ7 N;  4IXC A;  3ENO A;  3VEX A;  4GVE A;  1Y64 A;  1NGA A;  4UY8 O;  3DAW A;  5DM6 L;  3VGM A;  5F0X A;  3Q7B A;  3MCP A;  3MWP A;  1HUX A;  2Q0R A;  2P9S A;  4OPA A;  3LM9 A;  2YJF A;  5ELZ A;  5KPZ A;  4BR0 A;  4K25 A;  4BC4 A;  3O8M A;  4FWM A;  4WCE L;  3CCS N;  3U9D A;  5AQV A;  1VQ8 N;  2RHK A;  2P9U A;  2WC9 A;  4WFN L;  4CZK A;  4YDU A;  4KH6 A;  5EVZ A;  3Q7C A;  5M1P A;  3ZX0 A;  4BRH A;  1BDG A;  4CZL A;  1N8R O;  3CCM N;  4IOC L;  3QBW A;  4JKG A;  5AFU A;  3MWT A;  3UKU A;  3M1F A;  3AY9 A;  5BR9 A;  3CME N;  2HMP A;  5BN8 A;  4KH5 A;  3CI5 A;  5AQT A;  3HOT A;  2CH6 A;  5HOO A;  3ENB A;  5C12 A;  4FWQ A;  1JCF A;  1BA1 A;  4PL8 A;  3L4I A;  5AQH A;  3SK3 A;  4WQ5 A;  2BH1 A;  5GIN A;  3MCA B;  3A5L C;  3N4Q A;  2QEX N;  2C1I A;  4CBW A;  2HF3 A;  4BQL A;  3DWL A;  4AM6 A;  4ISE A;  1BG3 A;  1Z6R A;  2VWB A;  1K73 O;  3HTV A;  3VEW A;  3EKS A;  2KHO A;  3VF6 A;  2F7T A;  4WYB A;  5CE3 A;  5MLC Q;  1X9J A;  3ZET A;  3AAQ A;  2P9L A;  3A5M C;  3D2F A;  1P8Z A;  4IJA A;  4JKC A;  4DKW A;  3AGK A;  1IJJ A;  3QML A;  3C7N B;  3CJA A;  3FE1 A;  4XEI A;  4YOX A;  3TSU A;  3MK6 A;  5EXW A;  5F1X A;  5LY3 A;  4BRK A;  5DM7 L;  1NJI O;  4NO7 A;  1EQY A;  1ATR A;  2C1G A;  3D2E B;  3FZH A;  4ISG A;  1SAZ A;  2NNW A;  3SMS A;  2WBN A;  4K42 A;  5AQL A;  4KH4 A;  1NWK A;  3ATV A;  2I7N A;  4BQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...