5AGDA

An inactive (d125n) variant of the catalytic domain, bcgh76, of bacillus circulans aman6 in complex with alpha-1,6-mannopentaose
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
337
structure length
333
Chain Sequence
SDGDTAMKAFNDTFWDPNAKMFWKDSKREKHQDFWVEAELWELVMDAYQHTSDPALKAELKTQIDDVYDGTVAKYGQDWTNNPFNDNIMWWAMGSARAYQITGNPRYLEAARDHFDFVYDTQWDEEFANGGIWWLNSDHNTKNACINFPAAQAALYLYDITKDEHYLNAATKIFRWGKTMLTDGNGKVFDRIEIEHGAVPDATHYNQGTYIGSAVGLYKATGNAVYLDDAVKAAKFTKNHLVDSNGVLNYEGPNGDLKGGKTILMRNLAHLQKTLDETGQYPEFSAEFDEWLAFNIEMAWSHQNSDHIVDGNWAGGTYESWSSAAAVQALNGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-1,6-MANNANASE
publication title Evidence for a Boat Conformation at the Transition State of Gh76 Alpha-1,6-Mannanases- Key Enzymes in Bacterial and Fungal Mannoprotein Metabolism
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Hydrolase
total genus 141
structure length 333
sequence length 337
chains with identical sequence B
ec nomenclature ec 3.2.1.101: Mannan endo-1,6-alpha-mannosidase.
pdb deposition date 2015-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 5agdA00
3HXDB 4MBGB 2BB6A 1JCRB 1NI1B 2H6GB 3K7XA 2WY8A 2SQCA 3E33B 3PZ3B 3EUVB 1O5MB 1O79A 2V3NA 2WIIB 1KZOB 1O6RA 4EHMB 1R76A 4ZH1A 4D4BA 5JPMB 4YDOB 2V3PA 4GTMB 4MU9A 3KQ4A 4L9PB 1SA5B 1H35A 2R2LB 4V1RA 3CU7A 1N4RB 5FO9B 2PMVA 1TNYB 1QQFA 4GTQB 3SQCA 2PN5A 3E34B 3E32B 4M76A 3D5SA 1SQCA 1N4PB 3G6JB 3Q73B 5FOBB 3DSUB 3OXUA 4FXKB 1N9AB 1D8EB 3DSSB 2XQWA 1GXOA 1TNBB 2B39A 3Q7FB 1D8DB 1DCEB 1N4SB 4GTOB 4GTSB 3DSWB 1QSJA 2BEDB 3DSVB 4D94A 1H36A 4BOJA 1H3BA 1QBQB 1GXMA 2ZIRB 3D5RA 1S64B 3KSQB 3HXCB 3PZ2B 3Q75B 2WY7A 1O6QA 3HXEB 4BOKA 4ONTA 1KZPB 4KKJA 1X81B 2F0YB 1N94B 2GOXA 1NL4B 2V8IA 3C72B 1TNZB 1TN7B 1SA4B 3Q78B 1FT1B 1LTXB 3Q7AB 4LNGB 1MZCB 4GTTB 4D4DA 1TN8B 1TNOB 2BB5A 5JPNB 4GTRB 3Q79B 1FT2B 2V8JA 3E30B 2WINB 4LNVA 1C3DA 1O6HA 4YDEB 4V1SA 1W6JA 3PZ1B 4KKIA 1GXNA 3DSXB 2G02A 2H6HB 1JCQB 1JCSB 3KSLB 1LD8B 4LNBB 1FPPB 3HXBB 2A73B 5FO8B 3PZ4B 2H6IB 3OEDA 2NOJA 4C1SA 1H39A 1TN6B 1H3AA 3E37B 3SFXB 1O1TB 1N4QB 3HXFB 5FO7B 1N95B 4D4CA 1LD7B 4ZRPA 4FXGB 1O1SB 1S63B 2BBCA 3DRAB 1H37A 3RJ3A 1GSZA 4D4AA 3EU5B 2XWJB 5AGDA 2ZISB 2H6FB 3KLSA 1GHQA 2I07B 1TNUB 2IEJB 1H3CA 1W6KA 3SFYB 2XWBB 2V8KA 3DSTB 1O1RB 4GTPB 1HZFA 2G0DA 4ZRQA 4GTVB 3DPYB 1UMPA
chains in the Genus database with same CATH superfamily
3HXDB 2FV1A 1NI1B 3T33A 4AYPA 2SQCA 3E7JA 5DGRA 4DODA 3EUVB 2ZBLA 2JJBA 1O5MB 1KKTA 1F9DA 1N7OA 1HX9A 1K72A 1O6RA 3S4DA 5JPMB 4YDOB 4L9PB 1KRFA 4V1RA 3G4FA 2FUZA 1TNYB 4WVCA 3RRSA 1X1JA 4J5TA 1V5CA 3M74A 3SQCA 3M7LA 4M76A 2GZ6A 1RWGA 3QXQA 3E6UA 3W5NA 1DOGA 1N1ZA 3Q73B 2Z07A 5IL3A 3EU8A 3W7XA 3DSSB 2XQWA 1FBWA 3M73A 4L0GA 4KTPA 4AYOA 2B39A 4GAXA 1D8DB 1TF4A 1H14A 5IK9A 1DCEB 1N4SB 4GTOB 3DSWB 2RI8A 1FAEA 1L2AA 3QWTA 2Q1FA 5KKBA 3WIQA 2JG0A 3M01A 5ILYA 1NXCA 1HV6A 1KREA 3QDEA 5ILZA 3RENA 4OK4A 3HXEB 3X17A 1V7VA 4ONTA 4BOKA 5CA3A 2GOXA 1WU5A 3CIHA 1TNZB 3M78A 1LTXB 1KSCA 3SDVA 1CEMA 3WC3A 3Q79B 5JMDA 2P0VA 4TF4A 1HM2A 1V5DA 2FUTA 3M02A 3WKIA 1IS9A 4KKIA 3LZ9A 2G02A 1JCSB 4FJQA 1LD8B 2WDAA 1FPPB 3HXBB 4OZWA 1C82A 3PZ4B 1FP3A 4Z4LA 1RWFA 1FBOA 3HXFB 3QPFA 1N95B 1LD7B 3P2CA 1FO3A 3P5RA 3A0OA 1O1SB 2BBCA 1H37A 1V7XA 2XWJB 2AHGA 2I07B 1TNUB 1G6IA 2XWBB 1O1RB 4GTPB 1HZFA 2ZZRA 4MMIA 4ZRQA 4GTVB 3DPYB 3QRYA 2EACA 5CD2A 3RSYA 4WVAA 1R76A 4D4BA 1OJPA 3VSNA 2DROA 2F6DA 1H35A 1N4RB 2PMVA 3RX5A 1X9DA 4GTQB 2PN5A 1H13A 4EL8A 4JJJA 2EABA 5IL8A 1N4PB 3N0FA 4ZH5A 2BRVX 1HMWA 1LF9A 1N7RA 2VN4A 4GTSB 4Q2BA 1QSJA 4YCRA 2BEDB 3GT5A 3M75A 1LXMA 3ACSA 4BOJA 1H3BA 2ZIRB 3D5RA 3HXCB 5DGQA 2BRPA 1F9OA 3QT9A 3SDTA 3Q75B 5IKAA 1O6QA 1X81B 3WIWA 1VD5A 3NFVA 2WYNA 3E73A 1TN7B 1KWFA 2E22A 4AYQA 4GTTB 2BRWA 4D4DA 1TN8B 2BB5A 5JPNB 3NNBA 3E30B 2WINB 4FNVA 1WU4A 3GZKA 1GAIA 5IKHA 1XWQA 3SDUA 1GXNA 3ON6A 3EZ8A 4MMHA 2H6HB 1JCQB 3M71A 4DOEA 2OKXA 5FO8B 3EQAA 3SFXB 3E37B 1AGMA 4FUSA 4ZRPA 1N22A 5E2JA 4CE7A 2J5CA 5M7IA 1H12A 1GSZA 3M7EA 3M00A 1OJNA 1FMIA 2ZISB 3W7UA 1N7PA 2IEJB 1RQ5A 3QFYA 3DSTB 4WVBA 4MBGB 2H6GB 1X1HA 2WY8A 1WU6A 3E33B 3AFJA 3PZ3B 3M76A 2V3NA 1RWCA 1KZOB 4ZH1A 2FBAA 1IA6A 3VW5A 3P5PA 5M7YA 1L1YA 3AFLA 1SA5B 2R2LB 2VN7A 3CU7A 5FO9B 3ACTA 3M7BA 2AHFA 3ANJA 1G9GA 4CJ0A 5IK6A 1W3YA 3RX7A 3E34B 4E1YA 3E32B 3SAEA 1KS8A 1DL2A 3A3VA 1UG9A 3DSUB 3QFZA 3OXUA 1G87A 1NC5A 1D8EB 1TNBB 3Q7FB 3ANKA 2ONGA 3WIRA 5IK0A 5GW7A 1XW2A 1KFGA 2ONHA 4D94A 2FUQA 1GXMA 3KSQB 3N0GA 1UT9A 5GY3A 3PZ2B 2AFAA 4Z4JA 5JMFA 1KZPB 5ILDA 3RX8A 2F0YB 3VSMA 1JS4A 1N94B 1NL4B 5GZKA 5MEHA 2V8IA 1N21A 3C72B 1J0NA 1SA4B 3Q78B 4LNGB 3Q7AB 1MZCB 1FO2A 4OJZA 1N7NA 3S9VA 1FT2B 2WCOA 3QT3A 2NVPA 1HXCA 1C3DA 3S4BA 5EASA 5EAUA 2YIKA 1N20A 2RI9A 1GAHA 1GA2A 1GLMA 1ULVA 3DSXB 3H7LA 5ILKA 4ZG8A 2DRSA 4L6XA 5EATA 5DHKA 2A73B 3WKHA 2H6IB 3OEDA 3WUXA 1LF6A 1G9JA 2NOJA 4F13A 1O1TB 3G4DA 5ILJA 1N4QB 3PMMA 4GL3A 4LIXA 2DRRA 3RJ3A 4Q88A 4D4AA 1FCEA 4QT9A 4XUVA 3EU5B 5AGDA 2H6FB 3KLSA 3W7WA 3QG0A 1W6KA 3SFYB 1V7WA 3S4CA 1F1SA 1UMPA 1OJMA 2BB6A 1JCRB 3K7XA 3QSPA 4AYRA 1OJOA 1O79A 1RW9A 3W7SA 2GH4A 2WIIB 4EHMB 3SDQA 1EGUA 2CQTA 2V3PA 3PYBA 4GTMB 4MU9A 4CJ1A 3KQ4A 5IM1A 3VXDA 3SDRA 1HXAA 4RNQA 1QQFA 1F9GA 1N7QA 2D5JA 3W5MA 1RWAA 1QAZA 3D5SA 1SQCA 1RWHA 2FV0A 3G6JB 1KSDA 5DHIA 5FOBB 3GLYA 1N1BA 4FXKB 1N9AB 2CQSA 1GXOA 4OK2A 3H2WA 2DRQA 2JF4A 1CLCA 3WKGA 3TF4A 3DSVB 1IA7A 5CZLA 3H3KA 2X03A 1H36A 1QBQB 1S64B 3WKFA 3S4AA 2D8LA 4TXTA 2RGKA 1HMUA 2WY7A 1HXGA 4KKJA 4NEIA 1H54A 4F10A 2EAEA 2QNOA 1FT1B 4OZVA 5C05A 1LOHA 3M72A 1AYXA 1HCUA 1TNOB 1X1IA 4GTRB 3QXFA 5ILIA 2V8JA 3K11A 4LNVA 1O6HA 2E24A 3ANIA 2XFGA 1LXKA 4YDEB 4V1SA 1W6JA 5ILHA 2EADA 4KTRA 3PZ1B 1HN0A 3D3IA 4WU0A 3KSLB 4LNBB 4DI5A 3W7TA 1CB8A 1WZZA 3PYAA 1XWTA 3M77A 4C1SA 1H39A 1TN6B 1H3AA 1I8QA 1N23A 5FO7B 4D4CA 4FXGB 1J0MA 1S63B 3DRAB 2B4FA 3M7CA 1GHQA 1N24A 3E80A 1H3CA 2V8KA 2A8ZA 1HM3A 2G0DA
chains in the Genus database with same CATH topology
3HXDB 2FV1A 1NI1B 3T33A 4AYPA 2SQCA 5DGRA 4DODA 3EUVB 2ZBLA 2JJBA 1O5MB 1KKTA 1F9DA 1K72A 1O6RA 3S4DA 5JPMB 4YDOB 4L9PB 1KRFA 4V1RA 2FUZA 1TNYB 4WVCA 3RRSA 4J5TA 1V5CA 3M74A 3SQCA 3M7LA 4M76A 2GZ6A 3QXQA 3E6UA 3W5NA 1DOGA 3Q73B 2Z07A 3EU8A 3W7XA 3DSSB 2XQWA 1FBWA 3M73A 4L0GA 4KTPA 4AYOA 2B39A 1D8DB 1TF4A 1H14A 1DCEB 1N4SB 4GTOB 3DSWB 2RI8A 1FAEA 1L2AA 3QWTA 5KKBA 3WIQA 2JG0A 1NXCA 1KREA 3QDEA 3RENA 3HXEB 3X17A 1V7VA 4ONTA 4BOKA 5CA3A 2GOXA 1WU5A 1TNZB 3CIHA 3M78A 1LTXB 1KSCA 3SDVA 1CEMA 3WC3A 3Q79B 2P0VA 4TF4A 1V5DA 3WKIA 1IS9A 4KKIA 2G02A 1JCSB 1LD8B 1FPPB 3HXBB 3PZ4B 1FP3A 4Z4LA 1FBOA 3HXFB 3QPFA 1N95B 1LD7B 3P2CA 1FO3A 3P5RA 1O1SB 2BBCA 1H37A 1V7XA 2XWJB 2AHGA 2I07B 1TNUB 1G6IA 2XWBB 1O1RB 4GTPB 1HZFA 2ZZRA 4ZRQA 4GTVB 3DPYB 3QRYA 2EACA 5CD2A 3RSYA 4WVAA 1R76A 4D4BA 2DROA 2F6DA 1H35A 1N4RB 2PMVA 3RX5A 1X9DA 4GTQB 2PN5A 1H13A 4EL8A 4JJJA 2EABA 1N4PB 4ZH5A 1LF9A 2VN4A 4GTSB 4Q2BA 1QSJA 4YCRA 2BEDB 3GT5A 3M75A 3ACSA 4BOJA 1H3BA 2ZIRB 3D5RA 3HXCB 5DGQA 1F9OA 3QT9A 3SDTA 3Q75B 1O6QA 1X81B 3WIWA 1VD5A 2WYNA 3E73A 1TN7B 1KWFA 4AYQA 4GTTB 4D4DA 1TN8B 2BB5A 5JPNB 3E30B 2WINB 1WU4A 3GZKA 1GAIA 1XWQA 3SDUA 1GXNA 3ON6A 3EZ8A 2H6HB 1JCQB 3M71A 4DOEA 2OKXA 5FO8B 3EQAA 3SFXB 3E37B 1AGMA 4FUSA 4ZRPA 5E2JA 4CE7A 5M7IA 1H12A 1GSZA 3M7EA 1FMIA 2ZISB 3W7UA 2IEJB 1RQ5A 3QFYA 3DSTB 4WVBA 4MBGB 2H6GB 2WY8A 1WU6A 3E33B 3AFJA 3PZ3B 3M76A 2V3NA 1KZOB 4ZH1A 2FBAA 1IA6A 3VW5A 3P5PA 5M7YA 1L1YA 1SA5B 2R2LB 2VN7A 3CU7A 5FO9B 3ACTA 3M7BA 2AHFA 3ANJA 1G9GA 4CJ0A 3RX7A 3E34B 3SAEA 3E32B 1KS8A 1DL2A 3A3VA 1UG9A 3DSUB 3QFZA 3OXUA 1G87A 1NC5A 1D8EB 1TNBB 3Q7FB 3ANKA 3WIRA 5GW7A 1XW2A 1KFGA 4D94A 1GXMA 3KSQB 1UT9A 5GY3A 3PZ2B 2AFAA 4Z4JA 1KZPB 3RX8A 2F0YB 1JS4A 1N94B 1NL4B 5GZKA 5MEHA 2V8IA 3C72B 1SA4B 3Q78B 4LNGB 3Q7AB 1MZCB 1FO2A 3S9VA 1FT2B 3QT3A 2NVPA 1C3DA 3S4BA 2YIKA 2RI9A 1GAHA 1GA2A 1GLMA 1ULVA 3DSXB 3H7LA 4ZG8A 2DRSA 4L6XA 2A73B 3WKHA 2H6IB 3OEDA 3WUXA 1LF6A 1G9JA 2NOJA 1O1TB 1N4QB 3PMMA 4GL3A 4LIXA 2DRRA 3RJ3A 4Q88A 4D4AA 1FCEA 4QT9A 4XUVA 3EU5B 5AGDA 2H6FB 3KLSA 3W7WA 3QG0A 1W6KA 3SFYB 1V7WA 3S4CA 1UMPA 2BB6A 1JCRB 3K7XA 3QSPA 4AYRA 1O79A 3W7SA 2GH4A 2WIIB 4EHMB 3SDQA 2CQTA 2V3PA 3PYBA 4GTMB 4MU9A 4CJ1A 3KQ4A 3VXDA 3SDRA 1QQFA 2D5JA 3W5MA 3D5SA 1SQCA 2FV0A 3G6JB 1KSDA 5FOBB 3GLYA 4FXKB 1N9AB 2CQSA 1GXOA 3H2WA 2DRQA 2JF4A 1CLCA 3WKGA 3TF4A 3DSVB 1IA7A 5CZLA 3H3KA 1H36A 1QBQB 1S64B 3WKFA 3S4AA 2D8LA 4TXTA 2RGKA 2WY7A 4KKJA 1H54A 2EAEA 2QNOA 1FT1B 3M72A 1AYXA 1HCUA 1TNOB 4GTRB 3QXFA 2V8JA 3K11A 4LNVA 1O6HA 3ANIA 2XFGA 4YDEB 4V1SA 1W6JA 2EADA 4KTRA 3PZ1B 3D3IA 4WU0A 3KSLB 4LNBB 3W7TA 1WZZA 3PYAA 1XWTA 3M77A 4C1SA 1H39A 1TN6B 1H3AA 5FO7B 4D4CA 4FXGB 1S63B 3DRAB 2B4FA 3M7CA 1GHQA 1H3CA 2V8KA 2A8ZA 2G0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HXD B;  4MBG B;  2BB6 A;  1JCR B;  1NI1 B;  2H6G B;  3K7X A;  2WY8 A;  2SQC A;  3E33 B;  3PZ3 B;  3EUV B;  1O5M B;  1O79 A;  2V3N A;  2WII B;  1KZO B;  1O6R A;  4EHM B;  1R76 A;  4ZH1 A;  4D4B A;  5JPM B;  4YDO B;  2V3P A;  4GTM B;  4MU9 A;  3KQ4 A;  4L9P B;  1SA5 B;  1H35 A;  2R2L B;  4V1R A;  3CU7 A;  1N4R B;  5FO9 B;  2PMV A;  1TNY B;  1QQF A;  4GTQ B;  3SQC A;  2PN5 A;  3E34 B;  3E32 B;  4M76 A;  3D5S A;  1SQC A;  1N4P B;  3G6J B;  3Q73 B;  5FOB B;  3DSU B;  3OXU A;  4FXK B;  1N9A B;  1D8E B;  3DSS B;  2XQW A;  1GXO A;  1TNB B;  2B39 A;  3Q7F B;  1D8D B;  1DCE B;  1N4S B;  4GTO B;  4GTS B;  3DSW B;  1QSJ A;  2BED B;  3DSV B;  4D94 A;  1H36 A;  4BOJ A;  1H3B A;  1QBQ B;  1GXM A;  2ZIR B;  3D5R A;  1S64 B;  3KSQ B;  3HXC B;  3PZ2 B;  3Q75 B;  2WY7 A;  1O6Q A;  3HXE B;  4BOK A;  4ONT A;  1KZP B;  4KKJ A;  1X81 B;  2F0Y B;  1N94 B;  2GOX A;  1NL4 B;  2V8I A;  3C72 B;  1TNZ B;  1TN7 B;  1SA4 B;  3Q78 B;  1FT1 B;  1LTX B;  3Q7A B;  4LNG B;  1MZC B;  4GTT B;  4D4D A;  1TN8 B;  1TNO B;  2BB5 A;  5JPN B;  4GTR B;  3Q79 B;  1FT2 B;  2V8J A;  3E30 B;  2WIN B;  4LNV A;  1C3D A;  1O6H A;  4YDE B;  4V1S A;  1W6J A;  3PZ1 B;  4KKI A;  1GXN A;  3DSX B;  2G02 A;  2H6H B;  1JCQ B;  1JCS B;  3KSL B;  1LD8 B;  4LNB B;  1FPP B;  3HXB B;  2A73 B;  5FO8 B;  3PZ4 B;  2H6I B;  3OED A;  2NOJ A;  4C1S A;  1H39 A;  1TN6 B;  1H3A A;  3E37 B;  3SFX B;  1O1T B;  1N4Q B;  3HXF B;  5FO7 B;  1N95 B;  4D4C A;  1LD7 B;  4ZRP A;  4FXG B;  1O1S B;  1S63 B;  2BBC A;  3DRA B;  1H37 A;  3RJ3 A;  1GSZ A;  4D4A A;  3EU5 B;  2XWJ B;  5AGD A;  2ZIS B;  2H6F B;  3KLS A;  1GHQ A;  2I07 B;  1TNU B;  2IEJ B;  1H3C A;  1W6K A;  3SFY B;  2XWB B;  2V8K A;  3DST B;  1O1R B;  4GTP B;  1HZF A;  2G0D A;  4ZRQ A;  4GTV B;  3DPY B;  1UMP A; 
#chains in the Genus database with same CATH topology
 3HXD B;  2FV1 A;  1NI1 B;  3T33 A;  4AYP A;  2SQC A;  3E7J A;  5DGR A;  4DOD A;  3EUV B;  2ZBL A;  2JJB A;  1O5M B;  1KKT A;  1F9D A;  1N7O A;  1HX9 A;  1K72 A;  1O6R A;  3S4D A;  5JPM B;  4YDO B;  4L9P B;  1KRF A;  4V1R A;  3G4F A;  2FUZ A;  1TNY B;  4WVC A;  3RRS A;  1X1J A;  4J5T A;  1V5C A;  3M74 A;  3SQC A;  3M7L A;  4M76 A;  2GZ6 A;  1RWG A;  3QXQ A;  3E6U A;  3W5N A;  1DOG A;  1N1Z A;  3Q73 B;  2Z07 A;  5IL3 A;  3EU8 A;  3W7X A;  3DSS B;  2XQW A;  1FBW A;  3M73 A;  4L0G A;  4KTP A;  4AYO A;  2B39 A;  4GAX A;  1D8D B;  1TF4 A;  1H14 A;  5IK9 A;  1DCE B;  1N4S B;  4GTO B;  3DSW B;  2RI8 A;  1FAE A;  1L2A A;  3QWT A;  2Q1F A;  5KKB A;  3WIQ A;  2JG0 A;  3M01 A;  5ILY A;  1NXC A;  1HV6 A;  1KRE A;  3QDE A;  5ILZ A;  3REN A;  4OK4 A;  3HXE B;  3X17 A;  1V7V A;  4ONT A;  4BOK A;  5CA3 A;  2GOX A;  1WU5 A;  3CIH A;  1TNZ B;  3M78 A;  1LTX B;  1KSC A;  3SDV A;  1CEM A;  3WC3 A;  3Q79 B;  5JMD A;  2P0V A;  4TF4 A;  1HM2 A;  1V5D A;  2FUT A;  3M02 A;  3WKI A;  1IS9 A;  4KKI A;  3LZ9 A;  2G02 A;  1JCS B;  4FJQ A;  1LD8 B;  2WDA A;  1FPP B;  3HXB B;  4OZW A;  1C82 A;  3PZ4 B;  1FP3 A;  4Z4L A;  1RWF A;  1FBO A;  3HXF B;  3QPF A;  1N95 B;  1LD7 B;  3P2C A;  1FO3 A;  3P5R A;  3A0O A;  1O1S B;  2BBC A;  1H37 A;  1V7X A;  2XWJ B;  2AHG A;  2I07 B;  1TNU B;  1G6I A;  2XWB B;  1O1R B;  4GTP B;  1HZF A;  2ZZR A;  4MMI A;  4ZRQ A;  4GTV B;  3DPY B;  3QRY A;  2EAC A;  5CD2 A;  3RSY A;  4WVA A;  1R76 A;  4D4B A;  1OJP A;  3VSN A;  2DRO A;  2F6D A;  1H35 A;  1N4R B;  2PMV A;  3RX5 A;  1X9D A;  4GTQ B;  2PN5 A;  1H13 A;  4EL8 A;  4JJJ A;  2EAB A;  5IL8 A;  1N4P B;  3N0F A;  4ZH5 A;  2BRV X;  1HMW A;  1LF9 A;  1N7R A;  2VN4 A;  4GTS B;  4Q2B A;  1QSJ A;  4YCR A;  2BED B;  3GT5 A;  3M75 A;  1LXM A;  3ACS A;  4BOJ A;  1H3B A;  2ZIR B;  3D5R A;  3HXC B;  5DGQ A;  2BRP A;  1F9O A;  3QT9 A;  3SDT A;  3Q75 B;  5IKA A;  1O6Q A;  1X81 B;  3WIW A;  1VD5 A;  3NFV A;  2WYN A;  3E73 A;  1TN7 B;  1KWF A;  2E22 A;  4AYQ A;  4GTT B;  2BRW A;  4D4D A;  1TN8 B;  2BB5 A;  5JPN B;  3NNB A;  3E30 B;  2WIN B;  4FNV A;  1WU4 A;  3GZK A;  1GAI A;  5IKH A;  1XWQ A;  3SDU A;  1GXN A;  3ON6 A;  3EZ8 A;  4MMH A;  2H6H B;  1JCQ B;  3M71 A;  4DOE A;  2OKX A;  5FO8 B;  3EQA A;  3SFX B;  3E37 B;  1AGM A;  4FUS A;  4ZRP A;  1N22 A;  5E2J A;  4CE7 A;  2J5C A;  5M7I A;  1H12 A;  1GSZ A;  3M7E A;  3M00 A;  1OJN A;  1FMI A;  2ZIS B;  3W7U A;  1N7P A;  2IEJ B;  1RQ5 A;  3QFY A;  3DST B;  4WVB A;  4MBG B;  2H6G B;  1X1H A;  2WY8 A;  1WU6 A;  3E33 B;  3AFJ A;  3PZ3 B;  3M76 A;  2V3N A;  1RWC A;  1KZO B;  4ZH1 A;  2FBA A;  1IA6 A;  3VW5 A;  3P5P A;  5M7Y A;  1L1Y A;  3AFL A;  1SA5 B;  2R2L B;  2VN7 A;  3CU7 A;  5FO9 B;  3ACT A;  3M7B A;  2AHF A;  3ANJ A;  1G9G A;  4CJ0 A;  5IK6 A;  1W3Y A;  3RX7 A;  3E34 B;  4E1Y A;  3E32 B;  3SAE A;  1KS8 A;  1DL2 A;  3A3V A;  1UG9 A;  3DSU B;  3QFZ A;  3OXU A;  1G87 A;  1NC5 A;  1D8E B;  1TNB B;  3Q7F B;  3ANK A;  2ONG A;  3WIR A;  5IK0 A;  5GW7 A;  1XW2 A;  1KFG A;  2ONH A;  4D94 A;  2FUQ A;  1GXM A;  3KSQ B;  3N0G A;  1UT9 A;  5GY3 A;  3PZ2 B;  2AFA A;  4Z4J A;  5JMF A;  1KZP B;  5ILD A;  3RX8 A;  2F0Y B;  3VSM A;  1JS4 A;  1N94 B;  1NL4 B;  5GZK A;  5MEH A;  2V8I A;  1N21 A;  3C72 B;  1J0N A;  1SA4 B;  3Q78 B;  4LNG B;  3Q7A B;  1MZC B;  1FO2 A;  4OJZ A;  1N7N A;  3S9V A;  1FT2 B;  2WCO A;  3QT3 A;  2NVP A;  1HXC A;  1C3D A;  3S4B A;  5EAS A;  5EAU A;  2YIK A;  1N20 A;  2RI9 A;  1GAH A;  1GA2 A;  1GLM A;  1ULV A;  3DSX B;  3H7L A;  5ILK A;  4ZG8 A;  2DRS A;  4L6X A;  5EAT A;  5DHK A;  2A73 B;  3WKH A;  2H6I B;  3OED A;  3WUX A;  1LF6 A;  1G9J A;  2NOJ A;  4F13 A;  1O1T B;  3G4D A;  5ILJ A;  1N4Q B;  3PMM A;  4GL3 A;  4LIX A;  2DRR A;  3RJ3 A;  4Q88 A;  4D4A A;  1FCE A;  4QT9 A;  4XUV A;  3EU5 B;  5AGD A;  2H6F B;  3KLS A;  3W7W A;  3QG0 A;  1W6K A;  3SFY B;  1V7W A;  3S4C A;  1F1S A;  1UMP A;  1OJM A;  2BB6 A;  1JCR B;  3K7X A;  3QSP A;  4AYR A;  1OJO A;  1O79 A;  1RW9 A;  3W7S A;  2GH4 A;  2WII B;  4EHM B;  3SDQ A;  1EGU A;  2CQT A;  2V3P A;  3PYB A;  4GTM B;  4MU9 A;  4CJ1 A;  3KQ4 A;  5IM1 A;  3VXD A;  3SDR A;  1HXA A;  4RNQ A;  1QQF A;  1F9G A;  1N7Q A;  2D5J A;  3W5M A;  1RWA A;  1QAZ A;  3D5S A;  1SQC A;  1RWH A;  2FV0 A;  3G6J B;  1KSD A;  5DHI A;  5FOB B;  3GLY A;  1N1B A;  4FXK B;  1N9A B;  2CQS A;  1GXO A;  4OK2 A;  3H2W A;  2DRQ A;  2JF4 A;  1CLC A;  3WKG A;  3TF4 A;  3DSV B;  1IA7 A;  5CZL A;  3H3K A;  2X03 A;  1H36 A;  1QBQ B;  1S64 B;  3WKF A;  3S4A A;  2D8L A;  4TXT A;  2RGK A;  1HMU A;  2WY7 A;  1HXG A;  4KKJ A;  4NEI A;  1H54 A;  4F10 A;  2EAE A;  2QNO A;  1FT1 B;  4OZV A;  5C05 A;  1LOH A;  3M72 A;  1AYX A;  1HCU A;  1TNO B;  1X1I A;  4GTR B;  3QXF A;  5ILI A;  2V8J A;  3K11 A;  4LNV A;  1O6H A;  2E24 A;  3ANI A;  2XFG A;  1LXK A;  4YDE B;  4V1S A;  1W6J A;  5ILH A;  2EAD A;  4KTR A;  3PZ1 B;  1HN0 A;  3D3I A;  4WU0 A;  3KSL B;  4LNB B;  4DI5 A;  3W7T A;  1CB8 A;  1WZZ A;  3PYA A;  1XWT A;  3M77 A;  4C1S A;  1H39 A;  1TN6 B;  1H3A A;  1I8Q A;  1N23 A;  5FO7 B;  4D4C A;  4FXG B;  1J0M A;  1S63 B;  3DRA B;  2B4F A;  3M7C A;  1GHQ A;  1N24 A;  3E80 A;  1H3C A;  2V8K A;  2A8Z A;  1HM3 A;  2G0D A; 
#chains in the Genus database with same CATH homology
 3HXD B;  2FV1 A;  1NI1 B;  3T33 A;  4AYP A;  2SQC A;  5DGR A;  4DOD A;  3EUV B;  2ZBL A;  2JJB A;  1O5M B;  1KKT A;  1F9D A;  1K72 A;  1O6R A;  3S4D A;  5JPM B;  4YDO B;  4L9P B;  1KRF A;  4V1R A;  2FUZ A;  1TNY B;  4WVC A;  3RRS A;  4J5T A;  1V5C A;  3M74 A;  3SQC A;  3M7L A;  4M76 A;  2GZ6 A;  3QXQ A;  3E6U A;  3W5N A;  1DOG A;  3Q73 B;  2Z07 A;  3EU8 A;  3W7X A;  3DSS B;  2XQW A;  1FBW A;  3M73 A;  4L0G A;  4KTP A;  4AYO A;  2B39 A;  1D8D B;  1TF4 A;  1H14 A;  1DCE B;  1N4S B;  4GTO B;  3DSW B;  2RI8 A;  1FAE A;  1L2A A;  3QWT A;  5KKB A;  3WIQ A;  2JG0 A;  1NXC A;  1KRE A;  3QDE A;  3REN A;  3HXE B;  3X17 A;  1V7V A;  4ONT A;  4BOK A;  5CA3 A;  2GOX A;  1WU5 A;  1TNZ B;  3CIH A;  3M78 A;  1LTX B;  1KSC A;  3SDV A;  1CEM A;  3WC3 A;  3Q79 B;  2P0V A;  4TF4 A;  1V5D A;  3WKI A;  1IS9 A;  4KKI A;  2G02 A;  1JCS B;  1LD8 B;  1FPP B;  3HXB B;  3PZ4 B;  1FP3 A;  4Z4L A;  1FBO A;  3HXF B;  3QPF A;  1N95 B;  1LD7 B;  3P2C A;  1FO3 A;  3P5R A;  1O1S B;  2BBC A;  1H37 A;  1V7X A;  2XWJ B;  2AHG A;  2I07 B;  1TNU B;  1G6I A;  2XWB B;  1O1R B;  4GTP B;  1HZF A;  2ZZR A;  4ZRQ A;  4GTV B;  3DPY B;  3QRY A;  2EAC A;  5CD2 A;  3RSY A;  4WVA A;  1R76 A;  4D4B A;  2DRO A;  2F6D A;  1H35 A;  1N4R B;  2PMV A;  3RX5 A;  1X9D A;  4GTQ B;  2PN5 A;  1H13 A;  4EL8 A;  4JJJ A;  2EAB A;  1N4P B;  4ZH5 A;  1LF9 A;  2VN4 A;  4GTS B;  4Q2B A;  1QSJ A;  4YCR A;  2BED B;  3GT5 A;  3M75 A;  3ACS A;  4BOJ A;  1H3B A;  2ZIR B;  3D5R A;  3HXC B;  5DGQ A;  1F9O A;  3QT9 A;  3SDT A;  3Q75 B;  1O6Q A;  1X81 B;  3WIW A;  1VD5 A;  2WYN A;  3E73 A;  1TN7 B;  1KWF A;  4AYQ A;  4GTT B;  4D4D A;  1TN8 B;  2BB5 A;  5JPN B;  3E30 B;  2WIN B;  1WU4 A;  3GZK A;  1GAI A;  1XWQ A;  3SDU A;  1GXN A;  3ON6 A;  3EZ8 A;  2H6H B;  1JCQ B;  3M71 A;  4DOE A;  2OKX A;  5FO8 B;  3EQA A;  3SFX B;  3E37 B;  1AGM A;  4FUS A;  4ZRP A;  5E2J A;  4CE7 A;  5M7I A;  1H12 A;  1GSZ A;  3M7E A;  1FMI A;  2ZIS B;  3W7U A;  2IEJ B;  1RQ5 A;  3QFY A;  3DST B;  4WVB A;  4MBG B;  2H6G B;  2WY8 A;  1WU6 A;  3E33 B;  3AFJ A;  3PZ3 B;  3M76 A;  2V3N A;  1KZO B;  4ZH1 A;  2FBA A;  1IA6 A;  3VW5 A;  3P5P A;  5M7Y A;  1L1Y A;  1SA5 B;  2R2L B;  2VN7 A;  3CU7 A;  5FO9 B;  3ACT A;  3M7B A;  2AHF A;  3ANJ A;  1G9G A;  4CJ0 A;  3RX7 A;  3E34 B;  3SAE A;  3E32 B;  1KS8 A;  1DL2 A;  3A3V A;  1UG9 A;  3DSU B;  3QFZ A;  3OXU A;  1G87 A;  1NC5 A;  1D8E B;  1TNB B;  3Q7F B;  3ANK A;  3WIR A;  5GW7 A;  1XW2 A;  1KFG A;  4D94 A;  1GXM A;  3KSQ B;  1UT9 A;  5GY3 A;  3PZ2 B;  2AFA A;  4Z4J A;  1KZP B;  3RX8 A;  2F0Y B;  1JS4 A;  1N94 B;  1NL4 B;  5GZK A;  5MEH A;  2V8I A;  3C72 B;  1SA4 B;  3Q78 B;  4LNG B;  3Q7A B;  1MZC B;  1FO2 A;  3S9V A;  1FT2 B;  3QT3 A;  2NVP A;  1C3D A;  3S4B A;  2YIK A;  2RI9 A;  1GAH A;  1GA2 A;  1GLM A;  1ULV A;  3DSX B;  3H7L A;  4ZG8 A;  2DRS A;  4L6X A;  2A73 B;  3WKH A;  2H6I B;  3OED A;  3WUX A;  1LF6 A;  1G9J A;  2NOJ A;  1O1T B;  1N4Q B;  3PMM A;  4GL3 A;  4LIX A;  2DRR A;  3RJ3 A;  4Q88 A;  4D4A A;  1FCE A;  4QT9 A;  4XUV A;  3EU5 B;  5AGD A;  2H6F B;  3KLS A;  3W7W A;  3QG0 A;  1W6K A;  3SFY B;  1V7W A;  3S4C A;  1UMP A;  2BB6 A;  1JCR B;  3K7X A;  3QSP A;  4AYR A;  1O79 A;  3W7S A;  2GH4 A;  2WII B;  4EHM B;  3SDQ A;  2CQT A;  2V3P A;  3PYB A;  4GTM B;  4MU9 A;  4CJ1 A;  3KQ4 A;  3VXD A;  3SDR A;  1QQF A;  2D5J A;  3W5M A;  3D5S A;  1SQC A;  2FV0 A;  3G6J B;  1KSD A;  5FOB B;  3GLY A;  4FXK B;  1N9A B;  2CQS A;  1GXO A;  3H2W A;  2DRQ A;  2JF4 A;  1CLC A;  3WKG A;  3TF4 A;  3DSV B;  1IA7 A;  5CZL A;  3H3K A;  1H36 A;  1QBQ B;  1S64 B;  3WKF A;  3S4A A;  2D8L A;  4TXT A;  2RGK A;  2WY7 A;  4KKJ A;  1H54 A;  2EAE A;  2QNO A;  1FT1 B;  3M72 A;  1AYX A;  1HCU A;  1TNO B;  4GTR B;  3QXF A;  2V8J A;  3K11 A;  4LNV A;  1O6H A;  3ANI A;  2XFG A;  4YDE B;  4V1S A;  1W6J A;  2EAD A;  4KTR A;  3PZ1 B;  3D3I A;  4WU0 A;  3KSL B;  4LNB B;  3W7T A;  1WZZ A;  3PYA A;  1XWT A;  3M77 A;  4C1S A;  1H39 A;  1TN6 B;  1H3A A;  5FO7 B;  4D4C A;  4FXG B;  1S63 B;  3DRA B;  2B4F A;  3M7C A;  1GHQ A;  1H3C A;  2V8K A;  2A8Z A;  2G0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...