5AG2A

Sod-3 azide complex
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
194
structure length
193
Chain Sequence
KHTLPDLPFDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSKGNLKEAIALQPALKFNGGGHINHSIFWTNLAKDGGEPSKELMDTIKRDFGSLDNLQKRLSDITIAVQGSGWGWLGYKKDKILKIATCANQDPLEGMVPLFGIDVWEHAYYLQYKNVRPDYVHAIWKIANWKNISERFANARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [MN] 2, MITOCHONDRIAL
publication title The Structure of the Caenorhabditis Elegans Manganese Superoxide Dismutase Mnsod-3-Azide Complex.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase
total genus 74
structure length 193
sequence length 194
chains with identical sequence C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2015-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 5ag2A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 5ag2A02
4BR6A 1VARA 1VEWA 3IC9A 3C3SA 1IX9A 1SZXA 1JR9A 3AK3A 1P7GA 1EN4A 4JZGA 1AVMA 1QNMA 2GDSA 5A9GA 1ZUQA 1GN6A 1AR5A 3KKYA 1WB8A 2AW9A 1BT8A 5AG2A 1XUQA 4X9QA 1N0JA 2QKCA 3OT7A 1EN6A 1WB7A 1MMMA 1PM9A 1GN3A 1I08A 4F6EA 1XILA 3DC6A 2QKAA 4E4EA 1AR4A 3MDSA 3CEIA 3DC5A 1MA1A 3BFRA 1GN4A 1XDCA 3RN4A 3AK2A 1IDSA 1ZTEA 1BS3A 3QVNA 3EVKA 3LSUA 1AP5A 1EM1A 1KKCA 4GUNA 1B06A 1PL4A 3K9SA 1EN5A 1XREA 1ZSPA 3C3TA 1Y67A 1AP6A 4YIPA 2CE4A 1JA8A 1LUVA 3AK1A 1MSDA 3TJTA 2CDYA 1LUWA 1MNGA 1GN2A 1D5NA 2ADQB 1I0HA 4FFKA 1IXBA 2P4KA 4YIOA 4JYYA 1BSMA 4C7UA 1N0NA 4JZ2A 2ADPA 1ZLZA 2RCVA
chains in the Genus database with same CATH superfamily
2QSAA 4FPPA 1ZL8B 1K8AW 1VQNV 2ZKOA 4BWAA 4FLVA 3OE7G 2UXCO 1IBMO 2A9HA 1G1XB 2DOSA 5DN6G 2XTAA 4DUZB 4LFBB 3THOA 2F95B 4DUYB 4DK0A 5TISZ 1M56C 4YY3O 1XUQA 3A0BZ 3JD3A 4X9QA 1COWG 2YEVA 3CC2V 4RQEA 2WLLA 3RYHA 2XAQA 1K7DA 1QLEC 2JEUA 1P4RA 4TQDA 5IYZB 2AHYA 1IXMA 1JNBA 1YTFB 4BIOA 4CBCA 1O9GA 1KU9A 2EIMB 4F6EA 2F93B 1VP7A 1VQ5V 1J95A 4FMTA 3KDRA 5LHIA 1GN4A 2YC0A 1QVFU 3CMEV 1KD1W 1RP3B 4PI2A 1OHHG 3LSUA 4UV8A 4LBEC 3ZCCA 4B3MO 3GWOA 4QGPA 4OGQB 5KA5A 3FAVB 3CCRV 1DGSA 5IY5C 3UT5A 3QTCA 1E1QG 4KP4A 4P2ZA 2Q7EA 5KMGA 5B1AC 5E1AC 2UXBO 1E1RG 5IJ9A 5LMUO 4DR6B 4O4LA 1XMOB 2EZOA 2WPDG 1QQCA 4FLZA 1LUWA 2F4VO 5H2FZ 5GONA 1D5NA 4LF4O 2RNBA 5LBQA 3RYHB 5KX5A 2PI4A 2P06A 5JCOA 2R72A 1M90W 2ZE5A 4JI3B 1AJQA 3E8HA 4GX5A 3ABMB 1W0JG 3W7XA 3ZHSA 3BA9A 3SYAA 4H44B 2QM4A 1H2MA 3OR6C 2P67A 3CJHB 3R65A 3OUFA 4NTXA 2ARHA 3UM7A 1J5EO 3D3QA 3OFNG 4JI1B 3UT5B 1Q3EA 1CP9A 3CYOA 2HVJC 4X65O 2R9RB 2H3OA 2Q9LA 3FB5C 1N32O 4MW3A 4O4LB 3CCLV 3E22A 1Z5WA 4IL6Z 1FXVA 2F23A 1YIJV 1R3KC 3M8AA 2QJ1A 2DYRC 4X1KB 5KX5B 2QM8A 3ZRSA 1F51A 4KFMA 1I94O 3WG7B 4KUMA 4EB6B 1MSWD 2HR3A 2GTAA 3CMAV 3IGAC 1MA1A 2KQXA 3FYEB 1EFRG 2IH3C 1IJGA 1SKVA 4B3SO 2BSKA 4FFBA 4P9OA 1AI7A 1JJOA 4LWSA 4FVMA 4X8AA 5EIBD 3W7UA 1PL4A 1DLBA 2KKWA 4QIWF 4X1IA 1Y67A 4UCOA 3WB0A 2E74B 3APOA 4ASUG 4KHPB 4X20A 1I5XA 2Q6AA 4K0KB 4DK1A 5H5NA 4J7ZA 3LSSA 4RAIA 4NXNO 4WFHA 3ABKB 1IBLB 1X59A 2Q67A 2UXDB 1OJHA 4CH3A 1GM8A 4JYCA 4TV9B 3ASOB 1M57B 1XHZA 2GBOA 4LFCO 1TVKA 4LF5B 1Z5VA 4DV6B 1BZKA 2ZT9B 4JYAB 2JDIG 1QCEA 4FFBB 5GW7A 3HKDB 1OCOC 2XUMA 2ZM6B 3OEEG 4I0XA 5FPOA 4TSFG 2VQFB 1GN6A 3KCXA 4J11A 1FXKC 1SESA 1BT8A 2HP8A 1FFXA 4NVPA 1NVPB 2JJ2G 3CX5F 3ETGA 5C8YA 5LP6B 3K3WA 1BHBA 1K4CC 1EN6A 4A5UB 1P49A 4UVCA 2DYSB 4YJ2A 3OR7C 3TETA 1MMMA 4GX2A 1VQPV 1TUBB 3HKCA 3J81N 1ORQC 2JEXA 3JD1A 3HR0A 4ZBMA 5JH7A 3RYFB 2UXXA 3RN4A 4UXNA 3K0GA 1IDSA 3DXRB 1ZTEA 5CBFA 4YHHO 4HNAA 2LW7A 2OIEA 4I0XB 1F23A 1GAXA 2ZDIA 3EFFK 1KP2A 1M56B 1SA0A 2Q0OC 3C3TA 5L3CA 3T1HB 4UVAA 2YSUB 5BR8B 4IIJA 1RFYA 4IYHA 4K35A 5C93A 2EULA 5C8YB 3MAQA 1F4MA 2DJVA 2JS3A 1QLEB 1L1FA 3VOUA 2UUBO 4I55B 3JAMN 4PHZA 3UO3A 2YIAA 1TGOA 4JI0B 2E5LB 5D5QA 4XDLA 1S72V 4JI8B 1BQ0A 5JH7B 4GX0A 3AG2C 5LGUA 4D7TA 4BAYA 1PKXA 1VEWA 1BGYH 1IBKO 2VWKA 1OV9A 5LOVB 4WFGA 5IY5B 1US6A 5GTHZ 4B7KA 4LH7A 5CBGA 4JAVA 5B1AB 4AHCA 3D36C 2HFEC 2GHYA 2IBZH 4MW8A 3OTOO 1PL0A 1K97A 3I5DA 1CPYA 4P30A 4PA7A 3TXSA 2GTSA 4H13B 1QHTA 1FJGO 1SQBH 3T1YO 2QKCA 5BMVB 4JI5B 1GM7A 5H6RA 5LA6B 1NR7A 5CB4B 1H2GA 3H01A 5JVDA 1PM9A 2PYLA 4DV2O 1VQLV 3L75H 1FOUA 2XHBA 4I50B 4OXSA 2P22C 1Z2GA 1FFTB 4DR1O 2ZQMA 5B66Z 1BL8A 4GYCB 2PYJA 2QWNB 4XBFA 5F2VO 1ENVA 4BIUA 3BA8A 5LGNA 2QEXV 2G38A 3FB8C 2XNDG 2IJKA 3JARA 4ZI7A 3HKBA 2HVKC 5B1OA 1H8HG 3H1JH 3W7WA 1THZA 2DYRB 3K5LA 3TJTA 2WLIB 1SETA 1HWYA 5LMNO 4DXWA 2MW2B 3K5NA 1MNGA 5D5PA 1WA8B 2FKXA 3J80N 3B77A 1EZJA 1GO3F 1IXBA 3F5WC 3Q4HA 3I56V 2KB1A 3WB2A 4RWUA 4DO2A 3RVZA 4U3JB 4JGSA 3IC9A 3QG5A 3VQXA 5L3GA 5LYJB 1PV0A 3QO8A 4B3RO 1N33B 5EZYA 2WA4A 4UVBA 4BW9A 4ZHQA 3BPZA 1LR1A 3JARB 5EC2C 1VF6C 5B1NA 4CH6A 3J7AU 1GK9A 4UCVA 2AW9A 2IU3A 3CCEV 4ZKIA 2QE7G 4MVSA 1VQ7V 1V9PA 4FIPC 2RJZA 4LP8A 1JPXA 4J9ZB 3K58A 2YXYA 3H1HH 1GRJA 2BTOA 4DV4O 4NTWA 3CXHF 1XL4A 3CXCU 3GWKC 4NTYA 3DC6A 2GUZB 3JSNA 3LNNA 4FM1A 3CEIA 2RDCA 1VIBA 3K5OA 5J2UA 2UU9B 4O2BA 2Y0IA 5J9PC 4O4IA 4UB8Z 1XMQB 3HKEA 1FXKB 4ZOLA 1F4NA 4GKJO 3S3WA 4PELA 3M99B 1DF5A 3MHSC 1AP6A 4WBNB 3L72H 4LF8O 4H37A 3LDCA 3CRMA 4DW1A 2QDOA 3AK1A 3K0DA 4DR7O 2ITCC 2LJ2A 4DR4B 5JWPA 3BABA 4OPAA 4NR1A 1SQQH 2CUGA 1JFFB 2NLJC 3TXQA 3OGCC 2A7WA 3JYCA 3ETQA 5JJEB 1R3JC 1I5YA 4BR6A 2Y48A 4LFAO 1VF7A 2ATKC 4JAAA 1IZ3A 2VQEB 3D36A 4JI2O 3NR7A 4FLUA 1W2BU 4HYOA 3K5MA 5IYZA 5H6QA 1XHXA 4RQFA 2AGAA 4DYLA 3DSQA 1XNQB 2JS5A 3T2MA 4B08A 3ZHRA 1KBHA 2Y69C 4X66O 1SZTA 2EIKC 2FB5A 4NXNB 3NXSA 4LNUB 3FAVA 3K08A 4O4HB 3SPCA 3AG2B 1BMFG 2N05A 4UB6Z 1G8MA 1AR4A 2N74A 2EJ7A 5KHJA 2LGQA 1BS3A 2ZR2A 5JJJB 1QVGU 5CA3A 1YJNV 1H2LA 4DV5B 5DEDA 3PN1A 1AROP 1JOYA 1SQPH 4Z1MG 1Q81W 2ZR3A 4FLXA 3JATB 4Q20A 2X6BA 2CH7A 1F7YA 1YEWA 4PDVA 1N34B 1LUVA 3ZMZA 2GV9A 1Y4MA 2CDYA 3K57A 3L70H 4LF7O 3CJHA 3H1KH 3RW0A 3JCUZ 4JI4O 4X62B 1AILA 1KUQA 3ZHUA 5LHGA 2HHHB 2D3OW 4D6TH 1TA8A 2CTPA 1N36O 4X1YB 2BOBC 2ZE8A 2DWDC 3CE2A 1O9HA 4UCRA 4NYKA 2WAMA 4CC5A 4X1KA 1S5JA 5CA1B 4W4KA 3F7VC 1YHQV 2DQ3A 1GKFA 2CH7B 4EB6A 2FYUH 1NH2D 2Z5UA 2YXLA 3ZMUA 1WN7A 4DV1B 4JASA 4UV9A 4JF3A 4X89A 3LDEA 1YSCA 3OAAG 4JV5B 2VS0A 3FFQA 3N2GB 2CTRA 1WB7A 3JD4A 1OCRC 4HBNA 1HNZB 1K73W 4LF9B 1DTOA 4JI6O 3OW2U 1WLEA 1R6NA 3GVMA 2UUAO 3U0ZA 1R3LC 3FB7C 3RGBA 3PJSK 1EZVH 1YI2V 2F1MA 2OTLV 3N2KB 3QVNA 2QTSA 1HW7A 1KKCA 4MVMA 2IW5A 2ZIMA 4XDJA 4QNHB 4CH5A 2QWOB 5KHKA 2WA3A 1ZSPA 3CPWU 4TV9A 1Q6HA 1PD3A 3N27A 4R6ZA 1YXBA 5EYPB 3DTUB 2R9AA 5K1XA 2HJFC 4U7OA 3IAYA 1FJGB 2W0XA 3ZMVA 1CXZB 1WAZA 3HKDA 1HDJA 4B3TO 4DR3O 1SF9A 2JIZG 4DV2B 3T1CA 3JAWB 5KA6A 1NTMH 4JTDB 2LO1A 1WPBA 3RVYA 2XASA 4LR3A 3CHXA 3GB7C 2ZNIA 5KAFZ 3CD6V 5LP6A 5IWAO 4TQFA 1HNWO 2B9ZA 2ZD9A 1T5EA 3W7SA 5FLXN 2GDSA 3WB1A 2NR5A 3L71H 4J80A 1TUBA 2Q5ZA 1VQ8V 5CN0A 1VQ4V 4JAUA 3RYFA 3ZMTA 3ZS8C 1KMIZ 4FLTA 5A2QN 5IYBO 5KAIZ 2UUCB 3DXRA 5IE9A 4O2AA 5EIBC 3A0HZ 1RSOA 2Q4PA 3ZBHA 4DUZO 4AQYB 3CRRA 4LFBO 1JCHA 4KL1A 4DUYO 3G67A 2LP7A 1FS0G 1NTKH 3DC5A 3ETDA 4DV0B 1XDCA 1VQ9V 1B6QA 4EEQA 5ITZB 4LCUC 1HNXB 4XDKA 4OX9B 4MT8A 5LHHA 4O4JB 4I55A 3UO2A 4FLYA 1S5LZ 4LF6O 3BEHA 2EILC 3JAKB 3TGUH 2Y69B 4EFEA 1GM9A 3OMAB 4J10A 2EIKB 3OMIB 1FYJA 4O2AB 2P4VA 5LOVA 3CRCA 1H5WA 1RSOB 3CCQV 2HLDG 4EFBA 3CWBH 1H38A 3EXAA 2DN9A 3VQYA 4ABMA 4DR6O 3W7TA 1HP8A 1XMOO 2RCVA 2YIBD 4X64B 2RMKB 3CS5A 3C3SA 4GKKB 3E8GA 2YI8A 3OTFA 4CZZA 1XNRB 1HR0B 3SYOA 1Q90D 5BMVA 2XAJA 4JI3O 3O9OA 5LA6A 1KB9F 4YJ3B 4K3AA 5CB4A 4NXMB 4GKJB 2E3CA 4PI0A 5IYDO 1Y74B 4DV3B 4I50A 1L8DA 4ICGA 1FPOA 1AR1B 3ABUA 4JI1O 5JQGB 3G4SV 3STLC 5IJ0B 3MHHC 2NNUA 4R8CA 4I4TB 1OZ0A 2QM7A 1FD9A 4DV7B 4TWKA 2Z0AA 4IGGA 4GX1A 4FM2A 4DR5B 1V54C 3MD0A 4HAMA 2WWWA 5DECA 3CCMV 1R73A 2WLIA 3LDDA 5L3BA 4FM0A 4PDRA 3IJ4A 1WA8A 3QNEA 1LNQA 4IHJB 1EN5A 4JI7B 2YICA 1SERA 3OUSA 2HKOA 4YIPA 1JA8A 1NBMG 3K9AA 3CRQA 4U3JA 2GSMB 2D2CB 4AILC 3A8TA 3M7MX 1SC5B 4RUEA 1OCRB 2ADQB 3A0RA 5LYJA 3X2QC 3L74H 2UXCB 1IBMB 1E79G 4YIOA 3F7YC 1V55C 2JVDA 3FB6C 1EBOA 5FPRA 5K1PA 4LC1A 4KHPO 1AJNA 1YDXA 1G6UA 4K0KO 1NZ6A 4UCTA 3K04A 4YY3B 4MTOA 2DWEC 1IBLO 3IFXA 3ZHTA 2UXDO 5IYCO 3E35A 2EINC 1NH2B 1B3QA 1EN4A 1QNMA 2QWPB 4MVZA 2WLNA 2L35A 3KKYA 4LF5O 4DV6O 2GUZA 4EKWA 5AG2A 4JYAO 3E86A 1S5HC 4HZ3A 2EZPA 1U97A 5B3SC 2ZM6O 1KECA 5LL6Y 3SJQC 3CB2A 1AB3A 4B3MB 3ZJZA 5B1BC 4TUYB 1PPJH 4MVQA 2VQFO 2ZNJA 1P7BA 2OYQA 1FXKA 4UCUA 1I08A 3BHPA 2MK3A 2FMLA 1N8RW 5DM6V 2UXBB 1S77D 2K1EA 2JJ1G 3JALA 3AG4C 2N04A 4WBNA 5LMUB 1FKAO 1AI4A 3BY6A 4AI8A 2AZ2A 2F66C 1K9MW 3OGIB 1YCIA 2XAHA 4MTXA 2F4VB 1ZX3A 2WLHA 4LF4B 3RYCA 2BTQB 1Q43A 2KG7B 3K9SA 4MVRA 5JCOC 3CSXA 1I7FA 3AG1C 3ZRWB 1JFFA 5IT9N 5IDJA 2M6YA 5L3EA 4MVOA 2CAZC 3VBBA 1W0KG 4PJ0Z 5EBLC 4DW0A 2QTOA 1KYOF 1Q6UA 1KC8W 1QR9A 1J5EB 2BCCH 3T1HO 4MTFA 1Q7YW 3WU2Z 4JZ2A 1VMGA 4X65B 5BR8O 4JI6B 3UCSC 3JALB 3ABLC 3SYCA 1UJWB 3ZX6A 2OTJV 1BE3H 4N21A 2JGDB 1N32B 3CCSV 1NKDA 1M5IA 2YXHA 3CCJV 4JI0O 3RYCB 2E5LO 4LNUA 1U96A 4O4HA 5JJNB 4JI8O 2EILB 1YJ9V 1XBLA 1I94B 1AJPA 1AI5A 3B4SA 1M9NA 1M93A 3LSQA 1QBZA 4IYIA 4PA3A 1KP3A 2V7QG 2Q7HA 2EBOA 4F6RB 1N0JA 3RYIB 4B3SB 4FJCC 1XI1A 2IJIA 3G71V 1WJZA 2EJRA 1IURA 2PGGA 1H2NA 1PNLA 3JATA 3R66A 3K59A 4WFFA 1SRYA 1Y76A 3AG3C 3SR2C 2NN4A 4J41A 1CEZA 1NQTA 4JI5O 4J42A 1ROPA 1DK1A 2DW4A 1XOUA 4UFZA 3ABTA 1MZFA 1B04A 2Q0AA 3L9DA 4X88A 1TUEB 2CK3G 2Q68A 4LFCB 1VF5B 4H0LB 1PNKA 2P90A 4X1YA 3HPLC 3U10A 5LXTA 2QR4A 1L0NH 5KUMA 3CP1A 2LGWA 4FFKA 2QKSA 5CA1A 1FXHA 5H9CA 3RT3C 1V54B 1H2SB 1Y76B 2PUSA 4PD4F 2ITDC 1X4TA 1VARA 5FNVA 3ZN0A 5HFMA 3KG2A 3LNMB 2A06H 2P6JA 2HEPA 2E75B 3JASB 2IJJA 3N2GA 2Z3YA 4I5SA 4TT3G 4UCSA 4ZIBA 1ZWIC 3H1IH 2ZE6A 4CC6A 4PDLA 4LF6B 1JMKC 1WNSA 3RBZA 1XQ8A 1RPOA 2YIDA 3CCVV 1YJWV 1NTZH 3I55V 2V1DA 1RPRA 3X2QB 3HB3B 5LXTB 3N2KA 2QWQB 4YHHB 1N33O 3OEHG 1SQXH 1V55B 2QWRB 1VF6A 2ZINA 3CC4V 3FKSG 5LGTA 5KUKA 2ZDIC 5J2TA 2LW1A 4Z2WA 4WF9V 1H8EG 5CBHA 2KSDA 5KHHA 5EYPA 5FNVB 3SPHA 2YEVB 4W4LA 2EINB 2IH1C 2Y0PA 3BVOA 2WLLB 2YUAA 3EVKA 2UUBB 2WSSG 5KLVH 2ETNA 2A3QA 4QJFB 4WFEA 2UU9O 3B40A 1M4UA 1JVMA 2HJDA 3JAWA 5B3SB 3SPGA 1MSDA 2OCCC 1XMQO 1IBKB 5B1BB 1JJ2U 3G6EV 1VQOV 3VQVA 5L3FA 1QU7A 4N23A 5KMGB 3JCZA 3QO7A 5IJ9B 1L0LH 3AG4B 5J2TB 4PA6A 4MTGA 2XT9A 4DR2O 3OTOB 2F43G 4FLWA 4MS2A 1W59A 1WP7A 4RUFA 5BXZA 1WP8A 1YITV 3D3IA 5GONB 4DR4O 4GLXA 4PA9A 3T1YB 1GH6A 3SPIA 3AK3A 1P7GA 3AG1B 3H1LH 3JD2A 4QPKA 1AVMA 2WLJA 2OWOA 3E83A 3SJAC 1Q82W 5KHIA 1PP9H 5EK0A 4QE7A 1D2DA 1R3IC 1H2KA 3B8NA 2VQEO 2EIJC 2BE3A 3CC7V 5ITZA 3OT7A 4DR1B 2YDEA 4Z1VA 3FD9A 1K3EA 4O4JA 3U11A 5GTIZ 3E8FA 2AHZA 1GN3A 1Q8IA 3ABLB 3ICXA 4R7CA 2QKAA 1XNQO 3E22B 3JAKA 4QE9A 4BIZA 4E2LA 3K03A 3ZN1A 2Y4UA 1R6TA 2Q69A 2RN9A 2CTWA 2C2AA 3F5TA 3OM3B 5LMNB 3SYQA 1TAEA 1IVSA 3RFRA 4BW5A 2P5OA 4GUNA 1OCZC 4QPJA 1MZEA 2YI9A 4K8XA 3L73H 1K5QA 2B1GA 2IM9A 4I7ZB 2Q8VA 3STZC 1SQGA 3T4ZA 2W0FC 5B5EZ 4D7SA 4L87A 1RM1C 2BSKB 4JTCB 4WFBV 4LWSB 2BOCC 4DV5O 2H94A 3TCUA 1XL6A 1NI8A 1JX9A 3SJBC 2FTKA 4B3RB 3B2EE 2P4KA 4X1IB 4JYYA 4YJ3A 1BSMA 2DE0X 3AG3B 2FL4A 2L6LA 1N34O 2Y4TA 1Y6XA 2JGUA 4X20B 2PF4E 2ADPA 1ZLZA 1Y74A 2R9IA 3IC7A 4F4LA 3P3PA 4CS3A 4FK5C 1GMGA 2LFSA 4YXWG 1JR9A 3LUTB 5JQGA 4X62O 1AI6A 5EBWC 5IJ0A 4DV4B 3BAAA 2XAGA 3ASNC 5KHGA 1S76D 4H33A 4I4TA 2HHHO 2AZ0A 1TVKB 3H9VA 1Q86W 2JK5C 3SPJA 1K92A 1OCCC 4DRXA 3VQWA 2DMXA 1UFIA 1FAFA 2VRZA 3B09A 2OT5A 2X6CA 3FX7A 2ZXWC 1YZBA 4GCZA 4B7EA 4IHJA 4CH4A 4WFAV 2JRIA 1YVWA 3ML0A 3MDSA 1FFXB 4LH6A 3BRCA 4DV1O 2HG5C 1M1KW 4LF8B 3K06A 3AEIA 3AK2A 4G2KA 4U7NA 1YTFD 5EBMC 4JV5O 4JYBA 2Q7GA 4FZ0A 4DR7B 2PY5A 4YJ2B 3CCUV 4WCEV 3HKCB 3KZIZ 1HNZO 1K33A 4LF9O 3ZIAG 1UPGA 3G6BA 2WLKA 3E8BA 4DRXB 2V4DA 1MABG 3ZRXA 2YS8A 4J7JA 2X7RB 3P32A 1K34A 3ZRVA 4LFAB 1NJIW 3KCYA 3K79A 3QO5A 4HNAB 2Q73A 2IU0A 4JI2B 1SA0B 2K9PA 4PA4A 5EC1C 2ILMA 1N0NA 4IT5A 2UXNA 1SS3A 2H8PC 4IIJB 2EIMC 4JPRA 1QLNA 4KXRA 4UUJC 2IJHA 1Y66A 5L3DA 1NS1A 1A32A 3UKMA 3CRAA 5FL7G 1R1BA 2R70A 3E89A 4X66B 3RWRD 3QF7A 4TUYA 1SQVH 1BCCH 4R50A 1AR5A 4RO2A 1WB8A 1K5SA 3ZMSA 2OCCB 1Q6IA 4NKGB 3OD4A 2ZCEA 1R6KA 3FYIB 2ZIOA 3EHBB 4OPHA 2PZSA 1NU1H 2A0LA 3B8MA 2BTQA 1NR1A 2KG7A 1XILA 2QGNA 3ZRWA 4E4EA 2WLMA 3P30A 4P9PA 3ABMC 3SYPA 2UUCO 2CGNA 4I9QA 3C90A 4LF7B 2X0LA 4AQYO 3JD0A 1BQZA 5CMUA 2P7TC 1JQ0A 1VQ6V 4TOIA 2B5UA 5JVDB 1B06A 2W6IG 2RQ6A 4JI4B 2LFRA 4Q6GA 4DV0O 1VQKV 2EX3A 2W6JG 2EIJB 2JGDA 2CTQA 1HNXO 1NT2B 1N36B 4OX9O 4K8ZA 1GN2A 2DQ0A 1I0HA 4PV1B 3OMNB 1DF4A 1PNMA 4ZI7B 3HKBB 1N4CA 4GT1A 4C7UA 3WG7C 5BZBA 4FZ1A 3WFVA 1S3JA 1BHAA 4U3FH 4F6RA 2LQTA 1OCZB 2X6AA 1IX9A 3RYIA 1SZXA 2A79B 4MVUA 4JZGA 1YF2A 3O65A 3Q4HB 3T4DA 3SDLA 5A9GA 5HFLA 1ZUQA 4JTAB 3SJCC 2PI5A 3S3XA 3JSLA 2B1IA 1RM1B 1MOFA 4I9WA 4X64O 2VWJA 2UUAB 4GKKO 1OCOB 4CS4A 5BY1A 4L8JA 1XNRO 1HR0O 1XEQA 1MG1A 2AXTZ 5EZYB 3AG7A 4ZHQB 4TV8A 3P3NA 4CS2A 1NVPD 4NXMO 3UQ8A 3ABKC 1WPXA 2OCHA 4NB5A 3ZHVA 1K4DC 1GTOA 5CA0A 2OIGA 1QR8A 4DV3O 3SGIA 4DR2B 3ASOC 1M57C 3BFRA 3D8CA 1VQMV 1S0VA 4G28B 3BCCH 1ZL8A 4PDMA 3G80A 5E79Z 3ETEA 2XAFA 1KQSU 1AP5A 1EM1A 3ASNB 1P84F 3ZEDA 4J7KA 2QA4V 2YIBA 4DV7O 1XREA 4B3TB 3A2FA 4MSWC 1OCCB 4DR3B 1URFA 4GZRB 4DR5O 5J2UB 2CE4A 2ZE7A 3TK1A 2PTMA 4O2BB 1D5AA 2XOKG 4J9YB 1SQFA 4O4IB 1G4YB 2E76B 2ZXWB 2O57A 3HKEB 2ODMA 1ZAUA 3E2EA 3ZHQA 3APQA 1Q5OA 3JASA 4TV8B 5LP6C 5IWAB 1HNWB 3DGEA 4ZOLB 4JI7O 2DYSC 1KKDA 5CA0B 2CGOA 2M7WA 4G27B
chains in the Genus database with same CATH topology
4BR6A 1VARA 1VEWA 3IC9A 3C3SA 1IX9A 1SZXA 1JR9A 3AK3A 1P7GA 1EN4A 4JZGA 1AVMA 1QNMA 2GDSA 5A9GA 1ZUQA 1GN6A 1AR5A 3KKYA 1WB8A 2AW9A 1BT8A 5AG2A 1XUQA 4X9QA 1N0JA 2QKCA 3OT7A 1EN6A 1WB7A 1MMMA 1PM9A 1GN3A 1I08A 4F6EA 1XILA 3DC6A 2QKAA 4E4EA 1AR4A 3MDSA 3CEIA 3DC5A 3KDRA 1MA1A 3BFRA 1GN4A 1XDCA 3RN4A 3AK2A 1IDSA 1ZTEA 1BS3A 3QVNA 3EVKA 3LSUA 1AP5A 1EM1A 1KKCA 4GUNA 1B06A 1PL4A 3K9SA 1EN5A 1XREA 1ZSPA 3C3TA 1Y67A 1AP6A 4YIPA 2CE4A 1JA8A 1LUVA 3AK1A 1MSDA 3TJTA 2CDYA 1LUWA 1MNGA 1GN2A 1D5NA 2ADQB 1I0HA 4FFKA 1IXBA 2P4KA 4YIOA 4JYYA 1BSMA 4C7UA 1N0NA 4JZ2A 2ADPA 1ZLZA 2RCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BR6 A;  1VAR A;  1VEW A;  3IC9 A;  3C3S A;  1IX9 A;  1SZX A;  1JR9 A;  3AK3 A;  1P7G A;  1EN4 A;  4JZG A;  1AVM A;  1QNM A;  2GDS A;  5A9G A;  1ZUQ A;  1GN6 A;  1AR5 A;  3KKY A;  1WB8 A;  2AW9 A;  1BT8 A;  5AG2 A;  1XUQ A;  4X9Q A;  1N0J A;  2QKC A;  3OT7 A;  1EN6 A;  1WB7 A;  1MMM A;  1PM9 A;  1GN3 A;  1I08 A;  4F6E A;  1XIL A;  3DC6 A;  2QKA A;  4E4E A;  1AR4 A;  3MDS A;  3CEI A;  3DC5 A;  1MA1 A;  3BFR A;  1GN4 A;  1XDC A;  3RN4 A;  3AK2 A;  1IDS A;  1ZTE A;  1BS3 A;  3QVN A;  3EVK A;  3LSU A;  1AP5 A;  1EM1 A;  1KKC A;  4GUN A;  1B06 A;  1PL4 A;  3K9S A;  1EN5 A;  1XRE A;  1ZSP A;  3C3T A;  1Y67 A;  1AP6 A;  4YIP A;  2CE4 A;  1JA8 A;  1LUV A;  3AK1 A;  1MSD A;  3TJT A;  2CDY A;  1LUW A;  1MNG A;  1GN2 A;  1D5N A;  2ADQ B;  1I0H A;  4FFK A;  1IXB A;  2P4K A;  4YIO A;  4JYY A;  1BSM A;  4C7U A;  1N0N A;  4JZ2 A;  2ADP A;  1ZLZ A;  2RCV A; 
#chains in the Genus database with same CATH topology
 2QSA A;  4FPP A;  1ZL8 B;  1K8A W;  1VQN V;  2ZKO A;  4BWA A;  4FLV A;  3OE7 G;  2UXC O;  1IBM O;  2A9H A;  1G1X B;  2DOS A;  5DN6 G;  2XTA A;  4DUZ B;  4LFB B;  3THO A;  2F95 B;  4DUY B;  4DK0 A;  5TIS Z;  1M56 C;  4YY3 O;  1XUQ A;  3A0B Z;  3JD3 A;  4X9Q A;  1COW G;  2YEV A;  3CC2 V;  4RQE A;  2WLL A;  3RYH A;  2XAQ A;  1K7D A;  1QLE C;  2JEU A;  1P4R A;  4TQD A;  5IYZ B;  2AHY A;  1IXM A;  1JNB A;  1YTF B;  4BIO A;  4CBC A;  1O9G A;  1KU9 A;  2EIM B;  4F6E A;  2F93 B;  1VP7 A;  1VQ5 V;  1J95 A;  4FMT A;  3KDR A;  5LHI A;  1GN4 A;  2YC0 A;  1QVF U;  3CME V;  1KD1 W;  1RP3 B;  4PI2 A;  1OHH G;  3LSU A;  4UV8 A;  4LBE C;  3ZCC A;  4B3M O;  3GWO A;  4QGP A;  4OGQ B;  5KA5 A;  3FAV B;  3CCR V;  1DGS A;  5IY5 C;  3UT5 A;  3QTC A;  1E1Q G;  4KP4 A;  4P2Z A;  2Q7E A;  5KMG A;  5B1A C;  5E1A C;  2UXB O;  1E1R G;  5IJ9 A;  5LMU O;  4DR6 B;  4O4L A;  1XMO B;  2EZO A;  2WPD G;  1QQC A;  4FLZ A;  1LUW A;  2F4V O;  5H2F Z;  5GON A;  1D5N A;  4LF4 O;  2RNB A;  5LBQ A;  3RYH B;  5KX5 A;  2PI4 A;  2P06 A;  5JCO A;  2R72 A;  1M90 W;  2ZE5 A;  4JI3 B;  1AJQ A;  3E8H A;  4GX5 A;  3ABM B;  1W0J G;  3W7X A;  3ZHS A;  3BA9 A;  3SYA A;  4H44 B;  2QM4 A;  1H2M A;  3OR6 C;  2P67 A;  3CJH B;  3R65 A;  3OUF A;  4NTX A;  2ARH A;  3UM7 A;  1J5E O;  3D3Q A;  3OFN G;  4JI1 B;  3UT5 B;  1Q3E A;  1CP9 A;  3CYO A;  2HVJ C;  4X65 O;  2R9R B;  2H3O A;  2Q9L A;  3FB5 C;  1N32 O;  4MW3 A;  4O4L B;  3CCL V;  3E22 A;  1Z5W A;  4IL6 Z;  1FXV A;  2F23 A;  1YIJ V;  1R3K C;  3M8A A;  2QJ1 A;  2DYR C;  4X1K B;  5KX5 B;  2QM8 A;  3ZRS A;  1F51 A;  4KFM A;  1I94 O;  3WG7 B;  4KUM A;  4EB6 B;  1MSW D;  2HR3 A;  2GTA A;  3CMA V;  3IGA C;  1MA1 A;  2KQX A;  3FYE B;  1EFR G;  2IH3 C;  1IJG A;  1SKV A;  4B3S O;  2BSK A;  4FFB A;  4P9O A;  1AI7 A;  1JJO A;  4LWS A;  4FVM A;  4X8A A;  5EIB D;  3W7U A;  1PL4 A;  1DLB A;  2KKW A;  4QIW F;  4X1I A;  1Y67 A;  4UCO A;  3WB0 A;  2E74 B;  3APO A;  4ASU G;  4KHP B;  4X20 A;  1I5X A;  2Q6A A;  4K0K B;  4DK1 A;  5H5N A;  4J7Z A;  3LSS A;  4RAI A;  4NXN O;  4WFH A;  3ABK B;  1IBL B;  1X59 A;  2Q67 A;  2UXD B;  1OJH A;  4CH3 A;  1GM8 A;  4JYC A;  4TV9 B;  3ASO B;  1M57 B;  1XHZ A;  2GBO A;  4LFC O;  1TVK A;  4LF5 B;  1Z5V A;  4DV6 B;  1BZK A;  2ZT9 B;  4JYA B;  2JDI G;  1QCE A;  4FFB B;  5GW7 A;  3HKD B;  1OCO C;  2XUM A;  2ZM6 B;  3OEE G;  4I0X A;  5FPO A;  4TSF G;  2VQF B;  1GN6 A;  3KCX A;  4J11 A;  1FXK C;  1SES A;  1BT8 A;  2HP8 A;  1FFX A;  4NVP A;  1NVP B;  2JJ2 G;  3CX5 F;  3ETG A;  5C8Y A;  5LP6 B;  3K3W A;  1BHB A;  1K4C C;  1EN6 A;  4A5U B;  1P49 A;  4UVC A;  2DYS B;  4YJ2 A;  3OR7 C;  3TET A;  1MMM A;  4GX2 A;  1VQP V;  1TUB B;  3HKC A;  3J81 N;  1ORQ C;  2JEX A;  3JD1 A;  3HR0 A;  4ZBM A;  5JH7 A;  3RYF B;  2UXX A;  3RN4 A;  4UXN A;  3K0G A;  1IDS A;  3DXR B;  1ZTE A;  5CBF A;  4YHH O;  4HNA A;  2LW7 A;  2OIE A;  4I0X B;  1F23 A;  1GAX A;  2ZDI A;  3EFF K;  1KP2 A;  1M56 B;  1SA0 A;  2Q0O C;  3C3T A;  5L3C A;  3T1H B;  4UVA A;  2YSU B;  5BR8 B;  4IIJ A;  1RFY A;  4IYH A;  4K35 A;  5C93 A;  2EUL A;  5C8Y B;  3MAQ A;  1F4M A;  2DJV A;  2JS3 A;  1QLE B;  1L1F A;  3VOU A;  2UUB O;  4I55 B;  3JAM N;  4PHZ A;  3UO3 A;  2YIA A;  1TGO A;  4JI0 B;  2E5L B;  5D5Q A;  4XDL A;  1S72 V;  4JI8 B;  1BQ0 A;  5JH7 B;  4GX0 A;  3AG2 C;  5LGU A;  4D7T A;  4BAY A;  1PKX A;  1VEW A;  1BGY H;  1IBK O;  2VWK A;  1OV9 A;  5LOV B;  4WFG A;  5IY5 B;  1US6 A;  5GTH Z;  4B7K A;  4LH7 A;  5CBG A;  4JAV A;  5B1A B;  4AHC A;  3D36 C;  2HFE C;  2GHY A;  2IBZ H;  4MW8 A;  3OTO O;  1PL0 A;  1K97 A;  3I5D A;  1CPY A;  4P30 A;  4PA7 A;  3TXS A;  2GTS A;  4H13 B;  1QHT A;  1FJG O;  1SQB H;  3T1Y O;  2QKC A;  5BMV B;  4JI5 B;  1GM7 A;  5H6R A;  5LA6 B;  1NR7 A;  5CB4 B;  1H2G A;  3H01 A;  5JVD A;  1PM9 A;  2PYL A;  4DV2 O;  1VQL V;  3L75 H;  1FOU A;  2XHB A;  4I50 B;  4OXS A;  2P22 C;  1Z2G A;  1FFT B;  4DR1 O;  2ZQM A;  5B66 Z;  1BL8 A;  4GYC B;  2PYJ A;  2QWN B;  4XBF A;  5F2V O;  1ENV A;  4BIU A;  3BA8 A;  5LGN A;  2QEX V;  2G38 A;  3FB8 C;  2XND G;  2IJK A;  3JAR A;  4ZI7 A;  3HKB A;  2HVK C;  5B1O A;  1H8H G;  3H1J H;  3W7W A;  1THZ A;  2DYR B;  3K5L A;  3TJT A;  2WLI B;  1SET A;  1HWY A;  5LMN O;  4DXW A;  2MW2 B;  3K5N A;  1MNG A;  5D5P A;  1WA8 B;  2FKX A;  3J80 N;  3B77 A;  1EZJ A;  1GO3 F;  1IXB A;  3F5W C;  3Q4H A;  3I56 V;  2KB1 A;  3WB2 A;  4RWU A;  4DO2 A;  3RVZ A;  4U3J B;  4JGS A;  3IC9 A;  3QG5 A;  3VQX A;  5L3G A;  5LYJ B;  1PV0 A;  3QO8 A;  4B3R O;  1N33 B;  5EZY A;  2WA4 A;  4UVB A;  4BW9 A;  4ZHQ A;  3BPZ A;  1LR1 A;  3JAR B;  5EC2 C;  1VF6 C;  5B1N A;  4CH6 A;  3J7A U;  1GK9 A;  4UCV A;  2AW9 A;  2IU3 A;  3CCE V;  4ZKI A;  2QE7 G;  4MVS A;  1VQ7 V;  1V9P A;  4FIP C;  2RJZ A;  4LP8 A;  1JPX A;  4J9Z B;  3K58 A;  2YXY A;  3H1H H;  1GRJ A;  2BTO A;  4DV4 O;  4NTW A;  3CXH F;  1XL4 A;  3CXC U;  3GWK C;  4NTY A;  3DC6 A;  2GUZ B;  3JSN A;  3LNN A;  4FM1 A;  3CEI A;  2RDC A;  1VIB A;  3K5O A;  5J2U A;  2UU9 B;  4O2B A;  2Y0I A;  5J9P C;  4O4I A;  4UB8 Z;  1XMQ B;  3HKE A;  1FXK B;  4ZOL A;  1F4N A;  4GKJ O;  3S3W A;  4PEL A;  3M99 B;  1DF5 A;  3MHS C;  1AP6 A;  4WBN B;  3L72 H;  4LF8 O;  4H37 A;  3LDC A;  3CRM A;  4DW1 A;  2QDO A;  3AK1 A;  3K0D A;  4DR7 O;  2ITC C;  2LJ2 A;  4DR4 B;  5JWP A;  3BAB A;  4OPA A;  4NR1 A;  1SQQ H;  2CUG A;  1JFF B;  2NLJ C;  3TXQ A;  3OGC C;  2A7W A;  3JYC A;  3ETQ A;  5JJE B;  1R3J C;  1I5Y A;  4BR6 A;  2Y48 A;  4LFA O;  1VF7 A;  2ATK C;  4JAA A;  1IZ3 A;  2VQE B;  3D36 A;  4JI2 O;  3NR7 A;  4FLU A;  1W2B U;  4HYO A;  3K5M A;  5IYZ A;  5H6Q A;  1XHX A;  4RQF A;  2AGA A;  4DYL A;  3DSQ A;  1XNQ B;  2JS5 A;  3T2M A;  4B08 A;  3ZHR A;  1KBH A;  2Y69 C;  4X66 O;  1SZT A;  2EIK C;  2FB5 A;  4NXN B;  3NXS A;  4LNU B;  3FAV A;  3K08 A;  4O4H B;  3SPC A;  3AG2 B;  1BMF G;  2N05 A;  4UB6 Z;  1G8M A;  1AR4 A;  2N74 A;  2EJ7 A;  5KHJ A;  2LGQ A;  1BS3 A;  2ZR2 A;  5JJJ B;  1QVG U;  5CA3 A;  1YJN V;  1H2L A;  4DV5 B;  5DED A;  3PN1 A;  1ARO P;  1JOY A;  1SQP H;  4Z1M G;  1Q81 W;  2ZR3 A;  4FLX A;  3JAT B;  4Q20 A;  2X6B A;  2CH7 A;  1F7Y A;  1YEW A;  4PDV A;  1N34 B;  1LUV A;  3ZMZ A;  2GV9 A;  1Y4M A;  2CDY A;  3K57 A;  3L70 H;  4LF7 O;  3CJH A;  3H1K H;  3RW0 A;  3JCU Z;  4JI4 O;  4X62 B;  1AIL A;  1KUQ A;  3ZHU A;  5LHG A;  2HHH B;  2D3O W;  4D6T H;  1TA8 A;  2CTP A;  1N36 O;  4X1Y B;  2BOB C;  2ZE8 A;  2DWD C;  3CE2 A;  1O9H A;  4UCR A;  4NYK A;  2WAM A;  4CC5 A;  4X1K A;  1S5J A;  5CA1 B;  4W4K A;  3F7V C;  1YHQ V;  2DQ3 A;  1GKF A;  2CH7 B;  4EB6 A;  2FYU H;  1NH2 D;  2Z5U A;  2YXL A;  3ZMU A;  1WN7 A;  4DV1 B;  4JAS A;  4UV9 A;  4JF3 A;  4X89 A;  3LDE A;  1YSC A;  3OAA G;  4JV5 B;  2VS0 A;  3FFQ A;  3N2G B;  2CTR A;  1WB7 A;  3JD4 A;  1OCR C;  4HBN A;  1HNZ B;  1K73 W;  4LF9 B;  1DTO A;  4JI6 O;  3OW2 U;  1WLE A;  1R6N A;  3GVM A;  2UUA O;  3U0Z A;  1R3L C;  3FB7 C;  3RGB A;  3PJS K;  1EZV H;  1YI2 V;  2F1M A;  2OTL V;  3N2K B;  3QVN A;  2QTS A;  1HW7 A;  1KKC A;  4MVM A;  2IW5 A;  2ZIM A;  4XDJ A;  4QNH B;  4CH5 A;  2QWO B;  5KHK A;  2WA3 A;  1ZSP A;  3CPW U;  4TV9 A;  1Q6H A;  1PD3 A;  3N27 A;  4R6Z A;  1YXB A;  5EYP B;  3DTU B;  2R9A A;  5K1X A;  2HJF C;  4U7O A;  3IAY A;  1FJG B;  2W0X A;  3ZMV A;  1CXZ B;  1WAZ A;  3HKD A;  1HDJ A;  4B3T O;  4DR3 O;  1SF9 A;  2JIZ G;  4DV2 B;  3T1C A;  3JAW B;  5KA6 A;  1NTM H;  4JTD B;  2LO1 A;  1WPB A;  3RVY A;  2XAS A;  4LR3 A;  3CHX A;  3GB7 C;  2ZNI A;  5KAF Z;  3CD6 V;  5LP6 A;  5IWA O;  4TQF A;  1HNW O;  2B9Z A;  2ZD9 A;  1T5E A;  3W7S A;  5FLX N;  2GDS A;  3WB1 A;  2NR5 A;  3L71 H;  4J80 A;  1TUB A;  2Q5Z A;  1VQ8 V;  5CN0 A;  1VQ4 V;  4JAU A;  3RYF A;  3ZMT A;  3ZS8 C;  1KMI Z;  4FLT A;  5A2Q N;  5IYB O;  5KAI Z;  2UUC B;  3DXR A;  5IE9 A;  4O2A A;  5EIB C;  3A0H Z;  1RSO A;  2Q4P A;  3ZBH A;  4DUZ O;  4AQY B;  3CRR A;  4LFB O;  1JCH A;  4KL1 A;  4DUY O;  3G67 A;  2LP7 A;  1FS0 G;  1NTK H;  3DC5 A;  3ETD A;  4DV0 B;  1XDC A;  1VQ9 V;  1B6Q A;  4EEQ A;  5ITZ B;  4LCU C;  1HNX B;  4XDK A;  4OX9 B;  4MT8 A;  5LHH A;  4O4J B;  4I55 A;  3UO2 A;  4FLY A;  1S5L Z;  4LF6 O;  3BEH A;  2EIL C;  3JAK B;  3TGU H;  2Y69 B;  4EFE A;  1GM9 A;  3OMA B;  4J10 A;  2EIK B;  3OMI B;  1FYJ A;  4O2A B;  2P4V A;  5LOV A;  3CRC A;  1H5W A;  1RSO B;  3CCQ V;  2HLD G;  4EFB A;  3CWB H;  1H38 A;  3EXA A;  2DN9 A;  3VQY A;  4ABM A;  4DR6 O;  3W7T A;  1HP8 A;  1XMO O;  2RCV A;  2YIB D;  4X64 B;  2RMK B;  3CS5 A;  3C3S A;  4GKK B;  3E8G A;  2YI8 A;  3OTF A;  4CZZ A;  1XNR B;  1HR0 B;  3SYO A;  1Q90 D;  5BMV A;  2XAJ A;  4JI3 O;  3O9O A;  5LA6 A;  1KB9 F;  4YJ3 B;  4K3A A;  5CB4 A;  4NXM B;  4GKJ B;  2E3C A;  4PI0 A;  5IYD O;  1Y74 B;  4DV3 B;  4I50 A;  1L8D A;  4ICG A;  1FPO A;  1AR1 B;  3ABU A;  4JI1 O;  5JQG B;  3G4S V;  3STL C;  5IJ0 B;  3MHH C;  2NNU A;  4R8C A;  4I4T B;  1OZ0 A;  2QM7 A;  1FD9 A;  4DV7 B;  4TWK A;  2Z0A A;  4IGG A;  4GX1 A;  4FM2 A;  4DR5 B;  1V54 C;  3MD0 A;  4HAM A;  2WWW A;  5DEC A;  3CCM V;  1R73 A;  2WLI A;  3LDD A;  5L3B A;  4FM0 A;  4PDR A;  3IJ4 A;  1WA8 A;  3QNE A;  1LNQ A;  4IHJ B;  1EN5 A;  4JI7 B;  2YIC A;  1SER A;  3OUS A;  2HKO A;  4YIP A;  1JA8 A;  1NBM G;  3K9A A;  3CRQ A;  4U3J A;  2GSM B;  2D2C B;  4AIL C;  3A8T A;  3M7M X;  1SC5 B;  4RUE A;  1OCR B;  2ADQ B;  3A0R A;  5LYJ A;  3X2Q C;  3L74 H;  2UXC B;  1IBM B;  1E79 G;  4YIO A;  3F7Y C;  1V55 C;  2JVD A;  3FB6 C;  1EBO A;  5FPR A;  5K1P A;  4LC1 A;  4KHP O;  1AJN A;  1YDX A;  1G6U A;  4K0K O;  1NZ6 A;  4UCT A;  3K04 A;  4YY3 B;  4MTO A;  2DWE C;  1IBL O;  3IFX A;  3ZHT A;  2UXD O;  5IYC O;  3E35 A;  2EIN C;  1NH2 B;  1B3Q A;  1EN4 A;  1QNM A;  2QWP B;  4MVZ A;  2WLN A;  2L35 A;  3KKY A;  4LF5 O;  4DV6 O;  2GUZ A;  4EKW A;  5AG2 A;  4JYA O;  3E86 A;  1S5H C;  4HZ3 A;  2EZP A;  1U97 A;  5B3S C;  2ZM6 O;  1KEC A;  5LL6 Y;  3SJQ C;  3CB2 A;  1AB3 A;  4B3M B;  3ZJZ A;  5B1B C;  4TUY B;  1PPJ H;  4MVQ A;  2VQF O;  2ZNJ A;  1P7B A;  2OYQ A;  1FXK A;  4UCU A;  1I08 A;  3BHP A;  2MK3 A;  2FML A;  1N8R W;  5DM6 V;  2UXB B;  1S77 D;  2K1E A;  2JJ1 G;  3JAL A;  3AG4 C;  2N04 A;  4WBN A;  5LMU B;  1FKA O;  1AI4 A;  3BY6 A;  4AI8 A;  2AZ2 A;  2F66 C;  1K9M W;  3OGI B;  1YCI A;  2XAH A;  4MTX A;  2F4V B;  1ZX3 A;  2WLH A;  4LF4 B;  3RYC A;  2BTQ B;  1Q43 A;  2KG7 B;  3K9S A;  4MVR A;  5JCO C;  3CSX A;  1I7F A;  3AG1 C;  3ZRW B;  1JFF A;  5IT9 N;  5IDJ A;  2M6Y A;  5L3E A;  4MVO A;  2CAZ C;  3VBB A;  1W0K G;  4PJ0 Z;  5EBL C;  4DW0 A;  2QTO A;  1KYO F;  1Q6U A;  1KC8 W;  1QR9 A;  1J5E B;  2BCC H;  3T1H O;  4MTF A;  1Q7Y W;  3WU2 Z;  4JZ2 A;  1VMG A;  4X65 B;  5BR8 O;  4JI6 B;  3UCS C;  3JAL B;  3ABL C;  3SYC A;  1UJW B;  3ZX6 A;  2OTJ V;  1BE3 H;  4N21 A;  2JGD B;  1N32 B;  3CCS V;  1NKD A;  1M5I A;  2YXH A;  3CCJ V;  4JI0 O;  3RYC B;  2E5L O;  4LNU A;  1U96 A;  4O4H A;  5JJN B;  4JI8 O;  2EIL B;  1YJ9 V;  1XBL A;  1I94 B;  1AJP A;  1AI5 A;  3B4S A;  1M9N A;  1M93 A;  3LSQ A;  1QBZ A;  4IYI A;  4PA3 A;  1KP3 A;  2V7Q G;  2Q7H A;  2EBO A;  4F6R B;  1N0J A;  3RYI B;  4B3S B;  4FJC C;  1XI1 A;  2IJI A;  3G71 V;  1WJZ A;  2EJR A;  1IUR A;  2PGG A;  1H2N A;  1PNL A;  3JAT A;  3R66 A;  3K59 A;  4WFF A;  1SRY A;  1Y76 A;  3AG3 C;  3SR2 C;  2NN4 A;  4J41 A;  1CEZ A;  1NQT A;  4JI5 O;  4J42 A;  1ROP A;  1DK1 A;  2DW4 A;  1XOU A;  4UFZ A;  3ABT A;  1MZF A;  1B04 A;  2Q0A A;  3L9D A;  4X88 A;  1TUE B;  2CK3 G;  2Q68 A;  4LFC B;  1VF5 B;  4H0L B;  1PNK A;  2P90 A;  4X1Y A;  3HPL C;  3U10 A;  5LXT A;  2QR4 A;  1L0N H;  5KUM A;  3CP1 A;  2LGW A;  4FFK A;  2QKS A;  5CA1 A;  1FXH A;  5H9C A;  3RT3 C;  1V54 B;  1H2S B;  1Y76 B;  2PUS A;  4PD4 F;  2ITD C;  1X4T A;  1VAR A;  5FNV A;  3ZN0 A;  5HFM A;  3KG2 A;  3LNM B;  2A06 H;  2P6J A;  2HEP A;  2E75 B;  3JAS B;  2IJJ A;  3N2G A;  2Z3Y A;  4I5S A;  4TT3 G;  4UCS A;  4ZIB A;  1ZWI C;  3H1I H;  2ZE6 A;  4CC6 A;  4PDL A;  4LF6 B;  1JMK C;  1WNS A;  3RBZ A;  1XQ8 A;  1RPO A;  2YID A;  3CCV V;  1YJW V;  1NTZ H;  3I55 V;  2V1D A;  1RPR A;  3X2Q B;  3HB3 B;  5LXT B;  3N2K A;  2QWQ B;  4YHH B;  1N33 O;  3OEH G;  1SQX H;  1V55 B;  2QWR B;  1VF6 A;  2ZIN A;  3CC4 V;  3FKS G;  5LGT A;  5KUK A;  2ZDI C;  5J2T A;  2LW1 A;  4Z2W A;  4WF9 V;  1H8E G;  5CBH A;  2KSD A;  5KHH A;  5EYP A;  5FNV B;  3SPH A;  2YEV B;  4W4L A;  2EIN B;  2IH1 C;  2Y0P A;  3BVO A;  2WLL B;  2YUA A;  3EVK A;  2UUB B;  2WSS G;  5KLV H;  2ETN A;  2A3Q A;  4QJF B;  4WFE A;  2UU9 O;  3B40 A;  1M4U A;  1JVM A;  2HJD A;  3JAW A;  5B3S B;  3SPG A;  1MSD A;  2OCC C;  1XMQ O;  1IBK B;  5B1B B;  1JJ2 U;  3G6E V;  1VQO V;  3VQV A;  5L3F A;  1QU7 A;  4N23 A;  5KMG B;  3JCZ A;  3QO7 A;  5IJ9 B;  1L0L H;  3AG4 B;  5J2T B;  4PA6 A;  4MTG A;  2XT9 A;  4DR2 O;  3OTO B;  2F43 G;  4FLW A;  4MS2 A;  1W59 A;  1WP7 A;  4RUF A;  5BXZ A;  1WP8 A;  1YIT V;  3D3I A;  5GON B;  4DR4 O;  4GLX A;  4PA9 A;  3T1Y B;  1GH6 A;  3SPI A;  3AK3 A;  1P7G A;  3AG1 B;  3H1L H;  3JD2 A;  4QPK A;  1AVM A;  2WLJ A;  2OWO A;  3E83 A;  3SJA C;  1Q82 W;  5KHI A;  1PP9 H;  5EK0 A;  4QE7 A;  1D2D A;  1R3I C;  1H2K A;  3B8N A;  2VQE O;  2EIJ C;  2BE3 A;  3CC7 V;  5ITZ A;  3OT7 A;  4DR1 B;  2YDE A;  4Z1V A;  3FD9 A;  1K3E A;  4O4J A;  3U11 A;  5GTI Z;  3E8F A;  2AHZ A;  1GN3 A;  1Q8I A;  3ABL B;  3ICX A;  4R7C A;  2QKA A;  1XNQ O;  3E22 B;  3JAK A;  4QE9 A;  4BIZ A;  4E2L A;  3K03 A;  3ZN1 A;  2Y4U A;  1R6T A;  2Q69 A;  2RN9 A;  2CTW A;  2C2A A;  3F5T A;  3OM3 B;  5LMN B;  3SYQ A;  1TAE A;  1IVS A;  3RFR A;  4BW5 A;  2P5O A;  4GUN A;  1OCZ C;  4QPJ A;  1MZE A;  2YI9 A;  4K8X A;  3L73 H;  1K5Q A;  2B1G A;  2IM9 A;  4I7Z B;  2Q8V A;  3STZ C;  1SQG A;  3T4Z A;  2W0F C;  5B5E Z;  4D7S A;  4L87 A;  1RM1 C;  2BSK B;  4JTC B;  4WFB V;  4LWS B;  2BOC C;  4DV5 O;  2H94 A;  3TCU A;  1XL6 A;  1NI8 A;  1JX9 A;  3SJB C;  2FTK A;  4B3R B;  3B2E E;  2P4K A;  4X1I B;  4JYY A;  4YJ3 A;  1BSM A;  2DE0 X;  3AG3 B;  2FL4 A;  2L6L A;  1N34 O;  2Y4T A;  1Y6X A;  2JGU A;  4X20 B;  2PF4 E;  2ADP A;  1ZLZ A;  1Y74 A;  2R9I A;  3IC7 A;  4F4L A;  3P3P A;  4CS3 A;  4FK5 C;  1GMG A;  2LFS A;  4YXW G;  1JR9 A;  3LUT B;  5JQG A;  4X62 O;  1AI6 A;  5EBW C;  5IJ0 A;  4DV4 B;  3BAA A;  2XAG A;  3ASN C;  5KHG A;  1S76 D;  4H33 A;  4I4T A;  2HHH O;  2AZ0 A;  1TVK B;  3H9V A;  1Q86 W;  2JK5 C;  3SPJ A;  1K92 A;  1OCC C;  4DRX A;  3VQW A;  2DMX A;  1UFI A;  1FAF A;  2VRZ A;  3B09 A;  2OT5 A;  2X6C A;  3FX7 A;  2ZXW C;  1YZB A;  4GCZ A;  4B7E A;  4IHJ A;  4CH4 A;  4WFA V;  2JRI A;  1YVW A;  3ML0 A;  3MDS A;  1FFX B;  4LH6 A;  3BRC A;  4DV1 O;  2HG5 C;  1M1K W;  4LF8 B;  3K06 A;  3AEI A;  3AK2 A;  4G2K A;  4U7N A;  1YTF D;  5EBM C;  4JV5 O;  4JYB A;  2Q7G A;  4FZ0 A;  4DR7 B;  2PY5 A;  4YJ2 B;  3CCU V;  4WCE V;  3HKC B;  3KZI Z;  1HNZ O;  1K33 A;  4LF9 O;  3ZIA G;  1UPG A;  3G6B A;  2WLK A;  3E8B A;  4DRX B;  2V4D A;  1MAB G;  3ZRX A;  2YS8 A;  4J7J A;  2X7R B;  3P32 A;  1K34 A;  3ZRV A;  4LFA B;  1NJI W;  3KCY A;  3K79 A;  3QO5 A;  4HNA B;  2Q73 A;  2IU0 A;  4JI2 B;  1SA0 B;  2K9P A;  4PA4 A;  5EC1 C;  2ILM A;  1N0N A;  4IT5 A;  2UXN A;  1SS3 A;  2H8P C;  4IIJ B;  2EIM C;  4JPR A;  1QLN A;  4KXR A;  4UUJ C;  2IJH A;  1Y66 A;  5L3D A;  1NS1 A;  1A32 A;  3UKM A;  3CRA A;  5FL7 G;  1R1B A;  2R70 A;  3E89 A;  4X66 B;  3RWR D;  3QF7 A;  4TUY A;  1SQV H;  1BCC H;  4R50 A;  1AR5 A;  4RO2 A;  1WB8 A;  1K5S A;  3ZMS A;  2OCC B;  1Q6I A;  4NKG B;  3OD4 A;  2ZCE A;  1R6K A;  3FYI B;  2ZIO A;  3EHB B;  4OPH A;  2PZS A;  1NU1 H;  2A0L A;  3B8M A;  2BTQ A;  1NR1 A;  2KG7 A;  1XIL A;  2QGN A;  3ZRW A;  4E4E A;  2WLM A;  3P30 A;  4P9P A;  3ABM C;  3SYP A;  2UUC O;  2CGN A;  4I9Q A;  3C90 A;  4LF7 B;  2X0L A;  4AQY O;  3JD0 A;  1BQZ A;  5CMU A;  2P7T C;  1JQ0 A;  1VQ6 V;  4TOI A;  2B5U A;  5JVD B;  1B06 A;  2W6I G;  2RQ6 A;  4JI4 B;  2LFR A;  4Q6G A;  4DV0 O;  1VQK V;  2EX3 A;  2W6J G;  2EIJ B;  2JGD A;  2CTQ A;  1HNX O;  1NT2 B;  1N36 B;  4OX9 O;  4K8Z A;  1GN2 A;  2DQ0 A;  1I0H A;  4PV1 B;  3OMN B;  1DF4 A;  1PNM A;  4ZI7 B;  3HKB B;  1N4C A;  4GT1 A;  4C7U A;  3WG7 C;  5BZB A;  4FZ1 A;  3WFV A;  1S3J A;  1BHA A;  4U3F H;  4F6R A;  2LQT A;  1OCZ B;  2X6A A;  1IX9 A;  3RYI A;  1SZX A;  2A79 B;  4MVU A;  4JZG A;  1YF2 A;  3O65 A;  3Q4H B;  3T4D A;  3SDL A;  5A9G A;  5HFL A;  1ZUQ A;  4JTA B;  3SJC C;  2PI5 A;  3S3X A;  3JSL A;  2B1I A;  1RM1 B;  1MOF A;  4I9W A;  4X64 O;  2VWJ A;  2UUA B;  4GKK O;  1OCO B;  4CS4 A;  5BY1 A;  4L8J A;  1XNR O;  1HR0 O;  1XEQ A;  1MG1 A;  2AXT Z;  5EZY B;  3AG7 A;  4ZHQ B;  4TV8 A;  3P3N A;  4CS2 A;  1NVP D;  4NXM O;  3UQ8 A;  3ABK C;  1WPX A;  2OCH A;  4NB5 A;  3ZHV A;  1K4D C;  1GTO A;  5CA0 A;  2OIG A;  1QR8 A;  4DV3 O;  3SGI A;  4DR2 B;  3ASO C;  1M57 C;  3BFR A;  3D8C A;  1VQM V;  1S0V A;  4G28 B;  3BCC H;  1ZL8 A;  4PDM A;  3G80 A;  5E79 Z;  3ETE A;  2XAF A;  1KQS U;  1AP5 A;  1EM1 A;  3ASN B;  1P84 F;  3ZED A;  4J7K A;  2QA4 V;  2YIB A;  4DV7 O;  1XRE A;  4B3T B;  3A2F A;  4MSW C;  1OCC B;  4DR3 B;  1URF A;  4GZR B;  4DR5 O;  5J2U B;  2CE4 A;  2ZE7 A;  3TK1 A;  2PTM A;  4O2B B;  1D5A A;  2XOK G;  4J9Y B;  1SQF A;  4O4I B;  1G4Y B;  2E76 B;  2ZXW B;  2O57 A;  3HKE B;  2ODM A;  1ZAU A;  3E2E A;  3ZHQ A;  3APQ A;  1Q5O A;  3JAS A;  4TV8 B;  5LP6 C;  5IWA B;  1HNW B;  3DGE A;  4ZOL B;  4JI7 O;  2DYS C;  1KKD A;  5CA0 B;  2CGO A;  2M7W A;  4G27 B; 
#chains in the Genus database with same CATH homology
 4BR6 A;  1VAR A;  1VEW A;  3IC9 A;  3C3S A;  1IX9 A;  1SZX A;  1JR9 A;  3AK3 A;  1P7G A;  1EN4 A;  4JZG A;  1AVM A;  1QNM A;  2GDS A;  5A9G A;  1ZUQ A;  1GN6 A;  1AR5 A;  3KKY A;  1WB8 A;  2AW9 A;  1BT8 A;  5AG2 A;  1XUQ A;  4X9Q A;  1N0J A;  2QKC A;  3OT7 A;  1EN6 A;  1WB7 A;  1MMM A;  1PM9 A;  1GN3 A;  1I08 A;  4F6E A;  1XIL A;  3DC6 A;  2QKA A;  4E4E A;  1AR4 A;  3MDS A;  3CEI A;  3DC5 A;  3KDR A;  1MA1 A;  3BFR A;  1GN4 A;  1XDC A;  3RN4 A;  3AK2 A;  1IDS A;  1ZTE A;  1BS3 A;  3QVN A;  3EVK A;  3LSU A;  1AP5 A;  1EM1 A;  1KKC A;  4GUN A;  1B06 A;  1PL4 A;  3K9S A;  1EN5 A;  1XRE A;  1ZSP A;  3C3T A;  1Y67 A;  1AP6 A;  4YIP A;  2CE4 A;  1JA8 A;  1LUV A;  3AK1 A;  1MSD A;  3TJT A;  2CDY A;  1LUW A;  1MNG A;  1GN2 A;  1D5N A;  2ADQ B;  1I0H A;  4FFK A;  1IXB A;  2P4K A;  4YIO A;  4JYY A;  1BSM A;  4C7U A;  1N0N A;  4JZ2 A;  2ADP A;  1ZLZ A;  2RCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...