5AFUU

Cryo-em structure of dynein tail-dynactin-bicd2n complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
168
structure length
168
Chain Sequence
PGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAYPDNITPDTEKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPTLQLDFLMKILPNYHHLKKTMKGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Dynactin Complex and its Interaction with Dynein.
pubmed doi rcsb
molecule tags Motor protein
molecule keywords DYNEIN TAIL
total genus 33
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5afuU00
2FKOA 3HSQA 3VBNA 2RIJA 2AQ9A 1YP3A 3BSWA 2WLEA 1THJA 1XATA 2QIAA 1KGTA 3FSCA 3R5AA 1KRRA 4J18A 4M28A 4M9CA 4R37A 4E6UA 4E75A 1HM0A 2OI7A 4HURA 1KQAA 1MR9A 4AA7A 3R5BA 3D8VA 5E3PA 4KPXA 4H7OA 4EA8A 3FWWA 3FSBA 3R8YA 2Q4JA 1FXJA 3KWDA 3SPTA 3R3IA 4G87A 2P2OA 1KGQA 4R7PA 5DEPA 3TIOA 4EAAA 3BFPA 4KNRA 3SRTA 3T57A 3FS8A 1LXAA 1QRFA 3R2WA 1SSTA 3P1BA 1Z90A 2QIVX 1HM9A 2V0KA 5L6SA 4HUSA 4M99A 3I3XA 3MQHA 5DG3A 4KNXA 3GVDA 4EGGA 5ADXU 3VBLA 2NPOA 2V0JA 1MRLA 4FCEA 4HCQA 3CJ8A 3MC4A 4G3QA 3FSXA 3VBKA 4ISXA 3EG4A 3IGJA 3OW5A 3BRKX 5E3RA 3GOSA 3VBPA 3I3AA 3VNPA 4J09A 1SSQA 3OU9A 2WLFA 1YP4A 2GGQA 3NZ2A 3EH0A 1KHRA 3KWCA 4IHGA 3C8VA 4KPZA 1T3DA 3TISA 3BXYA 4E79A 4M2AA 1OCXA 3FSYA 3DHOA 3F1XA 4EA7A 3JQYA 4N27A 3R3RA 2VHEA 4E6TA 2JF2A 5F42A 3R5CA 3HJJA 4K6RA 4R36A 4AAWA 3TV0A 1FWYA 3FTTA 4KQLA 4EABA 3DK5A 3VBMA 2I5KA 4G3PA 4M98A 4N69A 2OEFA 2W0WA 1TDTA 2JF3A 4N6BA 2IC7A 5E3QA 4AC3A 1HV9A 4M2BA 1KRVA 1G97A 1MR7A 2WLGA 2IUAA 3OUPA 1KRUA 2OEGA 3D98A 2V0IA 2IU8A 2VD4A 3P47A 1J2ZA 4G3SA 2ICYA 3Q1XA 2W0VA 4MFGA 4IHHA 3MQGA 4E1KA 1HM8A 1XHDA 4EA9A 3OTZA 1QRLA 3OTMA 3IXCA 2WLDA 1S80A 2OI5A 1SSMA 4N6AA 3ST8A 1QQ0A 3DJ4A 3VBJA 5L6VA 1QRGA 1QRMA 4MYOA 3FOQA 3VBIA 3PMOA 1V67A 3TK8A 2TDTA 4IHFA 4HZCA 1G95A 1QREA 4HZDA 3TDTA 3R0SA 5AFUU 3EEVA 1YP2A 5ADXV 2XATA 3KWEA 4MZUA 3V4EA 1KK4A 3TWDA 2GGOA 5DEMA 3GUEA 2ICXA 2V0HA 1KK6A 1KK5A 1V3WA 2V0LA 5AFUV 3BSSA 3R1WA 4EQYA 2IU9A 3ECTA 4DCLA 2WLCA 5U2KA 2OI6A 3BSYA 3R5DA 2QKXA
chains in the Genus database with same CATH superfamily
2FKOA 3HSQA 3VBNA 1L0SA 2RIJA 2AQ9A 3SUCA 1YP3A 3BSWA 2WLEA 2QIAA 1THJA 1XATA 1KGTA 3FSCA 3OH1A 1KRRA 3R5AA 4J18A 4M28A 4M9CA 4R37A 4E6UA 1HM0A 1N4IA 2OI7A 4HURA 4E75A 1KQAA 1MR9A 4AA7A 3R5BA 3D8VA 5E3PA 4KPXA 4H7OA 4EA8A 3FWWA 3FSBA 3R8YA 2Q4JA 1FXJA 3KWDA 3SPTA 3R3IA 4G87A 2P2OA 3GQ9A 3OH2A 1KGQA 4R7PA 5DEPA 3TIOA 4EAAA 3GQ8A 3BFPA 4KNRA 3SRTA 3T57A 3FS8A 1LXAA 1QRFA 3R2WA 1SSTA 3P1BA 1Z90A 2QIVX 1HM9A 2V0KA 5L6SA 4HUSA 4M99A 3I3XA 3MQHA 5DG3A 4KNXA 3GVDA 4EGGA 5ADXU 3VBLA 2NPOA 2V0JA 1MRLA 4FCEA 4HCQA 3CJ8A 3MC4A 4G3QA 3FSXA 3VBKA 4ISXA 3EG4A 3OGZA 3IGJA 3OW5A 3BRKX 5E3RA 3GOSA 3OH4A 3I3AA 3VBPA 1EWWA 3VNPA 4J09A 1SSQA 3OU9A 2WLFA 1YP4A 2GGQA 3NZ2A 3EH0A 1KHRA 3KWCA 4IHGA 3C8VA 4KPZA 1T3DA 3TISA 3BXYA 4E79A 4M2AA 1OCXA 3FSYA 3DHOA 3F1XA 4EA7A 3JQYA 4N27A 3R3RA 2VHEA 4E6TA 2JF2A 5F42A 3R5CA 3HJJA 4K6RA 4R36A 4AAWA 3TV0A 1FWYA 3FTTA 4KQLA 4EABA 3DK5A 3VBMA 2I5KA 4G3PA 4M98A 4N69A 2OEFA 1Z2FA 2W0WA 1TDTA 2JF3A 4N6BA 2IC7A 5E3QA 4AC3A 1HV9A 4M2BA 1KRVA 1G97A 1MR7A 2WLGA 2IUAA 3OUPA 1KRUA 2OEGA 3D98A 2V0IA 2IU8A 2VD4A 3P47A 1J2ZA 4G3SA 2ICYA 3Q1XA 2W0VA 4MFGA 4IHHA 3GQAA 3MQGA 1HM8A 4E1KA 1XHDA 4EA9A 3OTZA 1QRLA 3OTMA 3IXCA 1S80A 2WLDA 2OI5A 1SSMA 4N6AA 3ST8A 1QQ0A 3DJ4A 3VBJA 5L6VA 1QRGA 3OH3A 1QRMA 4MYOA 3GQ7A 3FOQA 3OH0A 3VBIA 3PMOA 1V67A 3TK8A 2TDTA 4IHFA 4HZCA 1G95A 1QREA 4HZDA 3TDTA 3R0SA 5AFUU 3EEVA 1YP2A 5ADXV 2XATA 3KWEA 4MZUA 3V4EA 1KK4A 3TWDA 1M8NA 2GGOA 5DEMA 3GUEA 2ICXA 2V0HA 1KK6A 1KK5A 1V3WA 2V0LA 5AFUV 3BSSA 3R1WA 4EQYA 2IU9A 3ECTA 4DCLA 2WLCA 5U2KA 2OI6A 3BSYA 3R5DA 2QKXA
chains in the Genus database with same CATH topology
2FKOA 3HSQA 3VBNA 2RIJA 2AQ9A 1YP3A 3BSWA 2WLEA 1THJA 1XATA 2QIAA 1KGTA 3FSCA 3R5AA 1KRRA 4J18A 4M28A 4M9CA 4R37A 4E6UA 4E75A 1HM0A 2OI7A 4HURA 1KQAA 1MR9A 4AA7A 3R5BA 3D8VA 5E3PA 4KPXA 4H7OA 4EA8A 3FWWA 3FSBA 3R8YA 2Q4JA 1FXJA 3KWDA 3SPTA 3R3IA 4G87A 2P2OA 1KGQA 4R7PA 5DEPA 3TIOA 4EAAA 3BFPA 4KNRA 3SRTA 3T57A 3FS8A 1LXAA 1QRFA 3R2WA 1SSTA 3P1BA 1Z90A 2QIVX 1HM9A 2V0KA 5L6SA 4HUSA 4M99A 3I3XA 3MQHA 5DG3A 4KNXA 3GVDA 4EGGA 5ADXU 3VBLA 2NPOA 2V0JA 1MRLA 4FCEA 4HCQA 3CJ8A 3MC4A 4G3QA 3FSXA 3VBKA 4ISXA 3EG4A 3IGJA 3OW5A 3BRKX 5E3RA 3GOSA 3VBPA 3I3AA 3VNPA 4J09A 1SSQA 3OU9A 2WLFA 1YP4A 2GGQA 3NZ2A 3EH0A 1KHRA 3KWCA 4IHGA 3C8VA 4KPZA 1T3DA 3TISA 3BXYA 4E79A 4M2AA 1OCXA 3FSYA 3DHOA 3F1XA 4EA7A 3JQYA 4N27A 3R3RA 2VHEA 4E6TA 2JF2A 5F42A 3R5CA 3HJJA 4K6RA 4R36A 4AAWA 3TV0A 1FWYA 3FTTA 4KQLA 4EABA 3DK5A 3VBMA 2I5KA 4G3PA 4M98A 4N69A 2OEFA 2W0WA 1TDTA 2JF3A 4N6BA 2IC7A 5E3QA 4AC3A 1HV9A 4M2BA 1KRVA 1G97A 1MR7A 2WLGA 2IUAA 3OUPA 1KRUA 2OEGA 3D98A 2V0IA 2IU8A 2VD4A 3P47A 1J2ZA 4G3SA 2ICYA 3Q1XA 2W0VA 4MFGA 4IHHA 3MQGA 4E1KA 1HM8A 1XHDA 4EA9A 3OTZA 1QRLA 3OTMA 3IXCA 2WLDA 1S80A 2OI5A 1SSMA 4N6AA 3ST8A 1QQ0A 3DJ4A 3VBJA 5L6VA 1QRGA 1QRMA 4MYOA 3FOQA 3VBIA 3PMOA 1V67A 3TK8A 2TDTA 4IHFA 4HZCA 1G95A 1QREA 4HZDA 3TDTA 3R0SA 5AFUU 3EEVA 1YP2A 5ADXV 2XATA 3KWEA 4MZUA 3V4EA 1KK4A 3TWDA 2GGOA 5DEMA 3GUEA 2ICXA 2V0HA 1KK6A 1KK5A 1V3WA 2V0LA 5AFUV 3BSSA 3R1WA 4EQYA 2IU9A 3ECTA 4DCLA 2WLCA 5U2KA 2OI6A 3BSYA 3R5DA 2QKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FKO A;  3HSQ A;  3VBN A;  2RIJ A;  2AQ9 A;  1YP3 A;  3BSW A;  2WLE A;  1THJ A;  1XAT A;  2QIA A;  1KGT A;  3FSC A;  3R5A A;  1KRR A;  4J18 A;  4M28 A;  4M9C A;  4R37 A;  4E6U A;  4E75 A;  1HM0 A;  2OI7 A;  4HUR A;  1KQA A;  1MR9 A;  4AA7 A;  3R5B A;  3D8V A;  5E3P A;  4KPX A;  4H7O A;  4EA8 A;  3FWW A;  3FSB A;  3R8Y A;  2Q4J A;  1FXJ A;  3KWD A;  3SPT A;  3R3I A;  4G87 A;  2P2O A;  1KGQ A;  4R7P A;  5DEP A;  3TIO A;  4EAA A;  3BFP A;  4KNR A;  3SRT A;  3T57 A;  3FS8 A;  1LXA A;  1QRF A;  3R2W A;  1SST A;  3P1B A;  1Z90 A;  2QIV X;  1HM9 A;  2V0K A;  5L6S A;  4HUS A;  4M99 A;  3I3X A;  3MQH A;  5DG3 A;  4KNX A;  3GVD A;  4EGG A;  5ADX U;  3VBL A;  2NPO A;  2V0J A;  1MRL A;  4FCE A;  4HCQ A;  3CJ8 A;  3MC4 A;  4G3Q A;  3FSX A;  3VBK A;  4ISX A;  3EG4 A;  3IGJ A;  3OW5 A;  3BRK X;  5E3R A;  3GOS A;  3VBP A;  3I3A A;  3VNP A;  4J09 A;  1SSQ A;  3OU9 A;  2WLF A;  1YP4 A;  2GGQ A;  3NZ2 A;  3EH0 A;  1KHR A;  3KWC A;  4IHG A;  3C8V A;  4KPZ A;  1T3D A;  3TIS A;  3BXY A;  4E79 A;  4M2A A;  1OCX A;  3FSY A;  3DHO A;  3F1X A;  4EA7 A;  3JQY A;  4N27 A;  3R3R A;  2VHE A;  4E6T A;  2JF2 A;  5F42 A;  3R5C A;  3HJJ A;  4K6R A;  4R36 A;  4AAW A;  3TV0 A;  1FWY A;  3FTT A;  4KQL A;  4EAB A;  3DK5 A;  3VBM A;  2I5K A;  4G3P A;  4M98 A;  4N69 A;  2OEF A;  2W0W A;  1TDT A;  2JF3 A;  4N6B A;  2IC7 A;  5E3Q A;  4AC3 A;  1HV9 A;  4M2B A;  1KRV A;  1G97 A;  1MR7 A;  2WLG A;  2IUA A;  3OUP A;  1KRU A;  2OEG A;  3D98 A;  2V0I A;  2IU8 A;  2VD4 A;  3P47 A;  1J2Z A;  4G3S A;  2ICY A;  3Q1X A;  2W0V A;  4MFG A;  4IHH A;  3MQG A;  4E1K A;  1HM8 A;  1XHD A;  4EA9 A;  3OTZ A;  1QRL A;  3OTM A;  3IXC A;  2WLD A;  1S80 A;  2OI5 A;  1SSM A;  4N6A A;  3ST8 A;  1QQ0 A;  3DJ4 A;  3VBJ A;  5L6V A;  1QRG A;  1QRM A;  4MYO A;  3FOQ A;  3VBI A;  3PMO A;  1V67 A;  3TK8 A;  2TDT A;  4IHF A;  4HZC A;  1G95 A;  1QRE A;  4HZD A;  3TDT A;  3R0S A;  5AFU U;  3EEV A;  1YP2 A;  5ADX V;  2XAT A;  3KWE A;  4MZU A;  3V4E A;  1KK4 A;  3TWD A;  2GGO A;  5DEM A;  3GUE A;  2ICX A;  2V0H A;  1KK6 A;  1KK5 A;  1V3W A;  2V0L A;  5AFU V;  3BSS A;  3R1W A;  4EQY A;  2IU9 A;  3ECT A;  4DCL A;  2WLC A;  5U2K A;  2OI6 A;  3BSY A;  3R5D A;  2QKX A; 
#chains in the Genus database with same CATH topology
 2FKO A;  3HSQ A;  3VBN A;  1L0S A;  2RIJ A;  2AQ9 A;  3SUC A;  1YP3 A;  3BSW A;  2WLE A;  2QIA A;  1THJ A;  1XAT A;  1KGT A;  3FSC A;  3OH1 A;  1KRR A;  3R5A A;  4J18 A;  4M28 A;  4M9C A;  4R37 A;  4E6U A;  1HM0 A;  1N4I A;  2OI7 A;  4HUR A;  4E75 A;  1KQA A;  1MR9 A;  4AA7 A;  3R5B A;  3D8V A;  5E3P A;  4KPX A;  4H7O A;  4EA8 A;  3FWW A;  3FSB A;  3R8Y A;  2Q4J A;  1FXJ A;  3KWD A;  3SPT A;  3R3I A;  4G87 A;  2P2O A;  3GQ9 A;  3OH2 A;  1KGQ A;  4R7P A;  5DEP A;  3TIO A;  4EAA A;  3GQ8 A;  3BFP A;  4KNR A;  3SRT A;  3T57 A;  3FS8 A;  1LXA A;  1QRF A;  3R2W A;  1SST A;  3P1B A;  1Z90 A;  2QIV X;  1HM9 A;  2V0K A;  5L6S A;  4HUS A;  4M99 A;  3I3X A;  3MQH A;  5DG3 A;  4KNX A;  3GVD A;  4EGG A;  5ADX U;  3VBL A;  2NPO A;  2V0J A;  1MRL A;  4FCE A;  4HCQ A;  3CJ8 A;  3MC4 A;  4G3Q A;  3FSX A;  3VBK A;  4ISX A;  3EG4 A;  3OGZ A;  3IGJ A;  3OW5 A;  3BRK X;  5E3R A;  3GOS A;  3OH4 A;  3I3A A;  3VBP A;  1EWW A;  3VNP A;  4J09 A;  1SSQ A;  3OU9 A;  2WLF A;  1YP4 A;  2GGQ A;  3NZ2 A;  3EH0 A;  1KHR A;  3KWC A;  4IHG A;  3C8V A;  4KPZ A;  1T3D A;  3TIS A;  3BXY A;  4E79 A;  4M2A A;  1OCX A;  3FSY A;  3DHO A;  3F1X A;  4EA7 A;  3JQY A;  4N27 A;  3R3R A;  2VHE A;  4E6T A;  2JF2 A;  5F42 A;  3R5C A;  3HJJ A;  4K6R A;  4R36 A;  4AAW A;  3TV0 A;  1FWY A;  3FTT A;  4KQL A;  4EAB A;  3DK5 A;  3VBM A;  2I5K A;  4G3P A;  4M98 A;  4N69 A;  2OEF A;  1Z2F A;  2W0W A;  1TDT A;  2JF3 A;  4N6B A;  2IC7 A;  5E3Q A;  4AC3 A;  1HV9 A;  4M2B A;  1KRV A;  1G97 A;  1MR7 A;  2WLG A;  2IUA A;  3OUP A;  1KRU A;  2OEG A;  3D98 A;  2V0I A;  2IU8 A;  2VD4 A;  3P47 A;  1J2Z A;  4G3S A;  2ICY A;  3Q1X A;  2W0V A;  4MFG A;  4IHH A;  3GQA A;  3MQG A;  1HM8 A;  4E1K A;  1XHD A;  4EA9 A;  3OTZ A;  1QRL A;  3OTM A;  3IXC A;  1S80 A;  2WLD A;  2OI5 A;  1SSM A;  4N6A A;  3ST8 A;  1QQ0 A;  3DJ4 A;  3VBJ A;  5L6V A;  1QRG A;  3OH3 A;  1QRM A;  4MYO A;  3GQ7 A;  3FOQ A;  3OH0 A;  3VBI A;  3PMO A;  1V67 A;  3TK8 A;  2TDT A;  4IHF A;  4HZC A;  1G95 A;  1QRE A;  4HZD A;  3TDT A;  3R0S A;  5AFU U;  3EEV A;  1YP2 A;  5ADX V;  2XAT A;  3KWE A;  4MZU A;  3V4E A;  1KK4 A;  3TWD A;  1M8N A;  2GGO A;  5DEM A;  3GUE A;  2ICX A;  2V0H A;  1KK6 A;  1KK5 A;  1V3W A;  2V0L A;  5AFU V;  3BSS A;  3R1W A;  4EQY A;  2IU9 A;  3ECT A;  4DCL A;  2WLC A;  5U2K A;  2OI6 A;  3BSY A;  3R5D A;  2QKX A; 
#chains in the Genus database with same CATH homology
 2FKO A;  3HSQ A;  3VBN A;  2RIJ A;  2AQ9 A;  1YP3 A;  3BSW A;  2WLE A;  1THJ A;  1XAT A;  2QIA A;  1KGT A;  3FSC A;  3R5A A;  1KRR A;  4J18 A;  4M28 A;  4M9C A;  4R37 A;  4E6U A;  4E75 A;  1HM0 A;  2OI7 A;  4HUR A;  1KQA A;  1MR9 A;  4AA7 A;  3R5B A;  3D8V A;  5E3P A;  4KPX A;  4H7O A;  4EA8 A;  3FWW A;  3FSB A;  3R8Y A;  2Q4J A;  1FXJ A;  3KWD A;  3SPT A;  3R3I A;  4G87 A;  2P2O A;  1KGQ A;  4R7P A;  5DEP A;  3TIO A;  4EAA A;  3BFP A;  4KNR A;  3SRT A;  3T57 A;  3FS8 A;  1LXA A;  1QRF A;  3R2W A;  1SST A;  3P1B A;  1Z90 A;  2QIV X;  1HM9 A;  2V0K A;  5L6S A;  4HUS A;  4M99 A;  3I3X A;  3MQH A;  5DG3 A;  4KNX A;  3GVD A;  4EGG A;  5ADX U;  3VBL A;  2NPO A;  2V0J A;  1MRL A;  4FCE A;  4HCQ A;  3CJ8 A;  3MC4 A;  4G3Q A;  3FSX A;  3VBK A;  4ISX A;  3EG4 A;  3IGJ A;  3OW5 A;  3BRK X;  5E3R A;  3GOS A;  3VBP A;  3I3A A;  3VNP A;  4J09 A;  1SSQ A;  3OU9 A;  2WLF A;  1YP4 A;  2GGQ A;  3NZ2 A;  3EH0 A;  1KHR A;  3KWC A;  4IHG A;  3C8V A;  4KPZ A;  1T3D A;  3TIS A;  3BXY A;  4E79 A;  4M2A A;  1OCX A;  3FSY A;  3DHO A;  3F1X A;  4EA7 A;  3JQY A;  4N27 A;  3R3R A;  2VHE A;  4E6T A;  2JF2 A;  5F42 A;  3R5C A;  3HJJ A;  4K6R A;  4R36 A;  4AAW A;  3TV0 A;  1FWY A;  3FTT A;  4KQL A;  4EAB A;  3DK5 A;  3VBM A;  2I5K A;  4G3P A;  4M98 A;  4N69 A;  2OEF A;  2W0W A;  1TDT A;  2JF3 A;  4N6B A;  2IC7 A;  5E3Q A;  4AC3 A;  1HV9 A;  4M2B A;  1KRV A;  1G97 A;  1MR7 A;  2WLG A;  2IUA A;  3OUP A;  1KRU A;  2OEG A;  3D98 A;  2V0I A;  2IU8 A;  2VD4 A;  3P47 A;  1J2Z A;  4G3S A;  2ICY A;  3Q1X A;  2W0V A;  4MFG A;  4IHH A;  3MQG A;  4E1K A;  1HM8 A;  1XHD A;  4EA9 A;  3OTZ A;  1QRL A;  3OTM A;  3IXC A;  2WLD A;  1S80 A;  2OI5 A;  1SSM A;  4N6A A;  3ST8 A;  1QQ0 A;  3DJ4 A;  3VBJ A;  5L6V A;  1QRG A;  1QRM A;  4MYO A;  3FOQ A;  3VBI A;  3PMO A;  1V67 A;  3TK8 A;  2TDT A;  4IHF A;  4HZC A;  1G95 A;  1QRE A;  4HZD A;  3TDT A;  3R0S A;  5AFU U;  3EEV A;  1YP2 A;  5ADX V;  2XAT A;  3KWE A;  4MZU A;  3V4E A;  1KK4 A;  3TWD A;  2GGO A;  5DEM A;  3GUE A;  2ICX A;  2V0H A;  1KK6 A;  1KK5 A;  1V3W A;  2V0L A;  5AFU V;  3BSS A;  3R1W A;  4EQY A;  2IU9 A;  3ECT A;  4DCL A;  2WLC A;  5U2K A;  2OI6 A;  3BSY A;  3R5D A;  2QKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...