5AFUL

Cryo-em structure of dynein tail-dynactin-bicd2n complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
270
structure length
270
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVDVIPDNPKFQQLQRELSQVLTQRQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DYNEIN TAIL
publication title The Structure of the Dynactin Complex and its Interaction with Dynein.
pubmed doi rcsb
molecule tags Motor protein
total genus 71
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5afuL01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 5afuL02
4AKRA 1IZNB 3LK2B 3AA7A 3AA1B 5ADXL 1IZNA 3AAEB 3LK2A 3AA1A 2KZ7B 3AAEA 2KZ7A 3LK42 3AA6B 5AFUK 3AA0B 3LK41 3AA6A 3AA0A 2KXPB 2KXPA 5AFUL 3LK3B 3AAAB 3AAAA 3LK3A 5ADXK 4AKRB 3AA7B
chains in the Genus database with same CATH superfamily
3UUMA 4UV9B 2FGRA 5IYUA 5LJMA 2XHEB 2V26A 4LSHA 1QUUA 4PR7A 3GWHA 4FQEA 3F57A 3L3PA 4M1PA 3NZPA 4PJJA 1NEKA 2BS3A 1MIYA 4EEDA 2X9YA 3UUXB 4ISSA 2AE9A 4DV6T 4BJNA 2LHFA 4ILAA 4GHBA 1Z0PA 3NRYA 1T7SA 5IWAT 2BZBA 2VWAA 3POQA 1IJ5A 3FB2A 2C5IT 5ETWA 5AQTB 4YSXA 4LF7T 2WBLA 1YXRA 5JDNA 2H3RA 4L9IA 4H9PC 5FY1A 5AQPB 3VRAA 2QTKA 5G39A 4UR9A 3E22E 5GTIO 3CQCB 3VR8A 4X5TA 1H7CA 3RX6A 4RJXA 2CM0A 4ZHQE 2XE3A 4N75A 4OHFA 4PFPA 3AVSA 3KV9A 3N9PA 3A0HO 5LBMA 3WI4A 4QQ1A 2FBWA 4WYVA 3V5UA 1ZP0A 1E54A 2NOXA 3CQXC 4C4VB 3KVBA 3ZEFB 1US7B 2X51A 3IHRA 3PV0F 3E0ZA 3SY7A 4U7YA 3AE7A 2KXPA 1Q9FA 1BXWA 2R4PA 3E08A 2MNHA 2XQ5A 3LK3A 5L47A 3O1HA 2H7OA 4YTMA 4NUVA 4PNIA 1CHUA 4LF4T 2XQ6A 1U5PA 3EUHA 5HEJA 4YJ3E 1ORMA 3K3QC 2E9XC 5FKYA 4FESA 5FY0A 5HEUA 3FZMB 4DUYT 2Y0HA 2YDSA 1HX8A 1JNZA 1U4QA 4X62T 1ZHZA 2IWVA 2LOSA 2PFVA 2VL0A 4QWNB 2LRLA 4FRTA 4YSYA 2ZM0A 1QJ8A 5JDFA 3FZLB 2KMFA 2E9XD 3AEBA 2Q9QA 3SFEA 3T1HT 3CPZA 1SA0E 3ZYLA 1Y01A 4QKNA 3VRBA 3TLTA 4AFKA 2X68A 3EABA 5JRCA 1LVKA 3AAEB 3O1IA 3BS0A 4FZMA 1Z8UA 3FZKB 2UUBT 4KP3C 1J1JA 4Z91A 3RIUC 5HEGA 3PUZF 3P4RA 4CI2B 2RP4A 2WMNA 2XY8B 3AECA 2EHOC 4QH5A 3HKEE 2N2LA 2MBGA 4UF0B 3I9WA 3RLFF 4IDNA 1HCIA 4HGAA 1M62A 1WRDA 5LHHB 3A2SX 2D0TA 2A3DA 1G73A 3P7IA 3P4PA 4NIQA 3SYSA 2MYSA 4B61A 3PQSA 4EOZB 2LJLA 1XDPA 4P1NA 2M07A 2Y0KA 4AYID 4UVAB 2CLYC 3TLSA 2JQYA 3AEGA 4G76A 1D1CA 3DWOX 2XE5A 2NTXA 3P8CD 4I50E 4BUMX 4GCPA 3NKZA 3I1AA 4LMJA 2MPKA 4H9QC 2J4GA 2WCAA 2CPTA 4HWIB 2XE2A 4B3ST 2X66A 3UU6A 4IE4A 3N9MA 4IE6A 3PJAA 4D65A 1M7KA 3A7MA 4CN4A 4FOZA 3VZWX 3OYZA 4UELA 2R89A 4O8SA 4EZ4A 2MOZA 3OKQA 2M6IA 4U74A 2D9DA 3C4ZA 3NRXA 1GFOA 2CXFA 2X9WA 4Z90A 1VCSA 2WZHA 4JI5T 4FJOA 3K1SA 5LMNT 4IE5A 1MIVA 4LF8T 4XZCA 4K0KT 4AUIA 1IBMT 3RYHE 5ADXK 5JTGA 2BKOA 3KZIO 5FP3A 4DR6T 4O3XB 3AA1B 4KI0F 3PTRB 2XSAA 4RLCA 2R6GF 1HNZT 1UX4A 2P9BA 3B57A 2B1EA 4H9RC 5HXHA 4LF6T 3C50A 3AAAB 3P4QA 5GV0A 5KXJA 1MMDA 4E1SA 4L5GA 2RPAA 4ILUA 5HCJA 2XQ9A 3UQ4A 4U2YA 2E5LT 4H9SE 3UFGA 3ZJ1A 4U3CA 1XDOA 2ES0A 1GFQA 3VE2A 5PRNA 5ABHA 5F3JA 3S4UA 1H6S1 1D0XA 1YQ3A 3JTYA 2CBIA 4HFHA 5JR9B 2CEAA 4JI6T 4G63A 3MZKB 2C5KT 4FSOA 5AQUB 2BKNA 5CB4E 4C91A 4ILCA 3SZVA 5H6QB 3Q5XA 3LDQB 3ESLA 3GN5A 1HS7A 1E2AA 4NXMT 1HFAA 3FBLA 4TV8E 4B3MT 2W80C 1FEWA 1ZHTA 1FMWA 3RGLA 3B13A 1UUSA 2CE7A 4TUYE 3JAFA 3PGRA 2X9XA 5DL5A 3ZCJA 1OPFA 3HR0A 4DV5T 4B6XA 3RKOA 4O4LE 4OK0A 2CXLA 4TWDA 6PRNA 3F31A 2V7MA 2KNDA 1MMAA 3I0OA 1XWMA 2XASB 3TLWA 3VR9A 2KZ7A 2MHLA 4YHHT 4U31A 1BR2A 5AQIB 2BBJA 2KXPB 2VURA 3X1DA 1W9RA 3QOFA 3LK3B 2VL8A 4TWHA 5KMGP 3GA8A 2XQ3A 4HFCA 3UPGA 3PGUA 3LBXA 2CWOA 3JAEA 4H63V 4KX6A 3SY9A 3OPCA 3BRYA 5J0ZA 3AE6A 4DR3T 4UEMA 4ZOLE 3AA0A 4JFBA 4QXCB 2ODVA 1SHZC 5AQJB 4JLEA 4YLHA 2N2NA 3VE1A 3OJAA 1KNPA 3RIUA 3T24A 5DL7A 2N9DA 2ZMAA 2DL1A 2BDEA 5L3DB 5HCMA 2IWWA 2WY2A 3JADA 2Q9QB 1KNZA 2EHOA 4NPPA 5DL8A 4UVBB 2JQKA 3RH3A 5JVDE 1HX1B 5JRCB 3C4XA 3PURA 4LSIA 3AEEA 4AISA 4HWFA 3NWIA 5AQSB 5F8PA 5FVLA 2L3LA 2YKSA 2J62A 1YW0A 2KSRA 3Q2MA 1S94A 3FZHB 4UV8B 2IDOB 4CTDA 5AQGB 2W66A 3F2EA 3M65A 2NWBA 5AQLB 2LRKA 4RLBA 5LCYA 1CUNA 3CKDA 4YT0A 2ZM2A 3UU5A 4D64A 4F8HA 2XUEA 5AFUL 2DCFA 3PDYA 3C4WA 2HPLA 2GK9A 2X0HA 1HNWT 2LLYA 2I59A 2XAHB 5L4HA 5AQKB 4RJWA 4LSFA 3QRAA 4AKMA 4GK5E 4X64T 3ZSSA 4EIWA 3NZQA 2Y48B 2PTFA 5L3BB 2QRXA 2AXTO 5AQRB 2W67A 4JUYA 4QX7B 4DR5T 2YNKA 3QB5K 5HXRA 2CBJA 5AQQB 3PUSA 4AYDC 4HFBA 3W15B 1QJ9A 3SZDA 5JDMA 4X65T 5DABA 5HYAA 2Y2XA 2QVAA 5LMUT 3UU2A 5FL1A 3TZGA 1IJ6A 2WDQA 2WVPA 2VKJA 5JR9A 3ZT5A 2PORA 4L0RA 4XNLA 4WZXA 5KAIO 4C90A 3MK7C 4E7SA 4WW0A 3PJAJ 2XTLA 3SOLA 4YTNA 3CX8B 3N9QA 5LOVE 2CMRA 3HKBE 4IT4A 3T8OA 4ANJA 2BBHA 5CJ5A 4O2AE 4AZLA 4LF5T 3HKDE 5EE2A 2UXDT 1JNRA 3ZC0A 2V7KA 4OYJA 3PORA 2X0YA 2ODUA 5JQGE 2UXNB 3EMNX 4X20E 3LK2A 3BQIA 1OEDC 4A97A 5L3EB 1I94T 1N34T 3MACA 3ZLIA 2WWUA 4YFSA 1B7TA 2HN2A 4I55E 4PK4A 4FMSA 2F1CX 2FGQX 2BVLA 5IUXA 5ABEA 2X67A 4O4JE 3ZMTB 2LM9A 5LGUB 3LFMA 2SPCA 5FL0A 1HXXA 5ADXL 3MJXA 2PJQA 5LBQB 2ERVA 5AQNB 3RPUA 1KFYA 3PU3A 4DMWA 5TISO 4I4TE 4IGUA 4ZI3C 3GN5B 4XAXB 2KINB 2G0UA 4IDOA 3ZMUB 4CQIA 2CA5A 3HI2A 2KLQA 5KAFO 3M3ZB 3KVDD 1W09A 3PUAA 1XNQT 1FIOA 3O4XE 3ANWB 4WBOA 2WWVA 5CA0E 3AE2A 2C0SA 4TNVA 3PF1A 2LEHA 4O4UA 5EK4A 2H7VC 2LM2A 4ZI3D 2V5CA 4E7ZA 2KZ7B 4CN1A 2KT9A 2HHHT 3VHLA 3ZCIA 4FUVA 2BS4A 3POUA 3POXA 3TLUA 5LG4A 2E5VA 4MBQA 3KV4A 2KWIB 3LBXB 4O4IE 3ZN1B 3DWNA 4TV9E 1QSDA 1J5ET 3AA0B 4H63H 4GK0E 4IREA 2BVMA 1J5WA 3HA4A 3RBHA 3KV5A 2WJRA 3ONXA 2OLTA 5HWXA 2DWKA 4JI7T 3LJCA 2J1NA 4CZZB 2YK0A 3RIAA 4IE7A 3I0QA 2V5DA 2CHOA 4UIGA 2EHOB 4FSPA 1X9BA 3WAKA 2VKOA 2NW8A 5A1LA 3RC8A 4AXPA 2IIUA 3CX7B 1QLBA 2J47A 4HFDA 1XNRT 3DZMA 3AXJA 1IZNA 3RF1A 4U72A 4AYEC 4JBWF 3MA9A 4O49A 5HEHA 1HF8A 1YKHB 3ZT7A 2V1DB 4ZS2A 5FMNA 2F1TA 2JMMA 4DVDA 5M4YA 3T20A 2ACXA 1EZ3A 5F5WA 1N36T 3DTOA 3ZSTA 4DV1T 4DV3T 4MHCA 4AKRA 1BR1A 4AKHA 5L4EA 2Y7SA 4AQGA 4O3ZA 4N74A 2JIWA 2M6BA 3NSGA 5LA6E 3HOLA 4I43B 8PRNA 3ETVA 4ADZA 3IF8B 3PUYF 5AQMB 4CI1B 4DR2T 3OBVE 4B3TT 2LSGA 1WR0A 1ZEEA 3PUQA 3WAJA 3K8PC 5FXWA 3ONLC 2W63A 1YS5A 5FXVA 1HR0T 1BR4A 4QXBB 2W62A 4EEBA 1OWAA 2LSKA 3RYIE 3C98B 2D5UA 1T1LA 2Y6XA 3AAIA 4P09A 2VKHA 3ZPOA 5JH7E 3CQGB 3LG7A 2IHR1 3TLVA 2BG9C 5GONE 4OYKA 2JPFA 4JI0T 4MALA 4QHOA 5AQOB 2W81C 5FNVE 3KDSE 3EDUA 4GOUA 1NAFA 1E1HB 3LSVA 4O2BE 3PUGA 2WSSV 5HAXA 2ODJA 4TNWA 2XQ4A 2JQQA 4D5UA 3VU7H 3QK6A 2UU9T 3K19A 3JC6C 1IAPA 4F6RC 4GCQA 3UQ7A 3FXEB 4WBNE 4BAYB 2C5JA 3PGSA 4HE8A 1ZHYA 1XZYA 3C51A 3UULA 1PRNA 3D0TA 1OEDA 2ZFGA 4NXNT 3AEAA 5C3JA 3Q5EA 1D1BA 1ZHXA 3HOEA 2JMKA 4UB6O 1HNXT 4DO0A 7PRNA 4WNKA 2LSYA 2LOPA 3JC6D 1MM4A 1LRZA 3VZTX 5JDLA 3G7GA 1HG5A 3SWHA 3ANWA 4Z3TA 4ERRA 3AE4A 2JJ9A 3ZT6A 2CRBA 2E9XA 4AIUA 5AQVB 1E7PA 1WFDA 3CVRA 4LSEA 3HL6A 3QB5A 3PUXF 2JMHA 4QXHB 4X66T 2MTQA 4EGWA 4CXXA 3LK2B 4IDPA 5LNKA 5H2FO 4AI6A 1KF6A 4JEUB 1BH3A 1VRBA 3UAQA 2XAGB 4EAHA 4AQFC 3KBUA 2K4TA 2NR4A 3AE9A 2XQYA 1BT9A 4YSZA 3QNUA 3SYBA 1X79A 1THQA 4HN9A 2HH7A 1SE7A 5E79O 2AXDS 3PU8A 4CI3B 3AE1A 1P4TA 4ZXLA 2YDQA 3EDVA 5B66O 4YY3T 1I6ZA 4YJ2E 3L09A 2WDVA 3HKCE 2X9HA 4TWFA 4C69X 2RA1A 3AE3A 2Q9QC 4DNDA 4DBQA 1PHOA 2IUBA 4PW8A 2XAQB 4ZI7E 2L9QA 4IDZA 3P50A 2LE8A 2DHRA 2XJ7A 2WP9A 3N2OA 5LXTE 3UUNA 4O3YA 3NJTA 5HWYA 2XM1A 3RHWA 1MPFA 2FJDA 1ZV4X 1N33T 3KVAA 2LFUA 2Q9QD 2A72A 5CGMA 3ABVA 4ASKA 4AKGA 2XAFB 2BKPA 2UXXB 3AE5A 4QH1A 5KX5E 3K3NA 3T1YT 3OTOT 5GTHO 3BQKA 4PJ0O 4ZEYA 3EHZA 5EK3A 2LKGA 2K5BB 3Q9DA 4UXNB 4P0AA 4YTPA 3LK41 4DBRA 1HXUA 3Q5WA 4JYAT 4HWCA 3UFEA 1OXZA 4F4BA 3C64A 1GQEA 3IEEA 4AYMC 3ONJA 2KDYA 4BA9A 1XMOT 2YOEA 4QH4A 5AQHB 5JDQA 2XTQA 1VCTA 1R8IA 2XE1A 1GFPA 4JCHA 5LG3A 1D1AA 4DMVA 3P4WA 5HXCA 1IBLT 1MIWA 4H9NC 4KMCA 2XQAA 1MNEA 4U2ZA 1HTJF 1T72A 1UCUA 2PG8A 3QC9A 3AXJB 1IZNB 4ZZCA 3UU3A 2Z6EA 1UURA 4KBMB 4H9OC 1YKEB 5EZYE 2QYWA 3V8UA 5H6RB 2V8SV 2N2MA 5LJNA 3ZYKA 1S35A 5DQVA 3PQUA 4GKKT 4HTEA 3CX6B 4AKRB 3K3OA 2LKHA 2CWYA 2FJEA 4N58A 4U7IA 5HXEA 3CMLA 4J2CA 2BG9A 3NVOA 2DLRA 4Q25A 2UUAT 3VY8X 2R4NA 4TX5A 4YHJA 1OSMA 2X0LB 2BS2A 2W0GA 1G90A 3QUJA 2IC6A 4HWDA 2PBIA 1XMQT 4OX9T 4XBFB 2VASA 3N5LA 3VZUX 3AA7A 3L39A 2OMFA 3Q5DA 5JDHA 3AVRA 3ZMSB 3UUBA 2F1VA 1WR6A 2YU2A 4N78D 5ABGA 2XQ8A 4IL9A 4A56A 2NW7A 4HFIA 2CXDA 1T16A 1ZHWA 1MM5A 3KFWX 2DI4A 3ZC1A 3C5OA 2R88A 4ZS3A 2ZLDA 3SFDA 3FXDB 3G06A 5LP6E 3AA6B 3RKGA 2FJAA 3AE8A 2DNXA 1SUMB 1L0VA 3DA3A 2OV9A 2XZEA 3H3MA 1HXTA 3V5SA 5IYZE 1KEYA 4BJMA 2HN1A 4JI4T 2YDRA 5EK2A 3IA3A 4IIJE 5LGTB 2ZLYA 3BRZA 2E8IA 4LFBT 4HKAA 3NBXX 2R4LA 1OEDB 3WU2O 5T5FA 2V6YA 2A2FX 1O3XA 2LSIA 5G3AA 4KUMB 1LVFA 5HEOA 2H88A 4HFEA 5G38A 2K24A 4KRAA 4AQFA 3PUVF 4UB8O 1KNRA 3L8RA 2E9XB 2VVNA 2L8KA 2R8AA 4CXYA 4FI5A 3AB3B 3ZKRA 1Q9GA 1MMNA 3R6NA 1FMVA 3VKGA 4JI3T 5J1GA 2MAWA 4JI2T 3FZFB 3H3AA 1W0BA 4XNKA 2WM9A 5AFUK 5L2LA 5FXXA 4DR7T 3PRNA 4I0UA 2X9KA 4P0BA 1IBKT 1UK5A 4RL9A 1ZOYA 2I6HA 3A0BO 4IDQA 4X1IE 2QA7A 5ABFB 4KHZF 1YD8G 4JEHB 4EXTA 3CK6A 3UU4A 1Y64B 2VK9A 4IL4A 4EYYR 1DU2A 4TZ4C 5LGNB 5CA1E 2A9UA 1MMGA 2N1GA 2YN6A 2YEVC 2WB5A 3ZYMA 5LB7B 4PAGA 5G26A 2DWGA 4PJLA 4PK6A 2ACZA 4COFA 3KBTA 4YXDA 2NW9A 2K48A 3ZJ2A 5DQWA 4ZI2C 4G2AA 3FHNA 1ZHCA 4EZHA 2IMLA 1WLXA 4AKLA 5J2TE 3RQUA 2XTRA 4FZLA 4Z8XA 1D0YA 5FVKA 1NENA 1V9DA 5HXSA 5KDMC 5L3FB 5JDPA 4PUXA 4FZNA 2JQHA 2Y0LA 2EHOD 4LF9T 2WDRA 2CCQA 5B5EO 4FT6A 2Y8DA 4ZI2D 4MLKA 4KR8A 2CLYB 3A5XA 4MFRA 3U78A 2J1DG 1W0AA 2V6XA 2I0MA 2V7LA 3HW9A 4ILBA 1WCRA 4IL6O 3HWBA 2JRKA 2VVSA 4UVCB 2WQYA 4GYSA 2XMXA 2ZM8A 3BK9A 2GE4A 3PE0A 3ETUA 1T98A 1OEDE 5AQFB 2UXBT 3KV6A 3WI5A 4NUUA 2KC0A 5FY7A 2V7IA 2M06A 2IAKA 4O4HE 1WYBA 3N2KE 5L3GB 2YU1A 4A5XA 3FBZA 3GMIA 2VKDA 5BR8T 5J2UE 2F4VT 4U9CA 2WJQA 2NTYA 4LFAT 1QJPA 1WYCA 2HPJA 2K9AA 2LT3A 3DP7A 2W61A 3UT5E 4GCSA 2LSJA 3AA6A 2E2AA 4AYNA 1AJ3A 4V1Av 4HEAA 3ZMVB 5JR9C 1UX5A 2IC9A 4CN6A 3CIRA 3ZMZB 3VKHA 1HG2A 2FJBA 4DV0T 4CXWA 3UU8A 2IW5B 4C4VA 2BG9B 3DA4A 4FRXA 1UGOA 2D0UA 1G8XA 2VQET 3EAMA 3VY9X 4GIWA 3RRWA 4PFOA 3JCFA 4ISTA 3AA7B 4IE0A 3FYXA 5DL6A 4X1KE 3SRZA 4HFVA 4G75A 3QRCA 4DV4T 1LKXA 4GYRA 3OYXA 3H37A 2XPKA 5FYMA 5C8YE 3O1JA 3T0SA 2X27X 5CFBA 2K3WA 4PJNA 3RI5A 2PRNA 3N9NA 2M67A 2OA5A 3J7Yq 3LK42 1BR0A 5LHIB 2JQ9A 5D5DA 4DV2T 4LMKA 4AKIA 1NWMX 4DIDB 2V7JA 4LFCT 2VB6A 2FUPA 2NP9A 4EV6A 1N32T 4LMLA 5ABFA 3AAEA 2J4UP 4K3CA 4B3RT 3R84B 2YINA 5TAOA 3RYCE 4JI1T 3PUWF 2V6YB 2ZM6T 4DUZT 5C2TA 5LHGB 1ZKEA 3U3IA 4DV7T 4AQYT 4UF0A 2LHNA 4KR4A 5FXZA 4PJMA 3P4SA 3N9LA 3SS1A 2XQ7A 1YQ4A 5JREA 4JI8T 2H89A 3AEDA 4GF4A 3CWZB 2WMOA 4K0UA 3ZN0B 3EVYA 5FVNA 1KK7A 3RRCA 5LYJE 3JCUO 4PK5A 3GP6A 2XG6A 2QGSA 4OFZA 3N9OA 1FJGT 1GFNA 3KINB 2CHNA 3BQLA 1VOMA 3IBPA 2WZIA 3RQWA 4X1YE 3RIFA 4EB6E 2R4OA 2XSBA 2VQFT 4QX8B 4DR1T 4KHPT 1S5LO 2UUCT 2BG9E 3RC3A 3RYFE 4TN7B 3DJBA 2W00A 2KWHA 4ZZBA 3UTKA 5L3CB 2B76A 2K0LA 3OVUA 2XM2A 5DJQC 2YPVA 5IHYA 2W4XA 4N59A 4EYUA 4U33A 3MXZA 2WU2A 3O0EA 3MKDA 5E0OA 3WI3A 4DR4T 2LHRA 4A98A 5JDGA 1T8BA 1D0ZA 4O4XA 3TKLB 4JV5T 3AA1A 3A8YC 2D2SA 2UXCT 3B5MA 2XAJB 4GKJT 2WAUA 3N2GE 3O9XA 3AEFA 2O4VA 4IHJE 2WU5A 4C00A 4K3BA 4HWHA 5BMVE 4O3WA 1MNDA 2W2UA 4E1TA 3AAAA 2WS3A 1GFMA 3I9YA 3J9X1 3EI0A
chains in the Genus database with same CATH topology
1FMVA 3UUMA 3VKGA 3UPGA 5J1GA 1YS5A 3LBXA 2CWOA 4UV9B 5FXVA 2FGRA 4H63V 5IYUA 3H3AA 2XHEB 1BR4A 5LJMA 2V26A 4QXBB 2W62A 1QUUA 4LSHA 4XNKA 3GWHA 3SY9A 1OWAA 2LSKA 2WM9A 5AFUK 3RYIE 5L2LA 3C98B 3F57A 5FXXA 4UEMA 3PRNA 3L3PA 4ZOLE 2D5UA 3AA0A 4JFBA 4M1PA 4P0BA 2Y6XA 3NZPA 4PJJA 3AAIA 4QXCB 2ODVA 1MIYA 1SHZC 4JLEA 2VKHA 4P09A 4RL9A 3ZPOA 2X9YA 3CQGB 3LG7A 4YLHA 5JH7E 2N2NA 3VE1A 3UUXB 3OJAA 4ISSA 5GONE 3T24A 4X1IE 5DL7A 2QA7A 2N9DA 4OYKA 2JPFA 2ZMAA 4BJNA 2LHFA 4MALA 4QHOA 1Z0PA 4GHBA 3NRYA 1YD8G 4JEHB 4EXTA 2W81C 5FNVE 3KDSE 2BDEA 2BZBA 3EDUA 2VWAA 3POQA 1Y64B 4GOUA 5L3DB 1NAFA 1E1HB 2VK9A 1IJ5A 4EYYR 2Q9QB 1KNZA 2EHOA 3FB2A 2C5IT 4O2BE 4TZ4C 5ETWA 2WBLA 3PUGA 5LGNB 5DL8A 5JDNA 2H3RA 4L9IA 5CA1E 2WSSV 4UVBB 4H9PC 5FY1A 3RH3A 5JVDE 5HAXA 1MMGA 2N1GA 2ODJA 2YEVC 2QTKA 2JQQA 4D5UA 3VU7H 3ZYMA 5JRCB 3C4XA 3QK6A 3E22E 3PURA 4PAGA 5G26A 2DWGA 4LSIA 3K19A 3JC6C 1IAPA 3CQCB 4PJLA 4PK6A 4F6RC 4GCQA 3KBTA 1H7CA 3FXEB 4WBNE 2NW9A 3RX6A 2K48A 3ZJ2A 4BAYB 2C5JA 4HE8A 4RJXA 5DQWA 1ZHYA 2CM0A 4ZHQE 2XE3A 4ZI2C 3C51A 5F8PA 4G2AA 4OHFA 3UULA 4PFPA 1PRNA 3FHNA 1ZHCA 3D0TA 4EZHA 3AVSA 2L3LA 1WLXA 3KV9A 4AKLA 3N9PA 5J2TE 1YW0A 5LBMA 2XTRA 3Q2MA 2ZFGA 4FZLA 4QQ1A 1S94A 3WI4A 3V5UA 4Z8XA 1D0YA 4UV8B 1D1BA 1ZHXA 1E54A 1V9DA 2NOXA 3F2EA 3HOEA 3M65A 2JMKA 2NWBA 5HXSA 5KDMC 5L3FB 4PUXA 5JDPA 4RLBA 3CQXC 4FZNA 5LCYA 2Y0LA 4DO0A 2EHOD 3KVBA 7PRNA 3ZEFB 1US7B 1CUNA 2LSYA 2LOPA 3JC6D 4WNKA 1MM4A 1LRZA 2X51A 3VZTX 5JDLA 3IHRA 1HG5A 3G7GA 3CKDA 2CCQA 3ANWA 3SWHA 4Z3TA 2ZM2A 4ERRA 4FT6A 3E0ZA 2JJ9A 2Y8DA 3SY7A 4D64A 4ZI2D 4MLKA 2KXPA 2XUEA 5AFUL 1Q9FA 2E9XA 4KR8A 2CLYB 3A5XA 1BXWA 3E08A 2DCFA 2MNHA 3PDYA 3CVRA 3C4WA 4MFRA 3HL6A 2H7OA 2J1DG 3O1HA 2JMHA 4NUVA 4PNIA 4QXHB 3U78A 2MTQA 2HPLA 2GK9A 1U5PA 4CXXA 2V7LA 3HW9A 3EUHA 3LK2B 4YJ3E 2I59A 2XAHB 1ORMA 3K3QC 3HWBA 2E9XC 2JRKA 4FESA 5FY0A 5LNKA 4UVCB 4RJWA 4LSEA 4AI6A 4LSFA 3QRAA 4GYSA 2XMXA 2Y0HA 4JEUB 2ZM8A 3BK9A 1BH3A 2GE4A 1VRBA 4AKMA 1HX8A 4GK5E 3PE0A 3ETUA 3UAQA 2XAGB 4EIWA 1T98A 3NZQA 4EAHA 4AQFC 3KBUA 2K4TA 2Y48B 1U4QA 1BT9A 2XQYA 5L3BB 1ZHZA 3KV6A 2LOSA 4JUYA 2PFVA 3SYBA 1X79A 4QWNB 4QX7B 2YNKA 4NUUA 3WI5A 1THQA 2KC0A 4HN9A 2HH7A 4FRTA 5FY7A 2V7IA 2M06A 5HXRA 2IAKA 2ZM0A 1QJ8A 3PU8A 5JDFA 4CI3B 4O4HE 1WYBA 3N2KE 3PUSA 5L3GB 2KMFA 2YU1A 1P4TA 4AYDC 2E9XD 3EDVA 3W15B 1QJ9A 3FBZA 3GMIA 2Q9QA 2VKDA 3SZDA 5J2UE 4U9CA 4YJ2E 5JDMA 5DABA 3CPZA 1SA0E 3ZYLA 5HYAA 2Y2XA 3L09A 3HKCE 2X9HA 4QKNA 2NTYA 4AFKA 4C69X 2X68A 2RA1A 3UU2A 1QJPA 3TZGA 5JRCA 2Q9QC 4DNDA 1IJ6A 4DBQA 1PHOA 1LVKA 4PW8A 3AAEB 3O1IA 4FZMA 2VKJA 1WYCA 2HPJA 2K9AA 2LT3A 2XAQB 3DP7A 5JR9A 4ZI7E 2L9QA 2W61A 4IDZA 4KP3C 2LE8A 3UT5E 4GCSA 2LSJA 2PORA 3AA6A 2DHRA 4L0RA 4XNLA 4AYNA 1AJ3A 4C90A 4CI2B 4V1Av 4HEAA 2RP4A 3ZMVB 2WMNA 3N2OA 5JR9C 3MK7C 4E7SA 1UX5A 4WW0A 3UUNA 5LXTE 2IC9A 4O3YA 3ZMZB 2XTLA 1HG2A 5HWYA 3VKHA 2EHOC 4CXWA 1MPFA 1ZV4X 3SOLA 3HKEE 3KVAA 2IW5B 2MBGA 2N2LA 4UF0B 2LFUA 2Q9QD 3I9WA 3CX8B 1HCIA 2A72A 3N9QA 3LK3A 4ASKA 3DA4A 4FRXA 4HGAA 4AKGA 5LOVE 2XAFB 2CMRA 2D0UA 3HKBE 3T8OA 4ANJA 1WRDA 5LHHB 3A2SX 1G8XA 2UXXB 5KX5E 2D0TA 3VY9X 4GIWA 2A3DA 3K3NA 4O2AE 1G73A 3P7IA 4AZLA 3RRWA 3HKDE 5EE2A 3SYSA 2MYSA 4PFOA 3ZC0A 3BQKA 2V7KA 4ISTA 3PQSA 3AA7B 4B61A 4OYJA 3PORA 2ODUA 5JQGE 2UXNB 4IE0A 3EMNX 5EK3A 3FYXA 4EOZB 2LJLA 4X20E 3LK2A 5DL6A 2K5BB 3BQIA 3Q9DA 2M07A 5L3EB 2Y0KA 4UXNB 4UVAB 4AYID 2CLYC 4P0AA 3MACA 4X1KE 2WWUA 4HFVA 3SRZA 3ZLIA 3LK41 3QRCA 4G75A 4DBRA 4YFSA 1LKXA 1HXUA 4GYRA 3OYXA 3Q5WA 1B7TA 4FMSA 4I55E 4PK4A 3UFEA 3H37A 4G76A 1OXZA 1D1CA 2FGQX 2BVLA 5FYMA 5C8YE 4F4BA 3O1JA 3T0SA 3C64A 3IEEA 2X27X 4AYMC 2X67A 4O4JE 3ZMTB 2XE5A 2LM9A 2KDYA 2NTXA 4PJNA 3P8CD 4I50E 4BUMX 4BA9A 5LGUB 2PRNA 4GCPA 3LFMA 2SPCA 3I1AA 2XTQA 5JDQA 3N9NA 1HXXA 5ADXL 3MJXA 2PJQA 4H9QC 2M67A 2OA5A 5LBQB 1GFPA 2XE1A 3J7Yq 2ERVA 4JCHA 3RPUA 2XE2A 3LK42 2X66A 3PU3A 4IE4A 3N9MA 1D1AA 4DMWA 4DMVA 4IE6A 1BR0A 5LHIB 4D65A 5D5DA 5HXCA 4I4TE 4IGUA 4FOZA 4ZI3C 3VZWX 3OYZA 3GN5B 1MIWA 4XAXB 1NWMX 2KINB 4AKIA 2G0UA 4H9NC 4KMCA 4UELA 2V7JA 3ZMUB 2VB6A 2CA5A 4O8SA 4CQIA 2NP9A 1MNEA 4EZ4A 1HTJF 2MOZA 1UCUA 2PG8A 2KLQA 3HI2A 3OKQA 3QC9A 4U74A 1IZNB 3KVDD 3C4ZA 3NRXA 2Z6EA 3PUAA 4KBMB 4H9OC 1YKEB 1FIOA 1GFOA 3O4XE 3ANWB 4WBOA 3AAEA 2CXFA 2X9WA 5CA0E 2J4UP 2C0SA 3R84B 2YINA 5EZYE 4FJOA 5TAOA 3RYCE 2LEHA 3V8UA 4IE5A 5H6RB 2N2MA 1MIVA 4O4UA 5LJNA 4XZCA 5EK4A 2H7VC 3ZYKA 1S35A 5DQVA 4AUIA 5LHGB 3RYHE 3PQUA 1ZKEA 5ADXK 3U3IA 4HTEA 4ZI3D 3CX6B 4AKRB 3K3OA 5FP3A 2CWYA 4N58A 4O3XB 3AA1B 5HXEA 4E7ZA 2KZ7B 3PTRB 4UF0A 3CMLA 4J2CA 2LHNA 2KT9A 4RLCA 1UX4A 3VY8X 2DLRA 4KR4A 5FXZA 3VHLA 2P9BA 4PJMA 4TX5A 3N9LA 3B57A 4YHJA 3SS1A 3ZCIA 2B1EA 4H9RC 1OSMA 5HXHA 4FUVA 2X0LB 3POUA 3C50A 2W0GA 1G90A 3QUJA 2IC6A 3POXA 3AAAB 5JREA 5LG4A 5GV0A 1MMDA 4E1SA 2PBIA 4L5GA 4GF4A 3CWZB 4XBFB 2VASA 2WMOA 3KV4A 4K0UA 4MBQA 4ILUA 2KWIB 3LBXB 3ZN0B 3N5LA 3VZUX 3EVYA 3AA7A 4O4IE 3ZN1B 5FVNA 4H9SE 3ZJ1A 1KK7A 3RRCA 2OMFA 5LYJE 4TV9E 4PK5A 3GP6A 2XG6A 1QSDA 2QGSA 3AVRA 5JDHA 3AA0B 4OFZA 3ZMSB 2ES0A 4H63H 4GK0E 2F1VA 1WR6A 3N9OA 2BVMA 1GFNA 3HA4A 2YU2A 4N78D 3KINB 3KV5A 1GFQA 3RBHA 3BQLA 4A56A 3VE2A 2NW7A 1VOMA 5PRNA 3ONXA 3S4UA 2CXDA 3IBPA 5F3JA 1ZHWA 4X1YE 3KFWX 1D0XA 4EB6E 1H6S1 1MM5A 2DI4A 3JTYA 3ZC1A 3C5OA 5HWXA 2DWKA 5JR9B 2J1NA 3LJCA 4ZS3A 4CZZB 2CEAA 2YK0A 2ZLDA 4G63A 4QX8B 3MZKB 2C5KT 3FXDB 4IE7A 3I0QA 4FSOA 5LP6E 4UIGA 2EHOB 3AA6B 4FSPA 5CB4E 3RC3A 3RYFE 4C91A 4TN7B 3DJBA 2DNXA 3WAKA 3SZVA 3DA3A 5H6QB 2W00A 3Q5XA 2VKOA 2NW8A 5A1LA 3RC8A 1HXTA 4AXPA 2KWHA 3V5SA 3CX7B 3ESLA 3GN5A 1HS7A 5IYZE 3UTKA 4BJMA 5L3CB 1HFAA 3FBLA 4TV8E 2W80C 1FEWA 2K0LA 1IZNA 5DJQC 4U72A 5EK2A 1ZHTA 4AYEC 3MA9A 1FMWA 4O49A 4IIJE 5LGTB 2YPVA 5IHYA 2ZLYA 1HF8A 1YKHB 3B13A 2V1DB 2CE7A 2E8IA 4TUYE 4ZS2A 5FMNA 4HKAA 2X9XA 3NBXX 4DVDA 5M4YA 4EYUA 2F1TA 2JMMA 4N59A 3MXZA 5DL5A 3ZCJA 1OPFA 3T20A 2ACXA 5T5FA 3HR0A 1EZ3A 3O0EA 2A2FX 1O3XA 2LSIA 3DTOA 3MKDA 5E0OA 3WI3A 4KUMB 4B6XA 2LHRA 3RKOA 1LVFA 4O4LE 4MHCA 4OK0A 2CXLA 4AKRA 5JDGA 6PRNA 1BR1A 2V7MA 3F31A 4AKHA 1D0ZA 2Y7SA 4O4XA 2KNDA 3TKLB 2K24A 4AQGA 4AQFA 3AA1A 4KRAA 1MMAA 4O3ZA 2D2SA 3I0OA 3NSGA 2XASB 5LA6E 2KZ7A 2MHLA 3HOLA 4I43B 8PRNA 2XAJB 2WAUA 3ETVA 1BR2A 3N2GE 4ADZA 3O9XA 2O4VA 4IHJE 3IF8B 2KXPB 4CI1B 2E9XB 5BMVE 2L8KA 3OBVE 4O3WA 3LK3B 1MNDA 4CXYA 2VL8A 4FI5A 2LSGA 4E1TA 1ZEEA 5KMGP 3AAAA 3PUQA 3AB3B 3K8PC 3WAJA 1GFMA 5FXWA 3GA8A 3I9YA 1Q9GA 3J9X1 1MMNA 3R6NA 2W63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AKR A;  1IZN B;  3LK2 B;  3AA7 A;  3AA1 B;  5ADX L;  1IZN A;  3AAE B;  3LK2 A;  3AA1 A;  2KZ7 B;  3AAE A;  2KZ7 A;  3LK4 2;  3AA6 B;  5AFU K;  3AA0 B;  3LK4 1;  3AA6 A;  3AA0 A;  2KXP B;  2KXP A;  5AFU L;  3LK3 B;  3AAA B;  3AAA A;  3LK3 A;  5ADX K;  4AKR B;  3AA7 B; 
#chains in the Genus database with same CATH topology
 3UUM A;  4UV9 B;  2FGR A;  5IYU A;  5LJM A;  2XHE B;  2V26 A;  4LSH A;  1QUU A;  4PR7 A;  3GWH A;  4FQE A;  3F57 A;  3L3P A;  4M1P A;  3NZP A;  4PJJ A;  1NEK A;  2BS3 A;  1MIY A;  4EED A;  2X9Y A;  3UUX B;  4ISS A;  2AE9 A;  4DV6 T;  4BJN A;  2LHF A;  4ILA A;  4GHB A;  1Z0P A;  3NRY A;  1T7S A;  5IWA T;  2BZB A;  2VWA A;  3POQ A;  1IJ5 A;  3FB2 A;  2C5I T;  5ETW A;  5AQT B;  4YSX A;  4LF7 T;  2WBL A;  1YXR A;  5JDN A;  2H3R A;  4L9I A;  4H9P C;  5FY1 A;  5AQP B;  3VRA A;  2QTK A;  5G39 A;  4UR9 A;  3E22 E;  5GTI O;  3CQC B;  3VR8 A;  4X5T A;  1H7C A;  3RX6 A;  4RJX A;  2CM0 A;  4ZHQ E;  2XE3 A;  4N75 A;  4OHF A;  4PFP A;  3AVS A;  3KV9 A;  3N9P A;  3A0H O;  5LBM A;  3WI4 A;  4QQ1 A;  2FBW A;  4WYV A;  3V5U A;  1ZP0 A;  1E54 A;  2NOX A;  3CQX C;  4C4V B;  3KVB A;  3ZEF B;  1US7 B;  2X51 A;  3IHR A;  3PV0 F;  3E0Z A;  3SY7 A;  4U7Y A;  3AE7 A;  2KXP A;  1Q9F A;  1BXW A;  2R4P A;  3E08 A;  2MNH A;  2XQ5 A;  3LK3 A;  5L47 A;  3O1H A;  2H7O A;  4YTM A;  4NUV A;  4PNI A;  1CHU A;  4LF4 T;  2XQ6 A;  1U5P A;  3EUH A;  5HEJ A;  4YJ3 E;  1ORM A;  3K3Q C;  2E9X C;  5FKY A;  4FES A;  5FY0 A;  5HEU A;  3FZM B;  4DUY T;  2Y0H A;  2YDS A;  1HX8 A;  1JNZ A;  1U4Q A;  4X62 T;  1ZHZ A;  2IWV A;  2LOS A;  2PFV A;  2VL0 A;  4QWN B;  2LRL A;  4FRT A;  4YSY A;  2ZM0 A;  1QJ8 A;  5JDF A;  3FZL B;  2KMF A;  2E9X D;  3AEB A;  2Q9Q A;  3SFE A;  3T1H T;  3CPZ A;  1SA0 E;  3ZYL A;  1Y01 A;  4QKN A;  3VRB A;  3TLT A;  4AFK A;  2X68 A;  3EAB A;  5JRC A;  1LVK A;  3AAE B;  3O1I A;  3BS0 A;  4FZM A;  1Z8U A;  3FZK B;  2UUB T;  4KP3 C;  1J1J A;  4Z91 A;  3RIU C;  5HEG A;  3PUZ F;  3P4R A;  4CI2 B;  2RP4 A;  2WMN A;  2XY8 B;  3AEC A;  2EHO C;  4QH5 A;  3HKE E;  2N2L A;  2MBG A;  4UF0 B;  3I9W A;  3RLF F;  4IDN A;  1HCI A;  4HGA A;  1M62 A;  1WRD A;  5LHH B;  3A2S X;  2D0T A;  2A3D A;  1G73 A;  3P7I A;  3P4P A;  4NIQ A;  3SYS A;  2MYS A;  4B61 A;  3PQS A;  4EOZ B;  2LJL A;  1XDP A;  4P1N A;  2M07 A;  2Y0K A;  4AYI D;  4UVA B;  2CLY C;  3TLS A;  2JQY A;  3AEG A;  4G76 A;  1D1C A;  3DWO X;  2XE5 A;  2NTX A;  3P8C D;  4I50 E;  4BUM X;  4GCP A;  3NKZ A;  3I1A A;  4LMJ A;  2MPK A;  4H9Q C;  2J4G A;  2WCA A;  2CPT A;  4HWI B;  2XE2 A;  4B3S T;  2X66 A;  3UU6 A;  4IE4 A;  3N9M A;  4IE6 A;  3PJA A;  4D65 A;  1M7K A;  3A7M A;  4CN4 A;  4FOZ A;  3VZW X;  3OYZ A;  4UEL A;  2R89 A;  4O8S A;  4EZ4 A;  2MOZ A;  3OKQ A;  2M6I A;  4U74 A;  2D9D A;  3C4Z A;  3NRX A;  1GFO A;  2CXF A;  2X9W A;  4Z90 A;  1VCS A;  2WZH A;  4JI5 T;  4FJO A;  3K1S A;  5LMN T;  4IE5 A;  1MIV A;  4LF8 T;  4XZC A;  4K0K T;  4AUI A;  1IBM T;  3RYH E;  5ADX K;  5JTG A;  2BKO A;  3KZI O;  5FP3 A;  4DR6 T;  4O3X B;  3AA1 B;  4KI0 F;  3PTR B;  2XSA A;  4RLC A;  2R6G F;  1HNZ T;  1UX4 A;  2P9B A;  3B57 A;  2B1E A;  4H9R C;  5HXH A;  4LF6 T;  3C50 A;  3AAA B;  3P4Q A;  5GV0 A;  5KXJ A;  1MMD A;  4E1S A;  4L5G A;  2RPA A;  4ILU A;  5HCJ A;  2XQ9 A;  3UQ4 A;  4U2Y A;  2E5L T;  4H9S E;  3UFG A;  3ZJ1 A;  4U3C A;  1XDO A;  2ES0 A;  1GFQ A;  3VE2 A;  5PRN A;  5ABH A;  5F3J A;  3S4U A;  1H6S 1;  1D0X A;  1YQ3 A;  3JTY A;  2CBI A;  4HFH A;  5JR9 B;  2CEA A;  4JI6 T;  4G63 A;  3MZK B;  2C5K T;  4FSO A;  5AQU B;  2BKN A;  5CB4 E;  4C91 A;  4ILC A;  3SZV A;  5H6Q B;  3Q5X A;  3LDQ B;  3ESL A;  3GN5 A;  1HS7 A;  1E2A A;  4NXM T;  1HFA A;  3FBL A;  4TV8 E;  4B3M T;  2W80 C;  1FEW A;  1ZHT A;  1FMW A;  3RGL A;  3B13 A;  1UUS A;  2CE7 A;  4TUY E;  3JAF A;  3PGR A;  2X9X A;  5DL5 A;  3ZCJ A;  1OPF A;  3HR0 A;  4DV5 T;  4B6X A;  3RKO A;  4O4L E;  4OK0 A;  2CXL A;  4TWD A;  6PRN A;  3F31 A;  2V7M A;  2KND A;  1MMA A;  3I0O A;  1XWM A;  2XAS B;  3TLW A;  3VR9 A;  2KZ7 A;  2MHL A;  4YHH T;  4U31 A;  1BR2 A;  5AQI B;  2BBJ A;  2KXP B;  2VUR A;  3X1D A;  1W9R A;  3QOF A;  3LK3 B;  2VL8 A;  4TWH A;  5KMG P;  3GA8 A;  2XQ3 A;  4HFC A;  3UPG A;  3PGU A;  3LBX A;  2CWO A;  3JAE A;  4H63 V;  4KX6 A;  3SY9 A;  3OPC A;  3BRY A;  5J0Z A;  3AE6 A;  4DR3 T;  4UEM A;  4ZOL E;  3AA0 A;  4JFB A;  4QXC B;  2ODV A;  1SHZ C;  5AQJ B;  4JLE A;  4YLH A;  2N2N A;  3VE1 A;  3OJA A;  1KNP A;  3RIU A;  3T24 A;  5DL7 A;  2N9D A;  2ZMA A;  2DL1 A;  2BDE A;  5L3D B;  5HCM A;  2IWW A;  2WY2 A;  3JAD A;  2Q9Q B;  1KNZ A;  2EHO A;  4NPP A;  5DL8 A;  4UVB B;  2JQK A;  3RH3 A;  5JVD E;  1HX1 B;  5JRC B;  3C4X A;  3PUR A;  4LSI A;  3AEE A;  4AIS A;  4HWF A;  3NWI A;  5AQS B;  5F8P A;  5FVL A;  2L3L A;  2YKS A;  2J62 A;  1YW0 A;  2KSR A;  3Q2M A;  1S94 A;  3FZH B;  4UV8 B;  2IDO B;  4CTD A;  5AQG B;  2W66 A;  3F2E A;  3M65 A;  2NWB A;  5AQL B;  2LRK A;  4RLB A;  5LCY A;  1CUN A;  3CKD A;  4YT0 A;  2ZM2 A;  3UU5 A;  4D64 A;  4F8H A;  2XUE A;  5AFU L;  2DCF A;  3PDY A;  3C4W A;  2HPL A;  2GK9 A;  2X0H A;  1HNW T;  2LLY A;  2I59 A;  2XAH B;  5L4H A;  5AQK B;  4RJW A;  4LSF A;  3QRA A;  4AKM A;  4GK5 E;  4X64 T;  3ZSS A;  4EIW A;  3NZQ A;  2Y48 B;  2PTF A;  5L3B B;  2QRX A;  2AXT O;  5AQR B;  2W67 A;  4JUY A;  4QX7 B;  4DR5 T;  2YNK A;  3QB5 K;  5HXR A;  2CBJ A;  5AQQ B;  3PUS A;  4AYD C;  4HFB A;  3W15 B;  1QJ9 A;  3SZD A;  5JDM A;  4X65 T;  5DAB A;  5HYA A;  2Y2X A;  2QVA A;  5LMU T;  3UU2 A;  5FL1 A;  3TZG A;  1IJ6 A;  2WDQ A;  2WVP A;  2VKJ A;  5JR9 A;  3ZT5 A;  2POR A;  4L0R A;  4XNL A;  4WZX A;  5KAI O;  4C90 A;  3MK7 C;  4E7S A;  4WW0 A;  3PJA J;  2XTL A;  3SOL A;  4YTN A;  3CX8 B;  3N9Q A;  5LOV E;  2CMR A;  3HKB E;  4IT4 A;  3T8O A;  4ANJ A;  2BBH A;  5CJ5 A;  4O2A E;  4AZL A;  4LF5 T;  3HKD E;  5EE2 A;  2UXD T;  1JNR A;  3ZC0 A;  2V7K A;  4OYJ A;  3POR A;  2X0Y A;  2ODU A;  5JQG E;  2UXN B;  3EMN X;  4X20 E;  3LK2 A;  3BQI A;  1OED C;  4A97 A;  5L3E B;  1I94 T;  1N34 T;  3MAC A;  3ZLI A;  2WWU A;  4YFS A;  1B7T A;  2HN2 A;  4I55 E;  4PK4 A;  4FMS A;  2F1C X;  2FGQ X;  2BVL A;  5IUX A;  5ABE A;  2X67 A;  4O4J E;  3ZMT B;  2LM9 A;  5LGU B;  3LFM A;  2SPC A;  5FL0 A;  1HXX A;  5ADX L;  3MJX A;  2PJQ A;  5LBQ B;  2ERV A;  5AQN B;  3RPU A;  1KFY A;  3PU3 A;  4DMW A;  5TIS O;  4I4T E;  4IGU A;  4ZI3 C;  3GN5 B;  4XAX B;  2KIN B;  2G0U A;  4IDO A;  3ZMU B;  4CQI A;  2CA5 A;  3HI2 A;  2KLQ A;  5KAF O;  3M3Z B;  3KVD D;  1W09 A;  3PUA A;  1XNQ T;  1FIO A;  3O4X E;  3ANW B;  4WBO A;  2WWV A;  5CA0 E;  3AE2 A;  2C0S A;  4TNV A;  3PF1 A;  2LEH A;  4O4U A;  5EK4 A;  2H7V C;  2LM2 A;  4ZI3 D;  2V5C A;  4E7Z A;  2KZ7 B;  4CN1 A;  2KT9 A;  2HHH T;  3VHL A;  3ZCI A;  4FUV A;  2BS4 A;  3POU A;  3POX A;  3TLU A;  5LG4 A;  2E5V A;  4MBQ A;  3KV4 A;  2KWI B;  3LBX B;  4O4I E;  3ZN1 B;  3DWN A;  4TV9 E;  1QSD A;  1J5E T;  3AA0 B;  4H63 H;  4GK0 E;  4IRE A;  2BVM A;  1J5W A;  3HA4 A;  3RBH A;  3KV5 A;  2WJR A;  3ONX A;  2OLT A;  5HWX A;  2DWK A;  4JI7 T;  3LJC A;  2J1N A;  4CZZ B;  2YK0 A;  3RIA A;  4IE7 A;  3I0Q A;  2V5D A;  2CHO A;  4UIG A;  2EHO B;  4FSP A;  1X9B A;  3WAK A;  2VKO A;  2NW8 A;  5A1L A;  3RC8 A;  4AXP A;  2IIU A;  3CX7 B;  1QLB A;  2J47 A;  4HFD A;  1XNR T;  3DZM A;  3AXJ A;  1IZN A;  3RF1 A;  4U72 A;  4AYE C;  4JBW F;  3MA9 A;  4O49 A;  5HEH A;  1HF8 A;  1YKH B;  3ZT7 A;  2V1D B;  4ZS2 A;  5FMN A;  2F1T A;  2JMM A;  4DVD A;  5M4Y A;  3T20 A;  2ACX A;  1EZ3 A;  5F5W A;  1N36 T;  3DTO A;  3ZST A;  4DV1 T;  4DV3 T;  4MHC A;  4AKR A;  1BR1 A;  4AKH A;  5L4E A;  2Y7S A;  4AQG A;  4O3Z A;  4N74 A;  2JIW A;  2M6B A;  3NSG A;  5LA6 E;  3HOL A;  4I43 B;  8PRN A;  3ETV A;  4ADZ A;  3IF8 B;  3PUY F;  5AQM B;  4CI1 B;  4DR2 T;  3OBV E;  4B3T T;  2LSG A;  1WR0 A;  1ZEE A;  3PUQ A;  3WAJ A;  3K8P C;  5FXW A;  3ONL C;  2W63 A;  1YS5 A;  5FXV A;  1HR0 T;  1BR4 A;  4QXB B;  2W62 A;  4EEB A;  1OWA A;  2LSK A;  3RYI E;  3C98 B;  2D5U A;  1T1L A;  2Y6X A;  3AAI A;  4P09 A;  2VKH A;  3ZPO A;  5JH7 E;  3CQG B;  3LG7 A;  2IHR 1;  3TLV A;  2BG9 C;  5GON E;  4OYK A;  2JPF A;  4JI0 T;  4MAL A;  4QHO A;  5AQO B;  2W81 C;  5FNV E;  3KDS E;  3EDU A;  4GOU A;  1NAF A;  1E1H B;  3LSV A;  4O2B E;  3PUG A;  2WSS V;  5HAX A;  2ODJ A;  4TNW A;  2XQ4 A;  2JQQ A;  4D5U A;  3VU7 H;  3QK6 A;  2UU9 T;  3K19 A;  3JC6 C;  1IAP A;  4F6R C;  4GCQ A;  3UQ7 A;  3FXE B;  4WBN E;  4BAY B;  2C5J A;  3PGS A;  4HE8 A;  1ZHY A;  1XZY A;  3C51 A;  3UUL A;  1PRN A;  3D0T A;  1OED A;  2ZFG A;  4NXN T;  3AEA A;  5C3J A;  3Q5E A;  1D1B A;  1ZHX A;  3HOE A;  2JMK A;  4UB6 O;  1HNX T;  4DO0 A;  7PRN A;  4WNK A;  2LSY A;  2LOP A;  3JC6 D;  1MM4 A;  1LRZ A;  3VZT X;  5JDL A;  3G7G A;  1HG5 A;  3SWH A;  3ANW A;  4Z3T A;  4ERR A;  3AE4 A;  2JJ9 A;  3ZT6 A;  2CRB A;  2E9X A;  4AIU A;  5AQV B;  1E7P A;  1WFD A;  3CVR A;  4LSE A;  3HL6 A;  3QB5 A;  3PUX F;  2JMH A;  4QXH B;  4X66 T;  2MTQ A;  4EGW A;  4CXX A;  3LK2 B;  4IDP A;  5LNK A;  5H2F O;  4AI6 A;  1KF6 A;  4JEU B;  1BH3 A;  1VRB A;  3UAQ A;  2XAG B;  4EAH A;  4AQF C;  3KBU A;  2K4T A;  2NR4 A;  3AE9 A;  2XQY A;  1BT9 A;  4YSZ A;  3QNU A;  3SYB A;  1X79 A;  1THQ A;  4HN9 A;  2HH7 A;  1SE7 A;  5E79 O;  2AXD S;  3PU8 A;  4CI3 B;  3AE1 A;  1P4T A;  4ZXL A;  2YDQ A;  3EDV A;  5B66 O;  4YY3 T;  1I6Z A;  4YJ2 E;  3L09 A;  2WDV A;  3HKC E;  2X9H A;  4TWF A;  4C69 X;  2RA1 A;  3AE3 A;  2Q9Q C;  4DND A;  4DBQ A;  1PHO A;  2IUB A;  4PW8 A;  2XAQ B;  4ZI7 E;  2L9Q A;  4IDZ A;  3P50 A;  2LE8 A;  2DHR A;  2XJ7 A;  2WP9 A;  3N2O A;  5LXT E;  3UUN A;  4O3Y A;  3NJT A;  5HWY A;  2XM1 A;  3RHW A;  1MPF A;  2FJD A;  1ZV4 X;  1N33 T;  3KVA A;  2LFU A;  2Q9Q D;  2A72 A;  5CGM A;  3ABV A;  4ASK A;  4AKG A;  2XAF B;  2BKP A;  2UXX B;  3AE5 A;  4QH1 A;  5KX5 E;  3K3N A;  3T1Y T;  3OTO T;  5GTH O;  3BQK A;  4PJ0 O;  4ZEY A;  3EHZ A;  5EK3 A;  2LKG A;  2K5B B;  3Q9D A;  4UXN B;  4P0A A;  4YTP A;  3LK4 1;  4DBR A;  1HXU A;  3Q5W A;  4JYA T;  4HWC A;  3UFE A;  1OXZ A;  4F4B A;  3C64 A;  1GQE A;  3IEE A;  4AYM C;  3ONJ A;  2KDY A;  4BA9 A;  1XMO T;  2YOE A;  4QH4 A;  5AQH B;  5JDQ A;  2XTQ A;  1VCT A;  1R8I A;  2XE1 A;  1GFP A;  4JCH A;  5LG3 A;  1D1A A;  4DMV A;  3P4W A;  5HXC A;  1IBL T;  1MIW A;  4H9N C;  4KMC A;  2XQA A;  1MNE A;  4U2Z A;  1HTJ F;  1T72 A;  1UCU A;  2PG8 A;  3QC9 A;  3AXJ B;  1IZN B;  4ZZC A;  3UU3 A;  2Z6E A;  1UUR A;  4KBM B;  4H9O C;  1YKE B;  5EZY E;  2QYW A;  3V8U A;  5H6R B;  2V8S V;  2N2M A;  5LJN A;  3ZYK A;  1S35 A;  5DQV A;  3PQU A;  4GKK T;  4HTE A;  3CX6 B;  4AKR B;  3K3O A;  2LKH A;  2CWY A;  2FJE A;  4N58 A;  4U7I A;  5HXE A;  3CML A;  4J2C A;  2BG9 A;  3NVO A;  2DLR A;  4Q25 A;  2UUA T;  3VY8 X;  2R4N A;  4TX5 A;  4YHJ A;  1OSM A;  2X0L B;  2BS2 A;  2W0G A;  1G90 A;  3QUJ A;  2IC6 A;  4HWD A;  2PBI A;  1XMQ T;  4OX9 T;  4XBF B;  2VAS A;  3N5L A;  3VZU X;  3AA7 A;  3L39 A;  2OMF A;  3Q5D A;  5JDH A;  3AVR A;  3ZMS B;  3UUB A;  2F1V A;  1WR6 A;  2YU2 A;  4N78 D;  5ABG A;  2XQ8 A;  4IL9 A;  4A56 A;  2NW7 A;  4HFI A;  2CXD A;  1T16 A;  1ZHW A;  1MM5 A;  3KFW X;  2DI4 A;  3ZC1 A;  3C5O A;  2R88 A;  4ZS3 A;  2ZLD A;  3SFD A;  3FXD B;  3G06 A;  5LP6 E;  3AA6 B;  3RKG A;  2FJA A;  3AE8 A;  2DNX A;  1SUM B;  1L0V A;  3DA3 A;  2OV9 A;  2XZE A;  3H3M A;  1HXT A;  3V5S A;  5IYZ E;  1KEY A;  4BJM A;  2HN1 A;  4JI4 T;  2YDR A;  5EK2 A;  3IA3 A;  4IIJ E;  5LGT B;  2ZLY A;  3BRZ A;  2E8I A;  4LFB T;  4HKA A;  3NBX X;  2R4L A;  1OED B;  3WU2 O;  5T5F A;  2V6Y A;  2A2F X;  1O3X A;  2LSI A;  5G3A A;  4KUM B;  1LVF A;  5HEO A;  2H88 A;  4HFE A;  5G38 A;  2K24 A;  4KRA A;  4AQF A;  3PUV F;  4UB8 O;  1KNR A;  3L8R A;  2E9X B;  2VVN A;  2L8K A;  2R8A A;  4CXY A;  4FI5 A;  3AB3 B;  3ZKR A;  1Q9G A;  1MMN A;  3R6N A;  1FMV A;  3VKG A;  4JI3 T;  5J1G A;  2MAW A;  4JI2 T;  3FZF B;  3H3A A;  1W0B A;  4XNK A;  2WM9 A;  5AFU K;  5L2L A;  5FXX A;  4DR7 T;  3PRN A;  4I0U A;  2X9K A;  4P0B A;  1IBK T;  1UK5 A;  4RL9 A;  1ZOY A;  2I6H A;  3A0B O;  4IDQ A;  4X1I E;  2QA7 A;  5ABF B;  4KHZ F;  1YD8 G;  4JEH B;  4EXT A;  3CK6 A;  3UU4 A;  1Y64 B;  2VK9 A;  4IL4 A;  4EYY R;  1DU2 A;  4TZ4 C;  5LGN B;  5CA1 E;  2A9U A;  1MMG A;  2N1G A;  2YN6 A;  2YEV C;  2WB5 A;  3ZYM A;  5LB7 B;  4PAG A;  5G26 A;  2DWG A;  4PJL A;  4PK6 A;  2ACZ A;  4COF A;  3KBT A;  4YXD A;  2NW9 A;  2K48 A;  3ZJ2 A;  5DQW A;  4ZI2 C;  4G2A A;  3FHN A;  1ZHC A;  4EZH A;  2IML A;  1WLX A;  4AKL A;  5J2T E;  3RQU A;  2XTR A;  4FZL A;  4Z8X A;  1D0Y A;  5FVK A;  1NEN A;  1V9D A;  5HXS A;  5KDM C;  5L3F B;  5JDP A;  4PUX A;  4FZN A;  2JQH A;  2Y0L A;  2EHO D;  4LF9 T;  2WDR A;  2CCQ A;  5B5E O;  4FT6 A;  2Y8D A;  4ZI2 D;  4MLK A;  4KR8 A;  2CLY B;  3A5X A;  4MFR A;  3U78 A;  2J1D G;  1W0A A;  2V6X A;  2I0M A;  2V7L A;  3HW9 A;  4ILB A;  1WCR A;  4IL6 O;  3HWB A;  2JRK A;  2VVS A;  4UVC B;  2WQY A;  4GYS A;  2XMX A;  2ZM8 A;  3BK9 A;  2GE4 A;  3PE0 A;  3ETU A;  1T98 A;  1OED E;  5AQF B;  2UXB T;  3KV6 A;  3WI5 A;  4NUU A;  2KC0 A;  5FY7 A;  2V7I A;  2M06 A;  2IAK A;  4O4H E;  1WYB A;  3N2K E;  5L3G B;  2YU1 A;  4A5X A;  3FBZ A;  3GMI A;  2VKD A;  5BR8 T;  5J2U E;  2F4V T;  4U9C A;  2WJQ A;  2NTY A;  4LFA T;  1QJP A;  1WYC A;  2HPJ A;  2K9A A;  2LT3 A;  3DP7 A;  2W61 A;  3UT5 E;  4GCS A;  2LSJ A;  3AA6 A;  2E2A A;  4AYN A;  1AJ3 A;  4V1A v;  4HEA A;  3ZMV B;  5JR9 C;  1UX5 A;  2IC9 A;  4CN6 A;  3CIR A;  3ZMZ B;  3VKH A;  1HG2 A;  2FJB A;  4DV0 T;  4CXW A;  3UU8 A;  2IW5 B;  4C4V A;  2BG9 B;  3DA4 A;  4FRX A;  1UGO A;  2D0U A;  1G8X A;  2VQE T;  3EAM A;  3VY9 X;  4GIW A;  3RRW A;  4PFO A;  3JCF A;  4IST A;  3AA7 B;  4IE0 A;  3FYX A;  5DL6 A;  4X1K E;  3SRZ A;  4HFV A;  4G75 A;  3QRC A;  4DV4 T;  1LKX A;  4GYR A;  3OYX A;  3H37 A;  2XPK A;  5FYM A;  5C8Y E;  3O1J A;  3T0S A;  2X27 X;  5CFB A;  2K3W A;  4PJN A;  3RI5 A;  2PRN A;  3N9N A;  2M67 A;  2OA5 A;  3J7Y q;  3LK4 2;  1BR0 A;  5LHI B;  2JQ9 A;  5D5D A;  4DV2 T;  4LMK A;  4AKI A;  1NWM X;  4DID B;  2V7J A;  4LFC T;  2VB6 A;  2FUP A;  2NP9 A;  4EV6 A;  1N32 T;  4LML A;  5ABF A;  3AAE A;  2J4U P;  4K3C A;  4B3R T;  3R84 B;  2YIN A;  5TAO A;  3RYC E;  4JI1 T;  3PUW F;  2V6Y B;  2ZM6 T;  4DUZ T;  5C2T A;  5LHG B;  1ZKE A;  3U3I A;  4DV7 T;  4AQY T;  4UF0 A;  2LHN A;  4KR4 A;  5FXZ A;  4PJM A;  3P4S A;  3N9L A;  3SS1 A;  2XQ7 A;  1YQ4 A;  5JRE A;  4JI8 T;  2H89 A;  3AED A;  4GF4 A;  3CWZ B;  2WMO A;  4K0U A;  3ZN0 B;  3EVY A;  5FVN A;  1KK7 A;  3RRC A;  5LYJ E;  3JCU O;  4PK5 A;  3GP6 A;  2XG6 A;  2QGS A;  4OFZ A;  3N9O A;  1FJG T;  1GFN A;  3KIN B;  2CHN A;  3BQL A;  1VOM A;  3IBP A;  2WZI A;  3RQW A;  4X1Y E;  3RIF A;  4EB6 E;  2R4O A;  2XSB A;  2VQF T;  4QX8 B;  4DR1 T;  4KHP T;  1S5L O;  2UUC T;  2BG9 E;  3RC3 A;  3RYF E;  4TN7 B;  3DJB A;  2W00 A;  2KWH A;  4ZZB A;  3UTK A;  5L3C B;  2B76 A;  2K0L A;  3OVU A;  2XM2 A;  5DJQ C;  2YPV A;  5IHY A;  2W4X A;  4N59 A;  4EYU A;  4U33 A;  3MXZ A;  2WU2 A;  3O0E A;  3MKD A;  5E0O A;  3WI3 A;  4DR4 T;  2LHR A;  4A98 A;  5JDG A;  1T8B A;  1D0Z A;  4O4X A;  3TKL B;  4JV5 T;  3AA1 A;  3A8Y C;  2D2S A;  2UXC T;  3B5M A;  2XAJ B;  4GKJ T;  2WAU A;  3N2G E;  3O9X A;  3AEF A;  2O4V A;  4IHJ E;  2WU5 A;  4C00 A;  4K3B A;  4HWH A;  5BMV E;  4O3W A;  1MND A;  2W2U A;  4E1T A;  3AAA A;  2WS3 A;  1GFM A;  3I9Y A;  3J9X 1;  3EI0 A; 
#chains in the Genus database with same CATH homology
 1FMV A;  3UUM A;  3VKG A;  3UPG A;  5J1G A;  1YS5 A;  3LBX A;  2CWO A;  4UV9 B;  5FXV A;  2FGR A;  4H63 V;  5IYU A;  3H3A A;  2XHE B;  1BR4 A;  5LJM A;  2V26 A;  4QXB B;  2W62 A;  1QUU A;  4LSH A;  4XNK A;  3GWH A;  3SY9 A;  1OWA A;  2LSK A;  2WM9 A;  5AFU K;  3RYI E;  5L2L A;  3C98 B;  3F57 A;  5FXX A;  4UEM A;  3PRN A;  3L3P A;  4ZOL E;  2D5U A;  3AA0 A;  4JFB A;  4M1P A;  4P0B A;  2Y6X A;  3NZP A;  4PJJ A;  3AAI A;  4QXC B;  2ODV A;  1MIY A;  1SHZ C;  4JLE A;  2VKH A;  4P09 A;  4RL9 A;  3ZPO A;  2X9Y A;  3CQG B;  3LG7 A;  4YLH A;  5JH7 E;  2N2N A;  3VE1 A;  3UUX B;  3OJA A;  4ISS A;  5GON E;  3T24 A;  4X1I E;  5DL7 A;  2QA7 A;  2N9D A;  4OYK A;  2JPF A;  2ZMA A;  4BJN A;  2LHF A;  4MAL A;  4QHO A;  1Z0P A;  4GHB A;  3NRY A;  1YD8 G;  4JEH B;  4EXT A;  2W81 C;  5FNV E;  3KDS E;  2BDE A;  2BZB A;  3EDU A;  2VWA A;  3POQ A;  1Y64 B;  4GOU A;  5L3D B;  1NAF A;  1E1H B;  2VK9 A;  1IJ5 A;  4EYY R;  2Q9Q B;  1KNZ A;  2EHO A;  3FB2 A;  2C5I T;  4O2B E;  4TZ4 C;  5ETW A;  2WBL A;  3PUG A;  5LGN B;  5DL8 A;  5JDN A;  2H3R A;  4L9I A;  5CA1 E;  2WSS V;  4UVB B;  4H9P C;  5FY1 A;  3RH3 A;  5JVD E;  5HAX A;  1MMG A;  2N1G A;  2ODJ A;  2YEV C;  2QTK A;  2JQQ A;  4D5U A;  3VU7 H;  3ZYM A;  5JRC B;  3C4X A;  3QK6 A;  3E22 E;  3PUR A;  4PAG A;  5G26 A;  2DWG A;  4LSI A;  3K19 A;  3JC6 C;  1IAP A;  3CQC B;  4PJL A;  4PK6 A;  4F6R C;  4GCQ A;  3KBT A;  1H7C A;  3FXE B;  4WBN E;  2NW9 A;  3RX6 A;  2K48 A;  3ZJ2 A;  4BAY B;  2C5J A;  4HE8 A;  4RJX A;  5DQW A;  1ZHY A;  2CM0 A;  4ZHQ E;  2XE3 A;  4ZI2 C;  3C51 A;  5F8P A;  4G2A A;  4OHF A;  3UUL A;  4PFP A;  1PRN A;  3FHN A;  1ZHC A;  3D0T A;  4EZH A;  3AVS A;  2L3L A;  1WLX A;  3KV9 A;  4AKL A;  3N9P A;  5J2T E;  1YW0 A;  5LBM A;  2XTR A;  3Q2M A;  2ZFG A;  4FZL A;  4QQ1 A;  1S94 A;  3WI4 A;  3V5U A;  4Z8X A;  1D0Y A;  4UV8 B;  1D1B A;  1ZHX A;  1E54 A;  1V9D A;  2NOX A;  3F2E A;  3HOE A;  3M65 A;  2JMK A;  2NWB A;  5HXS A;  5KDM C;  5L3F B;  4PUX A;  5JDP A;  4RLB A;  3CQX C;  4FZN A;  5LCY A;  2Y0L A;  4DO0 A;  2EHO D;  3KVB A;  7PRN A;  3ZEF B;  1US7 B;  1CUN A;  2LSY A;  2LOP A;  3JC6 D;  4WNK A;  1MM4 A;  1LRZ A;  2X51 A;  3VZT X;  5JDL A;  3IHR A;  1HG5 A;  3G7G A;  3CKD A;  2CCQ A;  3ANW A;  3SWH A;  4Z3T A;  2ZM2 A;  4ERR A;  4FT6 A;  3E0Z A;  2JJ9 A;  2Y8D A;  3SY7 A;  4D64 A;  4ZI2 D;  4MLK A;  2KXP A;  2XUE A;  5AFU L;  1Q9F A;  2E9X A;  4KR8 A;  2CLY B;  3A5X A;  1BXW A;  3E08 A;  2DCF A;  2MNH A;  3PDY A;  3CVR A;  3C4W A;  4MFR A;  3HL6 A;  2H7O A;  2J1D G;  3O1H A;  2JMH A;  4NUV A;  4PNI A;  4QXH B;  3U78 A;  2MTQ A;  2HPL A;  2GK9 A;  1U5P A;  4CXX A;  2V7L A;  3HW9 A;  3EUH A;  3LK2 B;  4YJ3 E;  2I59 A;  2XAH B;  1ORM A;  3K3Q C;  3HWB A;  2E9X C;  2JRK A;  4FES A;  5FY0 A;  5LNK A;  4UVC B;  4RJW A;  4LSE A;  4AI6 A;  4LSF A;  3QRA A;  4GYS A;  2XMX A;  2Y0H A;  4JEU B;  2ZM8 A;  3BK9 A;  1BH3 A;  2GE4 A;  1VRB A;  4AKM A;  1HX8 A;  4GK5 E;  3PE0 A;  3ETU A;  3UAQ A;  2XAG B;  4EIW A;  1T98 A;  3NZQ A;  4EAH A;  4AQF C;  3KBU A;  2K4T A;  2Y48 B;  1U4Q A;  1BT9 A;  2XQY A;  5L3B B;  1ZHZ A;  3KV6 A;  2LOS A;  4JUY A;  2PFV A;  3SYB A;  1X79 A;  4QWN B;  4QX7 B;  2YNK A;  4NUU A;  3WI5 A;  1THQ A;  2KC0 A;  4HN9 A;  2HH7 A;  4FRT A;  5FY7 A;  2V7I A;  2M06 A;  5HXR A;  2IAK A;  2ZM0 A;  1QJ8 A;  3PU8 A;  5JDF A;  4CI3 B;  4O4H E;  1WYB A;  3N2K E;  3PUS A;  5L3G B;  2KMF A;  2YU1 A;  1P4T A;  4AYD C;  2E9X D;  3EDV A;  3W15 B;  1QJ9 A;  3FBZ A;  3GMI A;  2Q9Q A;  2VKD A;  3SZD A;  5J2U E;  4U9C A;  4YJ2 E;  5JDM A;  5DAB A;  3CPZ A;  1SA0 E;  3ZYL A;  5HYA A;  2Y2X A;  3L09 A;  3HKC E;  2X9H A;  4QKN A;  2NTY A;  4AFK A;  4C69 X;  2X68 A;  2RA1 A;  3UU2 A;  1QJP A;  3TZG A;  5JRC A;  2Q9Q C;  4DND A;  1IJ6 A;  4DBQ A;  1PHO A;  1LVK A;  4PW8 A;  3AAE B;  3O1I A;  4FZM A;  2VKJ A;  1WYC A;  2HPJ A;  2K9A A;  2LT3 A;  2XAQ B;  3DP7 A;  5JR9 A;  4ZI7 E;  2L9Q A;  2W61 A;  4IDZ A;  4KP3 C;  2LE8 A;  3UT5 E;  4GCS A;  2LSJ A;  2POR A;  3AA6 A;  2DHR A;  4L0R A;  4XNL A;  4AYN A;  1AJ3 A;  4C90 A;  4CI2 B;  4V1A v;  4HEA A;  2RP4 A;  3ZMV B;  2WMN A;  3N2O A;  5JR9 C;  3MK7 C;  4E7S A;  1UX5 A;  4WW0 A;  3UUN A;  5LXT E;  2IC9 A;  4O3Y A;  3ZMZ B;  2XTL A;  1HG2 A;  5HWY A;  3VKH A;  2EHO C;  4CXW A;  1MPF A;  1ZV4 X;  3SOL A;  3HKE E;  3KVA A;  2IW5 B;  2MBG A;  2N2L A;  4UF0 B;  2LFU A;  2Q9Q D;  3I9W A;  3CX8 B;  1HCI A;  2A72 A;  3N9Q A;  3LK3 A;  4ASK A;  3DA4 A;  4FRX A;  4HGA A;  4AKG A;  5LOV E;  2XAF B;  2CMR A;  2D0U A;  3HKB E;  3T8O A;  4ANJ A;  1WRD A;  5LHH B;  3A2S X;  1G8X A;  2UXX B;  5KX5 E;  2D0T A;  3VY9 X;  4GIW A;  2A3D A;  3K3N A;  4O2A E;  1G73 A;  3P7I A;  4AZL A;  3RRW A;  3HKD E;  5EE2 A;  3SYS A;  2MYS A;  4PFO A;  3ZC0 A;  3BQK A;  2V7K A;  4IST A;  3PQS A;  3AA7 B;  4B61 A;  4OYJ A;  3POR A;  2ODU A;  5JQG E;  2UXN B;  4IE0 A;  3EMN X;  5EK3 A;  3FYX A;  4EOZ B;  2LJL A;  4X20 E;  3LK2 A;  5DL6 A;  2K5B B;  3BQI A;  3Q9D A;  2M07 A;  5L3E B;  2Y0K A;  4UXN B;  4UVA B;  4AYI D;  2CLY C;  4P0A A;  3MAC A;  4X1K E;  2WWU A;  4HFV A;  3SRZ A;  3ZLI A;  3LK4 1;  3QRC A;  4G75 A;  4DBR A;  4YFS A;  1LKX A;  1HXU A;  4GYR A;  3OYX A;  3Q5W A;  1B7T A;  4FMS A;  4I55 E;  4PK4 A;  3UFE A;  3H37 A;  4G76 A;  1OXZ A;  1D1C A;  2FGQ X;  2BVL A;  5FYM A;  5C8Y E;  4F4B A;  3O1J A;  3T0S A;  3C64 A;  3IEE A;  2X27 X;  4AYM C;  2X67 A;  4O4J E;  3ZMT B;  2XE5 A;  2LM9 A;  2KDY A;  2NTX A;  4PJN A;  3P8C D;  4I50 E;  4BUM X;  4BA9 A;  5LGU B;  2PRN A;  4GCP A;  3LFM A;  2SPC A;  3I1A A;  2XTQ A;  5JDQ A;  3N9N A;  1HXX A;  5ADX L;  3MJX A;  2PJQ A;  4H9Q C;  2M67 A;  2OA5 A;  5LBQ B;  1GFP A;  2XE1 A;  3J7Y q;  2ERV A;  4JCH A;  3RPU A;  2XE2 A;  3LK4 2;  2X66 A;  3PU3 A;  4IE4 A;  3N9M A;  1D1A A;  4DMW A;  4DMV A;  4IE6 A;  1BR0 A;  5LHI B;  4D65 A;  5D5D A;  5HXC A;  4I4T E;  4IGU A;  4FOZ A;  4ZI3 C;  3VZW X;  3OYZ A;  3GN5 B;  1MIW A;  4XAX B;  1NWM X;  2KIN B;  4AKI A;  2G0U A;  4H9N C;  4KMC A;  4UEL A;  2V7J A;  3ZMU B;  2VB6 A;  2CA5 A;  4O8S A;  4CQI A;  2NP9 A;  1MNE A;  4EZ4 A;  1HTJ F;  2MOZ A;  1UCU A;  2PG8 A;  2KLQ A;  3HI2 A;  3OKQ A;  3QC9 A;  4U74 A;  1IZN B;  3KVD D;  3C4Z A;  3NRX A;  2Z6E A;  3PUA A;  4KBM B;  4H9O C;  1YKE B;  1FIO A;  1GFO A;  3O4X E;  3ANW B;  4WBO A;  3AAE A;  2CXF A;  2X9W A;  5CA0 E;  2J4U P;  2C0S A;  3R84 B;  2YIN A;  5EZY E;  4FJO A;  5TAO A;  3RYC E;  2LEH A;  3V8U A;  4IE5 A;  5H6R B;  2N2M A;  1MIV A;  4O4U A;  5LJN A;  4XZC A;  5EK4 A;  2H7V C;  3ZYK A;  1S35 A;  5DQV A;  4AUI A;  5LHG B;  3RYH E;  3PQU A;  1ZKE A;  5ADX K;  3U3I A;  4HTE A;  4ZI3 D;  3CX6 B;  4AKR B;  3K3O A;  5FP3 A;  2CWY A;  4N58 A;  4O3X B;  3AA1 B;  5HXE A;  4E7Z A;  2KZ7 B;  3PTR B;  4UF0 A;  3CML A;  4J2C A;  2LHN A;  2KT9 A;  4RLC A;  1UX4 A;  3VY8 X;  2DLR A;  4KR4 A;  5FXZ A;  3VHL A;  2P9B A;  4PJM A;  4TX5 A;  3N9L A;  3B57 A;  4YHJ A;  3SS1 A;  3ZCI A;  2B1E A;  4H9R C;  1OSM A;  5HXH A;  4FUV A;  2X0L B;  3POU A;  3C50 A;  2W0G A;  1G90 A;  3QUJ A;  2IC6 A;  3POX A;  3AAA B;  5JRE A;  5LG4 A;  5GV0 A;  1MMD A;  4E1S A;  2PBI A;  4L5G A;  4GF4 A;  3CWZ B;  4XBF B;  2VAS A;  2WMO A;  3KV4 A;  4K0U A;  4MBQ A;  4ILU A;  2KWI B;  3LBX B;  3ZN0 B;  3N5L A;  3VZU X;  3EVY A;  3AA7 A;  4O4I E;  3ZN1 B;  5FVN A;  4H9S E;  3ZJ1 A;  1KK7 A;  3RRC A;  2OMF A;  5LYJ E;  4TV9 E;  4PK5 A;  3GP6 A;  2XG6 A;  1QSD A;  2QGS A;  3AVR A;  5JDH A;  3AA0 B;  4OFZ A;  3ZMS B;  2ES0 A;  4H63 H;  4GK0 E;  2F1V A;  1WR6 A;  3N9O A;  2BVM A;  1GFN A;  3HA4 A;  2YU2 A;  4N78 D;  3KIN B;  3KV5 A;  1GFQ A;  3RBH A;  3BQL A;  4A56 A;  3VE2 A;  2NW7 A;  1VOM A;  5PRN A;  3ONX A;  3S4U A;  2CXD A;  3IBP A;  5F3J A;  1ZHW A;  4X1Y E;  3KFW X;  1D0X A;  4EB6 E;  1H6S 1;  1MM5 A;  2DI4 A;  3JTY A;  3ZC1 A;  3C5O A;  5HWX A;  2DWK A;  5JR9 B;  2J1N A;  3LJC A;  4ZS3 A;  4CZZ B;  2CEA A;  2YK0 A;  2ZLD A;  4G63 A;  4QX8 B;  3MZK B;  2C5K T;  3FXD B;  4IE7 A;  3I0Q A;  4FSO A;  5LP6 E;  4UIG A;  2EHO B;  3AA6 B;  4FSP A;  5CB4 E;  3RC3 A;  3RYF E;  4C91 A;  4TN7 B;  3DJB A;  2DNX A;  3WAK A;  3SZV A;  3DA3 A;  5H6Q B;  2W00 A;  3Q5X A;  2VKO A;  2NW8 A;  5A1L A;  3RC8 A;  1HXT A;  4AXP A;  2KWH A;  3V5S A;  3CX7 B;  3ESL A;  3GN5 A;  1HS7 A;  5IYZ E;  3UTK A;  4BJM A;  5L3C B;  1HFA A;  3FBL A;  4TV8 E;  2W80 C;  1FEW A;  2K0L A;  1IZN A;  5DJQ C;  4U72 A;  5EK2 A;  1ZHT A;  4AYE C;  3MA9 A;  1FMW A;  4O49 A;  4IIJ E;  5LGT B;  2YPV A;  5IHY A;  2ZLY A;  1HF8 A;  1YKH B;  3B13 A;  2V1D B;  2CE7 A;  2E8I A;  4TUY E;  4ZS2 A;  5FMN A;  4HKA A;  2X9X A;  3NBX X;  4DVD A;  5M4Y A;  4EYU A;  2F1T A;  2JMM A;  4N59 A;  3MXZ A;  5DL5 A;  3ZCJ A;  1OPF A;  3T20 A;  2ACX A;  5T5F A;  3HR0 A;  1EZ3 A;  3O0E A;  2A2F X;  1O3X A;  2LSI A;  3DTO A;  3MKD A;  5E0O A;  3WI3 A;  4KUM B;  4B6X A;  2LHR A;  3RKO A;  1LVF A;  4O4L E;  4MHC A;  4OK0 A;  2CXL A;  4AKR A;  5JDG A;  6PRN A;  1BR1 A;  2V7M A;  3F31 A;  4AKH A;  1D0Z A;  2Y7S A;  4O4X A;  2KND A;  3TKL B;  2K24 A;  4AQG A;  4AQF A;  3AA1 A;  4KRA A;  1MMA A;  4O3Z A;  2D2S A;  3I0O A;  3NSG A;  2XAS B;  5LA6 E;  2KZ7 A;  2MHL A;  3HOL A;  4I43 B;  8PRN A;  2XAJ B;  2WAU A;  3ETV A;  1BR2 A;  3N2G E;  4ADZ A;  3O9X A;  2O4V A;  4IHJ E;  3IF8 B;  2KXP B;  4CI1 B;  2E9X B;  5BMV E;  2L8K A;  3OBV E;  4O3W A;  3LK3 B;  1MND A;  4CXY A;  2VL8 A;  4FI5 A;  2LSG A;  4E1T A;  1ZEE A;  5KMG P;  3AAA A;  3PUQ A;  3AB3 B;  3K8P C;  3WAJ A;  1GFM A;  5FXW A;  3GA8 A;  3I9Y A;  1Q9G A;  3J9X 1;  1MMN A;  3R6N A;  2W63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...