5AFUL

Cryo-em structure of dynein tail-dynactin-bicd2n complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
270
structure length
270
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVDVIPDNPKFQQLQRELSQVLTQRQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DYNEIN TAIL
publication title The Structure of the Dynactin Complex and its Interaction with Dynein.
pubmed doi rcsb
molecule tags Motor protein
total genus 71
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5afuL01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 5afuL02
1IZNB 2KXPB 3AA0B 4AKRB 3AAEA 3LK42 2KZ7A 3AAAA 3AA7A 3LK3A 5AFUL 3AA1B 3AA6B 1IZNA 3LK2B 2KXPA 4AKRA 5ADXK 3AA0A 3AA1A 5AFUK 3AA6A 2KZ7B 3LK2A 3AAEB 3LK41 3AAAB 3AA7B 3LK3B 5ADXL
chains in the Genus database with same CATH superfamily
1E54A 1T8BA 2LOSA 4JV5T 5AQNB 2JMMA 4NUVA 2IWVA 1WYCA 2LOPA 1OPFA 4FSPA 4A5XA 3PRNA 4ZZCA 5DQVA 3FYXA 3M3ZB 2H89A 4AKRB 2CLYB 4IT4A 4B3TT 3ZPOA 4DNDA 2WBLA 2BVLA 3Q5WA 2XQAA 3AE8A 5FXWA 3CQXC 5L4EA 5J2TE 2FUPA 2KZ7B 1QJ8A 4YHJA 1THQA 4AYEC 1LVKA 2VVNA 3UU8A 3O9XA 1Y64B 2F1TA 2D0UA 4IL4A 4PK6A 3H37A 3ZT5A 3PQSA 4N58A 3TLVA 5JDGA 3RYCE 2IDOB 2IUBA 4EV6A 4PJLA 2WJRA 2V7KA 2VL0A 4JI3T 1IZNB 2NW7A 1HXXA 2ODJA 3AAEA 1D0XA 3QK6A 4O4XA 5HWYA 5HEJA 2JQQA 1T98A 4N59A 2F4VT 2JIWA 5F5WA 3DJBA 3HKCE 4N74A 2I0MA 5AQQB 2UXNB 3NRYA 2M67A 1W9RA 3PUQA 2KWIB 4H9RC 1FJGT 3ZN1B 3SFEA 5LGUB 2CXFA 3VHLA 4LMJA 2XE1A 4Z91A 4EAHA 2IWWA 4ISSA 4UXNB 3NZPA 2N9DA 5C3JA 5DL7A 1HX8A 1XNRT 4CN1A 4U9CA 2N2MA 4GK0E 1GQEA 3HR0A 4K3CA 1I94T 4G75A 2PG8A 2Z6EA 4JI7T 3QNUA 5AQVB 4FZMA 2PTFA 2IIUA 2AXTO 2W62A 3FZFB 1MMGA 5ABGA 5ADXK 2K5BB 3SY7A 2J62A 4PW8A 5EZYE 4BUMX 4D64A 4YT0A 2ACXA 3R84B 2LLYA 1FMWA 4YFSA 4CI2B 1ZHZA 1OEDC 5JTGA 3I0QA 4QXBB 1UX5A 3NBXX 2Q9QB 1DU2A 2J4GA 2CWYA 2K9AA 3AE7A 3MZKB 4HFIA 4DV0T 1E1HB 2FJBA 4TNVA 2BVMA 5LA6E 5J2UE 5HCMA 4CXYA 1ORMA 2KLQA 2V7JA 4DR1T 4YSZA 3AAAB 1US7B 2CBJA 1NENA 2BBHA 3UUXB 4WYVA 3QC9A 4F8HA 4UELA 2LM2A 3JADA 2XAGB 2X0HA 1HNWT 2I6HA 4YLHA 4DVDA 2LHFA 5GV0A 3MJXA 1J5WA 3HKDE 4HE8A 1MIWA 2R8AA 3B13A 2D5UA 2SPCA 2YKSA 3A8YC 2XQ7A 2BZBA 4IL6O 4I4TE 3WAKA 1HF8A 1U4QA 4B3ST 3ZCJA 5JDPA 1YS5A 1HX1B 4PJMA 2QYWA 2W0GA 3IA3A 2J4UP 3KBTA 3K19A 2YOEA 1BR2A 3RIUA 3POQA 4U7IA 3Q9DA 4IDZA 5T5FA 3LK2A 5KMGP 3FBZA 4JI8T 5JREA 5ADXL 4JI6T 4FQEA 4PJ0O 3R6NA 3V5SA 1D1CA 4L9IA 1UX4A 1W0BA 2X9XA 5LG4A 3T8OA 4LMLA 2LKGA 4QX8B 2N1GA 5LJNA 1HXTA 2CRBA 3T20A 3UQ7A 4PK4A 3CPZA 1SA0E 4C91A 4TWFA 2J1NA 2WVPA 4DUYT 1QLBA 2E5VA 3UULA 2ZM8A 2HN2A 3AXJB 4QH5A 5FNVE 5AQPB 5HCJA 5G3AA 3ZSSA 3OYXA 3ZMUB 5LMNT 3VE1A 3KV9A 5JRCB 4O4UA 5IUXA 2RA1A 3ZCIA 2XJ7A 5LGTB 5C8YE 3CMLA 2W80C 3ZLIA 3ANWB 3N9MA 4UB8O 2B1EA 3AE5A 2ZLYA 3TKLB 4CXXA 3IEEA 2WMOA 2M6BA 2HHHT 4ZS3A 3PUXF 4IGUA 4JBWF 2E9XA 2XG6A 4NXNT 3PU8A 5L2LA 2XM1A 4GOUA 3IF8B 2VL8A 2WU2A 4RL9A 5AQOB 3WU2O 3UU2A 3PE0A 3EABA 3NSGA 2OV9A 2LHRA 2YEVC 4DV1T 3PJAA 1SHZC 3PDYA 5E0OA 3PU3A 2YINA 4LSHA 3ETVA 3J7Yq 3SYBA 3GA8A 2A2FX 3ZJ2A 4QXCB 1WFDA 3HL6A 2XMXA 2X9YA 2CEAA 2NR4A 4CN6A 5J1GA 1OEDE 4TWHA 4X1KE 3QOFA 2XTRA 1MMAA 3G06A 3PUZF 4I0UA 4DV4T 1XDOA 5CA1E 2V6YB 3G7GA 2DNXA 5FL1A 2ZMAA 5HYAA 3BRZA 2ZLDA 4P09A 4QHOA 5KXJA 2VKOA 3GN5B 2H7VC 3NRXA 4IDQA 2CE7A 3ZT6A 4BAYB 2QRXA 3VKHA 2CCQA 2UUBT 1QJPA 3WI3A 4UIGA 3AA6B 2VKDA 1YXRA 2UUAT 2YDRA 2Y7SA 3AVSA 4H9PC 3ZKRA 2AXDS 4A56A 2BBJA 3AA0B 3HA4A 4KI0F 5L3FB 2KWHA 4O3WA 4K0KT 4DV6T 3NJTA 3ZMSB 1YD8G 1AJ3A 2J1DG 4HFHA 4NPPA 1G73A 1MPFA 3CQCB 5FXXA 2XPKA 4PK5A 3FZMB 4B61A 4J2CA 2YU1A 4N75A 4Q25A 1LVFA 4PJNA 2CHOA 2XAJB 3UU6A 3RGLA 3NZQA 1N34T 2DCFA 4WBOA 3F31A 2JQHA 3ZT7A 4QKNA 4OHFA 2HH7A 2KSRA 4PAGA 2EHOA 2DLRA 2YNKA 1MMDA 4I43B 4GK5E 4UVCB 3SZVA 3B5MA 3AECA 3E08A 4B3MT 2YDQA 4KUMB 3RIAA 2VQFT 4EZHA 2NOXA 2LM9A 4C90A 4XZCA 3L8RA 3LK3B 4P0BA 4BJNA 2K0LA 4O4LE 5AQSB 5L47A 5D5DA 2CM0A 3A0BO 1OEDB 2E9XD 3RI5A 2CHNA 4B3RT 3UUBA 2G0UA 2WWVA 3VY8X 1FIOA 3SOLA 1T7SA 3UUMA 1BR0A 3K8PC 4XAXB 1VOMA 4LF9T 5FVNA 4ILUA 5DJQC 1IJ6A 3LJCA 3V5UA 3RF1A 3SZDA 5JDFA 4C4VA 4IE6A 4UF0B 2QGSA 2X27X 3Q5DA 4ILAA 4GCQA 4ZI2D 2HPJA 4PUXA 4DBQA 3IHRA 3DWOX 2Y0KA 2KXPB 4UB6O 3AA7A 1X79A 5DL6A 2BS3A 5L4HA 3EMNX 4KBMB 3O0EA 3RYHE 2WSSV 3JAFA 5G38A 5AQFB 3ZSTA 4OFZA 2CPTA 4CN4A 3N5LA 5JH7E 5B5EO 4TUYE 4LF4T 3CX8B 4GKKT 5AQLB 2IMLA 4RLCA 1YKHB 4TNWA 4EYUA 3ZMVB 2PFVA 5M4YA 2WWUA 2X68A 3QUJA 3RKOA 1J5ET 1IBMT 2NTXA 2K24A 4F6RC 4WBNE 3OPCA 3UU5A 3OJAA 2ODUA 4HWHA 5IYZE 4WW0A 3S4UA 4NXMT 5FKYA 3VR9A 3AE3A 4E7SA 1ZHCA 5E79O 4N78D 4AYNA 3VZTX 5JR9C 2KC0A 3RHWA 2MAWA 5FY7A 2ZM6T 1E2AA 5FMNA 3GP6A 3HI2A 3CX7B 4ZZBA 1D1BA 2AE9A 4IDPA 2B76A 4DV5T 2RPAA 4AKRA 2CXLA 2EHOC 1T72A 2WCAA 3I0OA 3H3AA 4FUVA 1QUUA 2KMFA 5JVDE 5BMVE 2EHOD 4G63A 4L5GA 3O1JA 4JFBA 3N2KE 3JCUO 5JDLA 2ZM0A 3NKZA 5AQUB 4E1TA 2ZM2A 3U78A 4EGWA 2ES0A 4GKJT 2E2AA 4MFRA 2FJAA 3L09A 3M65A 4AUIA 3UFEA 4IE5A 3JCFA 4COFA 2NW8A 4LSFA 5TAOA 4GYRA 2QVAA 5LNKA 2H7OA 5AQGB 3C64A 2C0SA 1IZNA 5GONE 4A97A 4IE4A 3HOEA 1FEWA 2BG9A 5ABFB 4UV8B 4H9NC 4HTEA 4ZXLA 4KP3C 1MIYA 2YN6A 3AE2A 4EB6E 3ETUA 3AEBA 1OXZA 4AKMA 4DR7T 2BS4A 4U2ZA 2L3LA 3I9WA 1UGOA 3EAMA 5LP6E 4FZNA 3PJAJ 2VASA 4I55E 5G26A 3ABVA 4JLEA 5DQWA 4MALA 1GFMA 4JYAT 4U31A 3RC3A 4IDOA 4JI4T 3K3OA 2XE2A 4K0UA 2XASB 2KDYA 2R88A 4AI6A 2LSJA 1I6ZA 3KV4A 5LG3A 2R4LA 4JEUB 1FMVA 4LFAT 4TV8E 4MHCA 3AE6A 3VU7H 1J1JA 2LKHA 2RP4A 4LF5T 2LJLA 4ANJA 1V9DA 2V7MA 4LSIA 2Q9QA 1ZHYA 4DV7T 3WI4A 5EK3A 4ZOLE 1ZHWA 4LF6T 1H7CA 2BS2A 3CX6B 2I59A 3FB2A 3ZYMA 2XQ6A 1QSDA 2WDRA 3K3QC 3UFGA 2X67A 2OLTA 3K3NA 2W67A 1NAFA 5H6RB 3AAAA 3TLWA 3O1IA 3FZKB 3JC6C 2V5CA 3VRAA 1N32T 4AISA 2X9HA 3QB5A 4FESA 3KVDD 2LE8A 1QJ9A 3JC6D 5CB4E 3AB3B 5HEOA 1XMOT 2JMKA 5JDMA 2GE4A 2HPLA 4Z90A 4O8SA 4B6XA 1OSMA 3PF1A 4DO0A 3KVBA 5AQJB 5AQHB 4U72A 3F57A 3KINB 5L3CB 1R8IA 4TX5A 4U3CA 4OYJA 3LBXB 1D1AA 2WJQA 4UEMA 2R4NA 4JI2T 3HKBE 2NTYA 3N9NA 2LRKA 4OX9T 3VRBA 3UUNA 3UQ4A 4LMKA 2L8KA 3MK7C 4AQFA 3Q5EA 4ZI3C 2NWBA 4QH4A 3DA3A 1ZV4X 1HTJF 2UXCT 4ZI3D 5HXEA 5AQRB 4HEAA 3N9QA 7PRNA 5HXCA 3AEEA 3PV0F 2BG9C 2FGRA 2Y0HA 3PUGA 5CA0E 2A9UA 4Z3TA 4O2BE 4IHJE 4UVBB 3N2GE 1U5PA 5FVKA 4AKHA 4X66T 2YK0A 3QRAA 5KDMC 3CVRA 2VKJA 3AXJA 3MKDA 2PORA 1NEKA 4U74A 3RIFA 3RC8A 5LHIB 3A0HO 3MXZA 1IBLT 1S94A 2BKPA 4LFBT 3BQIA 3ZJ1A 1BXWA 3K1SA 3AEFA 3E0ZA 2DWGA 4AIUA 5JRCA 4EEDA 3EI0A 3CWZB 2KNDA 2C5IT 2R4PA 4QXHB 1M7KA 1P4TA 2W4XA 2V5DA 4ZS2A 5JDNA 2BDEA 4CI1B 3ANWA 3PGRA 1G8XA 4IE0A 3MA9A 1KK7A 1YQ3A 3RRWA 1ZEEA 3KDSE 4KHZF 2DHRA 5TISO 5DL5A 4KHPT 1E7PA 2LSKA 3O1HA 3VZUX 4LFCT 5LOVE 1BR1A 3LDQB 3P8CD 4EZ4A 2VWAA 4U7YA 3RIUC 3J9X1 3PTRB 3E22E 2Q9QD 2XQ5A 4BA9A 1HCIA 5PRNA 4AZLA 5FVLA 4GF4A 5JR9B 2MHLA 3A7MA 3PUWF 1SE7A 3AEDA 3L3PA 4CQIA 2MPKA 3TZGA 4FZLA 4O4IE 2ODVA 4MBQA 3PGSA 2XQ9A 2OMFA 3HOLA 3V8UA 3RX6A 4PFPA 5LHGB 4OK0A 2ERVA 2XHEB 5AFUK 3JTYA 4PNIA 3CKDA 4ASKA 3UPGA 4YXDA 3SY9A 2H88A 3N9LA 3SYSA 2V7IA 3P50A 2LRLA 3EHZA 4FRTA 2JRKA 3AA1B 5CGMA 4YY3T 3GN5A 2W81C 1GFQA 2O4VA 2VK9A 4UR9A 4EOZB 2V7LA 2VKHA 5JQGE 4AQFC 3QRCA 3HKEE 3AA6A 1WR0A 5JDHA 5HEGA 4DR2T 5LHHB 4H9SE 1D0YA 3VE2A 4E1SA 2FBWA 3OVUA 4DMWA 3P4QA 1L0VA 2F1CX 4A98A 4AQGA 3FXDB 4LSEA 2LEHA 2E9XC 1XWMA 3AE1A 1UURA 4ERRA 2LFUA 2Y6XA 5JDQA 4G2AA 4AQYT 2Y2XA 1HNZT 2WS3A 3RPUA 4JCHA 4AYDC 3RLFF 3HWBA 2M06A 2X9KA 1SUMB 2BG9E 2CBIA 2IHR1 1VRBA 2V1DB 3ONXA 2YU2A 4JUYA 2LT3A 1LRZA 3EVYA 4DR3T 5EK2A 4ZI2C 4HFDA 5L3GB 5ABHA 3AE9A 3ZEFB 2XZEA 2N2NA 1JNZA 4TZ4C 4O3XB 5ABEA 2JQ9A 4UV9B 2X9WA 1ZKEA 3UU4A 4WNKA 5BR8T 2XM2A 2YPVA 2JJ9A 1MM5A 3LK3A 5EE2A 3C5OA 4YHHT 2ZFGA 1WLXA 3AAIA 5CJ5A 1OEDA 4TWDA 1CHUA 2MTQA 4X20E 3POXA 5ETWA 4G76A 2IC9A 4GCSA 4F4BA 4TV9E 3LK41 3T24A 3VR8A 1YQ4A 5GTIO 3PGUA 4GHBA 2XQ3A 1XZYA 3KVAA 2K3WA 5LXTE 4JEHB 4YTMA 2JQYA 2V6XA 1N36T 3AAEB 2L9QA 1KFYA 4UF0A 3Q5XA 3RRCA 3X1DA 2XE3A 4RLBA 3PUYF 3GWHA 4ILCA 2LSYA 4K3BA 5HEUA 2R6GF 3ZC1A 4DUZT 3VZWX 1MIVA 2X0LB 2KXPA 4QQ1A 2DWKA 3C50A 2PBIA 2CA5A 3RH3A 4ZHQE 3LG7A 2XQ4A 2C5JA 5HWXA 4P0AA 2PJQA 1H6S1 5H6QB 2VQET 2OA5A 3HW9A 4EIWA 1Y01A 4CI3B 3Q2MA 4IREA 1GFOA 4CZZB 4X65T 2XTQA 3WI5A 2D2SA 2XSBA 3N2OA 1D0ZA 4U33A 1O3XA 4U2YA 2K48A 2LSGA 4O49A 1MM4A 4AKGA 5LGNB 2WU5A 2XSAA 4BJMA 2KZ7A 4I50E 2BG9B 1W0AA 5FXZA 3RQUA 4TN7B 1ZHTA 4HFCA 3OBVE 2YDSA 4DV3T 4V1Av 3OYZA 2WM9A 1OWAA 3EDVA 5HAXA 5HXSA 3OKQA 2K4TA 1S5LO 3N9OA 4PJJA 3VKGA 4HWIB 2XUEA 1UK5A 4DR6T 3DP7A 4H9QC 1KNRA 5FYMA 3FXEB 2D0TA 5IHYA 4ZI7E 1HXUA 2C5KT 5LB7B 3LFMA 2A3DA 4YSYA 2FJEA 5LCYA 3F2EA 2FGQX 2LHNA 3TLUA 4P1NA 4X64T 4ISTA 2CWOA 4O3ZA 1NWMX 3AEAA 3RYFE 1N33T 2R89A 3T1YT 3W15B 2WDQA 2IW5B 1BT9A 5IWAT 2N2LA 3ONJA 5LBQB 4CTDA 3BQKA 1Z8UA 3A5XA 4RJXA 3LK2B 2JQKA 4X5TA 4DR4T 1Q9FA 3KBUA 2MBGA 1MNDA 3LSVA 4HWDA 5FL0A 3UTKA 5AQTB 1X9BA 2H3RA 5ABFA 3KV6A 4DBRA 3RYIE 8PRNA 2BKOA 3AEGA 3ZYLA 3C4XA 4AYMC 4H63H 1MNEA 2WZIA 3CIRA 2XAHB 4C69X 3FHNA 1WCRA 1XMQT 3DA4A 4FI5A 4EYYR 2UXBT 4GCPA 4FOZA 3DWNA 4JI5T 4YJ2E 1PRNA 4O4HE 5DABA 5AQMB 5HXRA 1T16A 3RBHA 1KNPA 1XDPA 1HG5A 1BH3A 4IE7A 1HFAA 4IIJE 2XQ8A 4EXTA 3UT5E 4XNLA 4QWNB 2FJDA 2CLYC 1GFNA 3I9YA 4ZEYA 3WAJA 2BKNA 3NWIA 3QB5K 3N9PA 3P4SA 4JI1T 2V8SV 2XY8B 3I1AA 2WY2A 4HFBA 1IBKT 3POUA 2HN1A 1KNZA 2JMHA 3PORA 2KT9A 4HWFA 4Z8XA 3FZLB 4KMCA 1YKEB 5F8PA 2E9XB 2IAKA 1W09A 3ESLA 3EDUA 3ONLC 4MLKA 3ZC0A 1WR6A 2J47A 4PR7A 3AVRA 3PUVF 4HFEA 1HNXT 2ACZA 5FXVA 3C4ZA 5EK4A 2DL1A 2P9BA 3CK6A 1MMNA 1EZ3A 3T1HT 4HN9A 2LSIA 5HEHA 5AQIB 3C4WA 4QH1A 3SRZA 3P4WA 4IL9A 4YJ3E 3RQWA 3SFDA 4DMVA 2A72A 3ZYKA 2XAFB 2KINB 3PUAA 4CXWA 2F1VA 2W2UA 3TLSA 1UUSA 4RJWA 3DZMA 3ZMTB 3LBXA 3ZMZB 2UXXB 1HG2A 4FT6A 3P4RA 4D65A 2GK9A 5L3BB 1WRDA 2UU9T 2Y0LA 5CFBA 4XNKA 2WMNA 2XTLA 2MYSA 3OTOT 4O3YA 4NIQA 1ZHXA 2W66A 2M6IA 1IAPA 2CMRA 4KR8A 4QX7B 3LK42 4ILBA 3KV5A 5FY1A 1T1LA 4KRAA 2PRNA 1WYBA 1HS7A 1ZP0A 5FP3A 5HXHA 2XAQB 3KFWX 3C98B 4O4JE 2WQYA 2VB6A 5AQKB 3FBLA 2Q9QC 3PQUA 3MACA 4WZXA 1ZOYA 4H9OC 5FY0A 5KAFO 2WDVA 3SS1A 4JI0T 2M07A 3B57A 1YW0A 4XBFB 1Q9GA 4UVAB 4LF8T 4AXPA 3VY9X 4C00A 4AYID 2VVSA 4FSOA 5LMUT 1LKXA 1S35A 5L3EB 3H3MA 2X0YA 3BRYA 4H63V 3U3IA 1B7TA 4D5UA 3O4XE 4YTNA 4PFOA 4L0RA 5KX5E 2V26A 2E8IA 5F3JA 2EHOB 4IDNA 5H2FO 1G90A 4YSXA 2JPFA 2V6YA 3CQGB 3EUHA 6PRNA 4AKIA 2D9DA 3ZN0B 2NW9A 3A2SX 4DIDB 4X1IE 3AE4A 2WAUA 4DR5T 2R4OA 3T0SA 2QTKA 3P4PA 4FJOA 1BR4A 4KX6A 2IC6A 2UXDT 3UU3A 5LJMA 5IYUA 5JR9A 4EEBA 5B66O 2CXDA 5L3DB 2X51A 5GTHO 1UCUA 2WB5A 3AA0A 4AFKA 4HFVA 4X62T 3PURA 3C51A 3JAEA 5DL8A 5LBMA 2W63A 2Y48B 1GFPA 2W00A 2W61A 2WP9A 5G39A 1VCTA 2MNHA 1IJ5A 1HR0T 2VURA 4C4VB 2XQYA 1JNRA 3UAQA 1PHOA 3BQLA 5LYJE 2E5LT 1KF6A 4FMSA 2MOZA 4E7ZA 5J0ZA 3AA1A 3BS0A 3KZIO 4HWCA 1XNQT 1Z0PA 3AA7B 3SWHA 2Y8DA 3DTOA 2WZHA 4LF7T 4HKAA 4NUUA 4DV2T 4YTPA 4GIWA 5AFUL 3TLTA 2NP9A 4HGAA 2DI4A 3FZHB 4AKLA 2X66A 5C2TA 3L39A 3D0TA 4O2AE 2XE5A 3IBPA 5KAIO 2QA7A 3GMIA 4X1YE 2UUCT 4FRXA 1CUNA 4GYSA 4KR4A 5A1LA 3NVOA 3P7IA 1VCSA 4OYKA 4M1PA 3RKGA 4ADZA 1KEYA 1M62A 3BK9A 3PUSA
chains in the Genus database with same CATH topology
5LCYA 1E54A 2L8KA 2LOSA 3MK7C 3AA0B 3HA4A 4AQFA 4ZI3C 3F2EA 2FGQX 2LHNA 5L3FB 2NWBA 2KWHA 4O3WA 3DA3A 2JMMA 1ZV4X 1HTJF 4NUVA 4ISTA 2CWOA 4ZI3D 4O3ZA 1WYCA 3ZMSB 5HXEA 2LOPA 1NWMX 1YD8G 3RYFE 1OPFA 1AJ3A 2J1DG 4FSPA 4HEAA 3N9QA 3W15B 1G73A 7PRNA 1MPFA 3PRNA 3CQCB 5FXXA 5HXCA 4PK5A 2IW5B 5DQVA 1BT9A 4B61A 4J2CA 2N2LA 3FYXA 2YU1A 2FGRA 1LVFA 5LBQB 4AKRB 4PJNA 2Y0HA 3PUGA 5CA0E 2CLYB 3BQKA 3ZPOA 4DNDA 4Z3TA 4O2BE 2WBLA 3A5XA 4IHJE 4UVBB 2BVLA 2XAJB 3N2GE 1U5PA 4RJXA 3LK2B 4AKHA 3Q5WA 3NZQA 1Q9FA 2YK0A 3KBUA 2MBGA 2DCFA 3CQXC 5FXWA 5J2TE 1MNDA 4WBOA 3F31A 5KDMC 3QRAA 3CVRA 2VKJA 3MKDA 2PORA 2KZ7B 4U74A 1QJ8A 3RC8A 4YHJA 5LHIB 4QKNA 4OHFA 1THQA 3MXZA 4AYEC 3UTKA 1S94A 2HH7A 2H3RA 1LVKA 4PAGA 2EHOA 3KV6A 3BQIA 2DLRA 3ZJ1A 4DBRA 1BXWA 3O9XA 1Y64B 3E0ZA 2F1TA 3RYIE 1MMDA 2D0UA 2DWGA 4I43B 4GK5E 4UVCB 5JRCA 2YNKA 3SZVA 8PRNA 4PK6A 3ZYLA 3CWZB 3H37A 3C4XA 2KNDA 2C5IT 3PQSA 3E08A 4N58A 4AYMC 4H63H 4QXHB 1MNEA 4KUMB 5JDGA 1P4TA 4EZHA 4ZS2A 5JDNA 2BDEA 2NOXA 2LM9A 3RYCE 4C90A 4XZCA 4CI1B 2XAHB 4PJLA 3ANWA 3LK3B 4P0BA 4BJNA 1G8XA 2K0LA 4C69X 3FHNA 4IE0A 4O4LE 2V7KA 3DA4A 5D5DA 4FI5A 1IZNB 2CM0A 2NW7A 1KK7A 3MA9A 1HXXA 4EYYR 2ODJA 3AAEA 4GCPA 3RRWA 2E9XD 1D0XA 1ZEEA 4FOZA 3QK6A 4O4XA 3KDSE 5HWYA 4YJ2E 1PRNA 4O4HE 2JQQA 1T98A 5DABA 2DHRA 2G0UA 4N59A 3VY8X 3DJBA 5HXRA 3HKCE 3RBHA 1FIOA 5DL5A 1HG5A 2LSKA 3O1HA 3SOLA 1BH3A 3VZUX 4IE7A 1HFAA 2UXNB 3NRYA 2M67A 5LOVE 4IIJE 3PUQA 4EXTA 2KWIB 4H9RC 3UT5E 3ZN1B 3UUMA 5LGUB 2CXFA 4XNLA 1BR1A 1BR0A 3VHLA 3K8PC 4XAXB 4QWNB 1VOMA 2XE1A 2CLYC 4ILUA 3P8CD 3I9YA 5DJQC 1IJ6A 3LJCA 2VWAA 4EZ4A 1GFNA 3J9X1 3V5UA 3WAJA 3PTRB 4EAHA 3N9PA 3E22E 2Q9QD 4BA9A 1HCIA 4ISSA 3SZDA 5JDFA 4UXNB 3NZPA 2N9DA 3I1AA 4IE6A 5PRNA 5DL7A 1HX8A 4UF0B 2QGSA 2X27X 3POUA 4GCQA 4U9CA 4ZI2D 2N2MA 4GK0E 2HPJA 4GF4A 4AZLA 3HR0A 4PUXA 5JR9B 1KNZA 2JMHA 2MHLA 4G75A 2PG8A 4DBQA 2Z6EA 3L3PA 3IHRA 3PORA 5FVNA 2KT9A 4Z8XA 4CQIA 4KMCA 1YKEB 5F8PA 2Y0KA 2E9XB 3TZGA 4FZLA 2KXPB 4FZMA 2IAKA 4O4IE 2ODVA 4MBQA 3ESLA 1X79A 3AA7A 5DL6A 3EDUA 4MLKA 2W62A 2OMFA 3ZC0A 4KBMB 3EMNX 3O0EA 1MMGA 1WR6A 3RYHE 3HOLA 2WSSV 3V8UA 3RX6A 4PFPA 3AVRA 2K5BB 5LHGB 5ADXK 4OK0A 2ERVA 3SY7A 4OFZA 2XHEB 3N5LA 5FXVA 5AFUK 5JH7E 3JTYA 4PW8A 3C4ZA 4PNIA 4TUYE 5EK4A 5EZYE 4BUMX 4D64A 2P9BA 2ACXA 3CKDA 3R84B 4ASKA 3CX8B 3UPGA 4RLCA 1MMNA 3SY9A 1EZ3A 1FMWA 4YFSA 4CI2B 1ZHZA 4HN9A 1YKHB 2LSIA 3N9LA 3I0QA 3SYSA 4QXBB 1UX5A 2V7IA 3NBXX 3C4WA 4EYUA 2Q9QB 4FRTA 3ZMVB 3SRZA 2JRKA 2PFVA 3AA1B 5M4YA 2CWYA 2K9AA 2WWUA 3GN5A 3MZKB 4YJ3E 4DMVA 2A72A 3ZYKA 1E1HB 1GFQA 2O4VA 2VK9A 2W81C 2X68A 4EOZB 2V7LA 2VKHA 2BVMA 5JQGE 5LA6E 3QUJA 4AQFC 2XAFB 3HKEE 3RKOA 2KINB 3PUAA 3QRCA 2NTXA 5J2UE 3AA6A 1ORMA 4CXWA 4CXYA 5JDHA 2F1VA 2KLQA 2K24A 4F6RC 2V7JA 4WBNE 3AAAB 3OJAA 1US7B 2ODUA 4RJWA 5LHHB 3ZMTB 3LBXA 4H9SE 3ZMZB 2UXXB 3UUXB 1HG2A 5IYZE 1D0YA 4WW0A 3S4UA 3VE2A 4FT6A 3QC9A 4E1SA 4D65A 4UELA 2GK9A 5L3BB 1WRDA 2XAGB 2Y0LA 4E7SA 4DMWA 1ZHCA 4N78D 4YLHA 2WMNA 2XTLA 4XNKA 4AYNA 4DVDA 2MYSA 2LHFA 3VZTX 4AQGA 5JR9C 5GV0A 3MJXA 4O3YA 3HKDE 2KC0A 4HE8A 3FXDB 1MIWA 1ZHXA 4LSEA 2LEHA 2E9XC 1IAPA 5FY7A 5FMNA 3GP6A 3B13A 3HI2A 3CX7B 2D5UA 2CMRA 2SPCA 4KR8A 4QX7B 2BZBA 3LK42 1D1BA 4I4TE 3KV5A 5FY1A 3WAKA 4KRAA 1HF8A 1WYBA 2PRNA 1U4QA 4ERRA 2LFUA 3ZCJA 2Y6XA 5JDQA 4G2AA 5JDPA 1YS5A 2Y2XA 4PJMA 2CXLA 4AKRA 1HS7A 2EHOC 2W0GA 5FP3A 5HXHA 2J4UP 3KBTA 3RPUA 3K19A 3I0OA 1BR2A 3H3AA 2XAQB 1QUUA 4FUVA 4JCHA 3KFWX 2KMFA 4AYDC 3C98B 3POQA 3Q9DA 4IDZA 4O4JE 3LK2A 5JVDE 5T5FA 5BMVE 5KMGP 2EHOD 3HWBA 3FBZA 2M06A 4G63A 4L5GA 5JREA 2VB6A 3O1JA 5ADXL 4JFBA 3N2KE 5JDLA 3FBLA 2Q9QC 1VRBA 2V1DB 3R6NA 3PQUA 3MACA 3ONXA 2ZM0A 2YU2A 3V5SA 4E1TA 4JUYA 1D1CA 2ZM2A 3U78A 2LT3A 1LRZA 3EVYA 4H9OC 5FY0A 5EK2A 2ES0A 4L9IA 4ZI2C 3SS1A 4MFRA 1UX4A 2X9XA 5L3GB 5LG4A 2M07A 3T8OA 3B57A 3ZEFB 4QX8B 2N2NA 3L09A 3M65A 4AUIA 2N1GA 5LJNA 1HXTA 1YW0A 4IE5A 3UFEA 4XBFB 4UVAB 1Q9GA 3T20A 4TZ4C 4AXPA 4O3XB 3VY9X 4AYID 2NW8A 4PK4A 4UV9B 4LSFA 3CPZA 1SA0E 2X9WA 4GYRA 1ZKEA 5TAOA 4C91A 4WNKA 2J1NA 4FSOA 1LKXA 2YPVA 1S35A 2JJ9A 5L3EB 1MM5A 3LK3A 5LNKA 5EE2A 3C5OA 3UULA 2H7OA 2ZM8A 4H63V 3U3IA 3C64A 2ZFGA 1B7TA 1WLXA 2C0SA 1IZNA 4D5UA 3AAIA 5GONE 5FNVE 3O4XE 4PFOA 2MTQA 4X20E 4L0RA 5KX5E 4IE4A 5ETWA 3HOEA 1FEWA 2V26A 2E8IA 3POXA 4G76A 5F3JA 4UV8B 2IC9A 3OYXA 4H9NC 2EHOB 3ZMUB 4GCSA 4F4BA 4HTEA 4TV9E 3VE1A 1G90A 3LK41 3T24A 4KP3C 1MIYA 3KV9A 5JRCB 4O4UA 2JPFA 3CQGB 4EB6E 3EUHA 4GHBA 6PRNA 2RA1A 3ZCIA 3ETUA 1OXZA 3KVAA 4AKMA 4AKIA 2L3LA 5LGTB 5C8YE 3CMLA 3I9WA 2NW9A 3ZN0B 2W80C 3A2SX 5LXTE 3ZLIA 4JEHB 4X1IE 3ANWB 5LP6E 2WAUA 3N9MA 4FZNA 3T0SA 2B1EA 2VASA 2QTKA 4I55E 3AAEB 2ZLYA 3TKLB 2L9QA 4FJOA 4CXXA 5G26A 1BR4A 2IC6A 3Q5XA 4UF0A 4JLEA 3RRCA 5DQWA 4MALA 1GFMA 2XE3A 4RLBA 3GWHA 3IEEA 2WMOA 2LSYA 5LJMA 5IYUA 5JR9A 4ZS3A 2CXDA 3ZC1A 3RC3A 4IGUA 3VZWX 1MIVA 5L3DB 2E9XA 2X0LB 2X51A 3K3OA 2XG6A 1UCUA 2KXPA 3AA0A 4AFKA 4QQ1A 3PU8A 5L2LA 2XE2A 4HFVA 3PURA 4GOUA 3IF8B 4K0UA 2VL8A 2XASB 2KDYA 2DWKA 4RL9A 4AI6A 3C50A 2PBIA 3C51A 2LSJA 2CA5A 5DL8A 3RH3A 5LBMA 3UU2A 3PE0A 3LG7A 4ZHQE 2W63A 3KV4A 3NSGA 2Y48B 2C5JA 2W00A 4JEUB 2LHRA 1FMVA 1GFPA 2W61A 5HWXA 2YEVC 4P0AA 4TV8E 4MHCA 1SHZC 3PDYA 2MNHA 1IJ5A 2PJQA 3PU3A 5E0OA 5H6QB 2YINA 1H6S1 3VU7H 4LSHA 2OA5A 2XQYA 3ETVA 3UAQA 2RP4A 1PHOA 3HW9A 4EIWA 2LJLA 3BQLA 3Q2MA 4CI3B 5LYJE 3J7Yq 3SYBA 3GA8A 2A2FX 3ZJ2A 1V9DA 4ANJA 4CZZB 1GFOA 4QXCB 2XTQA 2V7MA 4FMSA 3WI5A 2D2SA 2MOZA 4LSIA 3HL6A 3N2OA 4E7ZA 2Q9QA 2XMXA 1ZHYA 2X9YA 3AA1A 1D0ZA 2CEAA 5EK3A 1O3XA 3WI4A 4ZOLE 1ZHWA 1H7CA 3CX6B 5J1GA 1Z0PA 2K48A 3AA7B 2LSGA 2I59A 3FB2A 4O49A 1MM4A 3ZYMA 4X1KE 1QSDA 3K3QC 4AKGA 3SWHA 5LGNB 2Y8DA 2XTRA 2X67A 3DTOA 1MMAA 3K3NA 4HKAA 4NUUA 1NAFA 4BJMA 2KZ7A 5H6RB 4I50E 3AAAA 4GIWA 3O1IA 5AFUL 3JC6C 5FXZA 2X9HA 4FESA 3KVDD 2LE8A 2NP9A 5CA1E 4HGAA 2DI4A 1QJ9A 4TN7B 4AKLA 3JC6D 1ZHTA 2X66A 3G7GA 5CB4E 2DNXA 3OBVE 2ZMAA 3AB3B 3D0TA 4O2AE 2JMKA 5HYAA 5JDMA 2GE4A 2XE5A 4P09A 4V1Av 2ZLDA 2HPLA 4QHOA 2VKOA 4O8SA 3OYZA 3GN5B 2WM9A 2H7VC 1OWAA 3IBPA 4B6XA 3NRXA 1OSMA 2CE7A 2QA7A 3EDVA 3GMIA 4BAYB 4X1YE 3KVBA 5HAXA 4DO0A 5HXSA 2CCQA 3VKHA 3OKQA 2K4TA 1QJPA 3WI3A 4FRXA 1CUNA 4GYSA 3N9OA 4KR4A 4UIGA 5A1LA 4PJJA 3VKGA 4U72A 3AA6B 2VKDA 2XUEA 3F57A 3KINB 5L3CB 3P7IA 3DP7A 2Y7SA 4TX5A 3AVSA 4H9QC 4OYKA 4OYJA 4M1PA 4H9PC 3LBXB 1D1AA 5FYMA 4UEMA 3FXEB 2D0TA 5IHYA 4ZI7E 4ADZA 3HKBE 1HXUA 2C5KT 2NTYA 3BK9A 3N9NA 3LFMA 2A3DA 3PUSA 4A56A 3UUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IZN B;  2KXP B;  3AA0 B;  4AKR B;  3AAE A;  3LK4 2;  2KZ7 A;  3AAA A;  3AA7 A;  3LK3 A;  5AFU L;  3AA1 B;  3AA6 B;  1IZN A;  3LK2 B;  2KXP A;  4AKR A;  5ADX K;  3AA0 A;  3AA1 A;  5AFU K;  3AA6 A;  2KZ7 B;  3LK2 A;  3AAE B;  3LK4 1;  3AAA B;  3AA7 B;  3LK3 B;  5ADX L; 
#chains in the Genus database with same CATH topology
 1E54 A;  1T8B A;  2LOS A;  4JV5 T;  5AQN B;  2JMM A;  4NUV A;  2IWV A;  1WYC A;  2LOP A;  1OPF A;  4FSP A;  4A5X A;  3PRN A;  4ZZC A;  5DQV A;  3FYX A;  3M3Z B;  2H89 A;  4AKR B;  2CLY B;  4IT4 A;  4B3T T;  3ZPO A;  4DND A;  2WBL A;  2BVL A;  3Q5W A;  2XQA A;  3AE8 A;  5FXW A;  3CQX C;  5L4E A;  5J2T E;  2FUP A;  2KZ7 B;  1QJ8 A;  4YHJ A;  1THQ A;  4AYE C;  1LVK A;  2VVN A;  3UU8 A;  3O9X A;  1Y64 B;  2F1T A;  2D0U A;  4IL4 A;  4PK6 A;  3H37 A;  3ZT5 A;  3PQS A;  4N58 A;  3TLV A;  5JDG A;  3RYC E;  2IDO B;  2IUB A;  4EV6 A;  4PJL A;  2WJR A;  2V7K A;  2VL0 A;  4JI3 T;  1IZN B;  2NW7 A;  1HXX A;  2ODJ A;  3AAE A;  1D0X A;  3QK6 A;  4O4X A;  5HWY A;  5HEJ A;  2JQQ A;  1T98 A;  4N59 A;  2F4V T;  2JIW A;  5F5W A;  3DJB A;  3HKC E;  4N74 A;  2I0M A;  5AQQ B;  2UXN B;  3NRY A;  2M67 A;  1W9R A;  3PUQ A;  2KWI B;  4H9R C;  1FJG T;  3ZN1 B;  3SFE A;  5LGU B;  2CXF A;  3VHL A;  4LMJ A;  2XE1 A;  4Z91 A;  4EAH A;  2IWW A;  4ISS A;  4UXN B;  3NZP A;  2N9D A;  5C3J A;  5DL7 A;  1HX8 A;  1XNR T;  4CN1 A;  4U9C A;  2N2M A;  4GK0 E;  1GQE A;  3HR0 A;  4K3C A;  1I94 T;  4G75 A;  2PG8 A;  2Z6E A;  4JI7 T;  3QNU A;  5AQV B;  4FZM A;  2PTF A;  2IIU A;  2AXT O;  2W62 A;  3FZF B;  1MMG A;  5ABG A;  5ADX K;  2K5B B;  3SY7 A;  2J62 A;  4PW8 A;  5EZY E;  4BUM X;  4D64 A;  4YT0 A;  2ACX A;  3R84 B;  2LLY A;  1FMW A;  4YFS A;  4CI2 B;  1ZHZ A;  1OED C;  5JTG A;  3I0Q A;  4QXB B;  1UX5 A;  3NBX X;  2Q9Q B;  1DU2 A;  2J4G A;  2CWY A;  2K9A A;  3AE7 A;  3MZK B;  4HFI A;  4DV0 T;  1E1H B;  2FJB A;  4TNV A;  2BVM A;  5LA6 E;  5J2U E;  5HCM A;  4CXY A;  1ORM A;  2KLQ A;  2V7J A;  4DR1 T;  4YSZ A;  3AAA B;  1US7 B;  2CBJ A;  1NEN A;  2BBH A;  3UUX B;  4WYV A;  3QC9 A;  4F8H A;  4UEL A;  2LM2 A;  3JAD A;  2XAG B;  2X0H A;  1HNW T;  2I6H A;  4YLH A;  4DVD A;  2LHF A;  5GV0 A;  3MJX A;  1J5W A;  3HKD E;  4HE8 A;  1MIW A;  2R8A A;  3B13 A;  2D5U A;  2SPC A;  2YKS A;  3A8Y C;  2XQ7 A;  2BZB A;  4IL6 O;  4I4T E;  3WAK A;  1HF8 A;  1U4Q A;  4B3S T;  3ZCJ A;  5JDP A;  1YS5 A;  1HX1 B;  4PJM A;  2QYW A;  2W0G A;  3IA3 A;  2J4U P;  3KBT A;  3K19 A;  2YOE A;  1BR2 A;  3RIU A;  3POQ A;  4U7I A;  3Q9D A;  4IDZ A;  5T5F A;  3LK2 A;  5KMG P;  3FBZ A;  4JI8 T;  5JRE A;  5ADX L;  4JI6 T;  4FQE A;  4PJ0 O;  3R6N A;  3V5S A;  1D1C A;  4L9I A;  1UX4 A;  1W0B A;  2X9X A;  5LG4 A;  3T8O A;  4LML A;  2LKG A;  4QX8 B;  2N1G A;  5LJN A;  1HXT A;  2CRB A;  3T20 A;  3UQ7 A;  4PK4 A;  3CPZ A;  1SA0 E;  4C91 A;  4TWF A;  2J1N A;  2WVP A;  4DUY T;  1QLB A;  2E5V A;  3UUL A;  2ZM8 A;  2HN2 A;  3AXJ B;  4QH5 A;  5FNV E;  5AQP B;  5HCJ A;  5G3A A;  3ZSS A;  3OYX A;  3ZMU B;  5LMN T;  3VE1 A;  3KV9 A;  5JRC B;  4O4U A;  5IUX A;  2RA1 A;  3ZCI A;  2XJ7 A;  5LGT B;  5C8Y E;  3CML A;  2W80 C;  3ZLI A;  3ANW B;  3N9M A;  4UB8 O;  2B1E A;  3AE5 A;  2ZLY A;  3TKL B;  4CXX A;  3IEE A;  2WMO A;  2M6B A;  2HHH T;  4ZS3 A;  3PUX F;  4IGU A;  4JBW F;  2E9X A;  2XG6 A;  4NXN T;  3PU8 A;  5L2L A;  2XM1 A;  4GOU A;  3IF8 B;  2VL8 A;  2WU2 A;  4RL9 A;  5AQO B;  3WU2 O;  3UU2 A;  3PE0 A;  3EAB A;  3NSG A;  2OV9 A;  2LHR A;  2YEV C;  4DV1 T;  3PJA A;  1SHZ C;  3PDY A;  5E0O A;  3PU3 A;  2YIN A;  4LSH A;  3ETV A;  3J7Y q;  3SYB A;  3GA8 A;  2A2F X;  3ZJ2 A;  4QXC B;  1WFD A;  3HL6 A;  2XMX A;  2X9Y A;  2CEA A;  2NR4 A;  4CN6 A;  5J1G A;  1OED E;  4TWH A;  4X1K E;  3QOF A;  2XTR A;  1MMA A;  3G06 A;  3PUZ F;  4I0U A;  4DV4 T;  1XDO A;  5CA1 E;  2V6Y B;  3G7G A;  2DNX A;  5FL1 A;  2ZMA A;  5HYA A;  3BRZ A;  2ZLD A;  4P09 A;  4QHO A;  5KXJ A;  2VKO A;  3GN5 B;  2H7V C;  3NRX A;  4IDQ A;  2CE7 A;  3ZT6 A;  4BAY B;  2QRX A;  3VKH A;  2CCQ A;  2UUB T;  1QJP A;  3WI3 A;  4UIG A;  3AA6 B;  2VKD A;  1YXR A;  2UUA T;  2YDR A;  2Y7S A;  3AVS A;  4H9P C;  3ZKR A;  2AXD S;  4A56 A;  2BBJ A;  3AA0 B;  3HA4 A;  4KI0 F;  5L3F B;  2KWH A;  4O3W A;  4K0K T;  4DV6 T;  3NJT A;  3ZMS B;  1YD8 G;  1AJ3 A;  2J1D G;  4HFH A;  4NPP A;  1G73 A;  1MPF A;  3CQC B;  5FXX A;  2XPK A;  4PK5 A;  3FZM B;  4B61 A;  4J2C A;  2YU1 A;  4N75 A;  4Q25 A;  1LVF A;  4PJN A;  2CHO A;  2XAJ B;  3UU6 A;  3RGL A;  3NZQ A;  1N34 T;  2DCF A;  4WBO A;  3F31 A;  2JQH A;  3ZT7 A;  4QKN A;  4OHF A;  2HH7 A;  2KSR A;  4PAG A;  2EHO A;  2DLR A;  2YNK A;  1MMD A;  4I43 B;  4GK5 E;  4UVC B;  3SZV A;  3B5M A;  3AEC A;  3E08 A;  4B3M T;  2YDQ A;  4KUM B;  3RIA A;  2VQF T;  4EZH A;  2NOX A;  2LM9 A;  4C90 A;  4XZC A;  3L8R A;  3LK3 B;  4P0B A;  4BJN A;  2K0L A;  4O4L E;  5AQS B;  5L47 A;  5D5D A;  2CM0 A;  3A0B O;  1OED B;  2E9X D;  3RI5 A;  2CHN A;  4B3R T;  3UUB A;  2G0U A;  2WWV A;  3VY8 X;  1FIO A;  3SOL A;  1T7S A;  3UUM A;  1BR0 A;  3K8P C;  4XAX B;  1VOM A;  4LF9 T;  5FVN A;  4ILU A;  5DJQ C;  1IJ6 A;  3LJC A;  3V5U A;  3RF1 A;  3SZD A;  5JDF A;  4C4V A;  4IE6 A;  4UF0 B;  2QGS A;  2X27 X;  3Q5D A;  4ILA A;  4GCQ A;  4ZI2 D;  2HPJ A;  4PUX A;  4DBQ A;  3IHR A;  3DWO X;  2Y0K A;  2KXP B;  4UB6 O;  3AA7 A;  1X79 A;  5DL6 A;  2BS3 A;  5L4H A;  3EMN X;  4KBM B;  3O0E A;  3RYH E;  2WSS V;  3JAF A;  5G38 A;  5AQF B;  3ZST A;  4OFZ A;  2CPT A;  4CN4 A;  3N5L A;  5JH7 E;  5B5E O;  4TUY E;  4LF4 T;  3CX8 B;  4GKK T;  5AQL B;  2IML A;  4RLC A;  1YKH B;  4TNW A;  4EYU A;  3ZMV B;  2PFV A;  5M4Y A;  2WWU A;  2X68 A;  3QUJ A;  3RKO A;  1J5E T;  1IBM T;  2NTX A;  2K24 A;  4F6R C;  4WBN E;  3OPC A;  3UU5 A;  3OJA A;  2ODU A;  4HWH A;  5IYZ E;  4WW0 A;  3S4U A;  4NXM T;  5FKY A;  3VR9 A;  3AE3 A;  4E7S A;  1ZHC A;  5E79 O;  4N78 D;  4AYN A;  3VZT X;  5JR9 C;  2KC0 A;  3RHW A;  2MAW A;  5FY7 A;  2ZM6 T;  1E2A A;  5FMN A;  3GP6 A;  3HI2 A;  3CX7 B;  4ZZB A;  1D1B A;  2AE9 A;  4IDP A;  2B76 A;  4DV5 T;  2RPA A;  4AKR A;  2CXL A;  2EHO C;  1T72 A;  2WCA A;  3I0O A;  3H3A A;  4FUV A;  1QUU A;  2KMF A;  5JVD E;  5BMV E;  2EHO D;  4G63 A;  4L5G A;  3O1J A;  4JFB A;  3N2K E;  3JCU O;  5JDL A;  2ZM0 A;  3NKZ A;  5AQU B;  4E1T A;  2ZM2 A;  3U78 A;  4EGW A;  2ES0 A;  4GKJ T;  2E2A A;  4MFR A;  2FJA A;  3L09 A;  3M65 A;  4AUI A;  3UFE A;  4IE5 A;  3JCF A;  4COF A;  2NW8 A;  4LSF A;  5TAO A;  4GYR A;  2QVA A;  5LNK A;  2H7O A;  5AQG B;  3C64 A;  2C0S A;  1IZN A;  5GON E;  4A97 A;  4IE4 A;  3HOE A;  1FEW A;  2BG9 A;  5ABF B;  4UV8 B;  4H9N C;  4HTE A;  4ZXL A;  4KP3 C;  1MIY A;  2YN6 A;  3AE2 A;  4EB6 E;  3ETU A;  3AEB A;  1OXZ A;  4AKM A;  4DR7 T;  2BS4 A;  4U2Z A;  2L3L A;  3I9W A;  1UGO A;  3EAM A;  5LP6 E;  4FZN A;  3PJA J;  2VAS A;  4I55 E;  5G26 A;  3ABV A;  4JLE A;  5DQW A;  4MAL A;  1GFM A;  4JYA T;  4U31 A;  3RC3 A;  4IDO A;  4JI4 T;  3K3O A;  2XE2 A;  4K0U A;  2XAS B;  2KDY A;  2R88 A;  4AI6 A;  2LSJ A;  1I6Z A;  3KV4 A;  5LG3 A;  2R4L A;  4JEU B;  1FMV A;  4LFA T;  4TV8 E;  4MHC A;  3AE6 A;  3VU7 H;  1J1J A;  2LKH A;  2RP4 A;  4LF5 T;  2LJL A;  4ANJ A;  1V9D A;  2V7M A;  4LSI A;  2Q9Q A;  1ZHY A;  4DV7 T;  3WI4 A;  5EK3 A;  4ZOL E;  1ZHW A;  4LF6 T;  1H7C A;  2BS2 A;  3CX6 B;  2I59 A;  3FB2 A;  3ZYM A;  2XQ6 A;  1QSD A;  2WDR A;  3K3Q C;  3UFG A;  2X67 A;  2OLT A;  3K3N A;  2W67 A;  1NAF A;  5H6R B;  3AAA A;  3TLW A;  3O1I A;  3FZK B;  3JC6 C;  2V5C A;  3VRA A;  1N32 T;  4AIS A;  2X9H A;  3QB5 A;  4FES A;  3KVD D;  2LE8 A;  1QJ9 A;  3JC6 D;  5CB4 E;  3AB3 B;  5HEO A;  1XMO T;  2JMK A;  5JDM A;  2GE4 A;  2HPL A;  4Z90 A;  4O8S A;  4B6X A;  1OSM A;  3PF1 A;  4DO0 A;  3KVB A;  5AQJ B;  5AQH B;  4U72 A;  3F57 A;  3KIN B;  5L3C B;  1R8I A;  4TX5 A;  4U3C A;  4OYJ A;  3LBX B;  1D1A A;  2WJQ A;  4UEM A;  2R4N A;  4JI2 T;  3HKB E;  2NTY A;  3N9N A;  2LRK A;  4OX9 T;  3VRB A;  3UUN A;  3UQ4 A;  4LMK A;  2L8K A;  3MK7 C;  4AQF A;  3Q5E A;  4ZI3 C;  2NWB A;  4QH4 A;  3DA3 A;  1ZV4 X;  1HTJ F;  2UXC T;  4ZI3 D;  5HXE A;  5AQR B;  4HEA A;  3N9Q A;  7PRN A;  5HXC A;  3AEE A;  3PV0 F;  2BG9 C;  2FGR A;  2Y0H A;  3PUG A;  5CA0 E;  2A9U A;  4Z3T A;  4O2B E;  4IHJ E;  4UVB B;  3N2G E;  1U5P A;  5FVK A;  4AKH A;  4X66 T;  2YK0 A;  3QRA A;  5KDM C;  3CVR A;  2VKJ A;  3AXJ A;  3MKD A;  2POR A;  1NEK A;  4U74 A;  3RIF A;  3RC8 A;  5LHI B;  3A0H O;  3MXZ A;  1IBL T;  1S94 A;  2BKP A;  4LFB T;  3BQI A;  3ZJ1 A;  1BXW A;  3K1S A;  3AEF A;  3E0Z A;  2DWG A;  4AIU A;  5JRC A;  4EED A;  3EI0 A;  3CWZ B;  2KND A;  2C5I T;  2R4P A;  4QXH B;  1M7K A;  1P4T A;  2W4X A;  2V5D A;  4ZS2 A;  5JDN A;  2BDE A;  4CI1 B;  3ANW A;  3PGR A;  1G8X A;  4IE0 A;  3MA9 A;  1KK7 A;  1YQ3 A;  3RRW A;  1ZEE A;  3KDS E;  4KHZ F;  2DHR A;  5TIS O;  5DL5 A;  4KHP T;  1E7P A;  2LSK A;  3O1H A;  3VZU X;  4LFC T;  5LOV E;  1BR1 A;  3LDQ B;  3P8C D;  4EZ4 A;  2VWA A;  4U7Y A;  3RIU C;  3J9X 1;  3PTR B;  3E22 E;  2Q9Q D;  2XQ5 A;  4BA9 A;  1HCI A;  5PRN A;  4AZL A;  5FVL A;  4GF4 A;  5JR9 B;  2MHL A;  3A7M A;  3PUW F;  1SE7 A;  3AED A;  3L3P A;  4CQI A;  2MPK A;  3TZG A;  4FZL A;  4O4I E;  2ODV A;  4MBQ A;  3PGS A;  2XQ9 A;  2OMF A;  3HOL A;  3V8U A;  3RX6 A;  4PFP A;  5LHG B;  4OK0 A;  2ERV A;  2XHE B;  5AFU K;  3JTY A;  4PNI A;  3CKD A;  4ASK A;  3UPG A;  4YXD A;  3SY9 A;  2H88 A;  3N9L A;  3SYS A;  2V7I A;  3P50 A;  2LRL A;  3EHZ A;  4FRT A;  2JRK A;  3AA1 B;  5CGM A;  4YY3 T;  3GN5 A;  2W81 C;  1GFQ A;  2O4V A;  2VK9 A;  4UR9 A;  4EOZ B;  2V7L A;  2VKH A;  5JQG E;  4AQF C;  3QRC A;  3HKE E;  3AA6 A;  1WR0 A;  5JDH A;  5HEG A;  4DR2 T;  5LHH B;  4H9S E;  1D0Y A;  3VE2 A;  4E1S A;  2FBW A;  3OVU A;  4DMW A;  3P4Q A;  1L0V A;  2F1C X;  4A98 A;  4AQG A;  3FXD B;  4LSE A;  2LEH A;  2E9X C;  1XWM A;  3AE1 A;  1UUR A;  4ERR A;  2LFU A;  2Y6X A;  5JDQ A;  4G2A A;  4AQY T;  2Y2X A;  1HNZ T;  2WS3 A;  3RPU A;  4JCH A;  4AYD C;  3RLF F;  3HWB A;  2M06 A;  2X9K A;  1SUM B;  2BG9 E;  2CBI A;  2IHR 1;  1VRB A;  2V1D B;  3ONX A;  2YU2 A;  4JUY A;  2LT3 A;  1LRZ A;  3EVY A;  4DR3 T;  5EK2 A;  4ZI2 C;  4HFD A;  5L3G B;  5ABH A;  3AE9 A;  3ZEF B;  2XZE A;  2N2N A;  1JNZ A;  4TZ4 C;  4O3X B;  5ABE A;  2JQ9 A;  4UV9 B;  2X9W A;  1ZKE A;  3UU4 A;  4WNK A;  5BR8 T;  2XM2 A;  2YPV A;  2JJ9 A;  1MM5 A;  3LK3 A;  5EE2 A;  3C5O A;  4YHH T;  2ZFG A;  1WLX A;  3AAI A;  5CJ5 A;  1OED A;  4TWD A;  1CHU A;  2MTQ A;  4X20 E;  3POX A;  5ETW A;  4G76 A;  2IC9 A;  4GCS A;  4F4B A;  4TV9 E;  3LK4 1;  3T24 A;  3VR8 A;  1YQ4 A;  5GTI O;  3PGU A;  4GHB A;  2XQ3 A;  1XZY A;  3KVA A;  2K3W A;  5LXT E;  4JEH B;  4YTM A;  2JQY A;  2V6X A;  1N36 T;  3AAE B;  2L9Q A;  1KFY A;  4UF0 A;  3Q5X A;  3RRC A;  3X1D A;  2XE3 A;  4RLB A;  3PUY F;  3GWH A;  4ILC A;  2LSY A;  4K3B A;  5HEU A;  2R6G F;  3ZC1 A;  4DUZ T;  3VZW X;  1MIV A;  2X0L B;  2KXP A;  4QQ1 A;  2DWK A;  3C50 A;  2PBI A;  2CA5 A;  3RH3 A;  4ZHQ E;  3LG7 A;  2XQ4 A;  2C5J A;  5HWX A;  4P0A A;  2PJQ A;  1H6S 1;  5H6Q B;  2VQE T;  2OA5 A;  3HW9 A;  4EIW A;  1Y01 A;  4CI3 B;  3Q2M A;  4IRE A;  1GFO A;  4CZZ B;  4X65 T;  2XTQ A;  3WI5 A;  2D2S A;  2XSB A;  3N2O A;  1D0Z A;  4U33 A;  1O3X A;  4U2Y A;  2K48 A;  2LSG A;  4O49 A;  1MM4 A;  4AKG A;  5LGN B;  2WU5 A;  2XSA A;  4BJM A;  2KZ7 A;  4I50 E;  2BG9 B;  1W0A A;  5FXZ A;  3RQU A;  4TN7 B;  1ZHT A;  4HFC A;  3OBV E;  2YDS A;  4DV3 T;  4V1A v;  3OYZ A;  2WM9 A;  1OWA A;  3EDV A;  5HAX A;  5HXS A;  3OKQ A;  2K4T A;  1S5L O;  3N9O A;  4PJJ A;  3VKG A;  4HWI B;  2XUE A;  1UK5 A;  4DR6 T;  3DP7 A;  4H9Q C;  1KNR A;  5FYM A;  3FXE B;  2D0T A;  5IHY A;  4ZI7 E;  1HXU A;  2C5K T;  5LB7 B;  3LFM A;  2A3D A;  4YSY A;  2FJE A;  5LCY A;  3F2E A;  2FGQ X;  2LHN A;  3TLU A;  4P1N A;  4X64 T;  4IST A;  2CWO A;  4O3Z A;  1NWM X;  3AEA A;  3RYF E;  1N33 T;  2R89 A;  3T1Y T;  3W15 B;  2WDQ A;  2IW5 B;  1BT9 A;  5IWA T;  2N2L A;  3ONJ A;  5LBQ B;  4CTD A;  3BQK A;  1Z8U A;  3A5X A;  4RJX A;  3LK2 B;  2JQK A;  4X5T A;  4DR4 T;  1Q9F A;  3KBU A;  2MBG A;  1MND A;  3LSV A;  4HWD A;  5FL0 A;  3UTK A;  5AQT B;  1X9B A;  2H3R A;  5ABF A;  3KV6 A;  4DBR A;  3RYI E;  8PRN A;  2BKO A;  3AEG A;  3ZYL A;  3C4X A;  4AYM C;  4H63 H;  1MNE A;  2WZI A;  3CIR A;  2XAH B;  4C69 X;  3FHN A;  1WCR A;  1XMQ T;  3DA4 A;  4FI5 A;  4EYY R;  2UXB T;  4GCP A;  4FOZ A;  3DWN A;  4JI5 T;  4YJ2 E;  1PRN A;  4O4H E;  5DAB A;  5AQM B;  5HXR A;  1T16 A;  3RBH A;  1KNP A;  1XDP A;  1HG5 A;  1BH3 A;  4IE7 A;  1HFA A;  4IIJ E;  2XQ8 A;  4EXT A;  3UT5 E;  4XNL A;  4QWN B;  2FJD A;  2CLY C;  1GFN A;  3I9Y A;  4ZEY A;  3WAJ A;  2BKN A;  3NWI A;  3QB5 K;  3N9P A;  3P4S A;  4JI1 T;  2V8S V;  2XY8 B;  3I1A A;  2WY2 A;  4HFB A;  1IBK T;  3POU A;  2HN1 A;  1KNZ A;  2JMH A;  3POR A;  2KT9 A;  4HWF A;  4Z8X A;  3FZL B;  4KMC A;  1YKE B;  5F8P A;  2E9X B;  2IAK A;  1W09 A;  3ESL A;  3EDU A;  3ONL C;  4MLK A;  3ZC0 A;  1WR6 A;  2J47 A;  4PR7 A;  3AVR A;  3PUV F;  4HFE A;  1HNX T;  2ACZ A;  5FXV A;  3C4Z A;  5EK4 A;  2DL1 A;  2P9B A;  3CK6 A;  1MMN A;  1EZ3 A;  3T1H T;  4HN9 A;  2LSI A;  5HEH A;  5AQI B;  3C4W A;  4QH1 A;  3SRZ A;  3P4W A;  4IL9 A;  4YJ3 E;  3RQW A;  3SFD A;  4DMV A;  2A72 A;  3ZYK A;  2XAF B;  2KIN B;  3PUA A;  4CXW A;  2F1V A;  2W2U A;  3TLS A;  1UUS A;  4RJW A;  3DZM A;  3ZMT B;  3LBX A;  3ZMZ B;  2UXX B;  1HG2 A;  4FT6 A;  3P4R A;  4D65 A;  2GK9 A;  5L3B B;  1WRD A;  2UU9 T;  2Y0L A;  5CFB A;  4XNK A;  2WMN A;  2XTL A;  2MYS A;  3OTO T;  4O3Y A;  4NIQ A;  1ZHX A;  2W66 A;  2M6I A;  1IAP A;  2CMR A;  4KR8 A;  4QX7 B;  3LK4 2;  4ILB A;  3KV5 A;  5FY1 A;  1T1L A;  4KRA A;  2PRN A;  1WYB A;  1HS7 A;  1ZP0 A;  5FP3 A;  5HXH A;  2XAQ B;  3KFW X;  3C98 B;  4O4J E;  2WQY A;  2VB6 A;  5AQK B;  3FBL A;  2Q9Q C;  3PQU A;  3MAC A;  4WZX A;  1ZOY A;  4H9O C;  5FY0 A;  5KAF O;  2WDV A;  3SS1 A;  4JI0 T;  2M07 A;  3B57 A;  1YW0 A;  4XBF B;  1Q9G A;  4UVA B;  4LF8 T;  4AXP A;  3VY9 X;  4C00 A;  4AYI D;  2VVS A;  4FSO A;  5LMU T;  1LKX A;  1S35 A;  5L3E B;  3H3M A;  2X0Y A;  3BRY A;  4H63 V;  3U3I A;  1B7T A;  4D5U A;  3O4X E;  4YTN A;  4PFO A;  4L0R A;  5KX5 E;  2V26 A;  2E8I A;  5F3J A;  2EHO B;  4IDN A;  5H2F O;  1G90 A;  4YSX A;  2JPF A;  2V6Y A;  3CQG B;  3EUH A;  6PRN A;  4AKI A;  2D9D A;  3ZN0 B;  2NW9 A;  3A2S X;  4DID B;  4X1I E;  3AE4 A;  2WAU A;  4DR5 T;  2R4O A;  3T0S A;  2QTK A;  3P4P A;  4FJO A;  1BR4 A;  4KX6 A;  2IC6 A;  2UXD T;  3UU3 A;  5LJM A;  5IYU A;  5JR9 A;  4EEB A;  5B66 O;  2CXD A;  5L3D B;  2X51 A;  5GTH O;  1UCU A;  2WB5 A;  3AA0 A;  4AFK A;  4HFV A;  4X62 T;  3PUR A;  3C51 A;  3JAE A;  5DL8 A;  5LBM A;  2W63 A;  2Y48 B;  1GFP A;  2W00 A;  2W61 A;  2WP9 A;  5G39 A;  1VCT A;  2MNH A;  1IJ5 A;  1HR0 T;  2VUR A;  4C4V B;  2XQY A;  1JNR A;  3UAQ A;  1PHO A;  3BQL A;  5LYJ E;  2E5L T;  1KF6 A;  4FMS A;  2MOZ A;  4E7Z A;  5J0Z A;  3AA1 A;  3BS0 A;  3KZI O;  4HWC A;  1XNQ T;  1Z0P A;  3AA7 B;  3SWH A;  2Y8D A;  3DTO A;  2WZH A;  4LF7 T;  4HKA A;  4NUU A;  4DV2 T;  4YTP A;  4GIW A;  5AFU L;  3TLT A;  2NP9 A;  4HGA A;  2DI4 A;  3FZH B;  4AKL A;  2X66 A;  5C2T A;  3L39 A;  3D0T A;  4O2A E;  2XE5 A;  3IBP A;  5KAI O;  2QA7 A;  3GMI A;  4X1Y E;  2UUC T;  4FRX A;  1CUN A;  4GYS A;  4KR4 A;  5A1L A;  3NVO A;  3P7I A;  1VCS A;  4OYK A;  4M1P A;  3RKG A;  4ADZ A;  1KEY A;  1M62 A;  3BK9 A;  3PUS A; 
#chains in the Genus database with same CATH homology
 5LCY A;  1E54 A;  2L8K A;  2LOS A;  3MK7 C;  3AA0 B;  3HA4 A;  4AQF A;  4ZI3 C;  3F2E A;  2FGQ X;  2LHN A;  5L3F B;  2NWB A;  2KWH A;  4O3W A;  3DA3 A;  2JMM A;  1ZV4 X;  1HTJ F;  4NUV A;  4IST A;  2CWO A;  4ZI3 D;  4O3Z A;  1WYC A;  3ZMS B;  5HXE A;  2LOP A;  1NWM X;  1YD8 G;  3RYF E;  1OPF A;  1AJ3 A;  2J1D G;  4FSP A;  4HEA A;  3N9Q A;  3W15 B;  1G73 A;  7PRN A;  1MPF A;  3PRN A;  3CQC B;  5FXX A;  5HXC A;  4PK5 A;  2IW5 B;  5DQV A;  1BT9 A;  4B61 A;  4J2C A;  2N2L A;  3FYX A;  2YU1 A;  2FGR A;  1LVF A;  5LBQ B;  4AKR B;  4PJN A;  2Y0H A;  3PUG A;  5CA0 E;  2CLY B;  3BQK A;  3ZPO A;  4DND A;  4Z3T A;  4O2B E;  2WBL A;  3A5X A;  4IHJ E;  4UVB B;  2BVL A;  2XAJ B;  3N2G E;  1U5P A;  4RJX A;  3LK2 B;  4AKH A;  3Q5W A;  3NZQ A;  1Q9F A;  2YK0 A;  3KBU A;  2MBG A;  2DCF A;  3CQX C;  5FXW A;  5J2T E;  1MND A;  4WBO A;  3F31 A;  5KDM C;  3QRA A;  3CVR A;  2VKJ A;  3MKD A;  2POR A;  2KZ7 B;  4U74 A;  1QJ8 A;  3RC8 A;  4YHJ A;  5LHI B;  4QKN A;  4OHF A;  1THQ A;  3MXZ A;  4AYE C;  3UTK A;  1S94 A;  2HH7 A;  2H3R A;  1LVK A;  4PAG A;  2EHO A;  3KV6 A;  3BQI A;  2DLR A;  3ZJ1 A;  4DBR A;  1BXW A;  3O9X A;  1Y64 B;  3E0Z A;  2F1T A;  3RYI E;  1MMD A;  2D0U A;  2DWG A;  4I43 B;  4GK5 E;  4UVC B;  5JRC A;  2YNK A;  3SZV A;  8PRN A;  4PK6 A;  3ZYL A;  3CWZ B;  3H37 A;  3C4X A;  2KND A;  2C5I T;  3PQS A;  3E08 A;  4N58 A;  4AYM C;  4H63 H;  4QXH B;  1MNE A;  4KUM B;  5JDG A;  1P4T A;  4EZH A;  4ZS2 A;  5JDN A;  2BDE A;  2NOX A;  2LM9 A;  3RYC E;  4C90 A;  4XZC A;  4CI1 B;  2XAH B;  4PJL A;  3ANW A;  3LK3 B;  4P0B A;  4BJN A;  1G8X A;  2K0L A;  4C69 X;  3FHN A;  4IE0 A;  4O4L E;  2V7K A;  3DA4 A;  5D5D A;  4FI5 A;  1IZN B;  2CM0 A;  2NW7 A;  1KK7 A;  3MA9 A;  1HXX A;  4EYY R;  2ODJ A;  3AAE A;  4GCP A;  3RRW A;  2E9X D;  1D0X A;  1ZEE A;  4FOZ A;  3QK6 A;  4O4X A;  3KDS E;  5HWY A;  4YJ2 E;  1PRN A;  4O4H E;  2JQQ A;  1T98 A;  5DAB A;  2DHR A;  2G0U A;  4N59 A;  3VY8 X;  3DJB A;  5HXR A;  3HKC E;  3RBH A;  1FIO A;  5DL5 A;  1HG5 A;  2LSK A;  3O1H A;  3SOL A;  1BH3 A;  3VZU X;  4IE7 A;  1HFA A;  2UXN B;  3NRY A;  2M67 A;  5LOV E;  4IIJ E;  3PUQ A;  4EXT A;  2KWI B;  4H9R C;  3UT5 E;  3ZN1 B;  3UUM A;  5LGU B;  2CXF A;  4XNL A;  1BR1 A;  1BR0 A;  3VHL A;  3K8P C;  4XAX B;  4QWN B;  1VOM A;  2XE1 A;  2CLY C;  4ILU A;  3P8C D;  3I9Y A;  5DJQ C;  1IJ6 A;  3LJC A;  2VWA A;  4EZ4 A;  1GFN A;  3J9X 1;  3V5U A;  3WAJ A;  3PTR B;  4EAH A;  3N9P A;  3E22 E;  2Q9Q D;  4BA9 A;  1HCI A;  4ISS A;  3SZD A;  5JDF A;  4UXN B;  3NZP A;  2N9D A;  3I1A A;  4IE6 A;  5PRN A;  5DL7 A;  1HX8 A;  4UF0 B;  2QGS A;  2X27 X;  3POU A;  4GCQ A;  4U9C A;  4ZI2 D;  2N2M A;  4GK0 E;  2HPJ A;  4GF4 A;  4AZL A;  3HR0 A;  4PUX A;  5JR9 B;  1KNZ A;  2JMH A;  2MHL A;  4G75 A;  2PG8 A;  4DBQ A;  2Z6E A;  3L3P A;  3IHR A;  3POR A;  5FVN A;  2KT9 A;  4Z8X A;  4CQI A;  4KMC A;  1YKE B;  5F8P A;  2Y0K A;  2E9X B;  3TZG A;  4FZL A;  2KXP B;  4FZM A;  2IAK A;  4O4I E;  2ODV A;  4MBQ A;  3ESL A;  1X79 A;  3AA7 A;  5DL6 A;  3EDU A;  4MLK A;  2W62 A;  2OMF A;  3ZC0 A;  4KBM B;  3EMN X;  3O0E A;  1MMG A;  1WR6 A;  3RYH E;  3HOL A;  2WSS V;  3V8U A;  3RX6 A;  4PFP A;  3AVR A;  2K5B B;  5LHG B;  5ADX K;  4OK0 A;  2ERV A;  3SY7 A;  4OFZ A;  2XHE B;  3N5L A;  5FXV A;  5AFU K;  5JH7 E;  3JTY A;  4PW8 A;  3C4Z A;  4PNI A;  4TUY E;  5EK4 A;  5EZY E;  4BUM X;  4D64 A;  2P9B A;  2ACX A;  3CKD A;  3R84 B;  4ASK A;  3CX8 B;  3UPG A;  4RLC A;  1MMN A;  3SY9 A;  1EZ3 A;  1FMW A;  4YFS A;  4CI2 B;  1ZHZ A;  4HN9 A;  1YKH B;  2LSI A;  3N9L A;  3I0Q A;  3SYS A;  4QXB B;  1UX5 A;  2V7I A;  3NBX X;  3C4W A;  4EYU A;  2Q9Q B;  4FRT A;  3ZMV B;  3SRZ A;  2JRK A;  2PFV A;  3AA1 B;  5M4Y A;  2CWY A;  2K9A A;  2WWU A;  3GN5 A;  3MZK B;  4YJ3 E;  4DMV A;  2A72 A;  3ZYK A;  1E1H B;  1GFQ A;  2O4V A;  2VK9 A;  2W81 C;  2X68 A;  4EOZ B;  2V7L A;  2VKH A;  2BVM A;  5JQG E;  5LA6 E;  3QUJ A;  4AQF C;  2XAF B;  3HKE E;  3RKO A;  2KIN B;  3PUA A;  3QRC A;  2NTX A;  5J2U E;  3AA6 A;  1ORM A;  4CXW A;  4CXY A;  5JDH A;  2F1V A;  2KLQ A;  2K24 A;  4F6R C;  2V7J A;  4WBN E;  3AAA B;  3OJA A;  1US7 B;  2ODU A;  4RJW A;  5LHH B;  3ZMT B;  3LBX A;  4H9S E;  3ZMZ B;  2UXX B;  3UUX B;  1HG2 A;  5IYZ E;  1D0Y A;  4WW0 A;  3S4U A;  3VE2 A;  4FT6 A;  3QC9 A;  4E1S A;  4D65 A;  4UEL A;  2GK9 A;  5L3B B;  1WRD A;  2XAG B;  2Y0L A;  4E7S A;  4DMW A;  1ZHC A;  4N78 D;  4YLH A;  2WMN A;  2XTL A;  4XNK A;  4AYN A;  4DVD A;  2MYS A;  2LHF A;  3VZT X;  4AQG A;  5JR9 C;  5GV0 A;  3MJX A;  4O3Y A;  3HKD E;  2KC0 A;  4HE8 A;  3FXD B;  1MIW A;  1ZHX A;  4LSE A;  2LEH A;  2E9X C;  1IAP A;  5FY7 A;  5FMN A;  3GP6 A;  3B13 A;  3HI2 A;  3CX7 B;  2D5U A;  2CMR A;  2SPC A;  4KR8 A;  4QX7 B;  2BZB A;  3LK4 2;  1D1B A;  4I4T E;  3KV5 A;  5FY1 A;  3WAK A;  4KRA A;  1HF8 A;  1WYB A;  2PRN A;  1U4Q A;  4ERR A;  2LFU A;  3ZCJ A;  2Y6X A;  5JDQ A;  4G2A A;  5JDP A;  1YS5 A;  2Y2X A;  4PJM A;  2CXL A;  4AKR A;  1HS7 A;  2EHO C;  2W0G A;  5FP3 A;  5HXH A;  2J4U P;  3KBT A;  3RPU A;  3K19 A;  3I0O A;  1BR2 A;  3H3A A;  2XAQ B;  1QUU A;  4FUV A;  4JCH A;  3KFW X;  2KMF A;  4AYD C;  3C98 B;  3POQ A;  3Q9D A;  4IDZ A;  4O4J E;  3LK2 A;  5JVD E;  5T5F A;  5BMV E;  5KMG P;  2EHO D;  3HWB A;  3FBZ A;  2M06 A;  4G63 A;  4L5G A;  5JRE A;  2VB6 A;  3O1J A;  5ADX L;  4JFB A;  3N2K E;  5JDL A;  3FBL A;  2Q9Q C;  1VRB A;  2V1D B;  3R6N A;  3PQU A;  3MAC A;  3ONX A;  2ZM0 A;  2YU2 A;  3V5S A;  4E1T A;  4JUY A;  1D1C A;  2ZM2 A;  3U78 A;  2LT3 A;  1LRZ A;  3EVY A;  4H9O C;  5FY0 A;  5EK2 A;  2ES0 A;  4L9I A;  4ZI2 C;  3SS1 A;  4MFR A;  1UX4 A;  2X9X A;  5L3G B;  5LG4 A;  2M07 A;  3T8O A;  3B57 A;  3ZEF B;  4QX8 B;  2N2N A;  3L09 A;  3M65 A;  4AUI A;  2N1G A;  5LJN A;  1HXT A;  1YW0 A;  4IE5 A;  3UFE A;  4XBF B;  4UVA B;  1Q9G A;  3T20 A;  4TZ4 C;  4AXP A;  4O3X B;  3VY9 X;  4AYI D;  2NW8 A;  4PK4 A;  4UV9 B;  4LSF A;  3CPZ A;  1SA0 E;  2X9W A;  4GYR A;  1ZKE A;  5TAO A;  4C91 A;  4WNK A;  2J1N A;  4FSO A;  1LKX A;  2YPV A;  1S35 A;  2JJ9 A;  5L3E B;  1MM5 A;  3LK3 A;  5LNK A;  5EE2 A;  3C5O A;  3UUL A;  2H7O A;  2ZM8 A;  4H63 V;  3U3I A;  3C64 A;  2ZFG A;  1B7T A;  1WLX A;  2C0S A;  1IZN A;  4D5U A;  3AAI A;  5GON E;  5FNV E;  3O4X E;  4PFO A;  2MTQ A;  4X20 E;  4L0R A;  5KX5 E;  4IE4 A;  5ETW A;  3HOE A;  1FEW A;  2V26 A;  2E8I A;  3POX A;  4G76 A;  5F3J A;  4UV8 B;  2IC9 A;  3OYX A;  4H9N C;  2EHO B;  3ZMU B;  4GCS A;  4F4B A;  4HTE A;  4TV9 E;  3VE1 A;  1G90 A;  3LK4 1;  3T24 A;  4KP3 C;  1MIY A;  3KV9 A;  5JRC B;  4O4U A;  2JPF A;  3CQG B;  4EB6 E;  3EUH A;  4GHB A;  6PRN A;  2RA1 A;  3ZCI A;  3ETU A;  1OXZ A;  3KVA A;  4AKM A;  4AKI A;  2L3L A;  5LGT B;  5C8Y E;  3CML A;  3I9W A;  2NW9 A;  3ZN0 B;  2W80 C;  3A2S X;  5LXT E;  3ZLI A;  4JEH B;  4X1I E;  3ANW B;  5LP6 E;  2WAU A;  3N9M A;  4FZN A;  3T0S A;  2B1E A;  2VAS A;  2QTK A;  4I55 E;  3AAE B;  2ZLY A;  3TKL B;  2L9Q A;  4FJO A;  4CXX A;  5G26 A;  1BR4 A;  2IC6 A;  3Q5X A;  4UF0 A;  4JLE A;  3RRC A;  5DQW A;  4MAL A;  1GFM A;  2XE3 A;  4RLB A;  3GWH A;  3IEE A;  2WMO A;  2LSY A;  5LJM A;  5IYU A;  5JR9 A;  4ZS3 A;  2CXD A;  3ZC1 A;  3RC3 A;  4IGU A;  3VZW X;  1MIV A;  5L3D B;  2E9X A;  2X0L B;  2X51 A;  3K3O A;  2XG6 A;  1UCU A;  2KXP A;  3AA0 A;  4AFK A;  4QQ1 A;  3PU8 A;  5L2L A;  2XE2 A;  4HFV A;  3PUR A;  4GOU A;  3IF8 B;  4K0U A;  2VL8 A;  2XAS B;  2KDY A;  2DWK A;  4RL9 A;  4AI6 A;  3C50 A;  2PBI A;  3C51 A;  2LSJ A;  2CA5 A;  5DL8 A;  3RH3 A;  5LBM A;  3UU2 A;  3PE0 A;  3LG7 A;  4ZHQ E;  2W63 A;  3KV4 A;  3NSG A;  2Y48 B;  2C5J A;  2W00 A;  4JEU B;  2LHR A;  1FMV A;  1GFP A;  2W61 A;  5HWX A;  2YEV C;  4P0A A;  4TV8 E;  4MHC A;  1SHZ C;  3PDY A;  2MNH A;  1IJ5 A;  2PJQ A;  3PU3 A;  5E0O A;  5H6Q B;  2YIN A;  1H6S 1;  3VU7 H;  4LSH A;  2OA5 A;  2XQY A;  3ETV A;  3UAQ A;  2RP4 A;  1PHO A;  3HW9 A;  4EIW A;  2LJL A;  3BQL A;  3Q2M A;  4CI3 B;  5LYJ E;  3J7Y q;  3SYB A;  3GA8 A;  2A2F X;  3ZJ2 A;  1V9D A;  4ANJ A;  4CZZ B;  1GFO A;  4QXC B;  2XTQ A;  2V7M A;  4FMS A;  3WI5 A;  2D2S A;  2MOZ A;  4LSI A;  3HL6 A;  3N2O A;  4E7Z A;  2Q9Q A;  2XMX A;  1ZHY A;  2X9Y A;  3AA1 A;  1D0Z A;  2CEA A;  5EK3 A;  1O3X A;  3WI4 A;  4ZOL E;  1ZHW A;  1H7C A;  3CX6 B;  5J1G A;  1Z0P A;  2K48 A;  3AA7 B;  2LSG A;  2I59 A;  3FB2 A;  4O49 A;  1MM4 A;  3ZYM A;  4X1K E;  1QSD A;  3K3Q C;  4AKG A;  3SWH A;  5LGN B;  2Y8D A;  2XTR A;  2X67 A;  3DTO A;  1MMA A;  3K3N A;  4HKA A;  4NUU A;  1NAF A;  4BJM A;  2KZ7 A;  5H6R B;  4I50 E;  3AAA A;  4GIW A;  3O1I A;  5AFU L;  3JC6 C;  5FXZ A;  2X9H A;  4FES A;  3KVD D;  2LE8 A;  2NP9 A;  5CA1 E;  4HGA A;  2DI4 A;  1QJ9 A;  4TN7 B;  4AKL A;  3JC6 D;  1ZHT A;  2X66 A;  3G7G A;  5CB4 E;  2DNX A;  3OBV E;  2ZMA A;  3AB3 B;  3D0T A;  4O2A E;  2JMK A;  5HYA A;  5JDM A;  2GE4 A;  2XE5 A;  4P09 A;  4V1A v;  2ZLD A;  2HPL A;  4QHO A;  2VKO A;  4O8S A;  3OYZ A;  3GN5 B;  2WM9 A;  2H7V C;  1OWA A;  3IBP A;  4B6X A;  3NRX A;  1OSM A;  2CE7 A;  2QA7 A;  3EDV A;  3GMI A;  4BAY B;  4X1Y E;  3KVB A;  5HAX A;  4DO0 A;  5HXS A;  2CCQ A;  3VKH A;  3OKQ A;  2K4T A;  1QJP A;  3WI3 A;  4FRX A;  1CUN A;  4GYS A;  3N9O A;  4KR4 A;  4UIG A;  5A1L A;  4PJJ A;  3VKG A;  4U72 A;  3AA6 B;  2VKD A;  2XUE A;  3F57 A;  3KIN B;  5L3C B;  3P7I A;  3DP7 A;  2Y7S A;  4TX5 A;  3AVS A;  4H9Q C;  4OYK A;  4OYJ A;  4M1P A;  4H9P C;  3LBX B;  1D1A A;  5FYM A;  4UEM A;  3FXE B;  2D0T A;  5IHY A;  4ZI7 E;  4ADZ A;  3HKB E;  1HXU A;  2C5K T;  2NTY A;  3BK9 A;  3N9N A;  3LFM A;  2A3D A;  3PUS A;  4A56 A;  3UUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...