5AFUL

Cryo-em structure of dynein tail-dynactin-bicd2n complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
270
structure length
270
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVDVIPDNPKFQQLQRELSQVLTQRQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Dynactin Complex and its Interaction with Dynein.
pubmed doi rcsb
molecule tags Motor protein
molecule keywords DYNEIN TAIL
total genus 71
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5afuL01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 5afuL02
3AA1A 5AFUK 3AA0B 3AA6A 3LK41 4AKRA 3LK42 3AAEA 3LK3A 3AA1B 3AA6B 3AA7A 3AAAA 3LK2B 4AKRB 2KZ7A 2KXPB 3LK2A 5AFUL 3AAAB 1IZNB 5ADXL 5ADXK 2KZ7B 2KXPA 3AAEB 3LK3B 1IZNA 3AA0A 3AA7B
chains in the Genus database with same CATH superfamily
4FRTA 1T16A 1ZV4X 2D0UA 3AECA 4PJLA 2Y8DA 3DA3A 3HKDE 1HXUA 4EXTA 2JQHA 4PW8A 3F31A 4TNWA 2X9WA 2HPJA 4B3RT 2O4VA 4ZS3A 3RIAA 1D1AA 4O4XA 4IE4A 2C0SA 1LVFA 3EAMA 4DR4T 5CJ5A 3O1JA 3I9WA 4KI0F 3W15B 2LSGA 5FY1A 5JVDE 4X1YE 5LCYA 3MKDA 4EYUA 2IHR1 4IE5A 5H6RB 4FMSA 2XJ7A 5GONE 3UUBA 1XDPA 2Y0LA 3C4WA 1BR1A 1OEDC 2XAHB 2KXPA 3RQWA 3VZWX 4EZHA 4JI3T 4AYEC 4KRAA 4HWFA 4DUYT 4FSOA 3MZKB 3O1HA 3EDUA 3OJAA 3FZKB 5ETWA 4ILAA 3ZEFB 2KWHA 4IL9A 2N2LA 3JAFA 4YSXA 3OBVE 3JCUO 1T7SA 3C98B 1QJPA 4HFIA 3DWNA 2XQ7A 4D65A 2R6GF 5C8YE 3T20A 4JI5T 3RI5A 4CTDA 3UPGA 3CWZB 3QB5K 2LRKA 1YKHB 5LHHB 3KV4A 2AE9A 2DI4A 4OHFA 3UFEA 4JLEA 3P4SA 5IHYA 3RH3A 4PK4A 4UEMA 5DJQC 5ABGA 2BZBA 4KHPT 4RL9A 4BJMA 4H63V 2LJLA 3RLFF 2XSBA 4LF5T 4YLHA 3VE1A 5AQLB 1G90A 2D0TA 2BBHA 3PURA 2BS4A 4EEBA 1QUUA 4B6XA 3KZIO 5KAFO 2XM2A 5IYZE 2G0UA 5CA0E 2K5BB 4C90A 2ZFGA 4LSEA 3NZPA 1HTJF 4QXCB 4O4IE 4U33A 4UIGA 3A5XA 4FZMA 2WM9A 2UU9T 2W0GA 3RYIE 4A98A 4UR9A 3WU2O 4DV3T 3T8OA 4JI8T 4DR6T 1OEDA 1MMGA 3PU8A 3PORA 4XNLA 3AEEA 2W67A 2H88A 2V7MA 3HI2A 3AA1B 4UV8B 4MBQA 2DWGA 2A2FX 4GCPA 1UX4A 3AE9A 2BDEA 4ZI3D 4P09A 4O3YA 5LBQB 3JAEA 3P8CD 3P4WA 4U3CA 3Q5XA 3PRNA 3IA3A 3BQLA 1DU2A 2EHOC 1S35A 4HFVA 2M07A 3KV6A 2JQYA 4PNIA 1UGOA 3NRYA 3CQXC 3N2OA 2VK9A 2XAJB 3ZMVB 4AKRB 5HWYA 5DL7A 2WDVA 2LHFA 3RF1A 3RBHA 3FYXA 3LBXA 3V8UA 3KINB 4IE7A 3RQUA 3AVSA 2W80C 3MJXA 2WBLA 4O4JE 1P4TA 3PJAJ 1HX1B 3DZMA 2FGRA 3TLVA 3AE3A 1N34T 2W66A 5CFBA 3KVBA 2NWBA 2IC9A 1MNEA 3UUNA 1QLBA 5L47A 4LMKA 1WFDA 1IZNA 3FZLB 4FI5A 3WI3A 3EMNX 4IL4A 5FXWA 4XBFB 3QNUA 1YW0A 5JRCA 2CBJA 1ZOYA 3H3MA 2R8AA 4QX7B 2QGSA 1CHUA 4FSPA 2R4OA 4AISA 3L8RA 5LA6E 2K0LA 3ONXA 1J5ET 4F6RC 2N2MA 5DL8A 2XTQA 3P4PA 2XHEB 3C51A 4EZ4A 1WR6A 2CPTA 5FVKA 1MM5A 5AQNB 5L3CB 1GFNA 4O4HE 2ZM0A 4TNVA 3PV0F 2CA5A 3P4QA 3ONLC 2ACXA 2OA5A 1G73A 3O9XA 3OVUA 3L39A 2VKJA 1D0ZA 4ZS2A 4AQFA 3K8PC 5HWXA 4DR1T 3SYSA 2A9UA 4IREA 1HXTA 1MMDA 1SHZC 4YJ2E 5LGNB 4U74A 3N9PA 4N78D 2WWVA 1YS5A 2XAFB 2IUBA 5EK4A 1W9RA 4KP3C 5KXJA 1VCTA 3ZCJA 3EI0A 3P4RA 5G39A 2OV9A 3LFMA 5FY0A 3EVYA 3NWIA 2FBWA 4BAYB 2J62A 3NRXA 4B3MT 2AXDS 2K24A 4I43B 2UXBT 5J2UE 2H89A 3LK2A 1WR0A 2QYWA 2WWUA 3C5OA 2XQ9A 2DCFA 2HHHT 4K3CA 2BVMA 2BG9E 2F1TA 4ZOLE 3ZC1A 3PUAA 1D1CA 2VKOA 2XUEA 2XG6A 5L3DB 2VL0A 3DJBA 3PTRB 5KDMC 2R4LA 4U72A 1BT9A 2DWKA 5JR9B 4WW0A 3AEFA 2XTLA 1N33T 4UXNB 3BK9A 4O2BE 1ZEEA 2NTYA 4FUVA 1US7B 2VB6A 2LSYA 3IBPA 2A72A 4JUYA 4JBWF 1VOMA 4UB6O 3VR8A 4C69X 1IJ6A 3CX6B 2ZMAA 2VWAA 5L3EB 3FZMB 5F3JA 5LGUB 3I0QA 4H63H 5LJNA 5M4YA 3JADA 4EYYR 4IDNA 1FMVA 2WJRA 4OYJA 2N2NA 1OEDB 3SS1A 2V7IA 5HEHA 1T98A 3HA4A 2DNXA 5J1GA 5LOVE 5FL1A 4WBNE 4O3ZA 3N9OA 3N9QA 4GK0E 2X27X 4DR2T 2WCAA 4LF7T 4GK5E 3VRAA 2KC0A 3SWHA 4RLBA 3A2SX 4ZHQE 4ZI3C 2LSKA 3LSVA 2LOSA 5JQGE 3ZYKA 1U4QA 5JR9C 4X62T 4PJ0O 4CQIA 4QH4A 3UU3A 2F4VT 4HWIB 2IDOB 5EK2A 2ES0A 2LRLA 1HF8A 2CM0A 3F57A 1IBLT 4AKLA 4AQGA 2HN1A 4B3ST 3UQ7A 4AZLA 4H9OC 5LYJE 4IGUA 3EDVA 5TISO 3NVOA 2XQ8A 2C5JA 4KMCA 5CGMA 3FXEB 1ORMA 3MK7C 5FY7A 3HKBE 4TX5A 3P50A 1T1LA 4PUXA 5FXZA 2KMFA 4E7ZA 2VVSA 4I50E 3WI5A 2X0YA 3VY9X 3QK6A 5DL6A 4AYID 5F8PA 1BR0A 4A56A 1ZHCA 4O3WA 2QRXA 3VHLA 5LMNT 3QOFA 3UULA 4PK5A 2V6YA 3QB5A 2FUPA 3RKGA 5FVLA 4CXWA 4Q25A 5KAIO 1J5WA 2BKNA 5B66O 5LHIB 2NW7A 3BRZA 1HCIA 3OPCA 4L9IA 4O4UA 4GCQA 2E9XD 1OEDE 3C64A 3PJAA 5HCMA 4UF0A 2ACZA 4NXMT 1R8IA 4O3XB 4HN9A 2EHOB 3HKEE 3D0TA 3VR9A 3RC3A 2X9XA 2MYSA 6PRNA 3VKGA 3VY8X 2VVNA 5FMNA 2FJBA 3SFEA 1BXWA 2KXPB 3NSGA 2LE8A 5L3FB 2XY8B 4U9CA 1VRBA 2FJEA 3AEDA 5EE2A 1E7PA 2MTQA 1KK7A 4NPPA 4C91A 5JDHA 2VKDA 2PTFA 3AA0B 1D0XA 4TUYE 5L4EA 3QRCA 4DBQA 3MXZA 1GQEA 4QH1A 3OKQA 5LXTE 3WI4A 3CVRA 2RP4A 1ZHYA 3CX7B 4AKHA 4G76A 5L3BB 2I0MA 2PBIA 4XAXB 8PRNA 1QSDA 5HCJA 4YHHT 2KSRA 5G38A 4HFDA 2Q9QC 3GMIA 2X9HA 4FT6A 1FIOA 3BQIA 3LJCA 2Q9QB 2H7OA 2XQ3A 1FJGT 2GK9A 3J9X1 1UCUA 4XNKA 3U78A 4KR8A 5DL5A 3AAIA 4P0AA 2J1DG 4I0UA 4Z3TA 2XZEA 4KX6A 4KHZF 2UXXB 3ZYLA 3AE7A 3CPZA 1NAFA 3AE4A 3N2KE 4YHJA 5JH7E 3N2GE 3T0SA 2YK0A 1ZHZA 3O0EA 5AQPB 4ILCA 4HWCA 5H6QB 4AQYT 5LNKA 5HEOA 5EK3A 4AQFC 2ODUA 2W4XA 4PJMA 2P9BA 2A3DA 3ANWA 1OWAA 4AIUA 2RA1A 3IF8B 3L09A 5AQJB 1LRZA 4CI2B 3O1IA 3B5MA 1ZKEA 2B76A 2E9XA 2X51A 2CEAA 4GIWA 4I55E 3N5LA 4AYDC 4F4BA 1I6ZA 4QQ1A 1NENA 1IZNB 2Y0KA 2V6XA 4I4TE 3ZSTA 4LFAT 3ZJ1A 3UAQA 3CMLA 4CN4A 4FZNA 3RPUA 3WAJA 4TV8E 2EHOD 4LMLA 5AQSB 4D5UA 2JIWA 1MIVA 3GN5A 2PRNA 2HPLA 4IDPA 2Q9QD 1X79A 1G8XA 2ZM2A 3RYHE 4HWHA 2CHNA 3A0HO 1MIYA 3PGUA 2XASB 3LK42 5G3AA 3DA4A 3PUSA 5LBMA 2Y0HA 5EZYE 1WLXA 4B3TT 4G2AA 3TZGA 3SZVA 3L3PA 5E0OA 1ZHWA 3JC6C 2CBIA 3KDSE 5AQMB 4UVCB 4ILBA 3M3ZB 4CXYA 1Q9FA 5AQQB 2FGQX 2J4UP 3VZTX 1UK5A 3G7GA 2HN2A 3FB2A 2VL8A 2CWYA 4TV9E 3O4XE 2KDYA 2XE1A 2YINA 4X66T 2YDRA 4LSIA 1UURA 5ADXL 2PJQA 4UB8O 2E5LT 5AQKB 3E22E 4N59A 5CB4E 5ABHA 4YTNA 4LFCT 2ODJA 3AXJB 2MNHA 3E08A 4DR5T 2ZM8A 4JCHA 1YXRA 3LG7A 3V5SA 1IAPA 3J7Yq 4YY3T 2CLYC 4HFEA 2QA7A 3HR0A 1Z0PA 2YNKA 5LB7B 2Q9QA 5AQVB 4CI1B 2CXLA 2UUAT 4B61A 5JDGA 2PFVA 5AQUB 4NIQA 3V5UA 2V6YB 4PJJA 2LM2A 1MMNA 4RJXA 4X65T 4TN7B 4EB6E 5DABA 3ZLIA 4FESA 3I1AA 3N9LA 5LP6E 5ABEA 2Y6XA 2X9KA 2UXCT 1KNRA 4DR7T 1GFOA 2W63A 3P7IA 2XQ5A 4ADZA 1XWMA 2M67A 4FJOA 4Z8XA 3PQUA 4OK0A 2UUCT 2LKGA 4WBOA 3SYBA 4YT0A 4TWFA 4HFHA 4ZZBA 5LHGB 3PUZF 1BR2A 2V8SV 1E2AA 4K3BA 4C00A 2JPFA 4N74A 5IYUA 1XZYA 5BR8T 4EIWA 1CUNA 3JTYA 2YDQA 4YJ3E 5FL0A 3C4XA 3JC6D 5GTIO 3HWBA 2Z6EA 2K4TA 4PR7A 2J47A 2L3LA 5ADXK 1ZP0A 3TKLB 3HL6A 2WMOA 2VQFT 3C50A 2WB5A 2IAKA 4CZZB 4L5GA 2QTKA 5AQGB 3PUWF 3S4UA 3UU5A 4AUIA 2KWIB 1KFYA 4MHCA 4RLCA 1FMWA 5HXRA 5AQHB 4AKIA 4G75A 5F5WA 4LSFA 4DVDA 2E9XB 4EV6A 3SFDA 2BG9C 3FXDB 3ZC0A 4YFSA 3QRAA 3RIFA 4LF4T 1VCSA 1WYCA 1KNZA 1D1BA 4DV0T 4JI7T 3WAKA 4QKNA 2MAWA 1HNZT 2R89A 2W2UA 1FEWA 4DMWA 3LDQB 2BVLA 3DTOA 4IIJE 2WDQA 5HXSA 2N9DA 4AI6A 2V7JA 3Q5WA 1SA0E 4U31A 3DWOX 3K19A 5AFUK 2JMHA 3PE0A 5J0ZA 2XAGB 4PFOA 1J1JA 3ZMZB 2JQ9A 2WZHA 1I94T 2WQYA 2BS2A 3KV5A 2DLRA 3BRYA 3F2EA 3AEAA 4G63A 4QX8B 5LGTB 2YU2A 2QVAA 3UFGA 3RGLA 5D5DA 4D64A 4QWNB 4ZI2C 5FVNA 2MPKA 3G06A 2XE3A 2J1NA 1XNRT 2UUBT 4TWDA 2XM1A 4UVBB 4DMVA 1HNWT 4PK6A 4LMJA 3IHRA 3HOLA 2YOEA 7PRNA 1W0BA 4C4VA 1HR0T 3AA0A 3RIUA 2WJQA 4O4LE 3VU7H 2XE2A 2IC6A 3LBXB 1IBMT 4QXBB 3FBLA 2XE5A 4CN1A 3ZT7A 3PGRA 4KBMB 4K0KT 4DR3T 4NXNT 1OXZA 5HEUA 4N58A 3UU4A 4ZEYA 2Y7SA 2V5CA 4IDQA 4DIDB 3PDYA 2MBGA 4IE0A 4GCSA 2K9AA 4JI6T 4QH5A 2LSJA 2M6IA 3QC9A 2JMKA 2XQ4A 4ERRA 3TLTA 3JCFA 1T72A 2R4PA 4FOZA 5CA1E 2K48A 3AEGA 3OYZA 4MALA 1SUMB 3KBTA 4OX9T 3T1HT 4PFPA 1XMOT 3OTOT 2LSIA 4WZXA 4DNDA 4GOUA 5FXXA 2MOZA 2YN6A 5AQRB 2WS3A 4JEHB 4ZI7E 3DP7A 5FKYA 1NWMX 2X68A 3PUYF 3ETUA 5DQVA 3RRCA 3I0OA 3KV9A 2KZ7B 5A1LA 4A97A 1ZHXA 1M7KA 2V7LA 2X66A 4JI1T 5JTGA 2L9QA 1XNQT 5LJMA 4X5TA 2CE7A 2BBJA 4M1PA 5L4HA 4TWHA 3CQCB 1OSMA 5JRCB 2V7KA 4PJNA 1GFPA 4DV4T 2ODVA 4ASKA 3H37A 3Q5EA 2OLTA 4LFBT 2WSSV 2ZM6T 4AYMC 4UVAB 4H9SE 1UUSA 2H3RA 4HE8A 4C4VB 3I9YA 4NUVA 3GP6A 2W61A 5HEGA 2WAUA 1KNPA 2Y2XA 4KR4A 3H3AA 2LHNA 4V1Av 4DBRA 2NP9A 3AVRA 2DHRA 2XAQB 2BG9B 2C5KT 3AAEB 5AQTB 5IWAT 3NZQA 3AE8A 3PF1A 4AYNA 4X1IE 4DV7T 2WDRA 4MFRA 2BS3A 3EABA 1T8BA 3BQKA 5JDLA 2YPVA 1O3XA 2WP9A 2BKOA 3Q9DA 3T24A 4LF9T 1N32T 4IDZA 5ABFB 4DV1T 1V9DA 3TLUA 4U2ZA 3PUQA 5FXVA 3NBXX 3CX8B 4JI4T 1N36T 2CXFA 4ISTA 1KEYA 4H9PC 5KX5E 3POXA 3PQSA 4Z91A 2W00A 4AKRA 3FZHB 1U5PA 4YSYA 2C5IT 3EHZA 3X1DA 5H2FO 3HW9A 3BS0A 3SY9A 1GFMA 4ZXLA 4K0UA 2VURA 3ZT5A 5ABFA 3A8YC 3UQ4A 3E0ZA 2KNDA 4BA9A 3Q5DA 2EHOA 3ZT6A 4OYKA 2Y48B 4H9NC 1BR4A 3QUJA 3R84B 1ZHTA 3RRWA 5BMVE 1MPFA 2NW9A 4HKAA 3NJTA 4N75A 3HOEA 2NOXA 2CXDA 1LVKA 2ERVA 2W81C 1HS7A 1W0AA 3ETVA 1HXXA 3IEEA 2I6HA 5HAXA 3MA9A 1E1HB 3ZPOA 2XMXA 4O8SA 2CLYB 3CIRA 3AA7B 3N9NA 1YD8G 2XTRA 2WU2A 1XDOA 5HXCA 1Y64B 2CRBA 2LKHA 1PHOA 3AAAA 1EZ3A 5C2TA 2KZ7A 1NEKA 4AKGA 3K1SA 1YKEB 4JEUB 4LF6T 4L0RA 3SZDA 2M6BA 4E1SA 3AAAB 4JI0T 4EGWA 4GKKT 2AXTO 2JQKA 2R88A 4GHBA 2M06A 3PGSA 2W62A 3UU2A 4YXDA 3SY7A 4WNKA 1L0VA 5L3GB 3M65A 2XQAA 2B1EA 2X0LB 3N9MA 4IE6A 1IBKT 3KVAA 1W09A 4HTEA 3AE6A 5JDFA 3NKZA 3ZKRA 3Q2MA 3ZMUB 3LK41 3AXJA 2IIUA 4U7IA 5AQFB 1OPFA 5J2TE 5HXHA 4X20E 5LG4A 3AE2A 2D5UA 4O2AE 3AE5A 3RC8A 4H9RC 2XQ6A 2LFUA 3AE1A 5AQIB 4ANJA 2LLYA 2UXDT 4AKMA 2LT3A 4HWDA 4FQEA 1B7TA 3RKOA 1Z8UA 3ZJ2A 4LSHA 1QJ9A 3UUXB 5L2LA 1YQ3A 3VKHA 4MLKA 1WRDA 3ZMTB 5G26A 3GWHA 3K3NA 2H7VC 4P1NA 1HG2A 3PUGA 4DUZT 5HXEA 1HFAA 4X64T 1BH3A 3A0BO 4HGAA 3RYCE 3UUMA 2SPCA 1HG5A 3ZSSA 3K3QC 3PUVF 4FRXA 5GV0A 4U7YA 4QXHB 4ILUA 3KFWX 3LK2B 3SOLA 2K3WA 2YKSA 1MM4A 4UELA 3FZFB 2KINB 4UF0B 1QJ8A 1YQ4A 5DQWA 3CK6A 1WCRA 3CKDA 2KLQA 4DO0A 2E8IA 3GA8A 2E9XC 2JQQA 5JREA 2OMFA 4BJNA 4IL6O 5JDMA 2HH7A 4JYAT 5JDQA 4WYVA 3UT5E 1HNXT 2LM9A 1MNDA 4U2YA 3ANWB 3B13A 4JI2T 3LK3B 5JDPA 4NUUA 2ZLYA 4IHJE 3VZUX 4HFBA 4E1TA 4F8HA 3AA6A 2X67A 3LK3A 2GE4A 5LG3A 3OYXA 2J4GA 4GYRA 1LKXA 2BKPA 1JNRA 3POQA 2KT9A 3ZMSB 5FYMA 1H7CA 1E54A 3AAEA 3PUXF 3SRZA 2CCQA 1S5LO 5AQOB 2VASA 3RHWA 1THQA 2MHLA 2XQYA 2XPKA 2ZLDA 2L8KA 4TZ4C 3ABVA 5KMGP 4XZCA 1D0YA 5JR9A 4EAHA 3R6NA 3B57A 3KVDD 4AXPA 2D9DA 4ZZCA 2V26A 3AA6B 4EOZB 1Q9GA 1XMQT 2PORA 2JRKA 3UU8A 3TLSA 2WMNA 3C4ZA 2CHOA 4E7SA 1KF6A 4LF8T 4JFBA 4HEAA 2F1CX 4IDOA 2XSAA 2I59A 3A7MA 1S94A 2BG9A 4YTMA 2FJAA 1WYBA 5HEJA 5JDNA 2IMLA 3U3IA 2NR4A 1PRNA 2E5VA 4GF4A 2WY2A 3PU3A 2IW5B 4ZI2D 1IJ5A 4IT4A 3T1YT 3GN5B 4H9QC 4AFKA 2D2SA 4A5XA 3AA1A 2F1VA 5B5EO 2UXNB 4GYSA 3ZN1B 3POUA 1HX8A 3KBUA 4P0BA 3ONJA 3RYFE 5GTHO 4RJWA 2NTXA 5C3JA 2V1DB 4GKJT 1M62A 2FJDA 2YU1A 4Z90A 4CN6A 3ZN0B 4UV9B 4JV5T 4CXXA 4FZLA 1SE7A 3FBZA 1UX5A 3UTKA 4YTPA 3EUHA 2LOPA 4CI3B 3UU6A 4BUMX 2X9YA 5T5FA 4EEDA 4O49A 2IWVA 3MACA 3VE2A 4OFZA 2CWOA 2CMRA 3FHNA 3RX6A 1JNZA 2NW8A 3K3OA 2X0HA 4J2CA 4COFA 2LEHA 2IWWA 2WU5A 5IUXA 5HYAA 4DV6T 4KUMB 4X1KE 5FNVE 3AA7A 2YDSA 4HFCA 3ESLA 2WZIA 1H6S1 3AEBA 2RPAA 5TAOA 2E2AA 2JJ9A 3AB3B 5AFUL 2WVPA 2VKHA 2R4NA 2YEVC 1Y01A 4ISSA 3RIUC 2LHRA 4QHOA 5LMUT 3ZCIA 1GFQA 5E79O 4YSZA 1MIWA 3VRBA 5PRNA 3CQGB 4PAGA 4DV2T 1AJ3A 2N1GA 1X9BA 4DV5T 5FP3A 2V5DA 3HKCE 2JMMA 3ZYMA 1MMAA 2DL1A 2PG8A 2VQET 3TLWA
chains in the Genus database with same CATH topology
4K0UA 2DNXA 5J1GA 4FRTA 1ZV4X 5LOVE 3ZLIA 2D0UA 4FESA 4PJLA 2Y8DA 3DA3A 3E0ZA 3HKDE 4WBNE 1HXUA 4O3ZA 3N9OA 2KNDA 3N9QA 4GK0E 4EXTA 2X27X 3I1AA 4BA9A 3N9LA 4PW8A 5LP6E 3F31A 2KC0A 4GK5E 2X9WA 2HPJA 2Y6XA 3SWHA 2EHOA 3A2SX 4OYKA 4RLBA 4ZHQE 2Y48B 2O4VA 4H9NC 4ZS3A 4ZI3C 1GFOA 2W63A 1BR4A 2LSKA 3P7IA 3QUJA 1D1AA 3R84B 4ADZA 4IE4A 4O4XA 2LOSA 5JQGE 2C0SA 3ZYKA 1ZHTA 1U4QA 1LVFA 3RRWA 5JR9C 5BMVE 1MPFA 2NW9A 3O1JA 2M67A 3I9WA 4FJOA 4HKAA 4CQIA 3W15B 3HOEA 2NOXA 2LSGA 2CXDA 5FY1A 5JVDE 4X1YE 1LVKA 4Z8XA 3PQUA 5LCYA 3MKDA 4EYUA 5EK2A 2ES0A 2ERVA 2W81C 4IE5A 1HF8A 4OK0A 1HS7A 2CM0A 3ETVA 5H6RB 4WBOA 4FMSA 3SYBA 1HXXA 3F57A 3IEEA 5GONE 5HAXA 3MA9A 1E1HB 3ZPOA 2Y0LA 3C4WA 1BR1A 4AKLA 4AQGA 2XMXA 4O8SA 4AZLA 2CLYB 4H9OC 2XAHB 2KXPA 5LYJE 4IGUA 3VZWX 5LHGB 3EDVA 4EZHA 3AA7B 4AYEC 1BR2A 3N9NA 1YD8G 4KRAA 2XTRA 4FSOA 2JPFA 5HXCA 3MZKB 2C5JA 5IYUA 3O1HA 3EDUA 1Y64B 3OJAA 4KMCA 3FXEB 5ETWA 4EIWA 1PHOA 1CUNA 1ORMA 3AAAA 3MK7C 1EZ3A 3JTYA 5FY7A 2KZ7A 4AKGA 3HKBE 4TX5A 3ZEFB 4YJ3E 1YKEB 2KWHA 3C4XA 2N2LA 3JC6D 4JEUB 4PUXA 4L0RA 5FXZA 3SZDA 3SZVA 4E1SA 2KMFA 3OBVE 3HWBA 2Z6EA 3AAAB 4E7ZA 2K4TA 3C98B 1QJPA 2L3LA 5ADXK 4I50E 4D65A 3WI5A 3VY9X 3QK6A 5C8YE 5DL6A 4AYID 4GHBA 3T20A 5F8PA 1BR0A 4A56A 3TKLB 2M06A 3UPGA 3CWZB 3HL6A 2WMOA 2W62A 1ZHCA 1YKHB 4O3WA 3VHLA 3C50A 3UU2A 3UULA 5LHHB 4PK5A 3KV4A 3SY7A 2DI4A 4OHFA 4WNKA 3UFEA 4JLEA 5L3GB 3M65A 2IAKA 4CZZB 4CXWA 4L5GA 5IHYA 2QTKA 2B1EA 2X0LB 3N9MA 3RH3A 4PK4A 4UEMA 4IE6A 5DJQC 2BZBA 3KVAA 4RL9A 4HTEA 3S4UA 5JDFA 4AUIA 4BJMA 2KWIB 4MHCA 5LHIB 4RLCA 2NW7A 4H63V 2LJLA 1FMWA 5HXRA 3Q2MA 3ZMUB 3LK41 4AKIA 4G75A 1OPFA 4YLHA 3VE1A 5J2TE 4LSFA 1HCIA 4L9IA 4DVDA 5HXHA 4X20E 4O4UA 2E9XB 1G90A 4GCQA 2D0TA 2E9XD 3PURA 5LG4A 3FXDB 1QUUA 3C64A 3ZC0A 4UF0A 4B6XA 2D5UA 4YFSA 3QRAA 4O2AE 1WYCA 1KNZA 4O3XB 4HN9A 3RC8A 1D1BA 2EHOB 3HKEE 4H9RC 5IYZE 2G0UA 3D0TA 5CA0E 3WAKA 2K5BB 4C90A 2LFUA 4QKNA 2ZFGA 3RC3A 4LSEA 4ANJA 3NZPA 2X9XA 1HTJF 2MYSA 4QXCB 6PRNA 4O4IE 4UIGA 3A5XA 4AKMA 4FZMA 2LT3A 1B7TA 2WM9A 3VKGA 3RKOA 2W0GA 3VY8X 1FEWA 3RYIE 3ZJ2A 4DMWA 4LSHA 1QJ9A 5FMNA 1BXWA 2KXPB 3UUXB 5L2LA 3VKHA 2BVLA 3DTOA 3T8OA 3NSGA 4MLKA 4IIJE 2LE8A 5HXSA 2N9DA 1WRDA 3ZMTB 5L3FB 4AI6A 5G26A 2V7JA 4U9CA 3Q5WA 3GWHA 3K3NA 1VRBA 5EE2A 2H7VC 1MMGA 2MTQA 1KK7A 1SA0E 1HG2A 3PUGA 3PU8A 3PORA 4XNLA 4C91A 3K19A 5JDHA 2VKDA 5HXEA 5AFUK 2JMHA 1HFAA 3PE0A 1BH3A 2XAGB 4PFOA 4HGAA 3AA0B 1D0XA 3RYCE 3ZMZB 4TUYE 3UUMA 2SPCA 2V7MA 3QRCA 1HG5A 3HI2A 3AA1B 3K3QC 4UV8B 4FRXA 5GV0A 4QXHB 4ILUA 4MBQA 2DWGA 4DBQA 2A2FX 3KFWX 3KV5A 2DLRA 3LK2B 3MXZA 3F2EA 3SOLA 4GCPA 1UX4A 3OKQA 5LXTE 3WI4A 4G63A 1MM4A 4QX8B 2BDEA 3CVRA 4P09A 4UELA 2RP4A 4ZI3D 1ZHYA 3CX7B 4O3YA 5LBQB 3P8CD 4AKHA 2KINB 4UF0B 5LGTB 1QJ8A 4G76A 5L3BB 2YU2A 3Q5XA 3PRNA 5DQWA 2PBIA 3BQLA 3CKDA 5D5DA 2KLQA 2EHOC 4DO0A 4QWNB 4D64A 1S35A 4XAXB 4ZI2C 5FVNA 2E8IA 4HFVA 2M07A 8PRNA 3GA8A 3KV6A 1QSDA 2E9XC 4PNIA 2XE3A 3NRYA 2J1NA 2JQQA 3CQXC 2VK9A 3N2OA 2XAJB 5JREA 3ZMVB 2OMFA 2Q9QC 4AKRB 4BJNA 3GMIA 5JDMA 2HH7A 2X9HA 4FT6A 5JDQA 4UVBB 3UT5E 5HWYA 4DMVA 4PK6A 5DL7A 2LM9A 1MNDA 3IHRA 1FIOA 2LHFA 3RBHA 3FYXA 3BQIA 3HOLA 3ANWB 3LJCA 2Q9QB 3B13A 2H7OA 7PRNA 3LBXA 3LK3B 5JDPA 2GK9A 3J9X1 4NUUA 2ZLYA 3V8UA 4IHJE 1UCUA 3KINB 3AA0A 4IE7A 3VZUX 3AVSA 4XNKA 4O4LE 3VU7H 2W80C 3U78A 4KR8A 4E1TA 3MJXA 2WBLA 3AA6A 5DL5A 4O4JE 2XE2A 2IC6A 2X67A 3AAIA 3LBXB 4P0AA 1P4TA 3LK3A 2GE4A 2FGRA 2J1DG 4QXBB 3OYXA 3FBLA 4Z3TA 2XE5A 4GYRA 3KVBA 4KBMB 2NWBA 2UXXB 1LKXA 1OXZA 3ZYLA 2IC9A 1MNEA 3UUNA 4N58A 2Y7SA 1IZNA 3POQA 3CPZA 1NAFA 3PDYA 4FI5A 2MBGA 2KT9A 4IE0A 3WI3A 2K9AA 4GCSA 3ZMSB 3EMNX 3N2KE 5FYMA 4YHJA 5FXWA 1H7CA 5JH7E 1E54A 4XBFB 3N2GE 2LSJA 3AAEA 2YK0A 3SRZA 2CCQA 1ZHZA 3QC9A 3O0EA 3T0SA 2VASA 1THQA 1YW0A 2MHLA 2XQYA 5H6QB 5JRCA 2JMKA 5LNKA 2ZLDA 4ERRA 4QX7B 2L8KA 2QGSA 5EK3A 4FSPA 4TZ4C 4AQFC 5LA6E 5KMGP 2K0LA 4FOZA 2ODUA 3ONXA 2K48A 5CA1E 4XZCA 1D0YA 4PJMA 5JR9A 2P9BA 4F6RC 3OYZA 2N2MA 5DL8A 4EAHA 4MALA 3B57A 3R6NA 2XTQA 2A3DA 3ANWA 2XHEB 3C51A 3KBTA 4AXPA 4PFPA 3KVDD 1OWAA 2RA1A 3IF8B 3L09A 4EZ4A 2LSIA 1LRZA 4DNDA 1WR6A 4GOUA 5FXXA 4CI2B 2MOZA 1MM5A 3O1IA 2V26A 4JEHB 1ZKEA 5L3CB 2E9XA 3AA6B 2X51A 4O4HE 4EOZB 2ZM0A 3DP7A 4ZI7E 1GFNA 2CEAA 1Q9GA 4GIWA 2PORA 2JRKA 4I55E 3N5LA 1NWMX 2X68A 4AYDC 4F4BA 3ETUA 5DQVA 2CA5A 2WMNA 3RRCA 3C4ZA 3I0OA 4E7SA 4QQ1A 3KV9A 1IZNB 2ACXA 2OA5A 2Y0KA 4JFBA 1G73A 4HEAA 3O9XA 2KZ7B 5A1LA 1ZHXA 4I4TE 2I59A 3ZJ1A 1S94A 3UAQA 3CMLA 2V7LA 2VKJA 2X66A 1WYBA 4FZNA 1D0ZA 4ZS2A 4AQFA 3K8PC 3RPUA 5HWXA 5JDNA 3WAJA 2L9QA 4TV8E 3U3IA 2EHOD 5LJMA 1PRNA 3SYSA 4D5UA 2CE7A 1HXTA 4M1PA 4GF4A 3CQCB 1OSMA 1MIVA 1MMDA 3GN5A 2PRNA 2HPLA 5JRCB 1SHZC 2V7KA 4YJ2E 4PJNA 3PU3A 2IW5B 4ZI2D 1GFPA 1IJ5A 5LGNB 4U74A 2ODVA 4ASKA 3N9PA 4N78D 3H37A 2Q9QD 2XAFB 1YS5A 1X79A 3GN5B 2WSSV 4H9QC 1G8XA 5EK4A 4AFKA 2ZM2A 4KP3C 3RYHE 2D2SA 4AYMC 4UVAB 3ZCJA 4H9SE 3AA1A 1MIYA 2XASB 3LK42 2F1VA 2UXNB 3DA4A 3PUSA 4GYSA 5LBMA 2H3RA 2Y0HA 5EZYE 1WLXA 4HE8A 3LFMA 3I9YA 4G2AA 5FY0A 3EVYA 4NUVA 3TZGA 3ZN1B 3GP6A 1HX8A 3KBUA 2W61A 3L3PA 4P0BA 5E0OA 3RYFE 4BAYB 3NRXA 1ZHWA 2NTXA 4RJWA 2V1DB 2K24A 4I43B 2WAUA 2Y2XA 2YU1A 3JC6C 4KR4A 5J2UE 3KDSE 3H3AA 3LK2A 2LHNA 2WWUA 4V1Av 4DBRA 3C5OA 2DCFA 2NP9A 4UVCB 3AVRA 2DHRA 4UV9B 2BVMA 3ZN0B 2XAQB 2C5KT 3AAEB 3NZQA 4CXYA 4CXXA 4ZOLE 1Q9FA 3ZC1A 2F1TA 3PUAA 2FGQX 1D1CA 4FZLA 3FBZA 1UX5A 4X1IE 4AYNA 4MFRA 2J4UP 2VKOA 3UTKA 3VZTX 3G7GA 2XUEA 2XG6A 3FB2A 2VL8A 3EUHA 2LOPA 5L3DB 3DJBA 3PTRB 2CWYA 4CI3B 5KDMC 4BUMX 2X9YA 5T5FA 4TV9E 4U72A 4O49A 3O4XE 3BQKA 3MACA 3VE2A 1BT9A 2KDYA 2DWKA 4OFZA 4WW0A 5JDLA 5JR9B 1O3XA 2XTLA 2XE1A 2YPVA 4UXNB 2YINA 3BK9A 4O2BE 3POUA 1ZEEA 2CWOA 2NTYA 3Q9DA 2CMRA 4FUVA 4LSIA 1US7B 2VB6A 3FHNA 3RX6A 2LSYA 5ADXL 3T24A 2NW8A 3IBPA 2PJQA 3K3OA 4IDZA 4J2CA 2A72A 3E22E 1V9DA 4JUYA 2LEHA 4N59A 1VOMA 5CB4E 5HYAA 3PUQA 4KUMB 4X1KE 5FXVA 3NBXX 2ODJA 5FNVE 2MNHA 3AA7A 3CX8B 3E08A 3ESLA 4C69X 2CXFA 4ISTA 2ZM8A 1IJ6A 1H6S1 4JCHA 5TAOA 3LG7A 2JJ9A 3AB3B 3V5SA 5AFUL 1IAPA 4H9PC 3CX6B 2VKHA 2ZMAA 5KX5E 2YEVC 3POXA 3PQSA 2W00A 3J7Yq 2VWAA 2CLYC 5L3EB 4ISSA 4AKRA 2LHRA 4QHOA 5F3JA 5LGUB 2QA7A 1U5PA 3I0QA 4H63H 5LJNA 5M4YA 3ZCIA 1GFQA 2C5IT 1Z0PA 3HR0A 2YNKA 4EYYR 1MIWA 4CI1B 1FMVA 2Q9QA 2CXLA 3CQGB 4OYJA 4PAGA 5PRNA 4B61A 5JDGA 2N2NA 2N1GA 2PFVA 1AJ3A 3HW9A 3V5UA 4PJJA 1MMNA 5FP3A 3SS1A 4RJXA 2V7IA 3HKCE 2JMMA 3ZYMA 4TN7B 1MMAA 1T98A 3HA4A 2PG8A 3SY9A 4EB6E 5DABA 1GFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AA1 A;  5AFU K;  3AA0 B;  3AA6 A;  3LK4 1;  4AKR A;  3LK4 2;  3AAE A;  3LK3 A;  3AA1 B;  3AA6 B;  3AA7 A;  3AAA A;  3LK2 B;  4AKR B;  2KZ7 A;  2KXP B;  3LK2 A;  5AFU L;  3AAA B;  1IZN B;  5ADX L;  5ADX K;  2KZ7 B;  2KXP A;  3AAE B;  3LK3 B;  1IZN A;  3AA0 A;  3AA7 B; 
#chains in the Genus database with same CATH topology
 4FRT A;  1T16 A;  1ZV4 X;  2D0U A;  3AEC A;  4PJL A;  2Y8D A;  3DA3 A;  3HKD E;  1HXU A;  4EXT A;  2JQH A;  4PW8 A;  3F31 A;  4TNW A;  2X9W A;  2HPJ A;  4B3R T;  2O4V A;  4ZS3 A;  3RIA A;  1D1A A;  4O4X A;  4IE4 A;  2C0S A;  1LVF A;  3EAM A;  4DR4 T;  5CJ5 A;  3O1J A;  3I9W A;  4KI0 F;  3W15 B;  2LSG A;  5FY1 A;  5JVD E;  4X1Y E;  5LCY A;  3MKD A;  4EYU A;  2IHR 1;  4IE5 A;  5H6R B;  4FMS A;  2XJ7 A;  5GON E;  3UUB A;  1XDP A;  2Y0L A;  3C4W A;  1BR1 A;  1OED C;  2XAH B;  2KXP A;  3RQW A;  3VZW X;  4EZH A;  4JI3 T;  4AYE C;  4KRA A;  4HWF A;  4DUY T;  4FSO A;  3MZK B;  3O1H A;  3EDU A;  3OJA A;  3FZK B;  5ETW A;  4ILA A;  3ZEF B;  2KWH A;  4IL9 A;  2N2L A;  3JAF A;  4YSX A;  3OBV E;  3JCU O;  1T7S A;  3C98 B;  1QJP A;  4HFI A;  3DWN A;  2XQ7 A;  4D65 A;  2R6G F;  5C8Y E;  3T20 A;  4JI5 T;  3RI5 A;  4CTD A;  3UPG A;  3CWZ B;  3QB5 K;  2LRK A;  1YKH B;  5LHH B;  3KV4 A;  2AE9 A;  2DI4 A;  4OHF A;  3UFE A;  4JLE A;  3P4S A;  5IHY A;  3RH3 A;  4PK4 A;  4UEM A;  5DJQ C;  5ABG A;  2BZB A;  4KHP T;  4RL9 A;  4BJM A;  4H63 V;  2LJL A;  3RLF F;  2XSB A;  4LF5 T;  4YLH A;  3VE1 A;  5AQL B;  1G90 A;  2D0T A;  2BBH A;  3PUR A;  2BS4 A;  4EEB A;  1QUU A;  4B6X A;  3KZI O;  5KAF O;  2XM2 A;  5IYZ E;  2G0U A;  5CA0 E;  2K5B B;  4C90 A;  2ZFG A;  4LSE A;  3NZP A;  1HTJ F;  4QXC B;  4O4I E;  4U33 A;  4UIG A;  3A5X A;  4FZM A;  2WM9 A;  2UU9 T;  2W0G A;  3RYI E;  4A98 A;  4UR9 A;  3WU2 O;  4DV3 T;  3T8O A;  4JI8 T;  4DR6 T;  1OED A;  1MMG A;  3PU8 A;  3POR A;  4XNL A;  3AEE A;  2W67 A;  2H88 A;  2V7M A;  3HI2 A;  3AA1 B;  4UV8 B;  4MBQ A;  2DWG A;  2A2F X;  4GCP A;  1UX4 A;  3AE9 A;  2BDE A;  4ZI3 D;  4P09 A;  4O3Y A;  5LBQ B;  3JAE A;  3P8C D;  3P4W A;  4U3C A;  3Q5X A;  3PRN A;  3IA3 A;  3BQL A;  1DU2 A;  2EHO C;  1S35 A;  4HFV A;  2M07 A;  3KV6 A;  2JQY A;  4PNI A;  1UGO A;  3NRY A;  3CQX C;  3N2O A;  2VK9 A;  2XAJ B;  3ZMV B;  4AKR B;  5HWY A;  5DL7 A;  2WDV A;  2LHF A;  3RF1 A;  3RBH A;  3FYX A;  3LBX A;  3V8U A;  3KIN B;  4IE7 A;  3RQU A;  3AVS A;  2W80 C;  3MJX A;  2WBL A;  4O4J E;  1P4T A;  3PJA J;  1HX1 B;  3DZM A;  2FGR A;  3TLV A;  3AE3 A;  1N34 T;  2W66 A;  5CFB A;  3KVB A;  2NWB A;  2IC9 A;  1MNE A;  3UUN A;  1QLB A;  5L47 A;  4LMK A;  1WFD A;  1IZN A;  3FZL B;  4FI5 A;  3WI3 A;  3EMN X;  4IL4 A;  5FXW A;  4XBF B;  3QNU A;  1YW0 A;  5JRC A;  2CBJ A;  1ZOY A;  3H3M A;  2R8A A;  4QX7 B;  2QGS A;  1CHU A;  4FSP A;  2R4O A;  4AIS A;  3L8R A;  5LA6 E;  2K0L A;  3ONX A;  1J5E T;  4F6R C;  2N2M A;  5DL8 A;  2XTQ A;  3P4P A;  2XHE B;  3C51 A;  4EZ4 A;  1WR6 A;  2CPT A;  5FVK A;  1MM5 A;  5AQN B;  5L3C B;  1GFN A;  4O4H E;  2ZM0 A;  4TNV A;  3PV0 F;  2CA5 A;  3P4Q A;  3ONL C;  2ACX A;  2OA5 A;  1G73 A;  3O9X A;  3OVU A;  3L39 A;  2VKJ A;  1D0Z A;  4ZS2 A;  4AQF A;  3K8P C;  5HWX A;  4DR1 T;  3SYS A;  2A9U A;  4IRE A;  1HXT A;  1MMD A;  1SHZ C;  4YJ2 E;  5LGN B;  4U74 A;  3N9P A;  4N78 D;  2WWV A;  1YS5 A;  2XAF B;  2IUB A;  5EK4 A;  1W9R A;  4KP3 C;  5KXJ A;  1VCT A;  3ZCJ A;  3EI0 A;  3P4R A;  5G39 A;  2OV9 A;  3LFM A;  5FY0 A;  3EVY A;  3NWI A;  2FBW A;  4BAY B;  2J62 A;  3NRX A;  4B3M T;  2AXD S;  2K24 A;  4I43 B;  2UXB T;  5J2U E;  2H89 A;  3LK2 A;  1WR0 A;  2QYW A;  2WWU A;  3C5O A;  2XQ9 A;  2DCF A;  2HHH T;  4K3C A;  2BVM A;  2BG9 E;  2F1T A;  4ZOL E;  3ZC1 A;  3PUA A;  1D1C A;  2VKO A;  2XUE A;  2XG6 A;  5L3D B;  2VL0 A;  3DJB A;  3PTR B;  5KDM C;  2R4L A;  4U72 A;  1BT9 A;  2DWK A;  5JR9 B;  4WW0 A;  3AEF A;  2XTL A;  1N33 T;  4UXN B;  3BK9 A;  4O2B E;  1ZEE A;  2NTY A;  4FUV A;  1US7 B;  2VB6 A;  2LSY A;  3IBP A;  2A72 A;  4JUY A;  4JBW F;  1VOM A;  4UB6 O;  3VR8 A;  4C69 X;  1IJ6 A;  3CX6 B;  2ZMA A;  2VWA A;  5L3E B;  3FZM B;  5F3J A;  5LGU B;  3I0Q A;  4H63 H;  5LJN A;  5M4Y A;  3JAD A;  4EYY R;  4IDN A;  1FMV A;  2WJR A;  4OYJ A;  2N2N A;  1OED B;  3SS1 A;  2V7I A;  5HEH A;  1T98 A;  3HA4 A;  2DNX A;  5J1G A;  5LOV E;  5FL1 A;  4WBN E;  4O3Z A;  3N9O A;  3N9Q A;  4GK0 E;  2X27 X;  4DR2 T;  2WCA A;  4LF7 T;  4GK5 E;  3VRA A;  2KC0 A;  3SWH A;  4RLB A;  3A2S X;  4ZHQ E;  4ZI3 C;  2LSK A;  3LSV A;  2LOS A;  5JQG E;  3ZYK A;  1U4Q A;  5JR9 C;  4X62 T;  4PJ0 O;  4CQI A;  4QH4 A;  3UU3 A;  2F4V T;  4HWI B;  2IDO B;  5EK2 A;  2ES0 A;  2LRL A;  1HF8 A;  2CM0 A;  3F57 A;  1IBL T;  4AKL A;  4AQG A;  2HN1 A;  4B3S T;  3UQ7 A;  4AZL A;  4H9O C;  5LYJ E;  4IGU A;  3EDV A;  5TIS O;  3NVO A;  2XQ8 A;  2C5J A;  4KMC A;  5CGM A;  3FXE B;  1ORM A;  3MK7 C;  5FY7 A;  3HKB E;  4TX5 A;  3P50 A;  1T1L A;  4PUX A;  5FXZ A;  2KMF A;  4E7Z A;  2VVS A;  4I50 E;  3WI5 A;  2X0Y A;  3VY9 X;  3QK6 A;  5DL6 A;  4AYI D;  5F8P A;  1BR0 A;  4A56 A;  1ZHC A;  4O3W A;  2QRX A;  3VHL A;  5LMN T;  3QOF A;  3UUL A;  4PK5 A;  2V6Y A;  3QB5 A;  2FUP A;  3RKG A;  5FVL A;  4CXW A;  4Q25 A;  5KAI O;  1J5W A;  2BKN A;  5B66 O;  5LHI B;  2NW7 A;  3BRZ A;  1HCI A;  3OPC A;  4L9I A;  4O4U A;  4GCQ A;  2E9X D;  1OED E;  3C64 A;  3PJA A;  5HCM A;  4UF0 A;  2ACZ A;  4NXM T;  1R8I A;  4O3X B;  4HN9 A;  2EHO B;  3HKE E;  3D0T A;  3VR9 A;  3RC3 A;  2X9X A;  2MYS A;  6PRN A;  3VKG A;  3VY8 X;  2VVN A;  5FMN A;  2FJB A;  3SFE A;  1BXW A;  2KXP B;  3NSG A;  2LE8 A;  5L3F B;  2XY8 B;  4U9C A;  1VRB A;  2FJE A;  3AED A;  5EE2 A;  1E7P A;  2MTQ A;  1KK7 A;  4NPP A;  4C91 A;  5JDH A;  2VKD A;  2PTF A;  3AA0 B;  1D0X A;  4TUY E;  5L4E A;  3QRC A;  4DBQ A;  3MXZ A;  1GQE A;  4QH1 A;  3OKQ A;  5LXT E;  3WI4 A;  3CVR A;  2RP4 A;  1ZHY A;  3CX7 B;  4AKH A;  4G76 A;  5L3B B;  2I0M A;  2PBI A;  4XAX B;  8PRN A;  1QSD A;  5HCJ A;  4YHH T;  2KSR A;  5G38 A;  4HFD A;  2Q9Q C;  3GMI A;  2X9H A;  4FT6 A;  1FIO A;  3BQI A;  3LJC A;  2Q9Q B;  2H7O A;  2XQ3 A;  1FJG T;  2GK9 A;  3J9X 1;  1UCU A;  4XNK A;  3U78 A;  4KR8 A;  5DL5 A;  3AAI A;  4P0A A;  2J1D G;  4I0U A;  4Z3T A;  2XZE A;  4KX6 A;  4KHZ F;  2UXX B;  3ZYL A;  3AE7 A;  3CPZ A;  1NAF A;  3AE4 A;  3N2K E;  4YHJ A;  5JH7 E;  3N2G E;  3T0S A;  2YK0 A;  1ZHZ A;  3O0E A;  5AQP B;  4ILC A;  4HWC A;  5H6Q B;  4AQY T;  5LNK A;  5HEO A;  5EK3 A;  4AQF C;  2ODU A;  2W4X A;  4PJM A;  2P9B A;  2A3D A;  3ANW A;  1OWA A;  4AIU A;  2RA1 A;  3IF8 B;  3L09 A;  5AQJ B;  1LRZ A;  4CI2 B;  3O1I A;  3B5M A;  1ZKE A;  2B76 A;  2E9X A;  2X51 A;  2CEA A;  4GIW A;  4I55 E;  3N5L A;  4AYD C;  4F4B A;  1I6Z A;  4QQ1 A;  1NEN A;  1IZN B;  2Y0K A;  2V6X A;  4I4T E;  3ZST A;  4LFA T;  3ZJ1 A;  3UAQ A;  3CML A;  4CN4 A;  4FZN A;  3RPU A;  3WAJ A;  4TV8 E;  2EHO D;  4LML A;  5AQS B;  4D5U A;  2JIW A;  1MIV A;  3GN5 A;  2PRN A;  2HPL A;  4IDP A;  2Q9Q D;  1X79 A;  1G8X A;  2ZM2 A;  3RYH E;  4HWH A;  2CHN A;  3A0H O;  1MIY A;  3PGU A;  2XAS B;  3LK4 2;  5G3A A;  3DA4 A;  3PUS A;  5LBM A;  2Y0H A;  5EZY E;  1WLX A;  4B3T T;  4G2A A;  3TZG A;  3SZV A;  3L3P A;  5E0O A;  1ZHW A;  3JC6 C;  2CBI A;  3KDS E;  5AQM B;  4UVC B;  4ILB A;  3M3Z B;  4CXY A;  1Q9F A;  5AQQ B;  2FGQ X;  2J4U P;  3VZT X;  1UK5 A;  3G7G A;  2HN2 A;  3FB2 A;  2VL8 A;  2CWY A;  4TV9 E;  3O4X E;  2KDY A;  2XE1 A;  2YIN A;  4X66 T;  2YDR A;  4LSI A;  1UUR A;  5ADX L;  2PJQ A;  4UB8 O;  2E5L T;  5AQK B;  3E22 E;  4N59 A;  5CB4 E;  5ABH A;  4YTN A;  4LFC T;  2ODJ A;  3AXJ B;  2MNH A;  3E08 A;  4DR5 T;  2ZM8 A;  4JCH A;  1YXR A;  3LG7 A;  3V5S A;  1IAP A;  3J7Y q;  4YY3 T;  2CLY C;  4HFE A;  2QA7 A;  3HR0 A;  1Z0P A;  2YNK A;  5LB7 B;  2Q9Q A;  5AQV B;  4CI1 B;  2CXL A;  2UUA T;  4B61 A;  5JDG A;  2PFV A;  5AQU B;  4NIQ A;  3V5U A;  2V6Y B;  4PJJ A;  2LM2 A;  1MMN A;  4RJX A;  4X65 T;  4TN7 B;  4EB6 E;  5DAB A;  3ZLI A;  4FES A;  3I1A A;  3N9L A;  5LP6 E;  5ABE A;  2Y6X A;  2X9K A;  2UXC T;  1KNR A;  4DR7 T;  1GFO A;  2W63 A;  3P7I A;  2XQ5 A;  4ADZ A;  1XWM A;  2M67 A;  4FJO A;  4Z8X A;  3PQU A;  4OK0 A;  2UUC T;  2LKG A;  4WBO A;  3SYB A;  4YT0 A;  4TWF A;  4HFH A;  4ZZB A;  5LHG B;  3PUZ F;  1BR2 A;  2V8S V;  1E2A A;  4K3B A;  4C00 A;  2JPF A;  4N74 A;  5IYU A;  1XZY A;  5BR8 T;  4EIW A;  1CUN A;  3JTY A;  2YDQ A;  4YJ3 E;  5FL0 A;  3C4X A;  3JC6 D;  5GTI O;  3HWB A;  2Z6E A;  2K4T A;  4PR7 A;  2J47 A;  2L3L A;  5ADX K;  1ZP0 A;  3TKL B;  3HL6 A;  2WMO A;  2VQF T;  3C50 A;  2WB5 A;  2IAK A;  4CZZ B;  4L5G A;  2QTK A;  5AQG B;  3PUW F;  3S4U A;  3UU5 A;  4AUI A;  2KWI B;  1KFY A;  4MHC A;  4RLC A;  1FMW A;  5HXR A;  5AQH B;  4AKI A;  4G75 A;  5F5W A;  4LSF A;  4DVD A;  2E9X B;  4EV6 A;  3SFD A;  2BG9 C;  3FXD B;  3ZC0 A;  4YFS A;  3QRA A;  3RIF A;  4LF4 T;  1VCS A;  1WYC A;  1KNZ A;  1D1B A;  4DV0 T;  4JI7 T;  3WAK A;  4QKN A;  2MAW A;  1HNZ T;  2R89 A;  2W2U A;  1FEW A;  4DMW A;  3LDQ B;  2BVL A;  3DTO A;  4IIJ E;  2WDQ A;  5HXS A;  2N9D A;  4AI6 A;  2V7J A;  3Q5W A;  1SA0 E;  4U31 A;  3DWO X;  3K19 A;  5AFU K;  2JMH A;  3PE0 A;  5J0Z A;  2XAG B;  4PFO A;  1J1J A;  3ZMZ B;  2JQ9 A;  2WZH A;  1I94 T;  2WQY A;  2BS2 A;  3KV5 A;  2DLR A;  3BRY A;  3F2E A;  3AEA A;  4G63 A;  4QX8 B;  5LGT B;  2YU2 A;  2QVA A;  3UFG A;  3RGL A;  5D5D A;  4D64 A;  4QWN B;  4ZI2 C;  5FVN A;  2MPK A;  3G06 A;  2XE3 A;  2J1N A;  1XNR T;  2UUB T;  4TWD A;  2XM1 A;  4UVB B;  4DMV A;  1HNW T;  4PK6 A;  4LMJ A;  3IHR A;  3HOL A;  2YOE A;  7PRN A;  1W0B A;  4C4V A;  1HR0 T;  3AA0 A;  3RIU A;  2WJQ A;  4O4L E;  3VU7 H;  2XE2 A;  2IC6 A;  3LBX B;  1IBM T;  4QXB B;  3FBL A;  2XE5 A;  4CN1 A;  3ZT7 A;  3PGR A;  4KBM B;  4K0K T;  4DR3 T;  4NXN T;  1OXZ A;  5HEU A;  4N58 A;  3UU4 A;  4ZEY A;  2Y7S A;  2V5C A;  4IDQ A;  4DID B;  3PDY A;  2MBG A;  4IE0 A;  4GCS A;  2K9A A;  4JI6 T;  4QH5 A;  2LSJ A;  2M6I A;  3QC9 A;  2JMK A;  2XQ4 A;  4ERR A;  3TLT A;  3JCF A;  1T72 A;  2R4P A;  4FOZ A;  5CA1 E;  2K48 A;  3AEG A;  3OYZ A;  4MAL A;  1SUM B;  3KBT A;  4OX9 T;  3T1H T;  4PFP A;  1XMO T;  3OTO T;  2LSI A;  4WZX A;  4DND A;  4GOU A;  5FXX A;  2MOZ A;  2YN6 A;  5AQR B;  2WS3 A;  4JEH B;  4ZI7 E;  3DP7 A;  5FKY A;  1NWM X;  2X68 A;  3PUY F;  3ETU A;  5DQV A;  3RRC A;  3I0O A;  3KV9 A;  2KZ7 B;  5A1L A;  4A97 A;  1ZHX A;  1M7K A;  2V7L A;  2X66 A;  4JI1 T;  5JTG A;  2L9Q A;  1XNQ T;  5LJM A;  4X5T A;  2CE7 A;  2BBJ A;  4M1P A;  5L4H A;  4TWH A;  3CQC B;  1OSM A;  5JRC B;  2V7K A;  4PJN A;  1GFP A;  4DV4 T;  2ODV A;  4ASK A;  3H37 A;  3Q5E A;  2OLT A;  4LFB T;  2WSS V;  2ZM6 T;  4AYM C;  4UVA B;  4H9S E;  1UUS A;  2H3R A;  4HE8 A;  4C4V B;  3I9Y A;  4NUV A;  3GP6 A;  2W61 A;  5HEG A;  2WAU A;  1KNP A;  2Y2X A;  4KR4 A;  3H3A A;  2LHN A;  4V1A v;  4DBR A;  2NP9 A;  3AVR A;  2DHR A;  2XAQ B;  2BG9 B;  2C5K T;  3AAE B;  5AQT B;  5IWA T;  3NZQ A;  3AE8 A;  3PF1 A;  4AYN A;  4X1I E;  4DV7 T;  2WDR A;  4MFR A;  2BS3 A;  3EAB A;  1T8B A;  3BQK A;  5JDL A;  2YPV A;  1O3X A;  2WP9 A;  2BKO A;  3Q9D A;  3T24 A;  4LF9 T;  1N32 T;  4IDZ A;  5ABF B;  4DV1 T;  1V9D A;  3TLU A;  4U2Z A;  3PUQ A;  5FXV A;  3NBX X;  3CX8 B;  4JI4 T;  1N36 T;  2CXF A;  4IST A;  1KEY A;  4H9P C;  5KX5 E;  3POX A;  3PQS A;  4Z91 A;  2W00 A;  4AKR A;  3FZH B;  1U5P A;  4YSY A;  2C5I T;  3EHZ A;  3X1D A;  5H2F O;  3HW9 A;  3BS0 A;  3SY9 A;  1GFM A;  4ZXL A;  4K0U A;  2VUR A;  3ZT5 A;  5ABF A;  3A8Y C;  3UQ4 A;  3E0Z A;  2KND A;  4BA9 A;  3Q5D A;  2EHO A;  3ZT6 A;  4OYK A;  2Y48 B;  4H9N C;  1BR4 A;  3QUJ A;  3R84 B;  1ZHT A;  3RRW A;  5BMV E;  1MPF A;  2NW9 A;  4HKA A;  3NJT A;  4N75 A;  3HOE A;  2NOX A;  2CXD A;  1LVK A;  2ERV A;  2W81 C;  1HS7 A;  1W0A A;  3ETV A;  1HXX A;  3IEE A;  2I6H A;  5HAX A;  3MA9 A;  1E1H B;  3ZPO A;  2XMX A;  4O8S A;  2CLY B;  3CIR A;  3AA7 B;  3N9N A;  1YD8 G;  2XTR A;  2WU2 A;  1XDO A;  5HXC A;  1Y64 B;  2CRB A;  2LKH A;  1PHO A;  3AAA A;  1EZ3 A;  5C2T A;  2KZ7 A;  1NEK A;  4AKG A;  3K1S A;  1YKE B;  4JEU B;  4LF6 T;  4L0R A;  3SZD A;  2M6B A;  4E1S A;  3AAA B;  4JI0 T;  4EGW A;  4GKK T;  2AXT O;  2JQK A;  2R88 A;  4GHB A;  2M06 A;  3PGS A;  2W62 A;  3UU2 A;  4YXD A;  3SY7 A;  4WNK A;  1L0V A;  5L3G B;  3M65 A;  2XQA A;  2B1E A;  2X0L B;  3N9M A;  4IE6 A;  1IBK T;  3KVA A;  1W09 A;  4HTE A;  3AE6 A;  5JDF A;  3NKZ A;  3ZKR A;  3Q2M A;  3ZMU B;  3LK4 1;  3AXJ A;  2IIU A;  4U7I A;  5AQF B;  1OPF A;  5J2T E;  5HXH A;  4X20 E;  5LG4 A;  3AE2 A;  2D5U A;  4O2A E;  3AE5 A;  3RC8 A;  4H9R C;  2XQ6 A;  2LFU A;  3AE1 A;  5AQI B;  4ANJ A;  2LLY A;  2UXD T;  4AKM A;  2LT3 A;  4HWD A;  4FQE A;  1B7T A;  3RKO A;  1Z8U A;  3ZJ2 A;  4LSH A;  1QJ9 A;  3UUX B;  5L2L A;  1YQ3 A;  3VKH A;  4MLK A;  1WRD A;  3ZMT B;  5G26 A;  3GWH A;  3K3N A;  2H7V C;  4P1N A;  1HG2 A;  3PUG A;  4DUZ T;  5HXE A;  1HFA A;  4X64 T;  1BH3 A;  3A0B O;  4HGA A;  3RYC E;  3UUM A;  2SPC A;  1HG5 A;  3ZSS A;  3K3Q C;  3PUV F;  4FRX A;  5GV0 A;  4U7Y A;  4QXH B;  4ILU A;  3KFW X;  3LK2 B;  3SOL A;  2K3W A;  2YKS A;  1MM4 A;  4UEL A;  3FZF B;  2KIN B;  4UF0 B;  1QJ8 A;  1YQ4 A;  5DQW A;  3CK6 A;  1WCR A;  3CKD A;  2KLQ A;  4DO0 A;  2E8I A;  3GA8 A;  2E9X C;  2JQQ A;  5JRE A;  2OMF A;  4BJN A;  4IL6 O;  5JDM A;  2HH7 A;  4JYA T;  5JDQ A;  4WYV A;  3UT5 E;  1HNX T;  2LM9 A;  1MND A;  4U2Y A;  3ANW B;  3B13 A;  4JI2 T;  3LK3 B;  5JDP A;  4NUU A;  2ZLY A;  4IHJ E;  3VZU X;  4HFB A;  4E1T A;  4F8H A;  3AA6 A;  2X67 A;  3LK3 A;  2GE4 A;  5LG3 A;  3OYX A;  2J4G A;  4GYR A;  1LKX A;  2BKP A;  1JNR A;  3POQ A;  2KT9 A;  3ZMS B;  5FYM A;  1H7C A;  1E54 A;  3AAE A;  3PUX F;  3SRZ A;  2CCQ A;  1S5L O;  5AQO B;  2VAS A;  3RHW A;  1THQ A;  2MHL A;  2XQY A;  2XPK A;  2ZLD A;  2L8K A;  4TZ4 C;  3ABV A;  5KMG P;  4XZC A;  1D0Y A;  5JR9 A;  4EAH A;  3R6N A;  3B57 A;  3KVD D;  4AXP A;  2D9D A;  4ZZC A;  2V26 A;  3AA6 B;  4EOZ B;  1Q9G A;  1XMQ T;  2POR A;  2JRK A;  3UU8 A;  3TLS A;  2WMN A;  3C4Z A;  2CHO A;  4E7S A;  1KF6 A;  4LF8 T;  4JFB A;  4HEA A;  2F1C X;  4IDO A;  2XSA A;  2I59 A;  3A7M A;  1S94 A;  2BG9 A;  4YTM A;  2FJA A;  1WYB A;  5HEJ A;  5JDN A;  2IML A;  3U3I A;  2NR4 A;  1PRN A;  2E5V A;  4GF4 A;  2WY2 A;  3PU3 A;  2IW5 B;  4ZI2 D;  1IJ5 A;  4IT4 A;  3T1Y T;  3GN5 B;  4H9Q C;  4AFK A;  2D2S A;  4A5X A;  3AA1 A;  2F1V A;  5B5E O;  2UXN B;  4GYS A;  3ZN1 B;  3POU A;  1HX8 A;  3KBU A;  4P0B A;  3ONJ A;  3RYF E;  5GTH O;  4RJW A;  2NTX A;  5C3J A;  2V1D B;  4GKJ T;  1M62 A;  2FJD A;  2YU1 A;  4Z90 A;  4CN6 A;  3ZN0 B;  4UV9 B;  4JV5 T;  4CXX A;  4FZL A;  1SE7 A;  3FBZ A;  1UX5 A;  3UTK A;  4YTP A;  3EUH A;  2LOP A;  4CI3 B;  3UU6 A;  4BUM X;  2X9Y A;  5T5F A;  4EED A;  4O49 A;  2IWV A;  3MAC A;  3VE2 A;  4OFZ A;  2CWO A;  2CMR A;  3FHN A;  3RX6 A;  1JNZ A;  2NW8 A;  3K3O A;  2X0H A;  4J2C A;  4COF A;  2LEH A;  2IWW A;  2WU5 A;  5IUX A;  5HYA A;  4DV6 T;  4KUM B;  4X1K E;  5FNV E;  3AA7 A;  2YDS A;  4HFC A;  3ESL A;  2WZI A;  1H6S 1;  3AEB A;  2RPA A;  5TAO A;  2E2A A;  2JJ9 A;  3AB3 B;  5AFU L;  2WVP A;  2VKH A;  2R4N A;  2YEV C;  1Y01 A;  4ISS A;  3RIU C;  2LHR A;  4QHO A;  5LMU T;  3ZCI A;  1GFQ A;  5E79 O;  4YSZ A;  1MIW A;  3VRB A;  5PRN A;  3CQG B;  4PAG A;  4DV2 T;  1AJ3 A;  2N1G A;  1X9B A;  4DV5 T;  5FP3 A;  2V5D A;  3HKC E;  2JMM A;  3ZYM A;  1MMA A;  2DL1 A;  2PG8 A;  2VQE T;  3TLW A; 
#chains in the Genus database with same CATH homology
 4K0U A;  2DNX A;  5J1G A;  4FRT A;  1ZV4 X;  5LOV E;  3ZLI A;  2D0U A;  4FES A;  4PJL A;  2Y8D A;  3DA3 A;  3E0Z A;  3HKD E;  4WBN E;  1HXU A;  4O3Z A;  3N9O A;  2KND A;  3N9Q A;  4GK0 E;  4EXT A;  2X27 X;  3I1A A;  4BA9 A;  3N9L A;  4PW8 A;  5LP6 E;  3F31 A;  2KC0 A;  4GK5 E;  2X9W A;  2HPJ A;  2Y6X A;  3SWH A;  2EHO A;  3A2S X;  4OYK A;  4RLB A;  4ZHQ E;  2Y48 B;  2O4V A;  4H9N C;  4ZS3 A;  4ZI3 C;  1GFO A;  2W63 A;  1BR4 A;  2LSK A;  3P7I A;  3QUJ A;  1D1A A;  3R84 B;  4ADZ A;  4IE4 A;  4O4X A;  2LOS A;  5JQG E;  2C0S A;  3ZYK A;  1ZHT A;  1U4Q A;  1LVF A;  3RRW A;  5JR9 C;  5BMV E;  1MPF A;  2NW9 A;  3O1J A;  2M67 A;  3I9W A;  4FJO A;  4HKA A;  4CQI A;  3W15 B;  3HOE A;  2NOX A;  2LSG A;  2CXD A;  5FY1 A;  5JVD E;  4X1Y E;  1LVK A;  4Z8X A;  3PQU A;  5LCY A;  3MKD A;  4EYU A;  5EK2 A;  2ES0 A;  2ERV A;  2W81 C;  4IE5 A;  1HF8 A;  4OK0 A;  1HS7 A;  2CM0 A;  3ETV A;  5H6R B;  4WBO A;  4FMS A;  3SYB A;  1HXX A;  3F57 A;  3IEE A;  5GON E;  5HAX A;  3MA9 A;  1E1H B;  3ZPO A;  2Y0L A;  3C4W A;  1BR1 A;  4AKL A;  4AQG A;  2XMX A;  4O8S A;  4AZL A;  2CLY B;  4H9O C;  2XAH B;  2KXP A;  5LYJ E;  4IGU A;  3VZW X;  5LHG B;  3EDV A;  4EZH A;  3AA7 B;  4AYE C;  1BR2 A;  3N9N A;  1YD8 G;  4KRA A;  2XTR A;  4FSO A;  2JPF A;  5HXC A;  3MZK B;  2C5J A;  5IYU A;  3O1H A;  3EDU A;  1Y64 B;  3OJA A;  4KMC A;  3FXE B;  5ETW A;  4EIW A;  1PHO A;  1CUN A;  1ORM A;  3AAA A;  3MK7 C;  1EZ3 A;  3JTY A;  5FY7 A;  2KZ7 A;  4AKG A;  3HKB E;  4TX5 A;  3ZEF B;  4YJ3 E;  1YKE B;  2KWH A;  3C4X A;  2N2L A;  3JC6 D;  4JEU B;  4PUX A;  4L0R A;  5FXZ A;  3SZD A;  3SZV A;  4E1S A;  2KMF A;  3OBV E;  3HWB A;  2Z6E A;  3AAA B;  4E7Z A;  2K4T A;  3C98 B;  1QJP A;  2L3L A;  5ADX K;  4I50 E;  4D65 A;  3WI5 A;  3VY9 X;  3QK6 A;  5C8Y E;  5DL6 A;  4AYI D;  4GHB A;  3T20 A;  5F8P A;  1BR0 A;  4A56 A;  3TKL B;  2M06 A;  3UPG A;  3CWZ B;  3HL6 A;  2WMO A;  2W62 A;  1ZHC A;  1YKH B;  4O3W A;  3VHL A;  3C50 A;  3UU2 A;  3UUL A;  5LHH B;  4PK5 A;  3KV4 A;  3SY7 A;  2DI4 A;  4OHF A;  4WNK A;  3UFE A;  4JLE A;  5L3G B;  3M65 A;  2IAK A;  4CZZ B;  4CXW A;  4L5G A;  5IHY A;  2QTK A;  2B1E A;  2X0L B;  3N9M A;  3RH3 A;  4PK4 A;  4UEM A;  4IE6 A;  5DJQ C;  2BZB A;  3KVA A;  4RL9 A;  4HTE A;  3S4U A;  5JDF A;  4AUI A;  4BJM A;  2KWI B;  4MHC A;  5LHI B;  4RLC A;  2NW7 A;  4H63 V;  2LJL A;  1FMW A;  5HXR A;  3Q2M A;  3ZMU B;  3LK4 1;  4AKI A;  4G75 A;  1OPF A;  4YLH A;  3VE1 A;  5J2T E;  4LSF A;  1HCI A;  4L9I A;  4DVD A;  5HXH A;  4X20 E;  4O4U A;  2E9X B;  1G90 A;  4GCQ A;  2D0T A;  2E9X D;  3PUR A;  5LG4 A;  3FXD B;  1QUU A;  3C64 A;  3ZC0 A;  4UF0 A;  4B6X A;  2D5U A;  4YFS A;  3QRA A;  4O2A E;  1WYC A;  1KNZ A;  4O3X B;  4HN9 A;  3RC8 A;  1D1B A;  2EHO B;  3HKE E;  4H9R C;  5IYZ E;  2G0U A;  3D0T A;  5CA0 E;  3WAK A;  2K5B B;  4C90 A;  2LFU A;  4QKN A;  2ZFG A;  3RC3 A;  4LSE A;  4ANJ A;  3NZP A;  2X9X A;  1HTJ F;  2MYS A;  4QXC B;  6PRN A;  4O4I E;  4UIG A;  3A5X A;  4AKM A;  4FZM A;  2LT3 A;  1B7T A;  2WM9 A;  3VKG A;  3RKO A;  2W0G A;  3VY8 X;  1FEW A;  3RYI E;  3ZJ2 A;  4DMW A;  4LSH A;  1QJ9 A;  5FMN A;  1BXW A;  2KXP B;  3UUX B;  5L2L A;  3VKH A;  2BVL A;  3DTO A;  3T8O A;  3NSG A;  4MLK A;  4IIJ E;  2LE8 A;  5HXS A;  2N9D A;  1WRD A;  3ZMT B;  5L3F B;  4AI6 A;  5G26 A;  2V7J A;  4U9C A;  3Q5W A;  3GWH A;  3K3N A;  1VRB A;  5EE2 A;  2H7V C;  1MMG A;  2MTQ A;  1KK7 A;  1SA0 E;  1HG2 A;  3PUG A;  3PU8 A;  3POR A;  4XNL A;  4C91 A;  3K19 A;  5JDH A;  2VKD A;  5HXE A;  5AFU K;  2JMH A;  1HFA A;  3PE0 A;  1BH3 A;  2XAG B;  4PFO A;  4HGA A;  3AA0 B;  1D0X A;  3RYC E;  3ZMZ B;  4TUY E;  3UUM A;  2SPC A;  2V7M A;  3QRC A;  1HG5 A;  3HI2 A;  3AA1 B;  3K3Q C;  4UV8 B;  4FRX A;  5GV0 A;  4QXH B;  4ILU A;  4MBQ A;  2DWG A;  4DBQ A;  2A2F X;  3KFW X;  3KV5 A;  2DLR A;  3LK2 B;  3MXZ A;  3F2E A;  3SOL A;  4GCP A;  1UX4 A;  3OKQ A;  5LXT E;  3WI4 A;  4G63 A;  1MM4 A;  4QX8 B;  2BDE A;  3CVR A;  4P09 A;  4UEL A;  2RP4 A;  4ZI3 D;  1ZHY A;  3CX7 B;  4O3Y A;  5LBQ B;  3P8C D;  4AKH A;  2KIN B;  4UF0 B;  5LGT B;  1QJ8 A;  4G76 A;  5L3B B;  2YU2 A;  3Q5X A;  3PRN A;  5DQW A;  2PBI A;  3BQL A;  3CKD A;  5D5D A;  2KLQ A;  2EHO C;  4DO0 A;  4QWN B;  4D64 A;  1S35 A;  4XAX B;  4ZI2 C;  5FVN A;  2E8I A;  4HFV A;  2M07 A;  8PRN A;  3GA8 A;  3KV6 A;  1QSD A;  2E9X C;  4PNI A;  2XE3 A;  3NRY A;  2J1N A;  2JQQ A;  3CQX C;  2VK9 A;  3N2O A;  2XAJ B;  5JRE A;  3ZMV B;  2OMF A;  2Q9Q C;  4AKR B;  4BJN A;  3GMI A;  5JDM A;  2HH7 A;  2X9H A;  4FT6 A;  5JDQ A;  4UVB B;  3UT5 E;  5HWY A;  4DMV A;  4PK6 A;  5DL7 A;  2LM9 A;  1MND A;  3IHR A;  1FIO A;  2LHF A;  3RBH A;  3FYX A;  3BQI A;  3HOL A;  3ANW B;  3LJC A;  2Q9Q B;  3B13 A;  2H7O A;  7PRN A;  3LBX A;  3LK3 B;  5JDP A;  2GK9 A;  3J9X 1;  4NUU A;  2ZLY A;  3V8U A;  4IHJ E;  1UCU A;  3KIN B;  3AA0 A;  4IE7 A;  3VZU X;  3AVS A;  4XNK A;  4O4L E;  3VU7 H;  2W80 C;  3U78 A;  4KR8 A;  4E1T A;  3MJX A;  2WBL A;  3AA6 A;  5DL5 A;  4O4J E;  2XE2 A;  2IC6 A;  2X67 A;  3AAI A;  3LBX B;  4P0A A;  1P4T A;  3LK3 A;  2GE4 A;  2FGR A;  2J1D G;  4QXB B;  3OYX A;  3FBL A;  4Z3T A;  2XE5 A;  4GYR A;  3KVB A;  4KBM B;  2NWB A;  2UXX B;  1LKX A;  1OXZ A;  3ZYL A;  2IC9 A;  1MNE A;  3UUN A;  4N58 A;  2Y7S A;  1IZN A;  3POQ A;  3CPZ A;  1NAF A;  3PDY A;  4FI5 A;  2MBG A;  2KT9 A;  4IE0 A;  3WI3 A;  2K9A A;  4GCS A;  3ZMS B;  3EMN X;  3N2K E;  5FYM A;  4YHJ A;  5FXW A;  1H7C A;  5JH7 E;  1E54 A;  4XBF B;  3N2G E;  2LSJ A;  3AAE A;  2YK0 A;  3SRZ A;  2CCQ A;  1ZHZ A;  3QC9 A;  3O0E A;  3T0S A;  2VAS A;  1THQ A;  1YW0 A;  2MHL A;  2XQY A;  5H6Q B;  5JRC A;  2JMK A;  5LNK A;  2ZLD A;  4ERR A;  4QX7 B;  2L8K A;  2QGS A;  5EK3 A;  4FSP A;  4TZ4 C;  4AQF C;  5LA6 E;  5KMG P;  2K0L A;  4FOZ A;  2ODU A;  3ONX A;  2K48 A;  5CA1 E;  4XZC A;  1D0Y A;  4PJM A;  5JR9 A;  2P9B A;  4F6R C;  3OYZ A;  2N2M A;  5DL8 A;  4EAH A;  4MAL A;  3B57 A;  3R6N A;  2XTQ A;  2A3D A;  3ANW A;  2XHE B;  3C51 A;  3KBT A;  4AXP A;  4PFP A;  3KVD D;  1OWA A;  2RA1 A;  3IF8 B;  3L09 A;  4EZ4 A;  2LSI A;  1LRZ A;  4DND A;  1WR6 A;  4GOU A;  5FXX A;  4CI2 B;  2MOZ A;  1MM5 A;  3O1I A;  2V26 A;  4JEH B;  1ZKE A;  5L3C B;  2E9X A;  3AA6 B;  2X51 A;  4O4H E;  4EOZ B;  2ZM0 A;  3DP7 A;  4ZI7 E;  1GFN A;  2CEA A;  1Q9G A;  4GIW A;  2POR A;  2JRK A;  4I55 E;  3N5L A;  1NWM X;  2X68 A;  4AYD C;  4F4B A;  3ETU A;  5DQV A;  2CA5 A;  2WMN A;  3RRC A;  3C4Z A;  3I0O A;  4E7S A;  4QQ1 A;  3KV9 A;  1IZN B;  2ACX A;  2OA5 A;  2Y0K A;  4JFB A;  1G73 A;  4HEA A;  3O9X A;  2KZ7 B;  5A1L A;  1ZHX A;  4I4T E;  2I59 A;  3ZJ1 A;  1S94 A;  3UAQ A;  3CML A;  2V7L A;  2VKJ A;  2X66 A;  1WYB A;  4FZN A;  1D0Z A;  4ZS2 A;  4AQF A;  3K8P C;  3RPU A;  5HWX A;  5JDN A;  3WAJ A;  2L9Q A;  4TV8 E;  3U3I A;  2EHO D;  5LJM A;  1PRN A;  3SYS A;  4D5U A;  2CE7 A;  1HXT A;  4M1P A;  4GF4 A;  3CQC B;  1OSM A;  1MIV A;  1MMD A;  3GN5 A;  2PRN A;  2HPL A;  5JRC B;  1SHZ C;  2V7K A;  4YJ2 E;  4PJN A;  3PU3 A;  2IW5 B;  4ZI2 D;  1GFP A;  1IJ5 A;  5LGN B;  4U74 A;  2ODV A;  4ASK A;  3N9P A;  4N78 D;  3H37 A;  2Q9Q D;  2XAF B;  1YS5 A;  1X79 A;  3GN5 B;  2WSS V;  4H9Q C;  1G8X A;  5EK4 A;  4AFK A;  2ZM2 A;  4KP3 C;  3RYH E;  2D2S A;  4AYM C;  4UVA B;  3ZCJ A;  4H9S E;  3AA1 A;  1MIY A;  2XAS B;  3LK4 2;  2F1V A;  2UXN B;  3DA4 A;  3PUS A;  4GYS A;  5LBM A;  2H3R A;  2Y0H A;  5EZY E;  1WLX A;  4HE8 A;  3LFM A;  3I9Y A;  4G2A A;  5FY0 A;  3EVY A;  4NUV A;  3TZG A;  3ZN1 B;  3GP6 A;  1HX8 A;  3KBU A;  2W61 A;  3L3P A;  4P0B A;  5E0O A;  3RYF E;  4BAY B;  3NRX A;  1ZHW A;  2NTX A;  4RJW A;  2V1D B;  2K24 A;  4I43 B;  2WAU A;  2Y2X A;  2YU1 A;  3JC6 C;  4KR4 A;  5J2U E;  3KDS E;  3H3A A;  3LK2 A;  2LHN A;  2WWU A;  4V1A v;  4DBR A;  3C5O A;  2DCF A;  2NP9 A;  4UVC B;  3AVR A;  2DHR A;  4UV9 B;  2BVM A;  3ZN0 B;  2XAQ B;  2C5K T;  3AAE B;  3NZQ A;  4CXY A;  4CXX A;  4ZOL E;  1Q9F A;  3ZC1 A;  2F1T A;  3PUA A;  2FGQ X;  1D1C A;  4FZL A;  3FBZ A;  1UX5 A;  4X1I E;  4AYN A;  4MFR A;  2J4U P;  2VKO A;  3UTK A;  3VZT X;  3G7G A;  2XUE A;  2XG6 A;  3FB2 A;  2VL8 A;  3EUH A;  2LOP A;  5L3D B;  3DJB A;  3PTR B;  2CWY A;  4CI3 B;  5KDM C;  4BUM X;  2X9Y A;  5T5F A;  4TV9 E;  4U72 A;  4O49 A;  3O4X E;  3BQK A;  3MAC A;  3VE2 A;  1BT9 A;  2KDY A;  2DWK A;  4OFZ A;  4WW0 A;  5JDL A;  5JR9 B;  1O3X A;  2XTL A;  2XE1 A;  2YPV A;  4UXN B;  2YIN A;  3BK9 A;  4O2B E;  3POU A;  1ZEE A;  2CWO A;  2NTY A;  3Q9D A;  2CMR A;  4FUV A;  4LSI A;  1US7 B;  2VB6 A;  3FHN A;  3RX6 A;  2LSY A;  5ADX L;  3T24 A;  2NW8 A;  3IBP A;  2PJQ A;  3K3O A;  4IDZ A;  4J2C A;  2A72 A;  3E22 E;  1V9D A;  4JUY A;  2LEH A;  4N59 A;  1VOM A;  5CB4 E;  5HYA A;  3PUQ A;  4KUM B;  4X1K E;  5FXV A;  3NBX X;  2ODJ A;  5FNV E;  2MNH A;  3AA7 A;  3CX8 B;  3E08 A;  3ESL A;  4C69 X;  2CXF A;  4IST A;  2ZM8 A;  1IJ6 A;  1H6S 1;  4JCH A;  5TAO A;  3LG7 A;  2JJ9 A;  3AB3 B;  3V5S A;  5AFU L;  1IAP A;  4H9P C;  3CX6 B;  2VKH A;  2ZMA A;  5KX5 E;  2YEV C;  3POX A;  3PQS A;  2W00 A;  3J7Y q;  2VWA A;  2CLY C;  5L3E B;  4ISS A;  4AKR A;  2LHR A;  4QHO A;  5F3J A;  5LGU B;  2QA7 A;  1U5P A;  3I0Q A;  4H63 H;  5LJN A;  5M4Y A;  3ZCI A;  1GFQ A;  2C5I T;  1Z0P A;  3HR0 A;  2YNK A;  4EYY R;  1MIW A;  4CI1 B;  1FMV A;  2Q9Q A;  2CXL A;  3CQG B;  4OYJ A;  4PAG A;  5PRN A;  4B61 A;  5JDG A;  2N2N A;  2N1G A;  2PFV A;  1AJ3 A;  3HW9 A;  3V5U A;  4PJJ A;  1MMN A;  5FP3 A;  3SS1 A;  4RJX A;  2V7I A;  3HKC E;  2JMM A;  3ZYM A;  4TN7 B;  1MMA A;  1T98 A;  3HA4 A;  2PG8 A;  3SY9 A;  4EB6 E;  5DAB A;  1GFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...