5AFUL

Cryo-em structure of dynein tail-dynactin-bicd2n complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
270
structure length
270
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVDVIPDNPKFQQLQRELSQVLTQRQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Dynactin Complex and its Interaction with Dynein.
pubmed doi rcsb
molecule tags Motor protein
molecule keywords DYNEIN TAIL
total genus 71
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5afuL01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 5afuL02
4AKRB 3AA6B 1IZNA 3LK2A 3LK3B 3AA0B 5AFUL 3AAAB 2KZ7B 2KXPA 3AA0A 3AA7B 1IZNB 3LK2B 3AAEB 3AA6A 3LK3A 5ADXL 5ADXK 3LK42 3AAEA 4AKRA 3AA1A 3AA7A 5AFUK 2KZ7A 2KXPB 3AA1B 3AAAA 3LK41
chains in the Genus database with same CATH superfamily
5GTHO 4FSPA 5H6QB 2CE7A 2NTXA 1LVKA 2A2FX 1Z8UA 3HKDE 2WDQA 4K0UA 3AA1A 3PF1A 5AQVB 4IL6O 2CPTA 4HKAA 2VQET 2VKDA 2BBHA 4U2ZA 4LFBT 2JMMA 3RQUA 5EK2A 3DA3A 2K48A 3QUJA 4PFPA 5JREA 2K24A 2W67A 3GN5B 3T1YT 3LK3A 2MBGA 5BR8T 2NWBA 1B7TA 3EDUA 2C5JA 3ZKRA 2XE3A 2LEHA 3AE8A 2V26A 3RI5A 4B6XA 5HXCA 2A3DA 3LBXA 2WP9A 3TZGA 3N9OA 2Y0KA 4IDPA 2J62A 2JQYA 2LM2A 3UFEA 5C8YE 4N75A 4IREA 4QXHB 5LHGB 4UF0A 1E7PA 2KNDA 4O2AE 1N36T 2M67A 3P8CD 2XAJB 3ZMZB 3QB5K 4O4UA 4ADZA 2P9BA 4A98A 2E9XC 4HFVA 2R4OA 4TWDA 2AXDS 2N2NA 3U78A 4YHJA 1HF8A 4CZZB 2Q9QC 4EEDA 3HR0A 4OFZA 2W2UA 3ZYKA 1G8XA 2V7MA 2X9YA 5HXRA 2KINB 2JMHA 4JFBA 5FP3A 2E8IA 4ZS2A 5LHHB 3SWHA 3UQ4A 3NZPA 1BR4A 4C91A 4AIUA 4KI0F 2M06A 4LF4T 1QSDA 4Z90A 1VRBA 4UVAB 3PUAA 2QGSA 2FBWA 2MAWA 3CQCB 2XQ9A 1BR0A 3MKDA 3TLSA 2N2MA 1NEKA 3SOLA 4TN7B 2JJ9A 5DQWA 2KDYA 4L0RA 5HEOA 5HXHA 1D0XA 3PQUA 4QWNB 5DL6A 2X9KA 4C90A 5L3DB 3LBXB 2RP4A 2Y8DA 3AVRA 3JAEA 2BG9E 3AEAA 4EEBA 2CLYB 1KEYA 1ZV4X 2CCQA 4XBFB 3HOLA 2OV9A 2V6YA 2UUCT 2ODUA 3ETUA 1CUNA 3QOFA 4LMKA 4L9IA 3G7GA 4GIWA 3AA6A 3KFWX 4AUIA 3POUA 3UFGA 3RC8A 2K0LA 3AAEA 1T1LA 3NBXX 1KNRA 1OXZA 3KV9A 3ANWB 4C00A 3K3OA 3OYXA 4D64A 3AA6B 2XQ3A 2YK0A 2F1VA 3EABA 4WNKA 4WBNE 3QC9A 1KFYA 2IWWA 4YJ3E 3PGRA 4O4XA 2NW7A 4YFSA 2BVLA 4P09A 3KV4A 3SYSA 4LSFA 3TLUA 2CM0A 5J2UE 1J5ET 5B5EO 4XNLA 5CGMA 3HI2A 2GK9A 3SY7A 2V7JA 2DNXA 3N5LA 4X62T 4H9NC 3RIAA 2R8AA 3V8UA 4ISSA 4Z8XA 4FZLA 4AXPA 1UGOA 4O3YA 4CN1A 2F1TA 3LG7A 4QX7B 4UEMA 3RYCE 2ZLDA 5D5DA 1W0AA 2WBLA 1G90A 2YKSA 4IE4A 1IBKT 3ZT5A 4YTMA 4HFDA 2KZ7B 2XZEA 3CQXC 2R4LA 4O8SA 1GFOA 4AKMA 2V5CA 5G3AA 2ES0A 2XMXA 2ZLYA 3JCFA 1BR2A 2YINA 1SUMB 3O1HA 1DU2A 1SA0E 2C5IT 2MTQA 1N34T 4N58A 4LF7T 4UB6O 5AQGB 2KXPA 4O49A 4YSZA 3Q5WA 2W81C 1MNEA 1OEDC 3PQSA 1LKXA 4Q25A 3N9PA 4PUXA 5KXJA 4NIQA 1UURA 5LBQB 3E22E 2XE5A 2WQYA 2CBJA 1IBLT 2Y2XA 1M62A 3RRCA 4U7IA 2PORA 2LSYA 3UPGA 3A7MA 2DLRA 4O4JE 2MOZA 4PNIA 5JDLA 3UUXB 4U7YA 4GCPA 2W0GA 5IHYA 2XQ7A 5FL0A 3U3IA 4E1TA 3NRXA 4UIGA 2W61A 4G2AA 4LF6T 3N2KE 1ZHYA 2DWGA 2WJQA 2ACXA 3V5UA 1WLXA 4DMWA 4C4VB 4U74A 3R6NA 1MMGA 2I59A 3LK42 3PUGA 1MIVA 2X66A 3AA1B 3HKCE 2JRKA 2EHOD 4H9PC 3RLFF 3AE9A 1HXTA 3AXJA 4BUMX 1S35A 4ZZBA 2RPAA 3ETVA 1MPFA 1ZHZA 3C50A 3FBLA 4JUYA 2W62A 2OMFA 3AE2A 3OPCA 2LE8A 2W63A 3AVSA 5ABGA 4HFHA 5CB4E 4U72A 1YS5A 4AKRA 4JBWF 4ZI3C 4AQGA 1SE7A 4QX8B 1GQEA 4FESA 5L3FB 3X1DA 2ZMAA 3KBUA 4RL9A 4UV9B 3FB2A 1ORMA 4YHHT 2D9DA 3PUYF 1QJ8A 3QRCA 2VL0A 5FY1A 1HX8A 1D1AA 2L3LA 1N33T 2FJAA 2BKPA 3PU3A 4GCSA 2KWIB 3BQLA 5IUXA 2XQ4A 4UVCB 4AISA 2KXPB 1ZEEA 3KZIO 4X1IE 1WR0A 4H63V 2UXCT 3ZSTA 5DABA 3VZWX 1T98A 4JI3T 4TWFA 3AA0A 2YNKA 2V7KA 3G06A 3NWIA 2M6IA 3TLTA 5GONE 3KDSE 4NXMT 4TWHA 5L3GB 5FKYA 4I4TE 4DR5T 5FVNA 2HPJA 2LSIA 2V1DB 3GP6A 5KAFO 2VKJA 4B3MT 3FHNA 3P4QA 4B3RT 4KHPT 2VB6A 1O3XA 4TV8E 5LG4A 3DA4A 4X65T 3ZJ2A 2AE9A 4PFOA 3K19A 3PU8A 5E79O 3ZT7A 2BKNA 4ILUA 3RIUC 2XE1A 2UUAT 3H3AA 4DV2T 5H2FO 3JAFA 1R8IA 5HXEA 2X68A 2XM2A 3WI4A 2Y0HA 1D0YA 3R84B 2LSJA 4AQFA 2WB5A 4F8HA 3W15B 2YDQA 3AAEB 1WCRA 4FI5A 2XSAA 2PRNA 2WZHA 3AEGA 5JTGA 3PUVF 5HCMA 2E9XD 1L0VA 2V6YB 3GA8A 2ODVA 2BS3A 4AKGA 3ZYLA 3C4WA 5HEUA 3AEDA 4O4HE 2ZM6T 3NRYA 5DL5A 1HX1B 3EDVA 4HWDA 4YTPA 2K3WA 3P4PA 4RLBA 2V7LA 2BKOA 4N74A 5F5WA 3RQWA 1VCSA 3TKLB 3UUNA 1QLBA 4ZI2D 1MM4A 4KR8A 2XG6A 4O4LE 4U2YA 2W4XA 2H7OA 4PAGA 4JI4T 2ERVA 2J1DG 4EGWA 4LF5T 3O0EA 2IC6A 4JEUB 2CBIA 2VVSA 3N9QA 2Z6EA 5FY0A 4L5GA 4JI7T 2CA5A 2L8KA 4JV5T 2Y7SA 3JC6C 4FZNA 3CQGB 2X0HA 2FJEA 3PUWF 4ILAA 2KWHA 1NWMX 3PUQA 3GWHA 3DP7A 5F3JA 4IT4A 5PRNA 3QK6A 3SS1A 2CRBA 3WI5A 2J1NA 3F57A 2WJRA 1E2AA 4MBQA 1MIYA 2JPFA 4DBRA 2XQAA 5LXTE 4DUZT 2I0MA 5G26A 2WY2A 5CFBA 3AE3A 3SYBA 5FVLA 5GTIO 1T16A 4IE7A 3B5MA 4GYRA 3L8RA 2HN1A 4PK6A 3SZVA 5AQSB 4UF0B 2ZM2A 3N9MA 3RYIE 4YSXA 4EZHA 5G39A 2XAGB 1KK7A 3T20A 1U5PA 5LP6E 4H9QC 2VVNA 3ZMUB 2NW8A 2YEVC 2IUBA 2OA5A 4EAHA 3C98B 4U31A 3CX8B 3OKQA 2MPKA 2KLQA 3VR9A 4YLHA 1MNDA 2R4NA 3J9X1 4U3CA 4EYYR 2Q9QA 4X5TA 3IEEA 3FXEB 2J4UP 4KX6A 1T8BA 4TNWA 4IDZA 5T5FA 4G75A 1YQ4A 3AEEA 4LFAT 1HR0T 2XASB 2W66A 4RJWA 4DR7T 5ADXK 2N1GA 4HWCA 3JADA 5FMNA 3FXDB 4CQIA 3N9LA 3A0HO 4IDNA 4V1Av 2C5KT 1THQA 2IW5B 2YDSA 2QA7A 2K4TA 3F31A 1W09A 3PV0F 4LMJA 2JIWA 1HXXA 3EI0A 5ABHA 2WZIA 4JI0T 2XSBA 2UXXB 4YXDA 1N32T 3S4UA 3Q5XA 4DR3T 5JDHA 1UX4A 1LVFA 3BQKA 2CXFA 4AYID 3ZYMA 2M6BA 2R89A 4IE5A 1T72A 4JI1T 3KINB 2MNHA 2LRKA 5LB7B 4HFCA 5HEHA 2FJDA 4FZMA 4NUVA 5HEJA 5FNVE 3CX7B 4IIJE 4TNVA 5HYAA 3O1IA 2LOPA 2WCAA 2VL8A 3LFMA 1Y01A 2RA1A 3T24A 2JMKA 2X9WA 4KP3C 1YXRA 4EZ4A 4CI2B 3EVYA 3KV6A 3PE0A 5ETWA 2ZFGA 4HGAA 3AA0B 5J1GA 5AQKB 3VKGA 4DIDB 2R4PA 4M1PA 1BR1A 3RYHE 5LYJE 3B13A 4H9OC 1HS7A 1GFPA 1W0BA 4KHZF 1GFQA 5LGTB 1ZP0A 1WYCA 5AQJB 2V5DA 3P7IA 2YU1A 1ZHTA 2CLYC 5L4HA 3PRNA 2Y6XA 3Q2MA 3VY8X 3AA7B 3VZUX 2ZM8A 2X9XA 3L09A 3OTOT 3PDYA 4IHJE 4ILCA 1JNRA 3KV5A 4HWHA 5LNKA 1J1JA 4KRAA 5LBMA 4X1YE 1OSMA 2MYSA 4OYKA 5LOVE 3FZFB 5AQTB 4GYSA 4PW8A 4D65A 2CXLA 4LFCT 3ZMSB 4CI3B 3PUZF 5LMNT 5JRCB 5FXWA 3HW9A 3H37A 4PK4A 4ZXLA 3SRZA 2EHOC 4MALA 4DO0A 2NOXA 4H9SE 1YD8G 4JI8T 2UUBT 3HWBA 5EE2A 3RPUA 1PRNA 5HXSA 4CN4A 3L3PA 2J47A 3IF8B 5B66O 4JCHA 3KVAA 3ZCIA 4DV4T 3O9XA 4I55E 3K8PC 1HG5A 4X1KE 2MHLA 2H3RA 4LSHA 3ZN1B 3OVUA 5EK3A 1WRDA 2XQYA 4UR9A 4CXYA 1IZNB 5AQNB 4TX5A 3O4XE 3I9YA 3SFDA 2XHEB 1QJ9A 2XQ6A 2XTLA 5AQMB 4FQEA 4I0UA 2QVAA 4AI6A 1GFMA 3MK7C 2X9HA 3IA3A 4QKNA 2F1CX 4HWFA 2V6XA 1D1BA 3RX6A 1ZHWA 4HE8A 4YY3T 5LHIB 1HG2A 3AE5A 2HPLA 2VK9A 4GK0E 4XAXB 4Z91A 4BJNA 2E9XA 2CWOA 2JQQA 4ZS3A 4JEHB 3PORA 2B1EA 4AYDC 2CEAA 4ILBA 3QB5A 3MXZA 3FYXA 4AKHA 4B3ST 3QRAA 4WW0A 3A8YC 3PTRB 3EUHA 3OJAA 4D5UA 3N9NA 4UB8O 5AFUK 3DJBA 2EHOB 4HFIA 3VE1A 5HCJA 2V7IA 2XAQB 5AQQB 4OHFA 2W00A 4ZI2C 3Q9DA 1HTJF 2BG9B 4J2CA 4ZEYA 2XJ7A 4UV8B 2BG9A 2IIUA 3VZTX 3LK2A 4DV7T 1XMOT 1CHUA 4TZ4C 8PRNA 6PRNA 3OYZA 3A0BO 2LHRA 3IHRA 4OYJA 4HTEA 4O3ZA 1AJ3A 3FZKB 5DJQC 5HWYA 2YU2A 3MA9A 2XPKA 3UU6A 4DVDA 5JDNA 2PG8A 2WU5A 1BH3A 4P0AA 2VASA 2UXNB 2XE2A 2PTFA 4XZCA 4GK5E 2BDEA 1BT9A 5HWXA 4A56A 5DL7A 2PBIA 3E08A 5AQLB 3DWOX 3SZDA 2KT9A 2Q9QB 2FGRA 5M4YA 1HNWT 4O3XB 2HH7A 4K3CA 4FOZA 3RYFE 4IL9A 4UXNB 1XWMA 2LLYA 2VKOA 3PGUA 3T8OA 4CTDA 5JDQA 1VCTA 3ONJA 4I50E 4LF9T 3L39A 1VOMA 1ZOYA 3LK3B 5FXZA 3FBZA 4RLCA 3ONLC 3NVOA 1PHOA 2VKHA 3BQIA 4YSYA 5LCYA 3ZLIA 2NP9A 5AQFB 4PJJA 4ZOLE 3RH3A 4DR1T 4OX9T 4UVBB 2QRXA 5TISO 4YJ2E 5LJMA 3WAJA 4AYNA 3AAAA 3P4WA 3LK41 4WYVA 3CIRA 1E54A 3RC3A 1I6ZA 5AFUL 3FZLB 1H6S1 5L3CB 3ZEFB 3PJAA 2HN2A 5JRCA 5JQGE 2NW9A 4PJMA 5KX5E 5FY7A 2LT3A 2OLTA 4IE6A 4U9CA 1YQ3A 4AKIA 4DBQA 3EMNX 5LJNA 3K3QC 3KVBA 4JLEA 5C3JA 4FRTA 2VQFT 3LK2B 5EZYE 4HEAA 5FXXA 2BS4A 2XUEA 4HFEA 4B61A 3FZMB 1EZ3A 1Y64B 1D1CA 2LSGA 3QNUA 3RIUA 3CK6A 3JTYA 1HNXT 3AAIA 3D0TA 3LSVA 3H3MA 2CMRA 5AQUB 3CVRA 2LHNA 4TUYE 3CWZB 3I9WA 4MLKA 4K3BA 4E1SA 2E2AA 3FZHB 4GCQA 1XDOA 1NAFA 2N2LA 2WM9A 2X27X 4ZI7E 3AE6A 2AXTO 1WFDA 3EAMA 1FMWA 1OPFA 4EYUA 2O4VA 3GN5A 2ZM0A 5ABFB 2YDRA 1M7KA 2NR4A 2X67A 2ODJA 5KAIO 4CXWA 3RGLA 1MM5A 1GFNA 5JDMA 1YW0A 4C69X 1MMAA 2LRLA 4PJLA 3HL6A 4DV5T 4QXBB 5CA0E 5IYUA 4I43B 2QYWA 4DV3T 2LJLA 4U33A 5CA1E 3I0QA 3CKDA 3PURA 4JI2T 5LGUB 2IAKA 3Q5DA 1HNZT 3KBTA 1FJGT 2LFUA 4ISTA 2BZBA 2BG9C 4ZZCA 2WWUA 2C0SA 5EK4A 3UULA 2WU2A 1ZKEA 1NENA 4G76A 3AEBA 5HEGA 5JR9B 2LOSA 4OK0A 3O1JA 5ABEA 2K5BB 4ANJA 1IZNA 3PGSA 3PJAJ 5LGNB 2CWYA 4FMSA 1S5LO 2DCFA 3RIFA 4QXCB 3VY9X 5DQVA 2FJBA 4DV0T 3AXJB 4NUUA 2PJQA 1UUSA 4ZI3D 2D0UA 2E5LT 2UXBT 2DI4A 3ZMVB 4LMLA 4RJXA 3DTOA 3Q5EA 4FSOA 3P4SA 3AAAB 1OEDA 5JDFA 5AQHB 4LF8T 4LSEA 4QH1A 1Z0PA 3ONXA 4FRXA 2Q9QD 3ZC0A 3NKZA 5ABFA 2BS2A 2LHFA 5C2TA 1V9DA 4P1NA 4F6RC 4MFRA 3VRBA 7PRNA 3WAKA 5DL8A 3C5OA 3BRYA 3WU2O 4DR6T 3C4ZA 2DHRA 5AQOB 3UTKA 4JI6T 2DL1A 4EXTA 1JNZA 3AEFA 3POQA 3I1AA 4A5XA 2LKHA 4COFA 4AFKA 3UUBA 2H89A 3VKHA 3E0ZA 3UAQA 3AE7A 2XY8B 4BJMA 2XTQA 3ZCJA 2G0UA 5ADXL 3WI3A 2UU9T 2KZ7A 2IHR1 4PK5A 2JQ9A 3N2OA 5F8PA 2VWAA 1MMNA 5L2LA 3F2EA 4EV6A 5FL1A 2FGQX 3VHLA 1WR6A 3DZMA 1X79A 2WSSV 1J5WA 2YPVA 5JDPA 3T0SA 4CI1B 4IDOA 4KR4A 3CMLA 2UXDT 3AE1A 1FIOA 5IYZE 2WDRA 4O2BE 4B3TT 4DR4T 5L47A 2B76A 5AQIB 3TLVA 3N2GE 5LG3A 3UU8A 3NZQA 3HKEE 4HWIB 1UX5A 1QJPA 5A1LA 2Y0LA 3HKBE 3AE4A 3ZC1A 2WS3A 2VURA 2X0YA 3LDQB 5L3EB 1G73A 2J4GA 3UU2A 4EOZB 2E9XB 4DUYT 4QH5A 3ZJ1A 1LRZA 1H7CA 4AYMC 2XQ5A 3ZPOA 4DV1T 4X66T 1FEWA 4K0KT 4GKKT 2W80C 1XNRT 3MZKB 4GHBA 2YN6A 5AQRB 4AYEC 2A72A 1KNPA 2XM1A 2FUPA 2XQ8A 1OEDE 3A5XA 2LM9A 2X51A 1Q9GA 4AQYT 4PJNA 2QTKA 1X9BA 3C64A 4GF4A 3V5SA 2M07A 2LSKA 4FT6A 2DWKA 4H9RC 4BA9A 4PJ0O 4X20E 1HXUA 1W9RA 3EHZA 1UCUA 1XDPA 5JR9C 4GKJT 3UU4A 2JQKA 4BAYB 4E7ZA 5LA6E 2IWVA 4HFBA 4Z3TA 4WBOA 1SHZC 4FUVA 4AQFC 3VRAA 1U4QA 3B57A 2SPCA 4JYAT 2EHOA 5AQPB 4IDQA 4QH4A 5IWAT 2Y48B 5JVDE 1UK5A 3RKOA 2NTYA 3VR8A 2A9UA 4A97A 3SY9A 1XNQT 4F4BA 3BRZA 1FMVA 2BVMA 3UT5E 2LKGA 4CXXA 3OBVE 4LSIA 3ANWA 1HFAA 1ZHCA 5FYMA 1XZYA 2WVPA 1E1HB 3I0OA 3POXA 2H7VC 3UQ7A 5LMUT 1HCIA 4AKRB 3RF1A 3ZN0B 3HA4A 3CX6B 2WAUA 4CN6A 1YKEB 3RRWA 2WWVA 1MMDA 4MHCA 2YOEA 4E7SA 1Q9FA 3LJCA 5FXVA 3MACA 4NPPA 5FVKA 3UUMA 5L4EA 4DR2T 2ACZA 5G38A 2KSRA 4EIWA 5E0OA 4WZXA 1OEDB 2PFVA 4X64T 4N78D 5TAOA 3RBHA 3JC6D 3IBPA 2H88A 5HAXA 4QQ1A 5BMVE 2CHNA 1BXWA 4FJOA 2L9QA 1IBMT 2I6HA 2F4VT 3KVDD 1QUUA 2KMFA 1KNZA 2GE4A 1US7B 4NXNT 3VE2A 4H63H 3NSGA 4C4VA 2KC0A 3M65A 5GV0A 3BK9A 4ZHQE 2N9DA 3M3ZB 2XAFB 4JI5T 2HHHT 2XTRA 4EB6E 3ZMTB 3ZT6A 3JCUO 2R6GF 3J7Yq 3P4RA 1MIWA 2D5UA 4QHOA 4O3WA 4ERRA 3ABVA 3DWNA 3T1HT 3VU7H 2XAHB 3K1SA 2IDOB 2R88A 2WMNA 1IJ5A 4YTNA 3RKGA 2JQHA 1OWAA 3AA7A 4YT0A 2CHOA 3BS0A 3RHWA 3PUSA 1YKHB 3CPZA 4TV9E 4AKLA 1KF6A 3PUXF 4DNDA 4N59A 1IJ6A 3SFEA 4IL4A 4XNKA 2D2SA 1I94T 5J2TE 3AECA 4DV6T 1D0ZA 3HOEA 2V8SV 3NJTA 4G63A 5J0ZA 4PR7A 4DMVA 3K3NA 4GOUA 3C51A 4P0BA 3TLWA 2X0LB 1XMQT 1WYBA 1P4TA 4IGUA 3GMIA 5CJ5A 4HN9A 5L3BB 3P50A 3AB3B 2E5VA 5KDMC 4IE0A 4KUMB 4O4IE 1IAPA 2WMOA 3C4XA 4KMCA 3MJXA 2IMLA 3UU3A 5KMGP 3ESLA 5JH7E 3A2SX 5H6RB 2BBJA 1ZHXA 1S94A 4AZLA 2CXDA 3UU5A 4ASKA 5JDGA 4KBMB 2K9AA 4UELA 2IC9A 2WDVA 1T7SA 2D0TA 3ZSSA 5JR9A
chains in the Genus database with same CATH topology
3O9XA 4FSPA 4I55E 5H6QB 3K8PC 1HG5A 4X1IE 4H63V 4X1KE 2DHRA 2MHLA 2H3RA 3UTKA 4LSHA 3ZN1B 5DABA 3VZWX 5EK3A 1T98A 2CE7A 4EXTA 1WRDA 2NTXA 2XQYA 2YNKA 3AA0A 2V7KA 1LVKA 2A2FX 3HKDE 1IZNB 4CXYA 4TX5A 3O4XE 3POQA 3I9YA 3I1AA 2XHEB 4K0UA 5GONE 1QJ9A 3AA1A 2XTLA 3KDSE 5L3GB 4HKAA 4AFKA 4I4TE 2VKDA 4AI6A 1GFMA 3MK7C 5FVNA 2X9HA 2HPJA 3VKHA 2JMMA 5EK2A 4QKNA 3E0ZA 2LSIA 3DA3A 2K48A 3QUJA 3UAQA 2V1DB 4PFPA 5JREA 1D1BA 2K24A 4BJMA 3RX6A 2XTQA 3ZCJA 3GN5B 4HE8A 1ZHWA 3GP6A 3LK3A 2G0UA 2MBGA 5ADXL 2VKJA 5LHIB 2NWBA 1HG2A 1B7TA 3EDUA 3WI3A 2C5JA 2HPLA 2VK9A 4GK0E 4XAXB 4BJNA 3FHNA 2XE3A 2KZ7A 2LEHA 2E9XA 2V26A 4B6XA 2CWOA 5HXCA 2JQQA 4ZS3A 2VB6A 4JEHB 1O3XA 4PK5A 2A3DA 3PORA 3LBXA 3TZGA 3N2OA 2B1EA 4TV8E 5F8PA 5LG4A 3N9OA 2VWAA 2Y0KA 3DA4A 4AYDC 2CEAA 2F1TA 1MMNA 5L2LA 3UFEA 3F2EA 3MXZA 3ZJ2A 3FYXA 4PFOA 5C8YE 4QXHB 5LHGB 4AKHA 3K19A 3PU8A 4UF0A 2KNDA 4ILUA 4O2AE 2XE1A 2FGQX 3QRAA 4WW0A 1WR6A 3H3AA 3PTRB 3VHLA 2M67A 3EUHA 3P8CD 3OJAA 2XAJB 3ZMZB 1X79A 2WSSV 4D5UA 3N9NA 2YPVA 5JDPA 5AFUK 4O4UA 3T0SA 4CI1B 3DJBA 2EHOB 3CMLA 4ADZA 2X68A 5HXEA 2P9BA 4KR4A 3VE1A 2E9XC 3WI4A 2Y0HA 4HFVA 1D0YA 1FIOA 2N2NA 3U78A 4YHJA 5IYZE 1HF8A 4CZZB 3R84B 2LSJA 4O2BE 2V7IA 2Q9QC 2XAQB 4AQFA 3HR0A 4OFZA 3W15B 4OHFA 2W00A 3AAEB 4ZI2C 4FI5A 3ZYKA 1G8XA 2V7MA 2X9YA 5HXRA 3N2GE 3Q9DA 1HTJF 3NZQA 2PRNA 4J2CA 3HKEE 2KINB 2JMHA 1UX5A 4JFBA 1QJPA 5A1LA 4UV8B 2E9XD 2Y0LA 3HKBE 3ZC1A 5FP3A 2E8IA 3GA8A 4ZS2A 5LHHB 3SWHA 3VZTX 3LK2A 2ODVA 3NZPA 1BR4A 4C91A 4AKGA 3ZYLA 5L3EB 4TZ4C 3C4WA 2M06A 1G73A 3UU2A 4O4HE 8PRNA 4EOZB 2E9XB 1QSDA 3NRYA 6PRNA 5DL5A 3EDVA 3ZJ1A 1LRZA 1VRBA 4UVAB 3PUAA 1H7CA 2QGSA 4AYMC 4RLBA 2V7LA 3CQCB 3OYZA 3ZPOA 1BR0A 1FEWA 2W80C 2LHRA 3IHRA 4OYJA 4HTEA 4O3ZA 3MKDA 1AJ3A 3TKLB 3UUNA 3MZKB 5DJQC 4ZI2D 5HWYA 1MM4A 2N2MA 3SOLA 4TN7B 2YU2A 4GHBA 3MA9A 2JJ9A 5DQWA 4KR8A 4DVDA 5JDNA 2KDYA 2XG6A 4O4LE 4AYEC 2A72A 2H7OA 2PG8A 1BH3A 4L0RA 4PAGA 2ERVA 2J1DG 5HXHA 1D0XA 4P0AA 3PQUA 4QWNB 3A5XA 3O0EA 2LM9A 2VASA 5DL6A 2X51A 2IC6A 2UXNB 4JEUB 2XE2A 1Q9GA 4XZCA 4GK5E 2BDEA 1BT9A 5HWXA 3N9QA 4A56A 4PJNA 4C90A 5DL7A 5L3DB 3E08A 2PBIA 2RP4A 2Y8DA 3C64A 3AVRA 3LBXB 2QTKA 2Z6EA 4GF4A 5FY0A 3V5SA 2M07A 2CLYB 2LSKA 1ZV4X 4FT6A 3SZDA 4L5GA 2CCQA 2KT9A 2CA5A 2L8KA 4XBFB 2Y7SA 3HOLA 2DWKA 3JC6C 2Q9QB 3CQGB 2FGRA 4FZNA 5M4YA 4O3XB 4H9RC 2HH7A 4BA9A 4X20E 1HXUA 4FOZA 2KWHA 2ODUA 3RYFE 1NWMX 3ETUA 1UCUA 1CUNA 4UXNB 3PUQA 4L9IA 3G7GA 3GWHA 2VKOA 3DP7A 4GIWA 5F3JA 3AA6A 3KFWX 5JR9C 4AUIA 5PRNA 3QK6A 3POUA 3T20A 3SS1A 3RC8A 2K0LA 3AAEA 3T8OA 4BAYB 3WI5A 3NBXX 4E7ZA 5LA6E 5JDQA 2J1NA 3F57A 1OXZA 3KV9A 3ANWB 4MBQA 4Z3TA 1MIYA 4WBOA 1SHZC 2JPFA 4DBRA 4FUVA 4AQFC 3K3OA 4I50E 5LXTE 3OYXA 4D64A 1U4QA 1VOMA 2SPCA 3AA6B 3B57A 3LK3B 5FXZA 2EHOA 2YK0A 5G26A 3FBZA 2F1VA 4RLCA 3SYBA 4WNKA 1PHOA 4WBNE 3QC9A 3BQIA 2VKHA 4IE7A 2Y48B 5LCYA 4GYRA 4YJ3E 5JVDE 3ZLIA 2NP9A 4ZOLE 4PK6A 4PJJA 2NTYA 3RKOA 3RH3A 3SZVA 4O4XA 2NW7A 4YFSA 4UF0B 2ZM2A 3N9MA 4UVBB 2BVLA 4P09A 3RYIE 3KV4A 4EZHA 3SY9A 4F4BA 2XAGB 1KK7A 4YJ2E 1U5PA 5LJMA 5LP6E 3WAJA 3SYSA 4LSFA 4AYNA 1FMVA 2BVMA 3UT5E 4H9QC 4CXXA 3ZMUB 2NW8A 3AAAA 3LK41 2CM0A 5J2UE 2YEVC 2OA5A 4EAHA 3C98B 4XNLA 3CX8B 1E54A 3OBVE 3RC3A 3HI2A 2GK9A 4LSIA 3SY7A 3ANWA 2V7JA 5AFUL 1HFAA 5L3CB 3OKQA 1H6S1 2KLQA 2DNXA 3N5LA 1ZHCA 3ZEFB 4H9NC 3V8UA 4ISSA 5FYMA 4Z8XA 4FZLA 4YLHA 4AXPA 4O3YA 1MNDA 1E1HB 3I0OA 3POXA 2H7VC 5JQGE 3LG7A 3J9X1 2NW9A 4EYYR 5JRCA 4QX7B 4PJMA 4UEMA 3RYCE 5KX5E 5FY7A 2ZLDA 5D5DA 2LT3A 1HCIA 2WBLA 4IE6A 1G90A 2Q9QA 4U9CA 4AKIA 4AKRB 3IEEA 4DBQA 3EMNX 3FXEB 2J4UP 3ZN0B 3HA4A 4IE4A 3CX6B 2WAUA 5LJNA 3K3QC 4IDZA 5T5FA 4G75A 3KVBA 4JLEA 1YKEB 2KZ7B 3RRWA 2XASB 3CQXC 4FRTA 4O8SA 1MMDA 4MHCA 3LK2B 1GFOA 4AKMA 4E7SA 4RJWA 1Q9FA 5ADXK 3LJCA 2N1GA 5EZYE 5FXVA 3MACA 4HEAA 5FXXA 2XUEA 2ES0A 2XMXA 4B61A 2ZLYA 5FMNA 3FXDB 4CQIA 1Y64B 1EZ3A 1D1CA 2LSGA 3UUMA 3JTYA 3N9LA 1BR2A 2YINA 3O1HA 4V1Av 2C5KT 1THQA 2IW5B 1SA0E 2C5IT 2MTQA 3AAIA 3D0TA 2QA7A 2K4TA 3F31A 2CMRA 4EIWA 3CVRA 5E0OA 4N58A 1HXXA 2LHNA 4TUYE 3CWZB 2PFVA 2KXPA 3I9WA 4N78D 4MLKA 5TAOA 4O49A 3RBHA 2UXXB 4E1SA 3Q5WA 3JC6D 2W81C 3IBPA 3S4UA 1MNEA 5HAXA 3Q5XA 3PQSA 1LKXA 4GCQA 4QQ1A 1NAFA 3N9PA 5BMVE 4PUXA 5JDHA 1BXWA 1UX4A 1LVFA 2WM9A 3BQKA 2CXFA 4FJOA 2N2LA 2X27X 4AYID 5LBQB 3E22E 3ZYMA 4ZI7E 2XE5A 2L9QA 2Y2XA 3KVDD 3RRCA 4IE5A 1QUUA 2KMFA 1FMWA 1OPFA 2PORA 4EYUA 3KINB 2LSYA 2O4VA 1KNZA 3GN5A 3UPGA 2DLRA 2ZM0A 2GE4A 1US7B 4O4JE 2MOZA 2MNHA 3VE2A 4H63H 3NSGA 4PNIA 3M65A 5JDLA 2KC0A 3BK9A 4ZHQE 5GV0A 3UUXB 2N9DA 2X67A 2ODJA 4GCPA 2XAFB 4CXWA 2W0GA 4FZMA 4NUVA 1MM5A 1GFNA 2XTRA 5FNVE 3CX7B 1YW0A 5IHYA 5JDMA 4C69X 1MMAA 4IIJE 4EB6E 3ZMTB 4PJLA 5HYAA 3O1IA 2LOPA 3HL6A 3U3IA 2VL8A 3LFMA 4QXBB 5CA0E 3J7Yq 4E1TA 5IYUA 3NRXA 4UIGA 4I43B 1MIWA 2W61A 2RA1A 3T24A 2JMKA 2D5UA 4G2AA 2X9WA 2LJLA 4KP3C 4QHOA 4EZ4A 4CI2B 4ERRA 4O3WA 5CA1E 3EVYA 3KV6A 3PE0A 3I0QA 3CKDA 3PURA 5ETWA 3VU7H 2XAHB 3N2KE 5LGUB 1ZHYA 2ZFGA 4HGAA 2IAKA 3AA0B 2DWGA 2WMNA 3KBTA 1IJ5A 2ACXA 2LFUA 3V5UA 4ISTA 1WLXA 2BZBA 5J1GA 4DMWA 3VKGA 2WWUA 2C0SA 4U74A 5EK4A 1MMGA 3R6NA 3UULA 4M1PA 2I59A 1BR1A 3RYHE 5LYJE 1ZKEA 3LK42 1OWAA 3B13A 3AA7A 4H9OC 4G76A 5JR9B 1HS7A 1GFPA 3PUGA 2LOSA 3PUSA 4OK0A 1MIVA 1YKHB 2X66A 1GFQA 3AA1B 5LGTB 3CPZA 3O1JA 4TV9E 3HKCE 2JRKA 1WYCA 2K5BB 4ANJA 2EHOD 3P7IA 4H9PC 1IZNA 2YU1A 1ZHTA 4AKLA 4DNDA 4N59A 2CLYC 1IJ6A 5LGNB 2CWYA 4FMSA 3PRNA 1HXTA 2Y6XA 4XNKA 2DCFA 3Q2MA 2D2SA 3VY8X 4BUMX 3AA7B 4QXCB 1S35A 2ZM8A 5DQVA 3VY9X 3VZUX 5J2TE 2X9XA 3L09A 3ETVA 1MPFA 1D0ZA 3HOEA 4G63A 4NUUA 2PJQA 4ZI3D 1ZHZA 2D0UA 3PDYA 3C50A 4DMVA 4IHJE 3FBLA 3K3NA 4JUYA 4GOUA 2DI4A 3ZMVB 2W62A 2OMFA 4RJXA 3C51A 4P0BA 3DTOA 4FSOA 2X0LB 3KV5A 5LNKA 1WYBA 2LE8A 4KRAA 3AAAB 1P4TA 2W63A 4IGUA 4X1YE 5LBMA 1OSMA 3AVSA 2MYSA 4OYKA 5JDFA 3GMIA 5LOVE 5CB4E 4GYSA 4HN9A 5L3BB 4PW8A 4U72A 4D65A 4LSEA 1YS5A 3AB3B 2CXLA 4AKRA 3ZMSB 4CI3B 1Z0PA 4ZI3C 4AQGA 5KDMC 4QX8B 4IE0A 3ONXA 4KUMB 4FESA 4O4IE 1IAPA 2WMOA 5L3FB 3C4XA 2ZMAA 2Q9QD 3KBUA 4UV9B 4FRXA 4RL9A 3FB2A 3ZC0A 5JRCB 1ORMA 2LHFA 5FXWA 4KMCA 3MJXA 1V9DA 3HW9A 3H37A 4PK4A 5KMGP 3ESLA 3SRZA 4F6RC 5JH7E 2EHOC 4MFRA 3A2SX 1QJ8A 4MALA 3QRCA 5H6RB 4DO0A 2NOXA 5FY1A 7PRNA 3WAKA 5DL8A 4H9SE 1HX8A 1YD8G 1D1AA 1ZHXA 2L3LA 3HWBA 3C5OA 5EE2A 1S94A 4AZLA 3RPUA 2CXDA 4ASKA 1PRNA 5HXSA 3PU3A 5JDGA 4GCSA 4KBMB 2KWIB 3BQLA 2K9AA 4UELA 4UVCB 3L3PA 2KXPB 1ZEEA 2IC9A 3IF8B 2D0TA 5JR9A 4JCHA 3KVAA 3ZCIA 3C4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AKR B;  3AA6 B;  1IZN A;  3LK2 A;  3LK3 B;  3AA0 B;  5AFU L;  3AAA B;  2KZ7 B;  2KXP A;  3AA0 A;  3AA7 B;  1IZN B;  3LK2 B;  3AAE B;  3AA6 A;  3LK3 A;  5ADX L;  5ADX K;  3LK4 2;  3AAE A;  4AKR A;  3AA1 A;  3AA7 A;  5AFU K;  2KZ7 A;  2KXP B;  3AA1 B;  3AAA A;  3LK4 1; 
#chains in the Genus database with same CATH topology
 5GTH O;  4FSP A;  5H6Q B;  2CE7 A;  2NTX A;  1LVK A;  2A2F X;  1Z8U A;  3HKD E;  2WDQ A;  4K0U A;  3AA1 A;  3PF1 A;  5AQV B;  4IL6 O;  2CPT A;  4HKA A;  2VQE T;  2VKD A;  2BBH A;  4U2Z A;  4LFB T;  2JMM A;  3RQU A;  5EK2 A;  3DA3 A;  2K48 A;  3QUJ A;  4PFP A;  5JRE A;  2K24 A;  2W67 A;  3GN5 B;  3T1Y T;  3LK3 A;  2MBG A;  5BR8 T;  2NWB A;  1B7T A;  3EDU A;  2C5J A;  3ZKR A;  2XE3 A;  2LEH A;  3AE8 A;  2V26 A;  3RI5 A;  4B6X A;  5HXC A;  2A3D A;  3LBX A;  2WP9 A;  3TZG A;  3N9O A;  2Y0K A;  4IDP A;  2J62 A;  2JQY A;  2LM2 A;  3UFE A;  5C8Y E;  4N75 A;  4IRE A;  4QXH B;  5LHG B;  4UF0 A;  1E7P A;  2KND A;  4O2A E;  1N36 T;  2M67 A;  3P8C D;  2XAJ B;  3ZMZ B;  3QB5 K;  4O4U A;  4ADZ A;  2P9B A;  4A98 A;  2E9X C;  4HFV A;  2R4O A;  4TWD A;  2AXD S;  2N2N A;  3U78 A;  4YHJ A;  1HF8 A;  4CZZ B;  2Q9Q C;  4EED A;  3HR0 A;  4OFZ A;  2W2U A;  3ZYK A;  1G8X A;  2V7M A;  2X9Y A;  5HXR A;  2KIN B;  2JMH A;  4JFB A;  5FP3 A;  2E8I A;  4ZS2 A;  5LHH B;  3SWH A;  3UQ4 A;  3NZP A;  1BR4 A;  4C91 A;  4AIU A;  4KI0 F;  2M06 A;  4LF4 T;  1QSD A;  4Z90 A;  1VRB A;  4UVA B;  3PUA A;  2QGS A;  2FBW A;  2MAW A;  3CQC B;  2XQ9 A;  1BR0 A;  3MKD A;  3TLS A;  2N2M A;  1NEK A;  3SOL A;  4TN7 B;  2JJ9 A;  5DQW A;  2KDY A;  4L0R A;  5HEO A;  5HXH A;  1D0X A;  3PQU A;  4QWN B;  5DL6 A;  2X9K A;  4C90 A;  5L3D B;  3LBX B;  2RP4 A;  2Y8D A;  3AVR A;  3JAE A;  2BG9 E;  3AEA A;  4EEB A;  2CLY B;  1KEY A;  1ZV4 X;  2CCQ A;  4XBF B;  3HOL A;  2OV9 A;  2V6Y A;  2UUC T;  2ODU A;  3ETU A;  1CUN A;  3QOF A;  4LMK A;  4L9I A;  3G7G A;  4GIW A;  3AA6 A;  3KFW X;  4AUI A;  3POU A;  3UFG A;  3RC8 A;  2K0L A;  3AAE A;  1T1L A;  3NBX X;  1KNR A;  1OXZ A;  3KV9 A;  3ANW B;  4C00 A;  3K3O A;  3OYX A;  4D64 A;  3AA6 B;  2XQ3 A;  2YK0 A;  2F1V A;  3EAB A;  4WNK A;  4WBN E;  3QC9 A;  1KFY A;  2IWW A;  4YJ3 E;  3PGR A;  4O4X A;  2NW7 A;  4YFS A;  2BVL A;  4P09 A;  3KV4 A;  3SYS A;  4LSF A;  3TLU A;  2CM0 A;  5J2U E;  1J5E T;  5B5E O;  4XNL A;  5CGM A;  3HI2 A;  2GK9 A;  3SY7 A;  2V7J A;  2DNX A;  3N5L A;  4X62 T;  4H9N C;  3RIA A;  2R8A A;  3V8U A;  4ISS A;  4Z8X A;  4FZL A;  4AXP A;  1UGO A;  4O3Y A;  4CN1 A;  2F1T A;  3LG7 A;  4QX7 B;  4UEM A;  3RYC E;  2ZLD A;  5D5D A;  1W0A A;  2WBL A;  1G90 A;  2YKS A;  4IE4 A;  1IBK T;  3ZT5 A;  4YTM A;  4HFD A;  2KZ7 B;  2XZE A;  3CQX C;  2R4L A;  4O8S A;  1GFO A;  4AKM A;  2V5C A;  5G3A A;  2ES0 A;  2XMX A;  2ZLY A;  3JCF A;  1BR2 A;  2YIN A;  1SUM B;  3O1H A;  1DU2 A;  1SA0 E;  2C5I T;  2MTQ A;  1N34 T;  4N58 A;  4LF7 T;  4UB6 O;  5AQG B;  2KXP A;  4O49 A;  4YSZ A;  3Q5W A;  2W81 C;  1MNE A;  1OED C;  3PQS A;  1LKX A;  4Q25 A;  3N9P A;  4PUX A;  5KXJ A;  4NIQ A;  1UUR A;  5LBQ B;  3E22 E;  2XE5 A;  2WQY A;  2CBJ A;  1IBL T;  2Y2X A;  1M62 A;  3RRC A;  4U7I A;  2POR A;  2LSY A;  3UPG A;  3A7M A;  2DLR A;  4O4J E;  2MOZ A;  4PNI A;  5JDL A;  3UUX B;  4U7Y A;  4GCP A;  2W0G A;  5IHY A;  2XQ7 A;  5FL0 A;  3U3I A;  4E1T A;  3NRX A;  4UIG A;  2W61 A;  4G2A A;  4LF6 T;  3N2K E;  1ZHY A;  2DWG A;  2WJQ A;  2ACX A;  3V5U A;  1WLX A;  4DMW A;  4C4V B;  4U74 A;  3R6N A;  1MMG A;  2I59 A;  3LK4 2;  3PUG A;  1MIV A;  2X66 A;  3AA1 B;  3HKC E;  2JRK A;  2EHO D;  4H9P C;  3RLF F;  3AE9 A;  1HXT A;  3AXJ A;  4BUM X;  1S35 A;  4ZZB A;  2RPA A;  3ETV A;  1MPF A;  1ZHZ A;  3C50 A;  3FBL A;  4JUY A;  2W62 A;  2OMF A;  3AE2 A;  3OPC A;  2LE8 A;  2W63 A;  3AVS A;  5ABG A;  4HFH A;  5CB4 E;  4U72 A;  1YS5 A;  4AKR A;  4JBW F;  4ZI3 C;  4AQG A;  1SE7 A;  4QX8 B;  1GQE A;  4FES A;  5L3F B;  3X1D A;  2ZMA A;  3KBU A;  4RL9 A;  4UV9 B;  3FB2 A;  1ORM A;  4YHH T;  2D9D A;  3PUY F;  1QJ8 A;  3QRC A;  2VL0 A;  5FY1 A;  1HX8 A;  1D1A A;  2L3L A;  1N33 T;  2FJA A;  2BKP A;  3PU3 A;  4GCS A;  2KWI B;  3BQL A;  5IUX A;  2XQ4 A;  4UVC B;  4AIS A;  2KXP B;  1ZEE A;  3KZI O;  4X1I E;  1WR0 A;  4H63 V;  2UXC T;  3ZST A;  5DAB A;  3VZW X;  1T98 A;  4JI3 T;  4TWF A;  3AA0 A;  2YNK A;  2V7K A;  3G06 A;  3NWI A;  2M6I A;  3TLT A;  5GON E;  3KDS E;  4NXM T;  4TWH A;  5L3G B;  5FKY A;  4I4T E;  4DR5 T;  5FVN A;  2HPJ A;  2LSI A;  2V1D B;  3GP6 A;  5KAF O;  2VKJ A;  4B3M T;  3FHN A;  3P4Q A;  4B3R T;  4KHP T;  2VB6 A;  1O3X A;  4TV8 E;  5LG4 A;  3DA4 A;  4X65 T;  3ZJ2 A;  2AE9 A;  4PFO A;  3K19 A;  3PU8 A;  5E79 O;  3ZT7 A;  2BKN A;  4ILU A;  3RIU C;  2XE1 A;  2UUA T;  3H3A A;  4DV2 T;  5H2F O;  3JAF A;  1R8I A;  5HXE A;  2X68 A;  2XM2 A;  3WI4 A;  2Y0H A;  1D0Y A;  3R84 B;  2LSJ A;  4AQF A;  2WB5 A;  4F8H A;  3W15 B;  2YDQ A;  3AAE B;  1WCR A;  4FI5 A;  2XSA A;  2PRN A;  2WZH A;  3AEG A;  5JTG A;  3PUV F;  5HCM A;  2E9X D;  1L0V A;  2V6Y B;  3GA8 A;  2ODV A;  2BS3 A;  4AKG A;  3ZYL A;  3C4W A;  5HEU A;  3AED A;  4O4H E;  2ZM6 T;  3NRY A;  5DL5 A;  1HX1 B;  3EDV A;  4HWD A;  4YTP A;  2K3W A;  3P4P A;  4RLB A;  2V7L A;  2BKO A;  4N74 A;  5F5W A;  3RQW A;  1VCS A;  3TKL B;  3UUN A;  1QLB A;  4ZI2 D;  1MM4 A;  4KR8 A;  2XG6 A;  4O4L E;  4U2Y A;  2W4X A;  2H7O A;  4PAG A;  4JI4 T;  2ERV A;  2J1D G;  4EGW A;  4LF5 T;  3O0E A;  2IC6 A;  4JEU B;  2CBI A;  2VVS A;  3N9Q A;  2Z6E A;  5FY0 A;  4L5G A;  4JI7 T;  2CA5 A;  2L8K A;  4JV5 T;  2Y7S A;  3JC6 C;  4FZN A;  3CQG B;  2X0H A;  2FJE A;  3PUW F;  4ILA A;  2KWH A;  1NWM X;  3PUQ A;  3GWH A;  3DP7 A;  5F3J A;  4IT4 A;  5PRN A;  3QK6 A;  3SS1 A;  2CRB A;  3WI5 A;  2J1N A;  3F57 A;  2WJR A;  1E2A A;  4MBQ A;  1MIY A;  2JPF A;  4DBR A;  2XQA A;  5LXT E;  4DUZ T;  2I0M A;  5G26 A;  2WY2 A;  5CFB A;  3AE3 A;  3SYB A;  5FVL A;  5GTI O;  1T16 A;  4IE7 A;  3B5M A;  4GYR A;  3L8R A;  2HN1 A;  4PK6 A;  3SZV A;  5AQS B;  4UF0 B;  2ZM2 A;  3N9M A;  3RYI E;  4YSX A;  4EZH A;  5G39 A;  2XAG B;  1KK7 A;  3T20 A;  1U5P A;  5LP6 E;  4H9Q C;  2VVN A;  3ZMU B;  2NW8 A;  2YEV C;  2IUB A;  2OA5 A;  4EAH A;  3C98 B;  4U31 A;  3CX8 B;  3OKQ A;  2MPK A;  2KLQ A;  3VR9 A;  4YLH A;  1MND A;  2R4N A;  3J9X 1;  4U3C A;  4EYY R;  2Q9Q A;  4X5T A;  3IEE A;  3FXE B;  2J4U P;  4KX6 A;  1T8B A;  4TNW A;  4IDZ A;  5T5F A;  4G75 A;  1YQ4 A;  3AEE A;  4LFA T;  1HR0 T;  2XAS B;  2W66 A;  4RJW A;  4DR7 T;  5ADX K;  2N1G A;  4HWC A;  3JAD A;  5FMN A;  3FXD B;  4CQI A;  3N9L A;  3A0H O;  4IDN A;  4V1A v;  2C5K T;  1THQ A;  2IW5 B;  2YDS A;  2QA7 A;  2K4T A;  3F31 A;  1W09 A;  3PV0 F;  4LMJ A;  2JIW A;  1HXX A;  3EI0 A;  5ABH A;  2WZI A;  4JI0 T;  2XSB A;  2UXX B;  4YXD A;  1N32 T;  3S4U A;  3Q5X A;  4DR3 T;  5JDH A;  1UX4 A;  1LVF A;  3BQK A;  2CXF A;  4AYI D;  3ZYM A;  2M6B A;  2R89 A;  4IE5 A;  1T72 A;  4JI1 T;  3KIN B;  2MNH A;  2LRK A;  5LB7 B;  4HFC A;  5HEH A;  2FJD A;  4FZM A;  4NUV A;  5HEJ A;  5FNV E;  3CX7 B;  4IIJ E;  4TNV A;  5HYA A;  3O1I A;  2LOP A;  2WCA A;  2VL8 A;  3LFM A;  1Y01 A;  2RA1 A;  3T24 A;  2JMK A;  2X9W A;  4KP3 C;  1YXR A;  4EZ4 A;  4CI2 B;  3EVY A;  3KV6 A;  3PE0 A;  5ETW A;  2ZFG A;  4HGA A;  3AA0 B;  5J1G A;  5AQK B;  3VKG A;  4DID B;  2R4P A;  4M1P A;  1BR1 A;  3RYH E;  5LYJ E;  3B13 A;  4H9O C;  1HS7 A;  1GFP A;  1W0B A;  4KHZ F;  1GFQ A;  5LGT B;  1ZP0 A;  1WYC A;  5AQJ B;  2V5D A;  3P7I A;  2YU1 A;  1ZHT A;  2CLY C;  5L4H A;  3PRN A;  2Y6X A;  3Q2M A;  3VY8 X;  3AA7 B;  3VZU X;  2ZM8 A;  2X9X A;  3L09 A;  3OTO T;  3PDY A;  4IHJ E;  4ILC A;  1JNR A;  3KV5 A;  4HWH A;  5LNK A;  1J1J A;  4KRA A;  5LBM A;  4X1Y E;  1OSM A;  2MYS A;  4OYK A;  5LOV E;  3FZF B;  5AQT B;  4GYS A;  4PW8 A;  4D65 A;  2CXL A;  4LFC T;  3ZMS B;  4CI3 B;  3PUZ F;  5LMN T;  5JRC B;  5FXW A;  3HW9 A;  3H37 A;  4PK4 A;  4ZXL A;  3SRZ A;  2EHO C;  4MAL A;  4DO0 A;  2NOX A;  4H9S E;  1YD8 G;  4JI8 T;  2UUB T;  3HWB A;  5EE2 A;  3RPU A;  1PRN A;  5HXS A;  4CN4 A;  3L3P A;  2J47 A;  3IF8 B;  5B66 O;  4JCH A;  3KVA A;  3ZCI A;  4DV4 T;  3O9X A;  4I55 E;  3K8P C;  1HG5 A;  4X1K E;  2MHL A;  2H3R A;  4LSH A;  3ZN1 B;  3OVU A;  5EK3 A;  1WRD A;  2XQY A;  4UR9 A;  4CXY A;  1IZN B;  5AQN B;  4TX5 A;  3O4X E;  3I9Y A;  3SFD A;  2XHE B;  1QJ9 A;  2XQ6 A;  2XTL A;  5AQM B;  4FQE A;  4I0U A;  2QVA A;  4AI6 A;  1GFM A;  3MK7 C;  2X9H A;  3IA3 A;  4QKN A;  2F1C X;  4HWF A;  2V6X A;  1D1B A;  3RX6 A;  1ZHW A;  4HE8 A;  4YY3 T;  5LHI B;  1HG2 A;  3AE5 A;  2HPL A;  2VK9 A;  4GK0 E;  4XAX B;  4Z91 A;  4BJN A;  2E9X A;  2CWO A;  2JQQ A;  4ZS3 A;  4JEH B;  3POR A;  2B1E A;  4AYD C;  2CEA A;  4ILB A;  3QB5 A;  3MXZ A;  3FYX A;  4AKH A;  4B3S T;  3QRA A;  4WW0 A;  3A8Y C;  3PTR B;  3EUH A;  3OJA A;  4D5U A;  3N9N A;  4UB8 O;  5AFU K;  3DJB A;  2EHO B;  4HFI A;  3VE1 A;  5HCJ A;  2V7I A;  2XAQ B;  5AQQ B;  4OHF A;  2W00 A;  4ZI2 C;  3Q9D A;  1HTJ F;  2BG9 B;  4J2C A;  4ZEY A;  2XJ7 A;  4UV8 B;  2BG9 A;  2IIU A;  3VZT X;  3LK2 A;  4DV7 T;  1XMO T;  1CHU A;  4TZ4 C;  8PRN A;  6PRN A;  3OYZ A;  3A0B O;  2LHR A;  3IHR A;  4OYJ A;  4HTE A;  4O3Z A;  1AJ3 A;  3FZK B;  5DJQ C;  5HWY A;  2YU2 A;  3MA9 A;  2XPK A;  3UU6 A;  4DVD A;  5JDN A;  2PG8 A;  2WU5 A;  1BH3 A;  4P0A A;  2VAS A;  2UXN B;  2XE2 A;  2PTF A;  4XZC A;  4GK5 E;  2BDE A;  1BT9 A;  5HWX A;  4A56 A;  5DL7 A;  2PBI A;  3E08 A;  5AQL B;  3DWO X;  3SZD A;  2KT9 A;  2Q9Q B;  2FGR A;  5M4Y A;  1HNW T;  4O3X B;  2HH7 A;  4K3C A;  4FOZ A;  3RYF E;  4IL9 A;  4UXN B;  1XWM A;  2LLY A;  2VKO A;  3PGU A;  3T8O A;  4CTD A;  5JDQ A;  1VCT A;  3ONJ A;  4I50 E;  4LF9 T;  3L39 A;  1VOM A;  1ZOY A;  3LK3 B;  5FXZ A;  3FBZ A;  4RLC A;  3ONL C;  3NVO A;  1PHO A;  2VKH A;  3BQI A;  4YSY A;  5LCY A;  3ZLI A;  2NP9 A;  5AQF B;  4PJJ A;  4ZOL E;  3RH3 A;  4DR1 T;  4OX9 T;  4UVB B;  2QRX A;  5TIS O;  4YJ2 E;  5LJM A;  3WAJ A;  4AYN A;  3AAA A;  3P4W A;  3LK4 1;  4WYV A;  3CIR A;  1E54 A;  3RC3 A;  1I6Z A;  5AFU L;  3FZL B;  1H6S 1;  5L3C B;  3ZEF B;  3PJA A;  2HN2 A;  5JRC A;  5JQG E;  2NW9 A;  4PJM A;  5KX5 E;  5FY7 A;  2LT3 A;  2OLT A;  4IE6 A;  4U9C A;  1YQ3 A;  4AKI A;  4DBQ A;  3EMN X;  5LJN A;  3K3Q C;  3KVB A;  4JLE A;  5C3J A;  4FRT A;  2VQF T;  3LK2 B;  5EZY E;  4HEA A;  5FXX A;  2BS4 A;  2XUE A;  4HFE A;  4B61 A;  3FZM B;  1EZ3 A;  1Y64 B;  1D1C A;  2LSG A;  3QNU A;  3RIU A;  3CK6 A;  3JTY A;  1HNX T;  3AAI A;  3D0T A;  3LSV A;  3H3M A;  2CMR A;  5AQU B;  3CVR A;  2LHN A;  4TUY E;  3CWZ B;  3I9W A;  4MLK A;  4K3B A;  4E1S A;  2E2A A;  3FZH B;  4GCQ A;  1XDO A;  1NAF A;  2N2L A;  2WM9 A;  2X27 X;  4ZI7 E;  3AE6 A;  2AXT O;  1WFD A;  3EAM A;  1FMW A;  1OPF A;  4EYU A;  2O4V A;  3GN5 A;  2ZM0 A;  5ABF B;  2YDR A;  1M7K A;  2NR4 A;  2X67 A;  2ODJ A;  5KAI O;  4CXW A;  3RGL A;  1MM5 A;  1GFN A;  5JDM A;  1YW0 A;  4C69 X;  1MMA A;  2LRL A;  4PJL A;  3HL6 A;  4DV5 T;  4QXB B;  5CA0 E;  5IYU A;  4I43 B;  2QYW A;  4DV3 T;  2LJL A;  4U33 A;  5CA1 E;  3I0Q A;  3CKD A;  3PUR A;  4JI2 T;  5LGU B;  2IAK A;  3Q5D A;  1HNZ T;  3KBT A;  1FJG T;  2LFU A;  4IST A;  2BZB A;  2BG9 C;  4ZZC A;  2WWU A;  2C0S A;  5EK4 A;  3UUL A;  2WU2 A;  1ZKE A;  1NEN A;  4G76 A;  3AEB A;  5HEG A;  5JR9 B;  2LOS A;  4OK0 A;  3O1J A;  5ABE A;  2K5B B;  4ANJ A;  1IZN A;  3PGS A;  3PJA J;  5LGN B;  2CWY A;  4FMS A;  1S5L O;  2DCF A;  3RIF A;  4QXC B;  3VY9 X;  5DQV A;  2FJB A;  4DV0 T;  3AXJ B;  4NUU A;  2PJQ A;  1UUS A;  4ZI3 D;  2D0U A;  2E5L T;  2UXB T;  2DI4 A;  3ZMV B;  4LML A;  4RJX A;  3DTO A;  3Q5E A;  4FSO A;  3P4S A;  3AAA B;  1OED A;  5JDF A;  5AQH B;  4LF8 T;  4LSE A;  4QH1 A;  1Z0P A;  3ONX A;  4FRX A;  2Q9Q D;  3ZC0 A;  3NKZ A;  5ABF A;  2BS2 A;  2LHF A;  5C2T A;  1V9D A;  4P1N A;  4F6R C;  4MFR A;  3VRB A;  7PRN A;  3WAK A;  5DL8 A;  3C5O A;  3BRY A;  3WU2 O;  4DR6 T;  3C4Z A;  2DHR A;  5AQO B;  3UTK A;  4JI6 T;  2DL1 A;  4EXT A;  1JNZ A;  3AEF A;  3POQ A;  3I1A A;  4A5X A;  2LKH A;  4COF A;  4AFK A;  3UUB A;  2H89 A;  3VKH A;  3E0Z A;  3UAQ A;  3AE7 A;  2XY8 B;  4BJM A;  2XTQ A;  3ZCJ A;  2G0U A;  5ADX L;  3WI3 A;  2UU9 T;  2KZ7 A;  2IHR 1;  4PK5 A;  2JQ9 A;  3N2O A;  5F8P A;  2VWA A;  1MMN A;  5L2L A;  3F2E A;  4EV6 A;  5FL1 A;  2FGQ X;  3VHL A;  1WR6 A;  3DZM A;  1X79 A;  2WSS V;  1J5W A;  2YPV A;  5JDP A;  3T0S A;  4CI1 B;  4IDO A;  4KR4 A;  3CML A;  2UXD T;  3AE1 A;  1FIO A;  5IYZ E;  2WDR A;  4O2B E;  4B3T T;  4DR4 T;  5L47 A;  2B76 A;  5AQI B;  3TLV A;  3N2G E;  5LG3 A;  3UU8 A;  3NZQ A;  3HKE E;  4HWI B;  1UX5 A;  1QJP A;  5A1L A;  2Y0L A;  3HKB E;  3AE4 A;  3ZC1 A;  2WS3 A;  2VUR A;  2X0Y A;  3LDQ B;  5L3E B;  1G73 A;  2J4G A;  3UU2 A;  4EOZ B;  2E9X B;  4DUY T;  4QH5 A;  3ZJ1 A;  1LRZ A;  1H7C A;  4AYM C;  2XQ5 A;  3ZPO A;  4DV1 T;  4X66 T;  1FEW A;  4K0K T;  4GKK T;  2W80 C;  1XNR T;  3MZK B;  4GHB A;  2YN6 A;  5AQR B;  4AYE C;  2A72 A;  1KNP A;  2XM1 A;  2FUP A;  2XQ8 A;  1OED E;  3A5X A;  2LM9 A;  2X51 A;  1Q9G A;  4AQY T;  4PJN A;  2QTK A;  1X9B A;  3C64 A;  4GF4 A;  3V5S A;  2M07 A;  2LSK A;  4FT6 A;  2DWK A;  4H9R C;  4BA9 A;  4PJ0 O;  4X20 E;  1HXU A;  1W9R A;  3EHZ A;  1UCU A;  1XDP A;  5JR9 C;  4GKJ T;  3UU4 A;  2JQK A;  4BAY B;  4E7Z A;  5LA6 E;  2IWV A;  4HFB A;  4Z3T A;  4WBO A;  1SHZ C;  4FUV A;  4AQF C;  3VRA A;  1U4Q A;  3B57 A;  2SPC A;  4JYA T;  2EHO A;  5AQP B;  4IDQ A;  4QH4 A;  5IWA T;  2Y48 B;  5JVD E;  1UK5 A;  3RKO A;  2NTY A;  3VR8 A;  2A9U A;  4A97 A;  3SY9 A;  1XNQ T;  4F4B A;  3BRZ A;  1FMV A;  2BVM A;  3UT5 E;  2LKG A;  4CXX A;  3OBV E;  4LSI A;  3ANW A;  1HFA A;  1ZHC A;  5FYM A;  1XZY A;  2WVP A;  1E1H B;  3I0O A;  3POX A;  2H7V C;  3UQ7 A;  5LMU T;  1HCI A;  4AKR B;  3RF1 A;  3ZN0 B;  3HA4 A;  3CX6 B;  2WAU A;  4CN6 A;  1YKE B;  3RRW A;  2WWV A;  1MMD A;  4MHC A;  2YOE A;  4E7S A;  1Q9F A;  3LJC A;  5FXV A;  3MAC A;  4NPP A;  5FVK A;  3UUM A;  5L4E A;  4DR2 T;  2ACZ A;  5G38 A;  2KSR A;  4EIW A;  5E0O A;  4WZX A;  1OED B;  2PFV A;  4X64 T;  4N78 D;  5TAO A;  3RBH A;  3JC6 D;  3IBP A;  2H88 A;  5HAX A;  4QQ1 A;  5BMV E;  2CHN A;  1BXW A;  4FJO A;  2L9Q A;  1IBM T;  2I6H A;  2F4V T;  3KVD D;  1QUU A;  2KMF A;  1KNZ A;  2GE4 A;  1US7 B;  4NXN T;  3VE2 A;  4H63 H;  3NSG A;  4C4V A;  2KC0 A;  3M65 A;  5GV0 A;  3BK9 A;  4ZHQ E;  2N9D A;  3M3Z B;  2XAF B;  4JI5 T;  2HHH T;  2XTR A;  4EB6 E;  3ZMT B;  3ZT6 A;  3JCU O;  2R6G F;  3J7Y q;  3P4R A;  1MIW A;  2D5U A;  4QHO A;  4O3W A;  4ERR A;  3ABV A;  3DWN A;  3T1H T;  3VU7 H;  2XAH B;  3K1S A;  2IDO B;  2R88 A;  2WMN A;  1IJ5 A;  4YTN A;  3RKG A;  2JQH A;  1OWA A;  3AA7 A;  4YT0 A;  2CHO A;  3BS0 A;  3RHW A;  3PUS A;  1YKH B;  3CPZ A;  4TV9 E;  4AKL A;  1KF6 A;  3PUX F;  4DND A;  4N59 A;  1IJ6 A;  3SFE A;  4IL4 A;  4XNK A;  2D2S A;  1I94 T;  5J2T E;  3AEC A;  4DV6 T;  1D0Z A;  3HOE A;  2V8S V;  3NJT A;  4G63 A;  5J0Z A;  4PR7 A;  4DMV A;  3K3N A;  4GOU A;  3C51 A;  4P0B A;  3TLW A;  2X0L B;  1XMQ T;  1WYB A;  1P4T A;  4IGU A;  3GMI A;  5CJ5 A;  4HN9 A;  5L3B B;  3P50 A;  3AB3 B;  2E5V A;  5KDM C;  4IE0 A;  4KUM B;  4O4I E;  1IAP A;  2WMO A;  3C4X A;  4KMC A;  3MJX A;  2IML A;  3UU3 A;  5KMG P;  3ESL A;  5JH7 E;  3A2S X;  5H6R B;  2BBJ A;  1ZHX A;  1S94 A;  4AZL A;  2CXD A;  3UU5 A;  4ASK A;  5JDG A;  4KBM B;  2K9A A;  4UEL A;  2IC9 A;  2WDV A;  1T7S A;  2D0T A;  3ZSS A;  5JR9 A; 
#chains in the Genus database with same CATH homology
 3O9X A;  4FSP A;  4I55 E;  5H6Q B;  3K8P C;  1HG5 A;  4X1I E;  4H63 V;  4X1K E;  2DHR A;  2MHL A;  2H3R A;  3UTK A;  4LSH A;  3ZN1 B;  5DAB A;  3VZW X;  5EK3 A;  1T98 A;  2CE7 A;  4EXT A;  1WRD A;  2NTX A;  2XQY A;  2YNK A;  3AA0 A;  2V7K A;  1LVK A;  2A2F X;  3HKD E;  1IZN B;  4CXY A;  4TX5 A;  3O4X E;  3POQ A;  3I9Y A;  3I1A A;  2XHE B;  4K0U A;  5GON E;  1QJ9 A;  3AA1 A;  2XTL A;  3KDS E;  5L3G B;  4HKA A;  4AFK A;  4I4T E;  2VKD A;  4AI6 A;  1GFM A;  3MK7 C;  5FVN A;  2X9H A;  2HPJ A;  3VKH A;  2JMM A;  5EK2 A;  4QKN A;  3E0Z A;  2LSI A;  3DA3 A;  2K48 A;  3QUJ A;  3UAQ A;  2V1D B;  4PFP A;  5JRE A;  1D1B A;  2K24 A;  4BJM A;  3RX6 A;  2XTQ A;  3ZCJ A;  3GN5 B;  4HE8 A;  1ZHW A;  3GP6 A;  3LK3 A;  2G0U A;  2MBG A;  5ADX L;  2VKJ A;  5LHI B;  2NWB A;  1HG2 A;  1B7T A;  3EDU A;  3WI3 A;  2C5J A;  2HPL A;  2VK9 A;  4GK0 E;  4XAX B;  4BJN A;  3FHN A;  2XE3 A;  2KZ7 A;  2LEH A;  2E9X A;  2V26 A;  4B6X A;  2CWO A;  5HXC A;  2JQQ A;  4ZS3 A;  2VB6 A;  4JEH B;  1O3X A;  4PK5 A;  2A3D A;  3POR A;  3LBX A;  3TZG A;  3N2O A;  2B1E A;  4TV8 E;  5F8P A;  5LG4 A;  3N9O A;  2VWA A;  2Y0K A;  3DA4 A;  4AYD C;  2CEA A;  2F1T A;  1MMN A;  5L2L A;  3UFE A;  3F2E A;  3MXZ A;  3ZJ2 A;  3FYX A;  4PFO A;  5C8Y E;  4QXH B;  5LHG B;  4AKH A;  3K19 A;  3PU8 A;  4UF0 A;  2KND A;  4ILU A;  4O2A E;  2XE1 A;  2FGQ X;  3QRA A;  4WW0 A;  1WR6 A;  3H3A A;  3PTR B;  3VHL A;  2M67 A;  3EUH A;  3P8C D;  3OJA A;  2XAJ B;  3ZMZ B;  1X79 A;  2WSS V;  4D5U A;  3N9N A;  2YPV A;  5JDP A;  5AFU K;  4O4U A;  3T0S A;  4CI1 B;  3DJB A;  2EHO B;  3CML A;  4ADZ A;  2X68 A;  5HXE A;  2P9B A;  4KR4 A;  3VE1 A;  2E9X C;  3WI4 A;  2Y0H A;  4HFV A;  1D0Y A;  1FIO A;  2N2N A;  3U78 A;  4YHJ A;  5IYZ E;  1HF8 A;  4CZZ B;  3R84 B;  2LSJ A;  4O2B E;  2V7I A;  2Q9Q C;  2XAQ B;  4AQF A;  3HR0 A;  4OFZ A;  3W15 B;  4OHF A;  2W00 A;  3AAE B;  4ZI2 C;  4FI5 A;  3ZYK A;  1G8X A;  2V7M A;  2X9Y A;  5HXR A;  3N2G E;  3Q9D A;  1HTJ F;  3NZQ A;  2PRN A;  4J2C A;  3HKE E;  2KIN B;  2JMH A;  1UX5 A;  4JFB A;  1QJP A;  5A1L A;  4UV8 B;  2E9X D;  2Y0L A;  3HKB E;  3ZC1 A;  5FP3 A;  2E8I A;  3GA8 A;  4ZS2 A;  5LHH B;  3SWH A;  3VZT X;  3LK2 A;  2ODV A;  3NZP A;  1BR4 A;  4C91 A;  4AKG A;  3ZYL A;  5L3E B;  4TZ4 C;  3C4W A;  2M06 A;  1G73 A;  3UU2 A;  4O4H E;  8PRN A;  4EOZ B;  2E9X B;  1QSD A;  3NRY A;  6PRN A;  5DL5 A;  3EDV A;  3ZJ1 A;  1LRZ A;  1VRB A;  4UVA B;  3PUA A;  1H7C A;  2QGS A;  4AYM C;  4RLB A;  2V7L A;  3CQC B;  3OYZ A;  3ZPO A;  1BR0 A;  1FEW A;  2W80 C;  2LHR A;  3IHR A;  4OYJ A;  4HTE A;  4O3Z A;  3MKD A;  1AJ3 A;  3TKL B;  3UUN A;  3MZK B;  5DJQ C;  4ZI2 D;  5HWY A;  1MM4 A;  2N2M A;  3SOL A;  4TN7 B;  2YU2 A;  4GHB A;  3MA9 A;  2JJ9 A;  5DQW A;  4KR8 A;  4DVD A;  5JDN A;  2KDY A;  2XG6 A;  4O4L E;  4AYE C;  2A72 A;  2H7O A;  2PG8 A;  1BH3 A;  4L0R A;  4PAG A;  2ERV A;  2J1D G;  5HXH A;  1D0X A;  4P0A A;  3PQU A;  4QWN B;  3A5X A;  3O0E A;  2LM9 A;  2VAS A;  5DL6 A;  2X51 A;  2IC6 A;  2UXN B;  4JEU B;  2XE2 A;  1Q9G A;  4XZC A;  4GK5 E;  2BDE A;  1BT9 A;  5HWX A;  3N9Q A;  4A56 A;  4PJN A;  4C90 A;  5DL7 A;  5L3D B;  3E08 A;  2PBI A;  2RP4 A;  2Y8D A;  3C64 A;  3AVR A;  3LBX B;  2QTK A;  2Z6E A;  4GF4 A;  5FY0 A;  3V5S A;  2M07 A;  2CLY B;  2LSK A;  1ZV4 X;  4FT6 A;  3SZD A;  4L5G A;  2CCQ A;  2KT9 A;  2CA5 A;  2L8K A;  4XBF B;  2Y7S A;  3HOL A;  2DWK A;  3JC6 C;  2Q9Q B;  3CQG B;  2FGR A;  4FZN A;  5M4Y A;  4O3X B;  4H9R C;  2HH7 A;  4BA9 A;  4X20 E;  1HXU A;  4FOZ A;  2KWH A;  2ODU A;  3RYF E;  1NWM X;  3ETU A;  1UCU A;  1CUN A;  4UXN B;  3PUQ A;  4L9I A;  3G7G A;  3GWH A;  2VKO A;  3DP7 A;  4GIW A;  5F3J A;  3AA6 A;  3KFW X;  5JR9 C;  4AUI A;  5PRN A;  3QK6 A;  3POU A;  3T20 A;  3SS1 A;  3RC8 A;  2K0L A;  3AAE A;  3T8O A;  4BAY B;  3WI5 A;  3NBX X;  4E7Z A;  5LA6 E;  5JDQ A;  2J1N A;  3F57 A;  1OXZ A;  3KV9 A;  3ANW B;  4MBQ A;  4Z3T A;  1MIY A;  4WBO A;  1SHZ C;  2JPF A;  4DBR A;  4FUV A;  4AQF C;  3K3O A;  4I50 E;  5LXT E;  3OYX A;  4D64 A;  1U4Q A;  1VOM A;  2SPC A;  3AA6 B;  3B57 A;  3LK3 B;  5FXZ A;  2EHO A;  2YK0 A;  5G26 A;  3FBZ A;  2F1V A;  4RLC A;  3SYB A;  4WNK A;  1PHO A;  4WBN E;  3QC9 A;  3BQI A;  2VKH A;  4IE7 A;  2Y48 B;  5LCY A;  4GYR A;  4YJ3 E;  5JVD E;  3ZLI A;  2NP9 A;  4ZOL E;  4PK6 A;  4PJJ A;  2NTY A;  3RKO A;  3RH3 A;  3SZV A;  4O4X A;  2NW7 A;  4YFS A;  4UF0 B;  2ZM2 A;  3N9M A;  4UVB B;  2BVL A;  4P09 A;  3RYI E;  3KV4 A;  4EZH A;  3SY9 A;  4F4B A;  2XAG B;  1KK7 A;  4YJ2 E;  1U5P A;  5LJM A;  5LP6 E;  3WAJ A;  3SYS A;  4LSF A;  4AYN A;  1FMV A;  2BVM A;  3UT5 E;  4H9Q C;  4CXX A;  3ZMU B;  2NW8 A;  3AAA A;  3LK4 1;  2CM0 A;  5J2U E;  2YEV C;  2OA5 A;  4EAH A;  3C98 B;  4XNL A;  3CX8 B;  1E54 A;  3OBV E;  3RC3 A;  3HI2 A;  2GK9 A;  4LSI A;  3SY7 A;  3ANW A;  2V7J A;  5AFU L;  1HFA A;  5L3C B;  3OKQ A;  1H6S 1;  2KLQ A;  2DNX A;  3N5L A;  1ZHC A;  3ZEF B;  4H9N C;  3V8U A;  4ISS A;  5FYM A;  4Z8X A;  4FZL A;  4YLH A;  4AXP A;  4O3Y A;  1MND A;  1E1H B;  3I0O A;  3POX A;  2H7V C;  5JQG E;  3LG7 A;  3J9X 1;  2NW9 A;  4EYY R;  5JRC A;  4QX7 B;  4PJM A;  4UEM A;  3RYC E;  5KX5 E;  5FY7 A;  2ZLD A;  5D5D A;  2LT3 A;  1HCI A;  2WBL A;  4IE6 A;  1G90 A;  2Q9Q A;  4U9C A;  4AKI A;  4AKR B;  3IEE A;  4DBQ A;  3EMN X;  3FXE B;  2J4U P;  3ZN0 B;  3HA4 A;  4IE4 A;  3CX6 B;  2WAU A;  5LJN A;  3K3Q C;  4IDZ A;  5T5F A;  4G75 A;  3KVB A;  4JLE A;  1YKE B;  2KZ7 B;  3RRW A;  2XAS B;  3CQX C;  4FRT A;  4O8S A;  1MMD A;  4MHC A;  3LK2 B;  1GFO A;  4AKM A;  4E7S A;  4RJW A;  1Q9F A;  5ADX K;  3LJC A;  2N1G A;  5EZY E;  5FXV A;  3MAC A;  4HEA A;  5FXX A;  2XUE A;  2ES0 A;  2XMX A;  4B61 A;  2ZLY A;  5FMN A;  3FXD B;  4CQI A;  1Y64 B;  1EZ3 A;  1D1C A;  2LSG A;  3UUM A;  3JTY A;  3N9L A;  1BR2 A;  2YIN A;  3O1H A;  4V1A v;  2C5K T;  1THQ A;  2IW5 B;  1SA0 E;  2C5I T;  2MTQ A;  3AAI A;  3D0T A;  2QA7 A;  2K4T A;  3F31 A;  2CMR A;  4EIW A;  3CVR A;  5E0O A;  4N58 A;  1HXX A;  2LHN A;  4TUY E;  3CWZ B;  2PFV A;  2KXP A;  3I9W A;  4N78 D;  4MLK A;  5TAO A;  4O49 A;  3RBH A;  2UXX B;  4E1S A;  3Q5W A;  3JC6 D;  2W81 C;  3IBP A;  3S4U A;  1MNE A;  5HAX A;  3Q5X A;  3PQS A;  1LKX A;  4GCQ A;  4QQ1 A;  1NAF A;  3N9P A;  5BMV E;  4PUX A;  5JDH A;  1BXW A;  1UX4 A;  1LVF A;  2WM9 A;  3BQK A;  2CXF A;  4FJO A;  2N2L A;  2X27 X;  4AYI D;  5LBQ B;  3E22 E;  3ZYM A;  4ZI7 E;  2XE5 A;  2L9Q A;  2Y2X A;  3KVD D;  3RRC A;  4IE5 A;  1QUU A;  2KMF A;  1FMW A;  1OPF A;  2POR A;  4EYU A;  3KIN B;  2LSY A;  2O4V A;  1KNZ A;  3GN5 A;  3UPG A;  2DLR A;  2ZM0 A;  2GE4 A;  1US7 B;  4O4J E;  2MOZ A;  2MNH A;  3VE2 A;  4H63 H;  3NSG A;  4PNI A;  3M65 A;  5JDL A;  2KC0 A;  3BK9 A;  4ZHQ E;  5GV0 A;  3UUX B;  2N9D A;  2X67 A;  2ODJ A;  4GCP A;  2XAF B;  4CXW A;  2W0G A;  4FZM A;  4NUV A;  1MM5 A;  1GFN A;  2XTR A;  5FNV E;  3CX7 B;  1YW0 A;  5IHY A;  5JDM A;  4C69 X;  1MMA A;  4IIJ E;  4EB6 E;  3ZMT B;  4PJL A;  5HYA A;  3O1I A;  2LOP A;  3HL6 A;  3U3I A;  2VL8 A;  3LFM A;  4QXB B;  5CA0 E;  3J7Y q;  4E1T A;  5IYU A;  3NRX A;  4UIG A;  4I43 B;  1MIW A;  2W61 A;  2RA1 A;  3T24 A;  2JMK A;  2D5U A;  4G2A A;  2X9W A;  2LJL A;  4KP3 C;  4QHO A;  4EZ4 A;  4CI2 B;  4ERR A;  4O3W A;  5CA1 E;  3EVY A;  3KV6 A;  3PE0 A;  3I0Q A;  3CKD A;  3PUR A;  5ETW A;  3VU7 H;  2XAH B;  3N2K E;  5LGU B;  1ZHY A;  2ZFG A;  4HGA A;  2IAK A;  3AA0 B;  2DWG A;  2WMN A;  3KBT A;  1IJ5 A;  2ACX A;  2LFU A;  3V5U A;  4IST A;  1WLX A;  2BZB A;  5J1G A;  4DMW A;  3VKG A;  2WWU A;  2C0S A;  4U74 A;  5EK4 A;  1MMG A;  3R6N A;  3UUL A;  4M1P A;  2I59 A;  1BR1 A;  3RYH E;  5LYJ E;  1ZKE A;  3LK4 2;  1OWA A;  3B13 A;  3AA7 A;  4H9O C;  4G76 A;  5JR9 B;  1HS7 A;  1GFP A;  3PUG A;  2LOS A;  3PUS A;  4OK0 A;  1MIV A;  1YKH B;  2X66 A;  1GFQ A;  3AA1 B;  5LGT B;  3CPZ A;  3O1J A;  4TV9 E;  3HKC E;  2JRK A;  1WYC A;  2K5B B;  4ANJ A;  2EHO D;  3P7I A;  4H9P C;  1IZN A;  2YU1 A;  1ZHT A;  4AKL A;  4DND A;  4N59 A;  2CLY C;  1IJ6 A;  5LGN B;  2CWY A;  4FMS A;  3PRN A;  1HXT A;  2Y6X A;  4XNK A;  2DCF A;  3Q2M A;  2D2S A;  3VY8 X;  4BUM X;  3AA7 B;  4QXC B;  1S35 A;  2ZM8 A;  5DQV A;  3VY9 X;  3VZU X;  5J2T E;  2X9X A;  3L09 A;  3ETV A;  1MPF A;  1D0Z A;  3HOE A;  4G63 A;  4NUU A;  2PJQ A;  4ZI3 D;  1ZHZ A;  2D0U A;  3PDY A;  3C50 A;  4DMV A;  4IHJ E;  3FBL A;  3K3N A;  4JUY A;  4GOU A;  2DI4 A;  3ZMV B;  2W62 A;  2OMF A;  4RJX A;  3C51 A;  4P0B A;  3DTO A;  4FSO A;  2X0L B;  3KV5 A;  5LNK A;  1WYB A;  2LE8 A;  4KRA A;  3AAA B;  1P4T A;  2W63 A;  4IGU A;  4X1Y E;  5LBM A;  1OSM A;  3AVS A;  2MYS A;  4OYK A;  5JDF A;  3GMI A;  5LOV E;  5CB4 E;  4GYS A;  4HN9 A;  5L3B B;  4PW8 A;  4U72 A;  4D65 A;  4LSE A;  1YS5 A;  3AB3 B;  2CXL A;  4AKR A;  3ZMS B;  4CI3 B;  1Z0P A;  4ZI3 C;  4AQG A;  5KDM C;  4QX8 B;  4IE0 A;  3ONX A;  4KUM B;  4FES A;  4O4I E;  1IAP A;  2WMO A;  5L3F B;  3C4X A;  2ZMA A;  2Q9Q D;  3KBU A;  4UV9 B;  4FRX A;  4RL9 A;  3FB2 A;  3ZC0 A;  5JRC B;  1ORM A;  2LHF A;  5FXW A;  4KMC A;  3MJX A;  1V9D A;  3HW9 A;  3H37 A;  4PK4 A;  5KMG P;  3ESL A;  3SRZ A;  4F6R C;  5JH7 E;  2EHO C;  4MFR A;  3A2S X;  1QJ8 A;  4MAL A;  3QRC A;  5H6R B;  4DO0 A;  2NOX A;  5FY1 A;  7PRN A;  3WAK A;  5DL8 A;  4H9S E;  1HX8 A;  1YD8 G;  1D1A A;  1ZHX A;  2L3L A;  3HWB A;  3C5O A;  5EE2 A;  1S94 A;  4AZL A;  3RPU A;  2CXD A;  4ASK A;  1PRN A;  5HXS A;  3PU3 A;  5JDG A;  4GCS A;  4KBM B;  2KWI B;  3BQL A;  2K9A A;  4UEL A;  4UVC B;  3L3P A;  2KXP B;  1ZEE A;  2IC9 A;  3IF8 B;  2D0T A;  5JR9 A;  4JCH A;  3KVA A;  3ZCI A;  3C4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...