5AFUL

Cryo-em structure of dynein tail-dynactin-bicd2n complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
270
structure length
270
Chain Sequence
b'SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVDVIPDNPKFQQLQRELSQVLTQRQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DYNEIN TAIL
publication title The Structure of the Dynactin Complex and its Interaction with Dynein.
pubmed doi rcsb
molecule tags Motor protein
total genus 71
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5afuL01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 5afuL02
3AA1A 3AAAA 3AA0B 5ADXL 3LK41 3AA7B 5AFUK 2KXPA 3LK42 3AA0A 3AA7A 1IZNB 1IZNA 2KZ7B 3AA6B 2KZ7A 3AA6A 5ADXK 3AAEB 4AKRB 5AFUL 3AAEA 4AKRA 3LK3B 3LK2B 3AAAB 3LK3A 3AA1B 3LK2A 2KXPB
chains in the Genus database with same CATH superfamily
2PBIA 2QYWA 2G0UA 5FL1A 4ILBA 1HNXT 4BAYB 5FXWA 2MBGA 4KR8A 3UUNA 5FYMA 1UX5A 4DBRA 1MMNA 2CM0A 3RF1A 5HEOA 1LKXA 4JCHA 5DQVA 3HOLA 4A56A 3PORA 4NXMT 3UU2A 1SE7A 2IW5B 4IGUA 5AQFB 2VKJA 5LHIB 3KV4A 3RYFE 4PK6A 3KINB 5C8YE 2WU2A 2XM1A 2XG6A 4P09A 4AYNA 5AQSB 2MOZA 2DL1A 5AQOB 5FY7A 4GCSA 2CXFA 2J47A 2W2UA 4IIJE 3PJAJ 3UU6A 2X27X 4AKGA 2CLYC 2DNXA 3WI5A 2V7LA 1MMDA 4QH5A 4OHFA 5AQGB 3AA7B 3DWNA 2JQYA 4H63H 4YFSA 2WDRA 2DCFA 3PUYF 1ZHXA 4X20E 4Z8XA 3SRZA 5L3BB 5A1LA 4NUUA 5L4HA 4E1TA 2LHNA 1U4QA 1BR4A 2J1DG 2VQET 3RRWA 4K0KT 3JAEA 4A5XA 2JQQA 4KHZF 3C50A 2CWYA 2W61A 3HL6A 2E9XA 2MPKA 5GTIO 4DV1T 4DV3T 4H9PC 4IDNA 3PGSA 2NP9A 2K9AA 3RKGA 4DMWA 5FNVE 2Y48B 4UV8B 1OEDB 1THQA 2KT9A 4J2CA 4C90A 2NW8A 4ILUA 4ADZA 5DL5A 2ZMAA 3UT5E 5H2FO 3A0BO 4IREA 3QB5A 4GCPA 3O1JA 2JJ9A 3KFWX 2F4VT 3FBLA 4E7SA 2V7KA 3HWBA 1J5WA 5L47A 2XUEA 3MJXA 1VOMA 3QRAA 1OWAA 4LF4T 4KHPT 3RYCE 4EZ4A 1E7PA 2K24A 1E54A 2YDSA 5LGUB 3PTRB 4UIGA 2PG8A 3SOLA 2CXDA 3VZUX 3PGUA 3BQKA 3OPCA 2BKNA 3K3QC 3KV9A 4OYJA 1GQEA 2W66A 3CVRA 4FESA 3IA3A 5CA0E 2PORA 3DP7A 3O4XE 4TWHA 1IZNA 2XE3A 4PR7A 4UVAB 2YDQA 2V8SV 4G75A 5HWYA 4FT6A 4COFA 3ZN0B 3A0HO 2WMNA 3RYHE 2ES0A 2LM2A 3NRXA 4AQFA 2HH7A 3LK41 4O3ZA 3FYXA 3EVYA 3ZJ1A 5H6QB 2C0SA 3RYIE 3BQLA 3T20A 4DIDB 2R4NA 3AB3B 2V5DA 2BG9A 2MNHA 2KMFA 2LSGA 5AFUL 3PQUA 3ZMZB 3ANWA 4NPPA 2VQFT 4K3BA 3AA1A 1IBMT 3KVAA 4AKIA 2J1NA 3EI0A 1FEWA 2M07A 3HA4A 3I9WA 4DNDA 3AECA 1W9RA 3AE5A 1BR2A 1N32T 1IJ6A 2JQKA 1S35A 3LK2A 5CA1E 5CJ5A 2IWWA 3A5XA 1WR6A 2XQ5A 2M06A 4HFBA 1US7B 5LHHB 2L9QA 1YQ4A 1G73A 4P0BA 1IJ5A 4TZ4C 4O4JE 2JPFA 2YEVC 3T1YT 4RLCA 3OVUA 3KVDD 4O8SA 5TAOA 2LKGA 3ZCIA 2PRNA 3VY8X 2XPKA 4ZXLA 4UELA 5JDGA 3N2OA 3M65A 4UV9B 3TLUA 5AFUK 5IYUA 5F3JA 4I4TE 2Y8DA 1IZNB 3PDYA 3SFEA 3UU5A 3FXDB 5JRCB 4YSZA 2P9BA 3BK9A 3KBUA 3FZFB 3RI5A 3AAEA 5L2LA 2VURA 1ZKEA 3GA8A 4TWFA 4LSIA 4O2AE 5T5FA 3AXJA 4HFHA 3KDSE 3QRCA 2BG9B 2XASB 2WJQA 5BMVE 3Q5XA 5LA6E 2QGSA 2WQYA 2BKOA 3C4XA 4FI5A 4ZZBA 3ANWB 2K5BB 3AA1B 4AIUA 2XQ3A 3FZKB 4A98A 3P4PA 4JI8T 3ONXA 2F1TA 2WDQA 3VR9A 2LSIA 4AFKA 1LVFA 2XTLA 4AI6A 2XQAA 2KLQA 1O3XA 2E2AA 2X0YA 4DR4T 3LK2B 2MTQA 4JI5T 3RIFA 4AYEC 4P0AA 3RKOA 4JI6T 2DI4A 3O1HA 3ZJ2A 4CXXA 4AQGA 3Q9DA 5JREA 2H3RA 5LG3A 1ZHZA 3V5SA 3UUMA 2YN6A 4U2ZA 5DL6A 2PTFA 2O4VA 4FOZA 5B5EO 4FQEA 1FIOA 3AAAA 1R8IA 1W0BA 1JNZA 2J62A 2XY8B 3ZMVB 4K3CA 3AAEB 2XM2A 3UFGA 2K0LA 1KFYA 5AQNB 3O1IA 1WCRA 4A97A 1UURA 2H7OA 3N2GE 1HG2A 3G7GA 4Z90A 4B3RT 5FP3A 5G26A 4WW0A 5M4YA 4MALA 2BG9E 4UB8O 3CQGB 3EDUA 2XQ4A 4H63V 5C2TA 3WI4A 1OXZA 2GK9A 3GP6A 3RX6A 4F6RC 3CMLA 3EAMA 2FGQX 2X51A 2LSKA 2LSJA 2E9XC 2ERVA 4PK4A 3JC6C 2BS2A 4AUIA 4LF9T 5LGTB 1YS5A 2ZFGA 2X0LB 2Q9QA 4OFZA 4YJ3E 5LJNA 2MAWA 1BH3A 4HN9A 4FMSA 1ZEEA 1PHOA 3PUAA 2DHRA 3UU3A 2VB6A 3A8YC 4PW8A 1XMOT 2WDVA 3UFEA 2FJAA 2QA7A 4PUXA 2C5IT 4HFVA 3AE6A 2E9XD 3PU3A 5JR9A 4C4VB 3JC6D 3AA7A 5JDPA 4ZI3C 3RPUA 5AQJB 1N33T 2JIWA 2FBWA 3AEDA 3A7MA 3EHZA 1UK5A 2QTKA 2AXTO 5DL7A 4CN6A 2A9UA 4DR6T 3Q2MA 5AQHB 2UU9T 4ZHQE 1KNPA 2LHRA 3ZC1A 1MM4A 4EOZB 2XHEB 2MYSA 2UXBT 3C4WA 3T8OA 2CMRA 1ZP0A 2WB5A 4IDPA 4HE8A 3ZKRA 1MIYA 5LBQB 3I9YA 4EZHA 5LCYA 3NWIA 3L3PA 4DR5T 3DJBA 2WWVA 2R6GF 3QOFA 3PQSA 3QUJA 2LOSA 3GMIA 3I1AA 4ZI3D 5KXJA 1N36T 1D0XA 4IE6A 4O3WA 2PFVA 3EDVA 2XQ6A 3VY9X 1OEDA 5E0OA 3P4QA 1HXXA 5EK2A 2Q9QB 4AQFC 4O2BE 1HXTA 1S94A 2NW9A 5BR8T 2WM9A 2YINA 4IE4A 3F57A 2BG9C 2VK9A 4YSYA 4JV5T 5C3JA 5IHYA 1HS7A 2KDYA 5JDMA 3T1HT 3N9LA 4EGWA 3UU8A 5JR9B 1NENA 4KR4A 1WYBA 4TV8E 4FRXA 3AVRA 1XWMA 1G8XA 5AQUB 5JDFA 4QH4A 4H9RC 4EB6E 4ILCA 3NRYA 2Y0LA 3RGLA 5FVKA 2YDRA 4IE0A 2W0GA 3J7Yq 2LJLA 1E2AA 4HTEA 4DR2T 1J1JA 3K19A 2E8IA 4PAGA 4QXCB 2XQ8A 2HN1A 3P7IA 2LHFA 2X9XA 2V6YA 4D5UA 1Q9GA 3H3AA 4DBQA 2F1VA 3IHRA 3TLVA 2FJBA 3POUA 2NR4A 4PK5A 4ISTA 2SPCA 2KINB 2UUBT 3TKLB 1ZHTA 3UU4A 4X65T 3O9XA 2WVPA 1CHUA 1QSDA 2LRKA 3EUHA 3JTYA 2KWHA 5FXZA 2ZM6T 5EK3A 3SYSA 3RIUA 5L3DB 3C98B 2UXCT 3CQCB 4G2AA 1MMGA 4AISA 4DV2T 1YXRA 4DO0A 4DV7T 2N2NA 3ABVA 3QK6A 3HKEE 1AJ3A 2LOPA 3ZMSB 3A2SX 4C00A 2BBHA 4HWHA 4PJLA 4U3CA 4HFCA 3LK42 4LFAT 2W81C 4YHJA 1Y01A 3VE1A 3OBVE 4L0RA 5J2TE 2IWVA 5HEHA 2B76A 5AQVB 5PRNA 4TWDA 3K1SA 4X66T 5KMGP 2X9WA 4ZZCA 2XAGB 3KBTA 8PRNA 2XQ7A 5DL8A 3AEAA 3AEEA 5L3GB 2W62A 2CPTA 2ZLYA 5L3FB 4GYSA 2C5JA 4UF0B 4XZCA 5IYZE 3L39A 1XDPA 3ZSTA 5FXXA 1QJ8A 3TLWA 3K3OA 4UVBB 2LRLA 4LSEA 2VKDA 5JRCA 3Q5WA 2V6YB 2CE7A 3BQIA 2BKPA 1GFOA 4LMLA 4DUZT 3N2KE 2LLYA 1NAFA 3OKQA 5FL0A 4AYID 3IEEA 3K8PC 2ACZA 1QLBA 4B3ST 4N59A 4ANJA 1OEDE 1M7KA 1Y64B 2YPVA 3UQ4A 2RP4A 3B13A 3N9OA 3FXEB 4X64T 4AZLA 2JMHA 3ZPOA 2YK0A 2CXLA 4YT0A 4O4UA 1YW0A 3FBZA 2M6BA 3UULA 1Q9FA 5FKYA 4C91A 4HWDA 5JDNA 3T24A 2MHLA 2ODVA 4MLKA 4TUYE 4JBWF 5LGNB 4K0UA 3ZCJA 1XNQT 3PJAA 4RJWA 4HWIB 4QH1A 5JDQA 1W0AA 4WBOA 2HN2A 3AE9A 1X9BA 3ONLC 4EYYR 3PRNA 1ORMA 3VRAA 2NOXA 3ETUA 1QJPA 1MPFA 2ODJA 3S4UA 2BVMA 1HR0T 2B1EA 4YY3T 5F8PA 4ZI7E 3PGRA 4UB6O 4GKJT 4JI7T 4QHOA 3ETVA 4YTPA 2W80C 3VKHA 2KNDA 2Y7SA 1FJGT 3H37A 4IDQA 5IUXA 3AE8A 3SWHA 2WBLA 4CZZB 2XE2A 3HOEA 5JR9C 3FZMB 1HG5A 4IE5A 2DWGA 3LBXB 2V7MA 3HW9A 3HKBE 2CA5A 4QKNA 2BDEA 5CB4E 4EXTA 4U9CA 2KXPB 2R89A 3WAJA 3LFMA 5HCJA 3CX6B 4BJNA 4JYAT 2R4OA 2M6IA 4E7ZA 4LF7T 1T8BA 5HXCA 2J4UP 3AE3A 2OA5A 4ERRA 4XNKA 1S5LO 4CI2B 5AQPB 2WZHA 2CLYB 2XJ7A 2UUCT 4N75A 4O4LE 3C4ZA 3V8UA 1ZV4X 1OEDC 4ZS3A 2X9KA 2KSRA 1HXUA 3N9PA 1WLXA 4YJ2E 4ZI2C 5DQWA 5DJQC 4H9SE 3POXA 4GHBA 4HWFA 4V1Av 3NJTA 3X1DA 3CQXC 2HPLA 5ADXL 2FUPA 1BXWA 2XE5A 2I59A 4C4VA 1SA0E 2WY2A 4GYRA 3N5LA 2CHNA 2JQ9A 4WBNE 4N74A 2LFUA 4F8HA 1E1HB 1KF6A 5J2UE 4LF5T 2L8KA 3PV0F 4NUVA 1ZOYA 1FMWA 2WCAA 3LSVA 2RA1A 4EYUA 4CN1A 4XBFB 2X67A 4ZI2D 3O0EA 4TNVA 4Z3TA 2OMFA 4KUMB 1BT9A 2XTQA 4JI3T 5FY0A 5KDMC 3WAKA 5JQGE 4GK0E 3AAIA 4DR3T 5LOVE 4IE7A 4BUMX 2FJDA 3UPGA 2XQ9A 4C69X 4O3XB 3U3IA 1H7CA 4X1IE 3ESLA 2ZM0A 2XMXA 2I0MA 3KV5A 5ABEA 3RC8A 3PUXF 1WFDA 2E5LT 4FZLA 5LXTE 4DV0T 5J1GA 4YLHA 2V1DB 3SY9A 3P8CD 3B57A 3PUSA 4FZNA 2AE9A 3NVOA 2XQYA 2EHOA 5JDHA 4H9QC 1D1CA 1HTJF 2VVSA 3SFDA 2CRBA 1HX1B 4AYDC 1MIVA 1L0VA 5D5DA 3ZMUB 5L3CB 4TN7B 4JI4T 5ABFB 1MIWA 2N9DA 4U2YA 4IL6O 3ZYMA 4DMVA 4DV5T 4QXBB 3JCFA 3UAQA 3U78A 2YOEA 1LVKA 5G38A 4X62T 1HNWT 3N9MA 4CI1B 4LMKA 2K4TA 3VRBA 3NBXX 4ZEYA 5KX5E 4AQYT 4QX7B 5HEUA 2DWKA 4EV6A 5CGMA 1G90A 2ZM8A 1CUNA 4EEDA 4KX6A 2CWOA 3TLSA 3DA3A 1GFPA 3ZEFB 5HXHA 1JNRA 2W4XA 5L3EB 2WS3A 1IBKT 3UQ7A 3PUQA 3FZHB 5F5WA 1HCIA 4P1NA 4CQIA 2XSAA 3MXZA 4BJMA 2BBJA 4JLEA 5FY1A 2Y6XA 3CPZA 3MZKB 5DABA 5AQLB 5AQKB 4UXNB 3TZGA 1XNRT 2EHOB 5AQQB 2LE8A 1MNDA 2YU2A 1J5ET 2LM9A 2E5VA 3CX8B 3V5UA 3HKDE 1H6S1 3PUGA 3F31A 3RQUA 3ZC0A 1IAPA 4FSOA 3PUWF 2N2MA 2BZBA 1WYCA 4ILAA 3AA0B 3R84B 3SZDA 5JDLA 2NTYA 3AE2A 4E1SA 3HKCE 1SUMB 3DWOX 3NSGA 1GFQA 2JQHA 2ZM2A 1M62A 4LFBT 2KC0A 2QRXA 2WU5A 4B3TT 4IL9A 4GIWA 3JCUO 3LK3A 2VKHA 1XZYA 2I6HA 2R4PA 3UUXB 2H7VC 4UF0A 4OK0A 5HEGA 4AXPA 5JVDE 2XZEA 4HFIA 3BRYA 3F2EA 1XMQT 4YTNA 4PJMA 4HGAA 2A2FX 2IMLA 4U33A 2CHOA 2WMOA 4WZXA 4LF8T 1HNZT 1MNEA 1UX4A 3RLFF 3ZMTB 2Z6EA 4H9NC 4HKAA 3T0SA 3AEFA 2WWUA 1T72A 1GFMA 4AYMC 2JMKA 1HF8A 3CX7B 5J0ZA 5ABHA 1NEKA 3BRZA 4AKMA 4WNKA 4XNLA 3G06A 3LG7A 4I50E 4U31A 3P50A 4MHCA 2V7IA 1N34T 3N9NA 3RBHA 2XAHB 2X68A 4X1KE 5GTHO 4IT4A 5EE2A 1P4TA 3PE0A 4KI0F 4HFEA 2C5KT 2R4LA 2IC9A 3ZT6A 1ZHWA 4HWCA 3LK3B 3RH3A 4GK5E 4GF4A 1MM5A 1OSMA 4QX8B 2UXNB 3VZTX 3DZMA 2H89A 7PRNA 2X66A 3M3ZB 5LBMA 3PURA 3VHLA 3POQA 3B5MA 3ZYKA 1W09A 3WU2O 1VCSA 4UR9A 1WRDA 5LMUT 2KZ7A 3C64A 3NZPA 4F4BA 5G39A 4FRTA 3VKGA 2V6XA 2X9YA 4ZOLE 2V7JA 3RQWA 2LT3A 4I0UA 1VCTA 4FJOA 1KEYA 3KV6A 4U72A 3LBXA 4EEBA 2UUAT 2R8AA 3FB2A 4IDOA 4JI1T 3H3MA 4DV4T 2L3LA 2W63A 3AEBA 2E9XB 3OYXA 2WJRA 1UGOA 3KZIO 2VASA 2XAFB 2FJEA 2VVNA 3W15B 1GFNA 3LDQB 3OYZA 5KAIO 4I55E 2XAJB 3I0OA 5LHGB 3DTOA 3NZQA 3UUBA 2N2LA 3PUZF 4HEAA 5FVNA 2KXPA 4B6XA 4LF6T 3MACA 3PU8A 4B3MT 4YXDA 1WR0A 2IDOB 2IHR1 3JAFA 5HXSA 2VWAA 1YQ3A 3VR8A 3MK7C 3FZLB 1NWMX 4DUYT 4EAHA 2UXDT 1BR0A 1ZHYA 5HWXA 3VE2A 3AE1A 1EZ3A 4HFDA 2ACXA 2VL0A 4PJ0O 5HXEA 1YKEB 4PFOA 3IF8B 4JUYA 3EABA 3JADA 4JI0T 3WI3A 4QQ1A 2GE4A 1OPFA 2Q9QC 2XTRA 4UEMA 4H9OC 4RJXA 5KAFO 5JTGA 4Q25A 3J9X1 5FMNA 2V26A 2XSBA 5AQIB 5ETWA 2CBIA 4PFPA 4JI2T 3N9QA 4QWNB 2EHOC 2DLRA 2CBJA 3FHNA 2W00A 2V5CA 3MA9A 3E08A 4N58A 4NIQA 4B61A 5B66O 2KZ7B 4U7IA 3C5OA 5HEJA 2IAKA 4PNIA 3QNUA 5HAXA 5GV0A 2R88A 5CFBA 3E0ZA 2RPAA 3Q5DA 5H6RB 4NXNT 1D0ZA 3D0TA 2D9DA 1UUSA 3ZT7A 2VL8A 2HHHT 5LNKA 3VU7H 4XAXB 2Q9QD 2OLTA 2M67A 4FZMA 3BS0A 1I94T 4O49A 4FUVA 4GKKT 4IDZA 2UXXB 4DV6T 5FVLA 4U74A 2EHOD 5JH7E 2XE1A 3E22E 3OTOT 4YHHT 1HFAA 2PJQA 2F1CX 1QJ9A 3KVBA 3PUVF 4O4IE 3Q5EA 5AQMB 2X0HA 5ABGA 4IHJE 4L9IA 5LJMA 1UCUA 1T16A 2YNKA 3AVSA 3AA6A 4D64A 4LSHA 2K48A 3NKZA 3RC3A 2IIUA 3ZYLA 4CXWA 2OV9A 4DR1T 2YU1A 2ZLDA 1IBLT 1Z0PA 3QC9A 3L8RA 2Y0KA 1YKHB 3ONJA 2K3WA 4G63A 2H88A 2LEHA 4KP3C 4L5GA 1VRBA 4IL4A 1YD8G 2XAQB 1MMAA 2JRKA 2IUBA 3L09A 3AE7A 4MFRA 3MKDA 1V9DA 1ZHCA 3GN5A 4PJNA 4AKRA 1FMVA 1KK7A 3SY7A 4KMCA 4OX9T 1D1BA 2X9HA 2WAUA 4UVCB 4AKLA 2WZIA 1T98A 1LRZA 4YTMA 4U7YA 5ABFA 1U5PA 4CN4A 4BA9A 1I6ZA 5HYAA 1T7SA 4PJJA 4X5TA 4G76A 2Y0HA 3GWHA 3AE4A 1DU2A 4KRAA 2Y2XA 2J4GA 4RLBA 1QUUA 5GONE 3SZVA 1BR1A 3IBPA 4O3YA 5EZYE 4TNWA 1PRNA 4LMJA 2VKOA 3LJCA 4TX5A 4X1YE 3P4SA 3SS1A 1X79A 2QVAA 5AQTB 2BS4A 2CEAA 5TISO 3AXJB 4QXHB 4ISSA 3TLTA 1HX8A 2FGRA 3P4RA 3RHWA 3CWZB 3RRCA 3AA6B 4AKHA 2D0TA 5EK4A 3EMNX 4GOUA 5ADXK 4FSPA 5LP6E 3SYBA 1KNZA 4M1PA 4MBQA 3ZLIA 4TV9E 5HCMA 4WYVA 4O4XA 5LYJE 4JEUB 2D2SA 4LFCT 3HR0A 2WSSV 3P4WA 5FXVA 2NW7A 3DA4A 3GN5B 4JFBA 4OYKA 4AKRB 2NWBA 2D0UA 3RIUC 4KBMB 4N78D 4Z91A 5AQRB 6PRNA 3ZT5A 2W67A 5HXRA 5IWAT 1B7TA 5LB7B 3AA0A 3ZN1B 1T1LA 3I0QA 4YSXA 2D5UA 2N1GA 2LSYA 3RIAA 2BVLA 4CXYA 1D0YA 2BS3A 2WP9A 2AXDS 2YKSA 3AAAB 5L4EA 4GCQA 4JEHB 1XDOA 2A3DA 3CIRA 5LG4A 3PF1A 4I43B 4EIWA 2A72A 4RL9A 3K3NA 3AEGA 4CI3B 4D65A 2LKHA 4ASKA 1D1AA 2CCQA 2ODUA 4LSFA 3CK6A 3R6NA 2HPJA 4ZS2A 1SHZC 2JMMA 3OJAA 5E79O 3UTKA 3ZSSA 4O4HE 4DVDA 5G3AA 4DR7T 3QB5K 1Z8UA 3VZWX 3CKDA 3HI2A 2NTXA 1KNRA 3C51A 4CTDA 5LMNT 2IC6A 2KWIB
chains in the Genus database with same CATH topology
2PBIA 3LG7A 4I50E 2G0UA 2H7OA 4MHCA 4QHOA 3ETVA 3N2GE 4BAYB 5FXWA 2V7IA 2MBGA 2W80C 4KR8A 3N9NA 3VKHA 3RBHA 3UUNA 5FYMA 1HG2A 2XAHB 1UX5A 2X68A 3G7GA 4DBRA 2KNDA 1MMNA 4X1KE 5FP3A 2Y7SA 5G26A 2CM0A 3H37A 4WW0A 5M4YA 4MALA 5EE2A 1P4TA 3PE0A 1LKXA 4JCHA 2C5KT 3CQGB 2IC9A 3EDUA 5DQVA 3HOLA 1ZHWA 3SWHA 4H63V 4A56A 3PORA 3LK3B 3RH3A 3WI4A 2WBLA 4CZZB 3UU2A 2XE2A 1OXZA 2GK9A 4GK5E 3GP6A 2IW5B 3HOEA 1MM5A 4IGUA 4QX8B 5JR9C 3RX6A 2VKJA 1HG5A 2UXNB 3CMLA 4F6RC 1OSMA 3VZTX 4IE5A 2X66A 7PRNA 5LHIB 5LBMA 3KV4A 2FGQX 2DWGA 3LBXB 3PURA 2X51A 3RYFE 3VHLA 3ZYKA 2LSKA 4PK6A 3POQA 2V7MA 2LSJA 3KINB 5C8YE 3HW9A 3HKBE 2E9XC 2ERVA 4PK4A 1WRDA 2XG6A 4P09A 4AYNA 3JC6C 2KZ7A 2MOZA 3C64A 2CA5A 3NZPA 4QKNA 4AUIA 4F4BA 5FY7A 5LGTB 2BDEA 4GCSA 1YS5A 2CXFA 4IIJE 3VKGA 4FRTA 2ZFGA 2X0LB 5CB4E 2X27X 2X9YA 2Q9QA 4AKGA 4OFZA 4ZOLE 2V7JA 2LT3A 2CLYC 2DNXA 4EXTA 4U9CA 4YJ3E 5LJNA 2KXPB 3WI5A 1BH3A 2V7LA 1MMDA 4FJOA 4OHFA 3AA7B 3WAJA 3KV6A 4U72A 4HN9A 3LFMA 4FMSA 4H63H 3CX6B 3SYBA 1ZEEA 3LBXA 4YFSA 4BJNA 1PHOA 3PUAA 2DHRA 2DCFA 3FB2A 2VB6A 4PW8A 4E7ZA 2L3LA 2W63A 5HXCA 2J4UP 2E9XB 3OYXA 1ZHXA 4X20E 4Z8XA 3UFEA 2OA5A 2VASA 3SRZA 2QA7A 2XAFB 4PUXA 4ERRA 4XNKA 4CI2B 5L3BB 3W15B 1GFNA 5A1LA 2C5IT 4NUUA 3OYZA 4E1TA 2LHNA 4I55E 2XAJB 3I0OA 1U4QA 1BR4A 2J1DG 3DTOA 5LHGB 3NZQA 3RRWA 2N2LA 2CLYB 4HEAA 4HFVA 2JQQA 5FVNA 2KXPA 3C50A 4B6XA 2E9XD 3PU3A 2CWYA 2W61A 3MACA 3JC6D 3PU8A 4O4LE 5JR9A 3AA7A 5JDPA 3C4ZA 3V8UA 1ZV4X 4ZI3C 3RPUA 4ZS3A 5HXSA 2VWAA 1HXUA 3N9PA 1WLXA 4YJ2E 4ZI2C 3HL6A 5DQWA 2QTKA 5DL7A 5DJQC 4H9SE 2E9XA 3POXA 3MK7C 4GHBA 4V1Av 1NWMX 4EAHA 3CQXC 3Q2MA 4H9PC 1BR0A 2HPLA 1ZHYA 5HWXA 3VE2A 1EZ3A 5ADXL 2NP9A 2ACXA 2K9AA 4ZHQE 4GF4A 2LHRA 3ZC1A 4DMWA 5HXEA 1BXWA 1MM4A 4EOZB 2XE5A 1YKEB 2XHEB 2MYSA 4PFOA 2I59A 3IF8B 4JUYA 5FNVE 2Y48B 3C4WA 3T8OA 2CMRA 4UV8B 1SA0E 3WI3A 1THQA 2KT9A 4J2CA 4QQ1A 4HE8A 2GE4A 4GYRA 1OPFA 1MIYA 3N5LA 2Q9QC 5LBQB 4C90A 2NW8A 2XTRA 3I9YA 4UEMA 4H9OC 4EZHA 4WBNE 2LFUA 4RJXA 1E1HB 4ILUA 5LCYA 5J2UE 3L3PA 3DJBA 2L8KA 3J9X1 5FMNA 4NUVA 2V26A 1FMWA 5ETWA 4PFPA 3PQSA 4ADZA 3QUJA 2RA1A 5DL5A 2ZMAA 2LOSA 3GMIA 3I1AA 3N9QA 2EHOC 2DLRA 4QWNB 3UT5E 4EYUA 3FHNA 4ZI3D 2W00A 4GCPA 3MA9A 4XBFB 2X67A 3E08A 3O1JA 1D0XA 4ZI2D 3O0EA 4N58A 4B61A 2JJ9A 3KFWX 2KZ7B 3FBLA 4IE6A 4E7SA 2PFVA 3C5OA 3EDVA 4O3WA 4Z3TA 2OMFA 2V7KA 4KUMB 3HWBA 2IAKA 1BT9A 3VY9X 4PNIA 2XTQA 5E0OA 2XUEA 3MJXA 1VOMA 5FY0A 5HAXA 5EK2A 2Q9QB 3WAKA 5KDMC 1HXXA 5JQGE 4GK0E 3AAIA 4AQFC 5GV0A 4O2BE 1HXTA 1OWAA 3E0ZA 1S94A 5H6RB 3RYCE 4EZ4A 2NW9A 1D0ZA 3D0TA 2WM9A 5LOVE 2YINA 2K24A 1E54A 4IE4A 2VL8A 3F57A 4IE7A 3VU7H 5LNKA 4BUMX 2VK9A 4XAXB 3UPGA 4C69X 4O3XB 5LGUB 2Q9QD 3PTRB 2M67A 3U3IA 4FZMA 1H7CA 4UIGA 4X1IE 2PG8A 3SOLA 2CXDA 3ESLA 4FUVA 2ZM0A 4O49A 3VZUX 3BQKA 2XMXA 4IDZA 5IHYA 1HS7A 2UXXB 3KV5A 3K3QC 3RC8A 2KDYA 5JDMA 4U74A 4FZLA 5LXTE 3N9LA 5J1GA 2EHOD 4YLHA 5JH7E 2XE1A 3E22E 3KV9A 2V1DB 1HFAA 2PJQA 4OYJA 3SY9A 1QJ9A 3KVBA 3P8CD 3CVRA 5JR9B 4FESA 3B57A 4O4IE 5CA0E 2PORA 3PUSA 3DP7A 4IHJE 4KR4A 3O4XE 4L9IA 5LJMA 4FZNA 1WYBA 1IZNA 1UCUA 2XQYA 2EHOA 2YNKA 3AVSA 5JDHA 4H9QC 2XE3A 1D1CA 3AA6A 4TV8E 4D64A 1HTJF 4UVAB 4FRXA 3AVRA 4LSHA 4G75A 2K48A 1G8XA 5HWYA 3RC3A 4FT6A 5JDFA 3ZN0B 4AYDC 3ZYLA 2WMNA 3RYHE 1MIVA 2ES0A 4H9RC 4CXWA 4EB6E 2YU1A 5D5DA 3ZMUB 5L3CB 2ZLDA 1Z0PA 3NRXA 4TN7B 4AQFA 2HH7A 3NRYA 3LK41 3QC9A 1MIWA 2Y0KA 4O3ZA 1YKHB 3FYXA 3EVYA 3ZJ1A 2N9DA 5H6QB 4G63A 2C0SA 2Y0LA 2LEHA 4KP3C 3RYIE 4L5GA 3ZYMA 4DMVA 1VRBA 3BQLA 4IE0A 1YD8G 2W0GA 2XAQB 4QXBB 3J7Yq 1MMAA 2JRKA 3T20A 2LJLA 3AB3B 4HTEA 3UAQA 3L09A 3U78A 4MFRA 3K19A 1LVKA 2E8IA 3MKDA 4PAGA 4QXCB 3P7IA 2LHFA 2MNHA 1V9DA 1ZHCA 2KMFA 2LSGA 3GN5A 4PJNA 2X9XA 5AFUL 3QRAA 3N9MA 3PQUA 4AKRA 3ZMZB 1FMVA 4CI1B 1Q9GA 4D5UA 1KK7A 3ANWA 3SY7A 4KMCA 3H3AA 1D1BA 2X9HA 4DBQA 2F1VA 2K4TA 3IHRA 2WAUA 4UVCB 4AKLA 3AA1A 3POUA 1T98A 3NBXX 4PK5A 1LRZA 5KX5E 3KVAA 4ISTA 1U5PA 4AKIA 2SPCA 4BA9A 2J1NA 4QX7B 2DWKA 2KINB 1G90A 5HYAA 1FEWA 2M07A 3TKLB 2ZM8A 4PJJA 1ZHTA 3HA4A 4G76A 3O9XA 1CUNA 3I9WA 4DNDA 1QSDA 2CWOA 2Y0HA 3GWHA 3EUHA 3JTYA 1BR2A 2KWHA 3DA3A 4KRAA 1IJ6A 2Y2XA 1GFPA 5FXZA 5EK3A 3ZEFB 1S35A 3LK2A 5CA1E 3SYSA 5HXHA 4RLBA 1QUUA 5GONE 5L3EB 3A5XA 1WR6A 3SZVA 5L3DB 2M06A 1US7B 5LHHB 2L9QA 3C98B 1BR1A 1G73A 3IBPA 3CQCB 4P0BA 4O3YA 5EZYE 1IJ5A 4G2AA 1MMGA 3PUQA 4TZ4C 4O4JE 1HCIA 1PRNA 2JPFA 2YEVC 2VKOA 4DO0A 3LJCA 4CQIA 4RLCA 4TX5A 3MXZA 3KVDD 4X1YE 2N2NA 4BJMA 4O8SA 5TAOA 3QK6A 3SS1A 3HKEE 3ZCIA 2PRNA 3VY8X 1X79A 1AJ3A 4JLEA 2LOPA 3ZMSB 3A2SX 4UELA 5FY1A 2Y6XA 2CEAA 5JDGA 3CPZA 3MZKB 3N2OA 5DABA 4PJLA 3M65A 4UV9B 4QXHB 4ISSA 5AFUK 3LK42 5IYUA 2W81C 1HX8A 4YHJA 5F3JA 2FGRA 4I4TE 2Y8DA 1IZNB 3CWZB 3OBVE 3PDYA 4UXNB 2EHOB 3TZGA 4L0RA 5J2TE 3RRCA 3AA6B 4AKHA 2LE8A 3FXDB 2D0TA 1MNDA 5EK4A 2YU2A 5JRCB 3EMNX 4GOUA 2LM9A 5ADXK 3CX8B 3V5UA 2P9BA 3BK9A 4FSPA 3HKDE 5LP6E 3PUGA 3F31A 3KBUA 1H6S1 3ZC0A 3AAEA 5PRNA 1KNZA 5KMGP 5L2LA 2X9WA 4M1PA 2XAGB 1IAPA 3KBTA 4MBQA 3ZLIA 8PRNA 4FSOA 5DL8A 2N2MA 2BZBA 5L3GB 2W62A 1WYCA 1ZKEA 2ZLYA 4TV9E 5L3FB 4GYSA 3AA0B 2C5JA 3GA8A 4UF0B 4XZCA 3R84B 3SZDA 4O4XA 5JDLA 5LYJE 4LSIA 4JEUB 4O2AE 2D2SA 5IYZE 5T5FA 2NTYA 3HR0A 2WSSV 4E1SA 3HKCE 5FXXA 3NSGA 3KDSE 1GFQA 1QJ8A 3K3OA 4UVBB 3QRCA 2ZM2A 2NW7A 2XASB 5FXVA 3DA4A 3GN5B 5BMVE 4JFBA 3Q5XA 2VKDA 4OYKA 5LA6E 5JRCA 2QGSA 2KC0A 4LSEA 4AKRB 3C4XA 3Q5WA 2NWBA 4FI5A 2D0UA 3ANWB 2K5BB 4GIWA 4KBMB 4N78D 2CE7A 3LK3A 3BQIA 6PRNA 2VKHA 1GFOA 3AA1B 3N2KE 5HXRA 1NAFA 1B7TA 3UUXB 3AA0A 2H7VC 3OKQA 4UF0A 3ZN1B 3I0QA 4AYID 4OK0A 3IEEA 3K8PC 2D5UA 2N1GA 3ONXA 2LSYA 4AXPA 2F1TA 5JVDE 4N59A 2BVLA 4ANJA 2LSIA 4CXYA 1D0YA 4AFKA 1Y64B 1LVFA 2YPVA 2RP4A 3B13A 2XTLA 3F2EA 3N9OA 3FXEB 4AI6A 4AZLA 2KLQA 1O3XA 2JMHA 3ZPOA 3LK2B 2MTQA 3AAAB 4GCQA 4JEHB 4PJMA 2YK0A 2CXLA 4HGAA 4O4UA 1YW0A 2A3DA 4AYEC 2A2FX 3FBZA 3RKOA 4P0AA 2DI4A 3UULA 5LG4A 2WMOA 3O1HA 4I43B 3ZJ2A 3VE1A 4EIWA 1Q9FA 2A72A 4C91A 4RL9A 4CXXA 5JDNA 4AQGA 3Q9DA 5JREA 2H3RA 3K3NA 3T24A 2MHLA 1ZHZA 2ODVA 1MNEA 3V5SA 3UUMA 4MLKA 1UX4A 4TUYE 3ZMTB 2Z6EA 5LGNB 4K0UA 4CI3B 5DL6A 2O4VA 3ZCJA 4D65A 4ASKA 4H9NC 4HKAA 3T0SA 1D1AA 2CCQA 4FOZA 4RJWA 2WWUA 2ODUA 4LSFA 5JDQA 1FIOA 4WBOA 3R6NA 2HPJA 3AAAA 4ZS2A 1SHZC 2JMMA 1GFMA 4AYMC 3OJAA 2JMKA 3UTKA 1HF8A 4O4HE 4EYYR 4DVDA 3PRNA 1ORMA 3CX7B 2NOXA 3ETUA 3VZWX 1QJPA 1MPFA 3ZMVB 3CKDA 3HI2A 2NTXA 2ODJA 3AAEB 3S4UA 2BVMA 2B1EA 2K0LA 4AKMA 3O1IA 3C51A 5F8PA 4ZI7E 4WNKA 4XNLA 2IC6A 2KWIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AA1 A;  3AAA A;  3AA0 B;  5ADX L;  3LK4 1;  3AA7 B;  5AFU K;  2KXP A;  3LK4 2;  3AA0 A;  3AA7 A;  1IZN B;  1IZN A;  2KZ7 B;  3AA6 B;  2KZ7 A;  3AA6 A;  5ADX K;  3AAE B;  4AKR B;  5AFU L;  3AAE A;  4AKR A;  3LK3 B;  3LK2 B;  3AAA B;  3LK3 A;  3AA1 B;  3LK2 A;  2KXP B; 
#chains in the Genus database with same CATH topology
 2PBI A;  2QYW A;  2G0U A;  5FL1 A;  4ILB A;  1HNX T;  4BAY B;  5FXW A;  2MBG A;  4KR8 A;  3UUN A;  5FYM A;  1UX5 A;  4DBR A;  1MMN A;  2CM0 A;  3RF1 A;  5HEO A;  1LKX A;  4JCH A;  5DQV A;  3HOL A;  4A56 A;  3POR A;  4NXM T;  3UU2 A;  1SE7 A;  2IW5 B;  4IGU A;  5AQF B;  2VKJ A;  5LHI B;  3KV4 A;  3RYF E;  4PK6 A;  3KIN B;  5C8Y E;  2WU2 A;  2XM1 A;  2XG6 A;  4P09 A;  4AYN A;  5AQS B;  2MOZ A;  2DL1 A;  5AQO B;  5FY7 A;  4GCS A;  2CXF A;  2J47 A;  2W2U A;  4IIJ E;  3PJA J;  3UU6 A;  2X27 X;  4AKG A;  2CLY C;  2DNX A;  3WI5 A;  2V7L A;  1MMD A;  4QH5 A;  4OHF A;  5AQG B;  3AA7 B;  3DWN A;  2JQY A;  4H63 H;  4YFS A;  2WDR A;  2DCF A;  3PUY F;  1ZHX A;  4X20 E;  4Z8X A;  3SRZ A;  5L3B B;  5A1L A;  4NUU A;  5L4H A;  4E1T A;  2LHN A;  1U4Q A;  1BR4 A;  2J1D G;  2VQE T;  3RRW A;  4K0K T;  3JAE A;  4A5X A;  2JQQ A;  4KHZ F;  3C50 A;  2CWY A;  2W61 A;  3HL6 A;  2E9X A;  2MPK A;  5GTI O;  4DV1 T;  4DV3 T;  4H9P C;  4IDN A;  3PGS A;  2NP9 A;  2K9A A;  3RKG A;  4DMW A;  5FNV E;  2Y48 B;  4UV8 B;  1OED B;  1THQ A;  2KT9 A;  4J2C A;  4C90 A;  2NW8 A;  4ILU A;  4ADZ A;  5DL5 A;  2ZMA A;  3UT5 E;  5H2F O;  3A0B O;  4IRE A;  3QB5 A;  4GCP A;  3O1J A;  2JJ9 A;  3KFW X;  2F4V T;  3FBL A;  4E7S A;  2V7K A;  3HWB A;  1J5W A;  5L47 A;  2XUE A;  3MJX A;  1VOM A;  3QRA A;  1OWA A;  4LF4 T;  4KHP T;  3RYC E;  4EZ4 A;  1E7P A;  2K24 A;  1E54 A;  2YDS A;  5LGU B;  3PTR B;  4UIG A;  2PG8 A;  3SOL A;  2CXD A;  3VZU X;  3PGU A;  3BQK A;  3OPC A;  2BKN A;  3K3Q C;  3KV9 A;  4OYJ A;  1GQE A;  2W66 A;  3CVR A;  4FES A;  3IA3 A;  5CA0 E;  2POR A;  3DP7 A;  3O4X E;  4TWH A;  1IZN A;  2XE3 A;  4PR7 A;  4UVA B;  2YDQ A;  2V8S V;  4G75 A;  5HWY A;  4FT6 A;  4COF A;  3ZN0 B;  3A0H O;  2WMN A;  3RYH E;  2ES0 A;  2LM2 A;  3NRX A;  4AQF A;  2HH7 A;  3LK4 1;  4O3Z A;  3FYX A;  3EVY A;  3ZJ1 A;  5H6Q B;  2C0S A;  3RYI E;  3BQL A;  3T20 A;  4DID B;  2R4N A;  3AB3 B;  2V5D A;  2BG9 A;  2MNH A;  2KMF A;  2LSG A;  5AFU L;  3PQU A;  3ZMZ B;  3ANW A;  4NPP A;  2VQF T;  4K3B A;  3AA1 A;  1IBM T;  3KVA A;  4AKI A;  2J1N A;  3EI0 A;  1FEW A;  2M07 A;  3HA4 A;  3I9W A;  4DND A;  3AEC A;  1W9R A;  3AE5 A;  1BR2 A;  1N32 T;  1IJ6 A;  2JQK A;  1S35 A;  3LK2 A;  5CA1 E;  5CJ5 A;  2IWW A;  3A5X A;  1WR6 A;  2XQ5 A;  2M06 A;  4HFB A;  1US7 B;  5LHH B;  2L9Q A;  1YQ4 A;  1G73 A;  4P0B A;  1IJ5 A;  4TZ4 C;  4O4J E;  2JPF A;  2YEV C;  3T1Y T;  4RLC A;  3OVU A;  3KVD D;  4O8S A;  5TAO A;  2LKG A;  3ZCI A;  2PRN A;  3VY8 X;  2XPK A;  4ZXL A;  4UEL A;  5JDG A;  3N2O A;  3M65 A;  4UV9 B;  3TLU A;  5AFU K;  5IYU A;  5F3J A;  4I4T E;  2Y8D A;  1IZN B;  3PDY A;  3SFE A;  3UU5 A;  3FXD B;  5JRC B;  4YSZ A;  2P9B A;  3BK9 A;  3KBU A;  3FZF B;  3RI5 A;  3AAE A;  5L2L A;  2VUR A;  1ZKE A;  3GA8 A;  4TWF A;  4LSI A;  4O2A E;  5T5F A;  3AXJ A;  4HFH A;  3KDS E;  3QRC A;  2BG9 B;  2XAS B;  2WJQ A;  5BMV E;  3Q5X A;  5LA6 E;  2QGS A;  2WQY A;  2BKO A;  3C4X A;  4FI5 A;  4ZZB A;  3ANW B;  2K5B B;  3AA1 B;  4AIU A;  2XQ3 A;  3FZK B;  4A98 A;  3P4P A;  4JI8 T;  3ONX A;  2F1T A;  2WDQ A;  3VR9 A;  2LSI A;  4AFK A;  1LVF A;  2XTL A;  4AI6 A;  2XQA A;  2KLQ A;  1O3X A;  2E2A A;  2X0Y A;  4DR4 T;  3LK2 B;  2MTQ A;  4JI5 T;  3RIF A;  4AYE C;  4P0A A;  3RKO A;  4JI6 T;  2DI4 A;  3O1H A;  3ZJ2 A;  4CXX A;  4AQG A;  3Q9D A;  5JRE A;  2H3R A;  5LG3 A;  1ZHZ A;  3V5S A;  3UUM A;  2YN6 A;  4U2Z A;  5DL6 A;  2PTF A;  2O4V A;  4FOZ A;  5B5E O;  4FQE A;  1FIO A;  3AAA A;  1R8I A;  1W0B A;  1JNZ A;  2J62 A;  2XY8 B;  3ZMV B;  4K3C A;  3AAE B;  2XM2 A;  3UFG A;  2K0L A;  1KFY A;  5AQN B;  3O1I A;  1WCR A;  4A97 A;  1UUR A;  2H7O A;  3N2G E;  1HG2 A;  3G7G A;  4Z90 A;  4B3R T;  5FP3 A;  5G26 A;  4WW0 A;  5M4Y A;  4MAL A;  2BG9 E;  4UB8 O;  3CQG B;  3EDU A;  2XQ4 A;  4H63 V;  5C2T A;  3WI4 A;  1OXZ A;  2GK9 A;  3GP6 A;  3RX6 A;  4F6R C;  3CML A;  3EAM A;  2FGQ X;  2X51 A;  2LSK A;  2LSJ A;  2E9X C;  2ERV A;  4PK4 A;  3JC6 C;  2BS2 A;  4AUI A;  4LF9 T;  5LGT B;  1YS5 A;  2ZFG A;  2X0L B;  2Q9Q A;  4OFZ A;  4YJ3 E;  5LJN A;  2MAW A;  1BH3 A;  4HN9 A;  4FMS A;  1ZEE A;  1PHO A;  3PUA A;  2DHR A;  3UU3 A;  2VB6 A;  3A8Y C;  4PW8 A;  1XMO T;  2WDV A;  3UFE A;  2FJA A;  2QA7 A;  4PUX A;  2C5I T;  4HFV A;  3AE6 A;  2E9X D;  3PU3 A;  5JR9 A;  4C4V B;  3JC6 D;  3AA7 A;  5JDP A;  4ZI3 C;  3RPU A;  5AQJ B;  1N33 T;  2JIW A;  2FBW A;  3AED A;  3A7M A;  3EHZ A;  1UK5 A;  2QTK A;  2AXT O;  5DL7 A;  4CN6 A;  2A9U A;  4DR6 T;  3Q2M A;  5AQH B;  2UU9 T;  4ZHQ E;  1KNP A;  2LHR A;  3ZC1 A;  1MM4 A;  4EOZ B;  2XHE B;  2MYS A;  2UXB T;  3C4W A;  3T8O A;  2CMR A;  1ZP0 A;  2WB5 A;  4IDP A;  4HE8 A;  3ZKR A;  1MIY A;  5LBQ B;  3I9Y A;  4EZH A;  5LCY A;  3NWI A;  3L3P A;  4DR5 T;  3DJB A;  2WWV A;  2R6G F;  3QOF A;  3PQS A;  3QUJ A;  2LOS A;  3GMI A;  3I1A A;  4ZI3 D;  5KXJ A;  1N36 T;  1D0X A;  4IE6 A;  4O3W A;  2PFV A;  3EDV A;  2XQ6 A;  3VY9 X;  1OED A;  5E0O A;  3P4Q A;  1HXX A;  5EK2 A;  2Q9Q B;  4AQF C;  4O2B E;  1HXT A;  1S94 A;  2NW9 A;  5BR8 T;  2WM9 A;  2YIN A;  4IE4 A;  3F57 A;  2BG9 C;  2VK9 A;  4YSY A;  4JV5 T;  5C3J A;  5IHY A;  1HS7 A;  2KDY A;  5JDM A;  3T1H T;  3N9L A;  4EGW A;  3UU8 A;  5JR9 B;  1NEN A;  4KR4 A;  1WYB A;  4TV8 E;  4FRX A;  3AVR A;  1XWM A;  1G8X A;  5AQU B;  5JDF A;  4QH4 A;  4H9R C;  4EB6 E;  4ILC A;  3NRY A;  2Y0L A;  3RGL A;  5FVK A;  2YDR A;  4IE0 A;  2W0G A;  3J7Y q;  2LJL A;  1E2A A;  4HTE A;  4DR2 T;  1J1J A;  3K19 A;  2E8I A;  4PAG A;  4QXC B;  2XQ8 A;  2HN1 A;  3P7I A;  2LHF A;  2X9X A;  2V6Y A;  4D5U A;  1Q9G A;  3H3A A;  4DBQ A;  2F1V A;  3IHR A;  3TLV A;  2FJB A;  3POU A;  2NR4 A;  4PK5 A;  4IST A;  2SPC A;  2KIN B;  2UUB T;  3TKL B;  1ZHT A;  3UU4 A;  4X65 T;  3O9X A;  2WVP A;  1CHU A;  1QSD A;  2LRK A;  3EUH A;  3JTY A;  2KWH A;  5FXZ A;  2ZM6 T;  5EK3 A;  3SYS A;  3RIU A;  5L3D B;  3C98 B;  2UXC T;  3CQC B;  4G2A A;  1MMG A;  4AIS A;  4DV2 T;  1YXR A;  4DO0 A;  4DV7 T;  2N2N A;  3ABV A;  3QK6 A;  3HKE E;  1AJ3 A;  2LOP A;  3ZMS B;  3A2S X;  4C00 A;  2BBH A;  4HWH A;  4PJL A;  4U3C A;  4HFC A;  3LK4 2;  4LFA T;  2W81 C;  4YHJ A;  1Y01 A;  3VE1 A;  3OBV E;  4L0R A;  5J2T E;  2IWV A;  5HEH A;  2B76 A;  5AQV B;  5PRN A;  4TWD A;  3K1S A;  4X66 T;  5KMG P;  2X9W A;  4ZZC A;  2XAG B;  3KBT A;  8PRN A;  2XQ7 A;  5DL8 A;  3AEA A;  3AEE A;  5L3G B;  2W62 A;  2CPT A;  2ZLY A;  5L3F B;  4GYS A;  2C5J A;  4UF0 B;  4XZC A;  5IYZ E;  3L39 A;  1XDP A;  3ZST A;  5FXX A;  1QJ8 A;  3TLW A;  3K3O A;  4UVB B;  2LRL A;  4LSE A;  2VKD A;  5JRC A;  3Q5W A;  2V6Y B;  2CE7 A;  3BQI A;  2BKP A;  1GFO A;  4LML A;  4DUZ T;  3N2K E;  2LLY A;  1NAF A;  3OKQ A;  5FL0 A;  4AYI D;  3IEE A;  3K8P C;  2ACZ A;  1QLB A;  4B3S T;  4N59 A;  4ANJ A;  1OED E;  1M7K A;  1Y64 B;  2YPV A;  3UQ4 A;  2RP4 A;  3B13 A;  3N9O A;  3FXE B;  4X64 T;  4AZL A;  2JMH A;  3ZPO A;  2YK0 A;  2CXL A;  4YT0 A;  4O4U A;  1YW0 A;  3FBZ A;  2M6B A;  3UUL A;  1Q9F A;  5FKY A;  4C91 A;  4HWD A;  5JDN A;  3T24 A;  2MHL A;  2ODV A;  4MLK A;  4TUY E;  4JBW F;  5LGN B;  4K0U A;  3ZCJ A;  1XNQ T;  3PJA A;  4RJW A;  4HWI B;  4QH1 A;  5JDQ A;  1W0A A;  4WBO A;  2HN2 A;  3AE9 A;  1X9B A;  3ONL C;  4EYY R;  3PRN A;  1ORM A;  3VRA A;  2NOX A;  3ETU A;  1QJP A;  1MPF A;  2ODJ A;  3S4U A;  2BVM A;  1HR0 T;  2B1E A;  4YY3 T;  5F8P A;  4ZI7 E;  3PGR A;  4UB6 O;  4GKJ T;  4JI7 T;  4QHO A;  3ETV A;  4YTP A;  2W80 C;  3VKH A;  2KND A;  2Y7S A;  1FJG T;  3H37 A;  4IDQ A;  5IUX A;  3AE8 A;  3SWH A;  2WBL A;  4CZZ B;  2XE2 A;  3HOE A;  5JR9 C;  3FZM B;  1HG5 A;  4IE5 A;  2DWG A;  3LBX B;  2V7M A;  3HW9 A;  3HKB E;  2CA5 A;  4QKN A;  2BDE A;  5CB4 E;  4EXT A;  4U9C A;  2KXP B;  2R89 A;  3WAJ A;  3LFM A;  5HCJ A;  3CX6 B;  4BJN A;  4JYA T;  2R4O A;  2M6I A;  4E7Z A;  4LF7 T;  1T8B A;  5HXC A;  2J4U P;  3AE3 A;  2OA5 A;  4ERR A;  4XNK A;  1S5L O;  4CI2 B;  5AQP B;  2WZH A;  2CLY B;  2XJ7 A;  2UUC T;  4N75 A;  4O4L E;  3C4Z A;  3V8U A;  1ZV4 X;  1OED C;  4ZS3 A;  2X9K A;  2KSR A;  1HXU A;  3N9P A;  1WLX A;  4YJ2 E;  4ZI2 C;  5DQW A;  5DJQ C;  4H9S E;  3POX A;  4GHB A;  4HWF A;  4V1A v;  3NJT A;  3X1D A;  3CQX C;  2HPL A;  5ADX L;  2FUP A;  1BXW A;  2XE5 A;  2I59 A;  4C4V A;  1SA0 E;  2WY2 A;  4GYR A;  3N5L A;  2CHN A;  2JQ9 A;  4WBN E;  4N74 A;  2LFU A;  4F8H A;  1E1H B;  1KF6 A;  5J2U E;  4LF5 T;  2L8K A;  3PV0 F;  4NUV A;  1ZOY A;  1FMW A;  2WCA A;  3LSV A;  2RA1 A;  4EYU A;  4CN1 A;  4XBF B;  2X67 A;  4ZI2 D;  3O0E A;  4TNV A;  4Z3T A;  2OMF A;  4KUM B;  1BT9 A;  2XTQ A;  4JI3 T;  5FY0 A;  5KDM C;  3WAK A;  5JQG E;  4GK0 E;  3AAI A;  4DR3 T;  5LOV E;  4IE7 A;  4BUM X;  2FJD A;  3UPG A;  2XQ9 A;  4C69 X;  4O3X B;  3U3I A;  1H7C A;  4X1I E;  3ESL A;  2ZM0 A;  2XMX A;  2I0M A;  3KV5 A;  5ABE A;  3RC8 A;  3PUX F;  1WFD A;  2E5L T;  4FZL A;  5LXT E;  4DV0 T;  5J1G A;  4YLH A;  2V1D B;  3SY9 A;  3P8C D;  3B57 A;  3PUS A;  4FZN A;  2AE9 A;  3NVO A;  2XQY A;  2EHO A;  5JDH A;  4H9Q C;  1D1C A;  1HTJ F;  2VVS A;  3SFD A;  2CRB A;  1HX1 B;  4AYD C;  1MIV A;  1L0V A;  5D5D A;  3ZMU B;  5L3C B;  4TN7 B;  4JI4 T;  5ABF B;  1MIW A;  2N9D A;  4U2Y A;  4IL6 O;  3ZYM A;  4DMV A;  4DV5 T;  4QXB B;  3JCF A;  3UAQ A;  3U78 A;  2YOE A;  1LVK A;  5G38 A;  4X62 T;  1HNW T;  3N9M A;  4CI1 B;  4LMK A;  2K4T A;  3VRB A;  3NBX X;  4ZEY A;  5KX5 E;  4AQY T;  4QX7 B;  5HEU A;  2DWK A;  4EV6 A;  5CGM A;  1G90 A;  2ZM8 A;  1CUN A;  4EED A;  4KX6 A;  2CWO A;  3TLS A;  3DA3 A;  1GFP A;  3ZEF B;  5HXH A;  1JNR A;  2W4X A;  5L3E B;  2WS3 A;  1IBK T;  3UQ7 A;  3PUQ A;  3FZH B;  5F5W A;  1HCI A;  4P1N A;  4CQI A;  2XSA A;  3MXZ A;  4BJM A;  2BBJ A;  4JLE A;  5FY1 A;  2Y6X A;  3CPZ A;  3MZK B;  5DAB A;  5AQL B;  5AQK B;  4UXN B;  3TZG A;  1XNR T;  2EHO B;  5AQQ B;  2LE8 A;  1MND A;  2YU2 A;  1J5E T;  2LM9 A;  2E5V A;  3CX8 B;  3V5U A;  3HKD E;  1H6S 1;  3PUG A;  3F31 A;  3RQU A;  3ZC0 A;  1IAP A;  4FSO A;  3PUW F;  2N2M A;  2BZB A;  1WYC A;  4ILA A;  3AA0 B;  3R84 B;  3SZD A;  5JDL A;  2NTY A;  3AE2 A;  4E1S A;  3HKC E;  1SUM B;  3DWO X;  3NSG A;  1GFQ A;  2JQH A;  2ZM2 A;  1M62 A;  4LFB T;  2KC0 A;  2QRX A;  2WU5 A;  4B3T T;  4IL9 A;  4GIW A;  3JCU O;  3LK3 A;  2VKH A;  1XZY A;  2I6H A;  2R4P A;  3UUX B;  2H7V C;  4UF0 A;  4OK0 A;  5HEG A;  4AXP A;  5JVD E;  2XZE A;  4HFI A;  3BRY A;  3F2E A;  1XMQ T;  4YTN A;  4PJM A;  4HGA A;  2A2F X;  2IML A;  4U33 A;  2CHO A;  2WMO A;  4WZX A;  4LF8 T;  1HNZ T;  1MNE A;  1UX4 A;  3RLF F;  3ZMT B;  2Z6E A;  4H9N C;  4HKA A;  3T0S A;  3AEF A;  2WWU A;  1T72 A;  1GFM A;  4AYM C;  2JMK A;  1HF8 A;  3CX7 B;  5J0Z A;  5ABH A;  1NEK A;  3BRZ A;  4AKM A;  4WNK A;  4XNL A;  3G06 A;  3LG7 A;  4I50 E;  4U31 A;  3P50 A;  4MHC A;  2V7I A;  1N34 T;  3N9N A;  3RBH A;  2XAH B;  2X68 A;  4X1K E;  5GTH O;  4IT4 A;  5EE2 A;  1P4T A;  3PE0 A;  4KI0 F;  4HFE A;  2C5K T;  2R4L A;  2IC9 A;  3ZT6 A;  1ZHW A;  4HWC A;  3LK3 B;  3RH3 A;  4GK5 E;  4GF4 A;  1MM5 A;  1OSM A;  4QX8 B;  2UXN B;  3VZT X;  3DZM A;  2H89 A;  7PRN A;  2X66 A;  3M3Z B;  5LBM A;  3PUR A;  3VHL A;  3POQ A;  3B5M A;  3ZYK A;  1W09 A;  3WU2 O;  1VCS A;  4UR9 A;  1WRD A;  5LMU T;  2KZ7 A;  3C64 A;  3NZP A;  4F4B A;  5G39 A;  4FRT A;  3VKG A;  2V6X A;  2X9Y A;  4ZOL E;  2V7J A;  3RQW A;  2LT3 A;  4I0U A;  1VCT A;  4FJO A;  1KEY A;  3KV6 A;  4U72 A;  3LBX A;  4EEB A;  2UUA T;  2R8A A;  3FB2 A;  4IDO A;  4JI1 T;  3H3M A;  4DV4 T;  2L3L A;  2W63 A;  3AEB A;  2E9X B;  3OYX A;  2WJR A;  1UGO A;  3KZI O;  2VAS A;  2XAF B;  2FJE A;  2VVN A;  3W15 B;  1GFN A;  3LDQ B;  3OYZ A;  5KAI O;  4I55 E;  2XAJ B;  3I0O A;  5LHG B;  3DTO A;  3NZQ A;  3UUB A;  2N2L A;  3PUZ F;  4HEA A;  5FVN A;  2KXP A;  4B6X A;  4LF6 T;  3MAC A;  3PU8 A;  4B3M T;  4YXD A;  1WR0 A;  2IDO B;  2IHR 1;  3JAF A;  5HXS A;  2VWA A;  1YQ3 A;  3VR8 A;  3MK7 C;  3FZL B;  1NWM X;  4DUY T;  4EAH A;  2UXD T;  1BR0 A;  1ZHY A;  5HWX A;  3VE2 A;  3AE1 A;  1EZ3 A;  4HFD A;  2ACX A;  2VL0 A;  4PJ0 O;  5HXE A;  1YKE B;  4PFO A;  3IF8 B;  4JUY A;  3EAB A;  3JAD A;  4JI0 T;  3WI3 A;  4QQ1 A;  2GE4 A;  1OPF A;  2Q9Q C;  2XTR A;  4UEM A;  4H9O C;  4RJX A;  5KAF O;  5JTG A;  4Q25 A;  3J9X 1;  5FMN A;  2V26 A;  2XSB A;  5AQI B;  5ETW A;  2CBI A;  4PFP A;  4JI2 T;  3N9Q A;  4QWN B;  2EHO C;  2DLR A;  2CBJ A;  3FHN A;  2W00 A;  2V5C A;  3MA9 A;  3E08 A;  4N58 A;  4NIQ A;  4B61 A;  5B66 O;  2KZ7 B;  4U7I A;  3C5O A;  5HEJ A;  2IAK A;  4PNI A;  3QNU A;  5HAX A;  5GV0 A;  2R88 A;  5CFB A;  3E0Z A;  2RPA A;  3Q5D A;  5H6R B;  4NXN T;  1D0Z A;  3D0T A;  2D9D A;  1UUS A;  3ZT7 A;  2VL8 A;  2HHH T;  5LNK A;  3VU7 H;  4XAX B;  2Q9Q D;  2OLT A;  2M67 A;  4FZM A;  3BS0 A;  1I94 T;  4O49 A;  4FUV A;  4GKK T;  4IDZ A;  2UXX B;  4DV6 T;  5FVL A;  4U74 A;  2EHO D;  5JH7 E;  2XE1 A;  3E22 E;  3OTO T;  4YHH T;  1HFA A;  2PJQ A;  2F1C X;  1QJ9 A;  3KVB A;  3PUV F;  4O4I E;  3Q5E A;  5AQM B;  2X0H A;  5ABG A;  4IHJ E;  4L9I A;  5LJM A;  1UCU A;  1T16 A;  2YNK A;  3AVS A;  3AA6 A;  4D64 A;  4LSH A;  2K48 A;  3NKZ A;  3RC3 A;  2IIU A;  3ZYL A;  4CXW A;  2OV9 A;  4DR1 T;  2YU1 A;  2ZLD A;  1IBL T;  1Z0P A;  3QC9 A;  3L8R A;  2Y0K A;  1YKH B;  3ONJ A;  2K3W A;  4G63 A;  2H88 A;  2LEH A;  4KP3 C;  4L5G A;  1VRB A;  4IL4 A;  1YD8 G;  2XAQ B;  1MMA A;  2JRK A;  2IUB A;  3L09 A;  3AE7 A;  4MFR A;  3MKD A;  1V9D A;  1ZHC A;  3GN5 A;  4PJN A;  4AKR A;  1FMV A;  1KK7 A;  3SY7 A;  4KMC A;  4OX9 T;  1D1B A;  2X9H A;  2WAU A;  4UVC B;  4AKL A;  2WZI A;  1T98 A;  1LRZ A;  4YTM A;  4U7Y A;  5ABF A;  1U5P A;  4CN4 A;  4BA9 A;  1I6Z A;  5HYA A;  1T7S A;  4PJJ A;  4X5T A;  4G76 A;  2Y0H A;  3GWH A;  3AE4 A;  1DU2 A;  4KRA A;  2Y2X A;  2J4G A;  4RLB A;  1QUU A;  5GON E;  3SZV A;  1BR1 A;  3IBP A;  4O3Y A;  5EZY E;  4TNW A;  1PRN A;  4LMJ A;  2VKO A;  3LJC A;  4TX5 A;  4X1Y E;  3P4S A;  3SS1 A;  1X79 A;  2QVA A;  5AQT B;  2BS4 A;  2CEA A;  5TIS O;  3AXJ B;  4QXH B;  4ISS A;  3TLT A;  1HX8 A;  2FGR A;  3P4R A;  3RHW A;  3CWZ B;  3RRC A;  3AA6 B;  4AKH A;  2D0T A;  5EK4 A;  3EMN X;  4GOU A;  5ADX K;  4FSP A;  5LP6 E;  3SYB A;  1KNZ A;  4M1P A;  4MBQ A;  3ZLI A;  4TV9 E;  5HCM A;  4WYV A;  4O4X A;  5LYJ E;  4JEU B;  2D2S A;  4LFC T;  3HR0 A;  2WSS V;  3P4W A;  5FXV A;  2NW7 A;  3DA4 A;  3GN5 B;  4JFB A;  4OYK A;  4AKR B;  2NWB A;  2D0U A;  3RIU C;  4KBM B;  4N78 D;  4Z91 A;  5AQR B;  6PRN A;  3ZT5 A;  2W67 A;  5HXR A;  5IWA T;  1B7T A;  5LB7 B;  3AA0 A;  3ZN1 B;  1T1L A;  3I0Q A;  4YSX A;  2D5U A;  2N1G A;  2LSY A;  3RIA A;  2BVL A;  4CXY A;  1D0Y A;  2BS3 A;  2WP9 A;  2AXD S;  2YKS A;  3AAA B;  5L4E A;  4GCQ A;  4JEH B;  1XDO A;  2A3D A;  3CIR A;  5LG4 A;  3PF1 A;  4I43 B;  4EIW A;  2A72 A;  4RL9 A;  3K3N A;  3AEG A;  4CI3 B;  4D65 A;  2LKH A;  4ASK A;  1D1A A;  2CCQ A;  2ODU A;  4LSF A;  3CK6 A;  3R6N A;  2HPJ A;  4ZS2 A;  1SHZ C;  2JMM A;  3OJA A;  5E79 O;  3UTK A;  3ZSS A;  4O4H E;  4DVD A;  5G3A A;  4DR7 T;  3QB5 K;  1Z8U A;  3VZW X;  3CKD A;  3HI2 A;  2NTX A;  1KNR A;  3C51 A;  4CTD A;  5LMN T;  2IC6 A;  2KWI B; 
#chains in the Genus database with same CATH homology
 2PBI A;  3LG7 A;  4I50 E;  2G0U A;  2H7O A;  4MHC A;  4QHO A;  3ETV A;  3N2G E;  4BAY B;  5FXW A;  2V7I A;  2MBG A;  2W80 C;  4KR8 A;  3N9N A;  3VKH A;  3RBH A;  3UUN A;  5FYM A;  1HG2 A;  2XAH B;  1UX5 A;  2X68 A;  3G7G A;  4DBR A;  2KND A;  1MMN A;  4X1K E;  5FP3 A;  2Y7S A;  5G26 A;  2CM0 A;  3H37 A;  4WW0 A;  5M4Y A;  4MAL A;  5EE2 A;  1P4T A;  3PE0 A;  1LKX A;  4JCH A;  2C5K T;  3CQG B;  2IC9 A;  3EDU A;  5DQV A;  3HOL A;  1ZHW A;  3SWH A;  4H63 V;  4A56 A;  3POR A;  3LK3 B;  3RH3 A;  3WI4 A;  2WBL A;  4CZZ B;  3UU2 A;  2XE2 A;  1OXZ A;  2GK9 A;  4GK5 E;  3GP6 A;  2IW5 B;  3HOE A;  1MM5 A;  4IGU A;  4QX8 B;  5JR9 C;  3RX6 A;  2VKJ A;  1HG5 A;  2UXN B;  3CML A;  4F6R C;  1OSM A;  3VZT X;  4IE5 A;  2X66 A;  7PRN A;  5LHI B;  5LBM A;  3KV4 A;  2FGQ X;  2DWG A;  3LBX B;  3PUR A;  2X51 A;  3RYF E;  3VHL A;  3ZYK A;  2LSK A;  4PK6 A;  3POQ A;  2V7M A;  2LSJ A;  3KIN B;  5C8Y E;  3HW9 A;  3HKB E;  2E9X C;  2ERV A;  4PK4 A;  1WRD A;  2XG6 A;  4P09 A;  4AYN A;  3JC6 C;  2KZ7 A;  2MOZ A;  3C64 A;  2CA5 A;  3NZP A;  4QKN A;  4AUI A;  4F4B A;  5FY7 A;  5LGT B;  2BDE A;  4GCS A;  1YS5 A;  2CXF A;  4IIJ E;  3VKG A;  4FRT A;  2ZFG A;  2X0L B;  5CB4 E;  2X27 X;  2X9Y A;  2Q9Q A;  4AKG A;  4OFZ A;  4ZOL E;  2V7J A;  2LT3 A;  2CLY C;  2DNX A;  4EXT A;  4U9C A;  4YJ3 E;  5LJN A;  2KXP B;  3WI5 A;  1BH3 A;  2V7L A;  1MMD A;  4FJO A;  4OHF A;  3AA7 B;  3WAJ A;  3KV6 A;  4U72 A;  4HN9 A;  3LFM A;  4FMS A;  4H63 H;  3CX6 B;  3SYB A;  1ZEE A;  3LBX A;  4YFS A;  4BJN A;  1PHO A;  3PUA A;  2DHR A;  2DCF A;  3FB2 A;  2VB6 A;  4PW8 A;  4E7Z A;  2L3L A;  2W63 A;  5HXC A;  2J4U P;  2E9X B;  3OYX A;  1ZHX A;  4X20 E;  4Z8X A;  3UFE A;  2OA5 A;  2VAS A;  3SRZ A;  2QA7 A;  2XAF B;  4PUX A;  4ERR A;  4XNK A;  4CI2 B;  5L3B B;  3W15 B;  1GFN A;  5A1L A;  2C5I T;  4NUU A;  3OYZ A;  4E1T A;  2LHN A;  4I55 E;  2XAJ B;  3I0O A;  1U4Q A;  1BR4 A;  2J1D G;  3DTO A;  5LHG B;  3NZQ A;  3RRW A;  2N2L A;  2CLY B;  4HEA A;  4HFV A;  2JQQ A;  5FVN A;  2KXP A;  3C50 A;  4B6X A;  2E9X D;  3PU3 A;  2CWY A;  2W61 A;  3MAC A;  3JC6 D;  3PU8 A;  4O4L E;  5JR9 A;  3AA7 A;  5JDP A;  3C4Z A;  3V8U A;  1ZV4 X;  4ZI3 C;  3RPU A;  4ZS3 A;  5HXS A;  2VWA A;  1HXU A;  3N9P A;  1WLX A;  4YJ2 E;  4ZI2 C;  3HL6 A;  5DQW A;  2QTK A;  5DL7 A;  5DJQ C;  4H9S E;  2E9X A;  3POX A;  3MK7 C;  4GHB A;  4V1A v;  1NWM X;  4EAH A;  3CQX C;  3Q2M A;  4H9P C;  1BR0 A;  2HPL A;  1ZHY A;  5HWX A;  3VE2 A;  1EZ3 A;  5ADX L;  2NP9 A;  2ACX A;  2K9A A;  4ZHQ E;  4GF4 A;  2LHR A;  3ZC1 A;  4DMW A;  5HXE A;  1BXW A;  1MM4 A;  4EOZ B;  2XE5 A;  1YKE B;  2XHE B;  2MYS A;  4PFO A;  2I59 A;  3IF8 B;  4JUY A;  5FNV E;  2Y48 B;  3C4W A;  3T8O A;  2CMR A;  4UV8 B;  1SA0 E;  3WI3 A;  1THQ A;  2KT9 A;  4J2C A;  4QQ1 A;  4HE8 A;  2GE4 A;  4GYR A;  1OPF A;  1MIY A;  3N5L A;  2Q9Q C;  5LBQ B;  4C90 A;  2NW8 A;  2XTR A;  3I9Y A;  4UEM A;  4H9O C;  4EZH A;  4WBN E;  2LFU A;  4RJX A;  1E1H B;  4ILU A;  5LCY A;  5J2U E;  3L3P A;  3DJB A;  2L8K A;  3J9X 1;  5FMN A;  4NUV A;  2V26 A;  1FMW A;  5ETW A;  4PFP A;  3PQS A;  4ADZ A;  3QUJ A;  2RA1 A;  5DL5 A;  2ZMA A;  2LOS A;  3GMI A;  3I1A A;  3N9Q A;  2EHO C;  2DLR A;  4QWN B;  3UT5 E;  4EYU A;  3FHN A;  4ZI3 D;  2W00 A;  4GCP A;  3MA9 A;  4XBF B;  2X67 A;  3E08 A;  3O1J A;  1D0X A;  4ZI2 D;  3O0E A;  4N58 A;  4B61 A;  2JJ9 A;  3KFW X;  2KZ7 B;  3FBL A;  4IE6 A;  4E7S A;  2PFV A;  3C5O A;  3EDV A;  4O3W A;  4Z3T A;  2OMF A;  2V7K A;  4KUM B;  3HWB A;  2IAK A;  1BT9 A;  3VY9 X;  4PNI A;  2XTQ A;  5E0O A;  2XUE A;  3MJX A;  1VOM A;  5FY0 A;  5HAX A;  5EK2 A;  2Q9Q B;  3WAK A;  5KDM C;  1HXX A;  5JQG E;  4GK0 E;  3AAI A;  4AQF C;  5GV0 A;  4O2B E;  1HXT A;  1OWA A;  3E0Z A;  1S94 A;  5H6R B;  3RYC E;  4EZ4 A;  2NW9 A;  1D0Z A;  3D0T A;  2WM9 A;  5LOV E;  2YIN A;  2K24 A;  1E54 A;  4IE4 A;  2VL8 A;  3F57 A;  4IE7 A;  3VU7 H;  5LNK A;  4BUM X;  2VK9 A;  4XAX B;  3UPG A;  4C69 X;  4O3X B;  5LGU B;  2Q9Q D;  3PTR B;  2M67 A;  3U3I A;  4FZM A;  1H7C A;  4UIG A;  4X1I E;  2PG8 A;  3SOL A;  2CXD A;  3ESL A;  4FUV A;  2ZM0 A;  4O49 A;  3VZU X;  3BQK A;  2XMX A;  4IDZ A;  5IHY A;  1HS7 A;  2UXX B;  3KV5 A;  3K3Q C;  3RC8 A;  2KDY A;  5JDM A;  4U74 A;  4FZL A;  5LXT E;  3N9L A;  5J1G A;  2EHO D;  4YLH A;  5JH7 E;  2XE1 A;  3E22 E;  3KV9 A;  2V1D B;  1HFA A;  2PJQ A;  4OYJ A;  3SY9 A;  1QJ9 A;  3KVB A;  3P8C D;  3CVR A;  5JR9 B;  4FES A;  3B57 A;  4O4I E;  5CA0 E;  2POR A;  3PUS A;  3DP7 A;  4IHJ E;  4KR4 A;  3O4X E;  4L9I A;  5LJM A;  4FZN A;  1WYB A;  1IZN A;  1UCU A;  2XQY A;  2EHO A;  2YNK A;  3AVS A;  5JDH A;  4H9Q C;  2XE3 A;  1D1C A;  3AA6 A;  4TV8 E;  4D64 A;  1HTJ F;  4UVA B;  4FRX A;  3AVR A;  4LSH A;  4G75 A;  2K48 A;  1G8X A;  5HWY A;  3RC3 A;  4FT6 A;  5JDF A;  3ZN0 B;  4AYD C;  3ZYL A;  2WMN A;  3RYH E;  1MIV A;  2ES0 A;  4H9R C;  4CXW A;  4EB6 E;  2YU1 A;  5D5D A;  3ZMU B;  5L3C B;  2ZLD A;  1Z0P A;  3NRX A;  4TN7 B;  4AQF A;  2HH7 A;  3NRY A;  3LK4 1;  3QC9 A;  1MIW A;  2Y0K A;  4O3Z A;  1YKH B;  3FYX A;  3EVY A;  3ZJ1 A;  2N9D A;  5H6Q B;  4G63 A;  2C0S A;  2Y0L A;  2LEH A;  4KP3 C;  3RYI E;  4L5G A;  3ZYM A;  4DMV A;  1VRB A;  3BQL A;  4IE0 A;  1YD8 G;  2W0G A;  2XAQ B;  4QXB B;  3J7Y q;  1MMA A;  2JRK A;  3T20 A;  2LJL A;  3AB3 B;  4HTE A;  3UAQ A;  3L09 A;  3U78 A;  4MFR A;  3K19 A;  1LVK A;  2E8I A;  3MKD A;  4PAG A;  4QXC B;  3P7I A;  2LHF A;  2MNH A;  1V9D A;  1ZHC A;  2KMF A;  2LSG A;  3GN5 A;  4PJN A;  2X9X A;  5AFU L;  3QRA A;  3N9M A;  3PQU A;  4AKR A;  3ZMZ B;  1FMV A;  4CI1 B;  1Q9G A;  4D5U A;  1KK7 A;  3ANW A;  3SY7 A;  4KMC A;  3H3A A;  1D1B A;  2X9H A;  4DBQ A;  2F1V A;  2K4T A;  3IHR A;  2WAU A;  4UVC B;  4AKL A;  3AA1 A;  3POU A;  1T98 A;  3NBX X;  4PK5 A;  1LRZ A;  5KX5 E;  3KVA A;  4IST A;  1U5P A;  4AKI A;  2SPC A;  4BA9 A;  2J1N A;  4QX7 B;  2DWK A;  2KIN B;  1G90 A;  5HYA A;  1FEW A;  2M07 A;  3TKL B;  2ZM8 A;  4PJJ A;  1ZHT A;  3HA4 A;  4G76 A;  3O9X A;  1CUN A;  3I9W A;  4DND A;  1QSD A;  2CWO A;  2Y0H A;  3GWH A;  3EUH A;  3JTY A;  1BR2 A;  2KWH A;  3DA3 A;  4KRA A;  1IJ6 A;  2Y2X A;  1GFP A;  5FXZ A;  5EK3 A;  3ZEF B;  1S35 A;  3LK2 A;  5CA1 E;  3SYS A;  5HXH A;  4RLB A;  1QUU A;  5GON E;  5L3E B;  3A5X A;  1WR6 A;  3SZV A;  5L3D B;  2M06 A;  1US7 B;  5LHH B;  2L9Q A;  3C98 B;  1BR1 A;  1G73 A;  3IBP A;  3CQC B;  4P0B A;  4O3Y A;  5EZY E;  1IJ5 A;  4G2A A;  1MMG A;  3PUQ A;  4TZ4 C;  4O4J E;  1HCI A;  1PRN A;  2JPF A;  2YEV C;  2VKO A;  4DO0 A;  3LJC A;  4CQI A;  4RLC A;  4TX5 A;  3MXZ A;  3KVD D;  4X1Y E;  2N2N A;  4BJM A;  4O8S A;  5TAO A;  3QK6 A;  3SS1 A;  3HKE E;  3ZCI A;  2PRN A;  3VY8 X;  1X79 A;  1AJ3 A;  4JLE A;  2LOP A;  3ZMS B;  3A2S X;  4UEL A;  5FY1 A;  2Y6X A;  2CEA A;  5JDG A;  3CPZ A;  3MZK B;  3N2O A;  5DAB A;  4PJL A;  3M65 A;  4UV9 B;  4QXH B;  4ISS A;  5AFU K;  3LK4 2;  5IYU A;  2W81 C;  1HX8 A;  4YHJ A;  5F3J A;  2FGR A;  4I4T E;  2Y8D A;  1IZN B;  3CWZ B;  3OBV E;  3PDY A;  4UXN B;  2EHO B;  3TZG A;  4L0R A;  5J2T E;  3RRC A;  3AA6 B;  4AKH A;  2LE8 A;  3FXD B;  2D0T A;  1MND A;  5EK4 A;  2YU2 A;  5JRC B;  3EMN X;  4GOU A;  2LM9 A;  5ADX K;  3CX8 B;  3V5U A;  2P9B A;  3BK9 A;  4FSP A;  3HKD E;  5LP6 E;  3PUG A;  3F31 A;  3KBU A;  1H6S 1;  3ZC0 A;  3AAE A;  5PRN A;  1KNZ A;  5KMG P;  5L2L A;  2X9W A;  4M1P A;  2XAG B;  1IAP A;  3KBT A;  4MBQ A;  3ZLI A;  8PRN A;  4FSO A;  5DL8 A;  2N2M A;  2BZB A;  5L3G B;  2W62 A;  1WYC A;  1ZKE A;  2ZLY A;  4TV9 E;  5L3F B;  4GYS A;  3AA0 B;  2C5J A;  3GA8 A;  4UF0 B;  4XZC A;  3R84 B;  3SZD A;  4O4X A;  5JDL A;  5LYJ E;  4LSI A;  4JEU B;  4O2A E;  2D2S A;  5IYZ E;  5T5F A;  2NTY A;  3HR0 A;  2WSS V;  4E1S A;  3HKC E;  5FXX A;  3NSG A;  3KDS E;  1GFQ A;  1QJ8 A;  3K3O A;  4UVB B;  3QRC A;  2ZM2 A;  2NW7 A;  2XAS B;  5FXV A;  3DA4 A;  3GN5 B;  5BMV E;  4JFB A;  3Q5X A;  2VKD A;  4OYK A;  5LA6 E;  5JRC A;  2QGS A;  2KC0 A;  4LSE A;  4AKR B;  3C4X A;  3Q5W A;  2NWB A;  4FI5 A;  2D0U A;  3ANW B;  2K5B B;  4GIW A;  4KBM B;  4N78 D;  2CE7 A;  3LK3 A;  3BQI A;  6PRN A;  2VKH A;  1GFO A;  3AA1 B;  3N2K E;  5HXR A;  1NAF A;  1B7T A;  3UUX B;  3AA0 A;  2H7V C;  3OKQ A;  4UF0 A;  3ZN1 B;  3I0Q A;  4AYI D;  4OK0 A;  3IEE A;  3K8P C;  2D5U A;  2N1G A;  3ONX A;  2LSY A;  4AXP A;  2F1T A;  5JVD E;  4N59 A;  2BVL A;  4ANJ A;  2LSI A;  4CXY A;  1D0Y A;  4AFK A;  1Y64 B;  1LVF A;  2YPV A;  2RP4 A;  3B13 A;  2XTL A;  3F2E A;  3N9O A;  3FXE B;  4AI6 A;  4AZL A;  2KLQ A;  1O3X A;  2JMH A;  3ZPO A;  3LK2 B;  2MTQ A;  3AAA B;  4GCQ A;  4JEH B;  4PJM A;  2YK0 A;  2CXL A;  4HGA A;  4O4U A;  1YW0 A;  2A3D A;  4AYE C;  2A2F X;  3FBZ A;  3RKO A;  4P0A A;  2DI4 A;  3UUL A;  5LG4 A;  2WMO A;  3O1H A;  4I43 B;  3ZJ2 A;  3VE1 A;  4EIW A;  1Q9F A;  2A72 A;  4C91 A;  4RL9 A;  4CXX A;  5JDN A;  4AQG A;  3Q9D A;  5JRE A;  2H3R A;  3K3N A;  3T24 A;  2MHL A;  1ZHZ A;  2ODV A;  1MNE A;  3V5S A;  3UUM A;  4MLK A;  1UX4 A;  4TUY E;  3ZMT B;  2Z6E A;  5LGN B;  4K0U A;  4CI3 B;  5DL6 A;  2O4V A;  3ZCJ A;  4D65 A;  4ASK A;  4H9N C;  4HKA A;  3T0S A;  1D1A A;  2CCQ A;  4FOZ A;  4RJW A;  2WWU A;  2ODU A;  4LSF A;  5JDQ A;  1FIO A;  4WBO A;  3R6N A;  2HPJ A;  3AAA A;  4ZS2 A;  1SHZ C;  2JMM A;  1GFM A;  4AYM C;  3OJA A;  2JMK A;  3UTK A;  1HF8 A;  4O4H E;  4EYY R;  4DVD A;  3PRN A;  1ORM A;  3CX7 B;  2NOX A;  3ETU A;  3VZW X;  1QJP A;  1MPF A;  3ZMV B;  3CKD A;  3HI2 A;  2NTX A;  2ODJ A;  3AAE B;  3S4U A;  2BVM A;  2B1E A;  2K0L A;  4AKM A;  3O1I A;  3C51 A;  5F8P A;  4ZI7 E;  4WNK A;  4XNL A;  2IC6 A;  2KWI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...