5AGFA

Nitrosyl complex of the d121q variant of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHQAYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C PRIME
publication title Hydrogen Bonding of the Dissociated Histidine Ligand is not Required for Formation of a Proximal No Adduct in Cytochrome C'.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
total genus 50
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5agfA00
1QQ3A 1NBBA 3FOOA 4ER9A 3NMKA 4EIYA 1RCPA 1JAFA 3M79A 3M4BA 4U9EA 5JSLA 4WGYA 4CJGA 3M15A 3C63A 5JS5A 4JEBA 1CPQA 2XLMA 4N4WA 4D4NA 3C62A 3U8PA 2XLWA 4JKVA 1GQAA 1E84A 5JUAA 1S05A 3NMIA 4CIPA 4CJOA 1E85A 1LM3B 4CDVA 3ZTMA 1BBHA 3QVZA 3QW1A 1QPUA 4CX9A 2J8WA 4IB4A 1CPRA 2XLDA 1YZAA 4IAQA 2YLIA 2YL3A 1CGNA 3ZQVA 2YL1A 4U9DA 2XLHA 3HNKA 5AGFA 3M4CA 2XL6A 3VRCA 3HNJA 2YL7A 1YYJA 2XM0A 3HNLA 2QLAA 3L1MA 3TOMA 4CDYA 3DE8A 1E86A 3FOPA 3NMJA 2YLGA 2BC5A 5JT4A 1EKYA 4IARA 4JE9A 5B3IA 3ZTZA 2XLEA 3IQ5A 4JEAA 2J9BA 4CDAA 1E83A 5JVEA 2CCYA 2YLDA 1YZCA 3HNIA 1MQVA 4N6HA 1CGOA 4WGZA 2XLVA 3QW0A 2YKZA 3DE9A 4NC3A 3ZWIA 5JLIA 3IQ6A 5JRAA 3TOLA 4L6RA 1APCA 5JP7A 1A7VA 1YYXA 2XM4A 256BA 3ZQYA 1M6TA 2XL8A 2XLOA 3QVYA 4D4XA 4ULVA 2YL0A
chains in the Genus database with same CATH superfamily
3FAJA 1ZHYA 2VCAA 3RKOF 4XLPF 2KSFA 3TJ5A 2DI3A 2RD9A 1ZYRF 3NKDA 3QMKA 4K1OA 4KNWA 3E9VA 5HSWA 3POVA 4EIYA 5KYUB 2KYHA 2OG2A 1RCPA 2OJQA 3KL4A 4OD5A 3T6BA 4DVYP 3DJNB 3LS0A 3EHNA 3M79A 1HW2A 4O6NA 3EG9A 2JX0A 2Q9AA 4U9EA 3M15A 3V5ZA 3OEOA 3K66A 1C02A 2L6FA 4M63A 4YL1A 1UFBA 1WGWA 1WN0A 2FAPB 3EGXA 1CGME 1ORYA 4Z9JA 1RXQA 4IGGA 3KMIA 3EZHA 1QKRA 1DOWA 2VCCA 2XLWA 5BQIA 1ST6A 3A9CA 3I5PA 4JKVA 4A4AA 1NU7D 3RVYA 2Y3BA 2R02A 3B0VC 2J9VA 1JPNA 3F47A 3NMIA 3U9JA 3BRJA 3ASOC 1LM3B 3JSZA 2B0JA 4JJFA 1QVXA 3RQGA 3QZCA 4G7OF 2GFHA 1LPEA 3K33A 4LDRA 1MNEA 5L0GA 3ZSUA 4MS2A 4JCZA 3LNMB 2J8WA 3CQZA 2HKVA 4IB4A 1T6QA 1KU2A 4R32A 4YL3A 3DXJF 2YHSA 4OIRF 1JOGA 4YL0A 1FFTC 3WHNA 3LAYA 4H54A 1U0BB 3ECSA 3FVYA 3K6BA 4FWVA 4YT5A 2Y69C 2OQMA 1HE1A 3LLIA 3DWWA 2YQYA 1M57C 5AC4A 2XS1A 2W45A 1TKNA 4JJGA 4MNDA 2A0UA 1ZHTA 1Q0MA 1HW1A 2YL1A 4U9DA 1PV3A 2NUTA 2XLHA 4BEMJ 3S28A 1D1BA 1NZEA 4OIPF 1VYKA 2J0XA 2XS8A 3LESA 3IEEA 2R7UA 2JPUA 1JPJA 3K7DA 2DB4A 2L81A 2MYSA 3MYFA 4AE4B 1TWAA 2QLAA 2Y3HA 4A2NB 1TQGA 3DM9B 3HKKA 4E17A 3OA1A 1WOLA 3AG4C 4O7GA 5CI8A 1XZQA 5E3CA 3X2QC 5B3SC 3CAXA 4LLCA 1E86A 4JTAB 3LEVA 3DM5A 4HFKB 3U5SA 1A0BA 3C8ZA 4NTAA 1Q0GA 3B71A 4DRJB 5EGYA 2KNHA 2HS5A 3JT1A 3US6A 3MLGA 2J9BA 2OKUA 2IYLD 2HV7A 3PMRA 4JW1A 4QI0A 4XPYA 3AG1C 1OCOC 4KNVA 1E83A 3N0TA 4E0HA 2LD6A 2M4EA 1V55C 2UUHA 3U2MA 1C17M 2HFIA 2WZGA 3GODA 4IJJA 4DVZA 5GPGB 5CI9A 3C7JA 4BJTA 2YEVA 3DI5A 4PK4A 3QW0A 1D0YA 1SYQA 2R7QA 4ZLCA 1D1CA 1WASA 3ZWIA 5AC5A 1OW6A 2H8AA 3GM3A 4IAOA 2H7VC 5EHHA 3EH2A 4N6CA 2YVKA 5L0CA 2B0HA 2VCBA 4YT8A 1BR2A 1ORJA 3EGDB 3G50A 4BJ1A 4MTGA 2CNWD 2OOCA 4LDKA 1SF8A 5L0IA 4ZLDA 4X0RA 1SR2A 1NLXA 1A7VA 4BJ5C 2XM4A 5E2QA 2R7RA 1VMAA 4GYTA 3C8GB 3DJUB 4QDLA 2NSGA 2XL8A 4MVZA 2TMVP 4KC9A 5A6KA 4BJ6C 2FGYA 1NFNA 5BQHA 1RJ9B 1H9TA 2HV6A 3JSEO 2QE9A 1G4US 4AK9A 2PBEA 1GM5A 2XSEA 4XEFA 1LE2A 1NBBA 3FOOA 2VASA 5KYUA 4ER9A 2ZXWC 4MVRA 2D5RB 3IHUA 4I1MA 3UNGC 3FDQA 4Q5SF 2XXAA 5L0HA 3RQEA 4G78A 2R7TA 1Y6DA 1LIHA 1YAUO 2QUPA 5JSLA 3T9OA 2LK4A 4YN0B 1JMWA 3C63A 2XRHA 3GWNA 3GEHA 4RBNA 2J7PD 5KYWA 2EPKX 2OJED 3C62A 1ZHZA 3KPHA 4CSAA 2I15A 3VYWA 3W8HA 3U8PA 2LCHA 4JRZA 4LDQA 1RKCA 4CS8C 2KW3C 1FTSA 2AVKA 3A11A 2ZD9A 3F46A 2GA0A 4G7ZF 1M56C 3ABMC 1S05A 3Q7GA 4DRHB 3LNRA 2J9UA 3LS1A 4NCQA 2MHRA 1JR8A 3JYHA 1OR2A 1LS4A 5B1AC 1ZU5A 1KTMA 2BE5F 3JTLO 3UMKA 1M2VB 3R2PA 2R7SA 1V54C 5F5FA 5T1DB 1D1AA 3DZAA 2L6GA 4YT4A 4P9FA 1EQ1A 1PD0A 1J8YF 1R4TA 2J46A 5KYYB 1OXKA 2BL2A 3W4YA 2XLDA 4YK5A 3IQTA 2YLIA 2A6HF 4F4BA 3O6XA 4EBKA 3KH2A 2CDQA 5T3WA 3JZ0A 1CGNA 4KBLA 2ZXPA 2Q7RA 3FMSA 1Q0KA 1NG1A 5DS6A 3O39A 2WVQA 2R7VA 2HMQA 4CS9A 2C03A 3ASNC 4JIOA 1QLEC 1ZW3A 3M4CA 5DQTA 2KJGA 3MFNA 3TD7A 1IW7F 3NDBB 2VC9A 1L7CA 2YL7A 4U5HA 1Z6AA 2W4MA 4QI2A 2PFDA 3U8VA 1HMOA 4HE8D 4LERA 4CDYA 4CS9C 3UMIA 3U2LA 2Y3DA 3FOPA 4FX5A 4Z9HA 4E7SA 2BC5A 3H2VA 5COFA 4JE9A 1EKYA 4XTKA 4Q4ZF 3JYYA 1VK5A 2IXMA 1WWPA 3GM2A 4JEAA 1WATA 3GEEA 3TQOA 4BG0A 2EPNA 2R9RB 2E87A 4CDAA 5JVEA 1A7EA 3G4XA 3SEOA 2R7WA 4OIQF 1FFHA 2L7AA 3C18A 3PCVA 2LFDA 2G3KA 1TWGA 4N6HA 3SYNA 1CGOA 5DLJA 4WGZA 1HMDA 2IM8A 2P7VA 1RKEB 3EJNA 4DBRA 3SXKA 4U5EE 4U5FE 1MNDA 1NFOA 2OEVA 1O87A 3DE9A 3IQCA 3U3FA 3L8JA 2P6VA 2AWCA 1Z7Qc 3EGDA 5JLIA 1XWJA 1RKEA 1M2OA 2QY9A 1LKXA 5DQZA 3IQ6A 2EIKC 2HMZA 3UGPA 4ANJA 1OW7A 2J9WA 4O79A 4YT2A 4G7HF 2W4BA 2J45A 1APCA 1DOVA 2R7OA 3C8GD 4AL1A 2H7OA 3C8GA 3DAGA 1YYXA 3S90A 4N06A 4JTDB 2IXPA 256BA 3B29A 3ZVRA 4FAPB 4O6YA 1LVKA 4BJ6A 4W8KA 2F22A 1VOMA 4ULVA 1A41A 2XLOA 3RIPA 2EPLX 3W2VA 4JC7A 2YL0A 3S0XA 1QQ3A 3V5XA 1N1CA 1ZVZA 3EFOB 4MTOA 3NYMA 2YWAA 2HJMA 3HLZA 3LLKA 3NMKA 1OR3A 1RMVA 3BEHA 5L3VA 1ZHXA 3S29A 3UMHA 3W8IA 4EWCA 2L6HA 5DVWA 1ZZPA 1ZU4A 4WGYA 4CJGA 5L0DA 1YA7O 5JS5A 4JEBA 3WAQA 2EPOA 1VLSA 5TJ5E 4FESA 2WVNA 2CNWA 2H7BA 4MW3A 1CPQA 3AG2C 2R7XA 2R03A 3VM6A 4D4NA 2GAQA 4UDVA 4AL0A 2HJ3A 2I8BA 2ZPAA 1K04A 4IWBA 3S9OA 4NQFA 4MQ9F 4E18A 3SXMA 3U0CA 2R25A 2UUIA 3B0PA 5E33A 2P0NA 3DAFA 1GQAA 1Q0FA 3NYLA 5JUAA 1E84A 1K05A 3PHF2 2V3CC 2A69F 2EIJC 2RSEB 2OEXA 4MVOA 4EBBA 1H9GA 4CIPA 2PX3A 1E85A 4XPWA 3B0UX 4CDVA 1VYIA 1M2VA 2NUPB 4AX2A 2FFHA 2DGJA 4PFOA 1YA9A 4EHPA 2VH3A 2A0BA 5T3TA 3T4RA 5KYYA 4CX9A 3ZDLA 3O55A 1FR0A 1XZPA 1G8XA 2LFFA 3WODF 1CPRA 3K1IA 4K0DA 2OU6A 1G4WR 1T9KA 1YZAA 4IAQA 1QZXA 4NY3A 3UR3C 4EUKB 2NSFA 4K7BA 4JVSA 4P6IC 4J30B 5EK0A 2J7PA 4B6IA 1EI7A 2AP3A 4Q7CA 3ZQVA 1OQCA 1QSPA 4EBJA 1GGQA 1FNTc 3EQLF 5L0FA 4XEVA 4GEHA 4C7OB 2P61A 4MVMA 3RFYA 4U5CE 2KK1A 2XL6A 4I44A 3VRCA 4H4KC 4XWJA 5KYXB 4CBEA 3HNJA 4KI2A 1OKKD 4OINF 1OKKA 2AWYA 2XM0A 3HNLA 5CIVA 5A6AA 5HV9A 4CSAC 3L1MA 4J32B 1NSGB 4G0HA 3ABKC 4RDAA 3GWLA 3TK0A 2XL4A 3DE8A 1L3PA 3NKEA 4PJJA 1A7DA 3NMJA 3Q6MA 2YLGA 3N2ZB 2LQGA 2PNOA 4IARA 3KYJA 4PACA 4ULWA 5JT4A 2PF4E 3FXHA 3IQ5A 3ZIBA 1Z5ZA 4LACB 3AQCA 3QTHA 2EIMC 2IOQA 2PP4A 3H65A 2CCYA 1J8MF 3NRHA 4E0IA 1MMAA 2Q4FA 1S7ZA 2WL8A 2XLVA 3RH3A 1LI7A 3AQBA 4PFPA 2IBFA 5E3AA 4AE4A 3V5YA 5COGA 4C3BA 3J06A 3TULA 1HE9A 4WJ0A 2XXAB 4GQHA 1TR2A 1I4ZA 1D0ZA 1R5ID 4MW8A 4JURI 1OXBA 2YZSA 3CEXA 4NTFA 3TOLA 5JRAA 3RW0A 5JP7A 1YJGA 3NG1A 3KKBA 3LUTB 4XLNF 4U5BE 5BQGA 5KYWB 3IPMO 1WTYA 1M6TA 4U5GA 2YRFA 4XQ1A 1BZ4A 3ABLC 3K1HA 1SZIA 3R7CA 4JCHA 4PJNA 4DBQA 3QVYA 2IXNA 2JD3A 4D4XA 4CIHA 2ICWG 3EFOA 3L0IA 3PDMP 1PCXA 1PD1A 1O5HA 2DYSC 1BR4A 2OCCC 1T6IA 2EILC 2D4UA 3X1OA 3EPVA 5BUOA 1ZW2A 2O9XA 4PR9A 5K0IA 2L9JA 2Q3TA 2X51A 3RQFA 2HSBA 3JCUQ 1K40A 5L0JA 4RD9A 4HFFB 1JAFA 3M4BA 3EHMA 4XPXA 4BPMA 2LP4A 3L8IA 2KGOA 2GWWA 1Z23A 3EG9B 4MTFA 2X0CA 4DXWA 2V26A 1V74B 1UG7A 1GS9A 3HJCA 3I4UA 4IRUA 2XLMA 2W9YA 3Q7LA 1I5NA 4J7YA 2PX0A 3NYJA 4MVQA 1IZMA 4N4WA 3SNHA 5DS4A 4CS7A 3EGXB 5DS5A 2HZ8A 1RJ9A 5D91A 3HTKC 3L34A 1U6HA 2Z15A 1BR1A 2CGEA 3B9QA 3S27A 4E7ZA 3Q6NA 1B68A 1MMNA 3EZIA 1MMDA 2CW0F 4ONSA 3O10A 1AUEA 1TFKB 2WB7A 2Y39A 5COMA 4CJOA 1MMGA 2MWQA 2NUPA 1JRAA 1T5OA 2G3VA 4I3MA 5A69A 2EPMX 4U5DE 1FMWA 3ZTMA 1LI5A 2LIGA 3GANA 1BBHA 2J0WA 3QVZA 2A1DD 1F1MA 4MVUA 1Y4CA 2AU5A 2IXOA 3QW1A 4HEAJ 5B1BC 1YDIA 3TJ6A 1QPUA 3LJBA 4I1OB 5A6JA 1E2XA 3MBGA 1BDJB 4PJMA 1D0XA 3DMDA 4O6MA 3SXZA 4PJLA 3DKAA 1YLMA 2M64A 2YL3A 1NU9C 1YARO 3MX3A 3RYLA 1YVIA 4EKWA 2NPUA 2KC3A 2WZFA 4C7OA 1HY5A 3RF3A 3SZRA 1FMVA 3AJMA 3I5QA 3HNKA 3ZC4A 5AGFA 2NUTB 4J7TA 3LEOA 5KYXA 2DYRC 2C04A 2WZLA 1OCZC 3DD7A 2Q9BA 1TFOB 3GM1A 3ATPA 4XEKA 3U3BA 1KNYA 1AVOB 4C3EA 4BJ5A 5F5HA 3RVZA 1YYJA 3U9MA 4W8PA 2KQ9A 4NTBA 4Z9IA 3VAYA 3EH1A 3G4ZA 3CSKA 3TOMA 1OCRC 3SP1A 1OW8A 4C3DA 1VB5A 5A6BD 5A6BA 4MVSA 2WVOA 1Z63A 2Y3GA 2ZXRA 3ITFA 3T6GB 3WG7C 2XLEA 3SXYA 2R05A 2ZXOA 3ZTZA 4DOZA 5B3IA 1LS1A 3S84A 2ASRA 2YLDA 1EA8A 1Z3IX 2CYDA 2ETSA 2GDCA 3JRMO 1OCCC 4OD4A 1I4YA 1YZCA 3HNIA 1TWCA 2Q9CA 3VF0A 5FCLA 1VTMP 3K1IC 3GEIA 3AGTA 3ZG1A 4BEJA 4DRIB 2EINC 1G5ZA 4JTCB 2QNLA 3W2WA 3AOUA 1FAPB 2NG1A 1AEPA 2YKZA 5D92A 3UGOA 4NC3A 4LLEA 1Q0DA 2LSEA 4YWQA 1T01A 1T6UA 1ORSC 5IY5C 1V4AA 3AGUA 2HSQA 1VLTA 3FHDA 3T6JA 4CS8A 2G62A 3CZ6A 3FAPB 2VB6A 3V7OA 4YJWA 4JZAA 5FZTA 3GORA 3JRTA 4OIOF 2A6EF 3OWTA 4L6RA 1ZHWA 2HUJA 2P1AA 3KYIA 5F28E 3AG3C 3M1CB 4WABA 3ZQYA 1TWHA 1H6GA 5KYNA 3E70C 4P9TA 3MYIA 1O3UA 1W2WA 1SMYF 2Q00A 3H2UA 3N24A 4DJ9A 5L3QA 2QTVA 1H7IA 1C03A 1U89A 2A68F 1MQVA 1LE4A
chains in the Genus database with same CATH topology
1QQ3A 1NBBA 3FOOA 4ER9A 3NMKA 4EIYA 1RCPA 1JAFA 3M79A 3M4BA 4U9EA 5JSLA 4WGYA 4CJGA 3M15A 3C63A 5JS5A 4JEBA 1CPQA 2XLMA 4N4WA 4D4NA 3C62A 3U8PA 2XLWA 4JKVA 1GQAA 1E84A 5JUAA 1S05A 3NMIA 4CIPA 4CJOA 1E85A 1LM3B 4CDVA 3ZTMA 1BBHA 3QVZA 3QW1A 1QPUA 4CX9A 2J8WA 4IB4A 1CPRA 2XLDA 1YZAA 4IAQA 2YLIA 2YL3A 1CGNA 3ZQVA 2YL1A 4U9DA 2XLHA 3HNKA 5AGFA 3M4CA 2XL6A 3VRCA 3HNJA 2YL7A 1YYJA 2XM0A 3HNLA 2QLAA 3L1MA 3TOMA 4CDYA 3DE8A 1E86A 3FOPA 3NMJA 2YLGA 2BC5A 5JT4A 1EKYA 4IARA 4JE9A 5B3IA 3ZTZA 2XLEA 3IQ5A 4JEAA 2J9BA 4CDAA 1E83A 5JVEA 2CCYA 2YLDA 1YZCA 3HNIA 1MQVA 4N6HA 1CGOA 4WGZA 2XLVA 3QW0A 2YKZA 3DE9A 4NC3A 3ZWIA 5JLIA 3IQ6A 5JRAA 3TOLA 4L6RA 1APCA 5JP7A 1A7VA 1YYXA 2XM4A 256BA 3ZQYA 1M6TA 2XL8A 2XLOA 3QVYA 4D4XA 4ULVA 2YL0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QQ3 A;  1NBB A;  3FOO A;  4ER9 A;  3NMK A;  4EIY A;  1RCP A;  1JAF A;  3M79 A;  3M4B A;  4U9E A;  5JSL A;  4WGY A;  4CJG A;  3M15 A;  3C63 A;  5JS5 A;  4JEB A;  1CPQ A;  2XLM A;  4N4W A;  4D4N A;  3C62 A;  3U8P A;  2XLW A;  4JKV A;  1GQA A;  1E84 A;  5JUA A;  1S05 A;  3NMI A;  4CIP A;  4CJO A;  1E85 A;  1LM3 B;  4CDV A;  3ZTM A;  1BBH A;  3QVZ A;  3QW1 A;  1QPU A;  4CX9 A;  2J8W A;  4IB4 A;  1CPR A;  2XLD A;  1YZA A;  4IAQ A;  2YLI A;  2YL3 A;  1CGN A;  3ZQV A;  2YL1 A;  4U9D A;  2XLH A;  3HNK A;  5AGF A;  3M4C A;  2XL6 A;  3VRC A;  3HNJ A;  2YL7 A;  1YYJ A;  2XM0 A;  3HNL A;  2QLA A;  3L1M A;  3TOM A;  4CDY A;  3DE8 A;  1E86 A;  3FOP A;  3NMJ A;  2YLG A;  2BC5 A;  5JT4 A;  1EKY A;  4IAR A;  4JE9 A;  5B3I A;  3ZTZ A;  2XLE A;  3IQ5 A;  4JEA A;  2J9B A;  4CDA A;  1E83 A;  5JVE A;  2CCY A;  2YLD A;  1YZC A;  3HNI A;  1MQV A;  4N6H A;  1CGO A;  4WGZ A;  2XLV A;  3QW0 A;  2YKZ A;  3DE9 A;  4NC3 A;  3ZWI A;  5JLI A;  3IQ6 A;  5JRA A;  3TOL A;  4L6R A;  1APC A;  5JP7 A;  1A7V A;  1YYX A;  2XM4 A;  256B A;  3ZQY A;  1M6T A;  2XL8 A;  2XLO A;  3QVY A;  4D4X A;  4ULV A;  2YL0 A; 
#chains in the Genus database with same CATH topology
 3FAJ A;  1ZHY A;  2VCA A;  3RKO F;  4XLP F;  2KSF A;  3TJ5 A;  2DI3 A;  2RD9 A;  1ZYR F;  3NKD A;  3QMK A;  4K1O A;  4KNW A;  3E9V A;  5HSW A;  3POV A;  4EIY A;  5KYU B;  2KYH A;  2OG2 A;  1RCP A;  2OJQ A;  3KL4 A;  4OD5 A;  3T6B A;  4DVY P;  3DJN B;  3LS0 A;  3EHN A;  3M79 A;  1HW2 A;  4O6N A;  3EG9 A;  2JX0 A;  2Q9A A;  4U9E A;  3M15 A;  3V5Z A;  3OEO A;  3K66 A;  1C02 A;  2L6F A;  4M63 A;  4YL1 A;  1UFB A;  1WGW A;  1WN0 A;  2FAP B;  3EGX A;  1CGM E;  1ORY A;  4Z9J A;  1RXQ A;  4IGG A;  3KMI A;  3EZH A;  1QKR A;  1DOW A;  2VCC A;  2XLW A;  5BQI A;  1ST6 A;  3A9C A;  3I5P A;  4JKV A;  4A4A A;  1NU7 D;  3RVY A;  2Y3B A;  2R02 A;  3B0V C;  2J9V A;  1JPN A;  3F47 A;  3NMI A;  3U9J A;  3BRJ A;  3ASO C;  1LM3 B;  3JSZ A;  2B0J A;  4JJF A;  1QVX A;  3RQG A;  3QZC A;  4G7O F;  2GFH A;  1LPE A;  3K33 A;  4LDR A;  1MNE A;  5L0G A;  3ZSU A;  4MS2 A;  4JCZ A;  3LNM B;  2J8W A;  3CQZ A;  2HKV A;  4IB4 A;  1T6Q A;  1KU2 A;  4R32 A;  4YL3 A;  3DXJ F;  2YHS A;  4OIR F;  1JOG A;  4YL0 A;  1FFT C;  3WHN A;  3LAY A;  4H54 A;  1U0B B;  3ECS A;  3FVY A;  3K6B A;  4FWV A;  4YT5 A;  2Y69 C;  2OQM A;  1HE1 A;  3LLI A;  3DWW A;  2YQY A;  1M57 C;  5AC4 A;  2XS1 A;  2W45 A;  1TKN A;  4JJG A;  4MND A;  2A0U A;  1ZHT A;  1Q0M A;  1HW1 A;  2YL1 A;  4U9D A;  1PV3 A;  2NUT A;  2XLH A;  4BEM J;  3S28 A;  1D1B A;  1NZE A;  4OIP F;  1VYK A;  2J0X A;  2XS8 A;  3LES A;  3IEE A;  2R7U A;  2JPU A;  1JPJ A;  3K7D A;  2DB4 A;  2L81 A;  2MYS A;  3MYF A;  4AE4 B;  1TWA A;  2QLA A;  2Y3H A;  4A2N B;  1TQG A;  3DM9 B;  3HKK A;  4E17 A;  3OA1 A;  1WOL A;  3AG4 C;  4O7G A;  5CI8 A;  1XZQ A;  5E3C A;  3X2Q C;  5B3S C;  3CAX A;  4LLC A;  1E86 A;  4JTA B;  3LEV A;  3DM5 A;  4HFK B;  3U5S A;  1A0B A;  3C8Z A;  4NTA A;  1Q0G A;  3B71 A;  4DRJ B;  5EGY A;  2KNH A;  2HS5 A;  3JT1 A;  3US6 A;  3MLG A;  2J9B A;  2OKU A;  2IYL D;  2HV7 A;  3PMR A;  4JW1 A;  4QI0 A;  4XPY A;  3AG1 C;  1OCO C;  4KNV A;  1E83 A;  3N0T A;  4E0H A;  2LD6 A;  2M4E A;  1V55 C;  2UUH A;  3U2M A;  1C17 M;  2HFI A;  2WZG A;  3GOD A;  4IJJ A;  4DVZ A;  5GPG B;  5CI9 A;  3C7J A;  4BJT A;  2YEV A;  3DI5 A;  4PK4 A;  3QW0 A;  1D0Y A;  1SYQ A;  2R7Q A;  4ZLC A;  1D1C A;  1WAS A;  3ZWI A;  5AC5 A;  1OW6 A;  2H8A A;  3GM3 A;  4IAO A;  2H7V C;  5EHH A;  3EH2 A;  4N6C A;  2YVK A;  5L0C A;  2B0H A;  2VCB A;  4YT8 A;  1BR2 A;  1ORJ A;  3EGD B;  3G50 A;  4BJ1 A;  4MTG A;  2CNW D;  2OOC A;  4LDK A;  1SF8 A;  5L0I A;  4ZLD A;  4X0R A;  1SR2 A;  1NLX A;  1A7V A;  4BJ5 C;  2XM4 A;  5E2Q A;  2R7R A;  1VMA A;  4GYT A;  3C8G B;  3DJU B;  4QDL A;  2NSG A;  2XL8 A;  4MVZ A;  2TMV P;  4KC9 A;  5A6K A;  4BJ6 C;  2FGY A;  1NFN A;  5BQH A;  1RJ9 B;  1H9T A;  2HV6 A;  3JSE O;  2QE9 A;  1G4U S;  4AK9 A;  2PBE A;  1GM5 A;  2XSE A;  4XEF A;  1LE2 A;  1NBB A;  3FOO A;  2VAS A;  5KYU A;  4ER9 A;  2ZXW C;  4MVR A;  2D5R B;  3IHU A;  4I1M A;  3UNG C;  3FDQ A;  4Q5S F;  2XXA A;  5L0H A;  3RQE A;  4G78 A;  2R7T A;  1Y6D A;  1LIH A;  1YAU O;  2QUP A;  5JSL A;  3T9O A;  2LK4 A;  4YN0 B;  1JMW A;  3C63 A;  2XRH A;  3GWN A;  3GEH A;  4RBN A;  2J7P D;  5KYW A;  2EPK X;  2OJE D;  3C62 A;  1ZHZ A;  3KPH A;  4CSA A;  2I15 A;  3VYW A;  3W8H A;  3U8P A;  2LCH A;  4JRZ A;  4LDQ A;  1RKC A;  4CS8 C;  2KW3 C;  1FTS A;  2AVK A;  3A11 A;  2ZD9 A;  3F46 A;  2GA0 A;  4G7Z F;  1M56 C;  3ABM C;  1S05 A;  3Q7G A;  4DRH B;  3LNR A;  2J9U A;  3LS1 A;  4NCQ A;  2MHR A;  1JR8 A;  3JYH A;  1OR2 A;  1LS4 A;  5B1A C;  1ZU5 A;  1KTM A;  2BE5 F;  3JTL O;  3UMK A;  1M2V B;  3R2P A;  2R7S A;  1V54 C;  5F5F A;  5T1D B;  1D1A A;  3DZA A;  2L6G A;  4YT4 A;  4P9F A;  1EQ1 A;  1PD0 A;  1J8Y F;  1R4T A;  2J46 A;  5KYY B;  1OXK A;  2BL2 A;  3W4Y A;  2XLD A;  4YK5 A;  3IQT A;  2YLI A;  2A6H F;  4F4B A;  3O6X A;  4EBK A;  3KH2 A;  2CDQ A;  5T3W A;  3JZ0 A;  1CGN A;  4KBL A;  2ZXP A;  2Q7R A;  3FMS A;  1Q0K A;  1NG1 A;  5DS6 A;  3O39 A;  2WVQ A;  2R7V A;  2HMQ A;  4CS9 A;  2C03 A;  3ASN C;  4JIO A;  1QLE C;  1ZW3 A;  3M4C A;  5DQT A;  2KJG A;  3MFN A;  3TD7 A;  1IW7 F;  3NDB B;  2VC9 A;  1L7C A;  2YL7 A;  4U5H A;  1Z6A A;  2W4M A;  4QI2 A;  2PFD A;  3U8V A;  1HMO A;  4HE8 D;  4LER A;  4CDY A;  4CS9 C;  3UMI A;  3U2L A;  2Y3D A;  3FOP A;  4FX5 A;  4Z9H A;  4E7S A;  2BC5 A;  3H2V A;  5COF A;  4JE9 A;  1EKY A;  4XTK A;  4Q4Z F;  3JYY A;  1VK5 A;  2IXM A;  1WWP A;  3GM2 A;  4JEA A;  1WAT A;  3GEE A;  3TQO A;  4BG0 A;  2EPN A;  2R9R B;  2E87 A;  4CDA A;  5JVE A;  1A7E A;  3G4X A;  3SEO A;  2R7W A;  4OIQ F;  1FFH A;  2L7A A;  3C18 A;  3PCV A;  2LFD A;  2G3K A;  1TWG A;  4N6H A;  3SYN A;  1CGO A;  5DLJ A;  4WGZ A;  1HMD A;  2IM8 A;  2P7V A;  1RKE B;  3EJN A;  4DBR A;  3SXK A;  4U5E E;  4U5F E;  1MND A;  1NFO A;  2OEV A;  1O87 A;  3DE9 A;  3IQC A;  3U3F A;  3L8J A;  2P6V A;  2AWC A;  1Z7Q c;  3EGD A;  5JLI A;  1XWJ A;  1RKE A;  1M2O A;  2QY9 A;  1LKX A;  5DQZ A;  3IQ6 A;  2EIK C;  2HMZ A;  3UGP A;  4ANJ A;  1OW7 A;  2J9W A;  4O79 A;  4YT2 A;  4G7H F;  2W4B A;  2J45 A;  1APC A;  1DOV A;  2R7O A;  3C8G D;  4AL1 A;  2H7O A;  3C8G A;  3DAG A;  1YYX A;  3S90 A;  4N06 A;  4JTD B;  2IXP A;  256B A;  3B29 A;  3ZVR A;  4FAP B;  4O6Y A;  1LVK A;  4BJ6 A;  4W8K A;  2F22 A;  1VOM A;  4ULV A;  1A41 A;  2XLO A;  3RIP A;  2EPL X;  3W2V A;  4JC7 A;  2YL0 A;  3S0X A;  1QQ3 A;  3V5X A;  1N1C A;  1ZVZ A;  3EFO B;  4MTO A;  3NYM A;  2YWA A;  2HJM A;  3HLZ A;  3LLK A;  3NMK A;  1OR3 A;  1RMV A;  3BEH A;  5L3V A;  1ZHX A;  3S29 A;  3UMH A;  3W8I A;  4EWC A;  2L6H A;  5DVW A;  1ZZP A;  1ZU4 A;  4WGY A;  4CJG A;  5L0D A;  1YA7 O;  5JS5 A;  4JEB A;  3WAQ A;  2EPO A;  1VLS A;  5TJ5 E;  4FES A;  2WVN A;  2CNW A;  2H7B A;  4MW3 A;  1CPQ A;  3AG2 C;  2R7X A;  2R03 A;  3VM6 A;  4D4N A;  2GAQ A;  4UDV A;  4AL0 A;  2HJ3 A;  2I8B A;  2ZPA A;  1K04 A;  4IWB A;  3S9O A;  4NQF A;  4MQ9 F;  4E18 A;  3SXM A;  3U0C A;  2R25 A;  2UUI A;  3B0P A;  5E33 A;  2P0N A;  3DAF A;  1GQA A;  1Q0F A;  3NYL A;  5JUA A;  1E84 A;  1K05 A;  3PHF 2;  2V3C C;  2A69 F;  2EIJ C;  2RSE B;  2OEX A;  4MVO A;  4EBB A;  1H9G A;  4CIP A;  2PX3 A;  1E85 A;  4XPW A;  3B0U X;  4CDV A;  1VYI A;  1M2V A;  2NUP B;  4AX2 A;  2FFH A;  2DGJ A;  4PFO A;  1YA9 A;  4EHP A;  2VH3 A;  2A0B A;  5T3T A;  3T4R A;  5KYY A;  4CX9 A;  3ZDL A;  3O55 A;  1FR0 A;  1XZP A;  1G8X A;  2LFF A;  3WOD F;  1CPR A;  3K1I A;  4K0D A;  2OU6 A;  1G4W R;  1T9K A;  1YZA A;  4IAQ A;  1QZX A;  4NY3 A;  3UR3 C;  4EUK B;  2NSF A;  4K7B A;  4JVS A;  4P6I C;  4J30 B;  5EK0 A;  2J7P A;  4B6I A;  1EI7 A;  2AP3 A;  4Q7C A;  3ZQV A;  1OQC A;  1QSP A;  4EBJ A;  1GGQ A;  1FNT c;  3EQL F;  5L0F A;  4XEV A;  4GEH A;  4C7O B;  2P61 A;  4MVM A;  3RFY A;  4U5C E;  2KK1 A;  2XL6 A;  4I44 A;  3VRC A;  4H4K C;  4XWJ A;  5KYX B;  4CBE A;  3HNJ A;  4KI2 A;  1OKK D;  4OIN F;  1OKK A;  2AWY A;  2XM0 A;  3HNL A;  5CIV A;  5A6A A;  5HV9 A;  4CSA C;  3L1M A;  4J32 B;  1NSG B;  4G0H A;  3ABK C;  4RDA A;  3GWL A;  3TK0 A;  2XL4 A;  3DE8 A;  1L3P A;  3NKE A;  4PJJ A;  1A7D A;  3NMJ A;  3Q6M A;  2YLG A;  3N2Z B;  2LQG A;  2PNO A;  4IAR A;  3KYJ A;  4PAC A;  4ULW A;  5JT4 A;  2PF4 E;  3FXH A;  3IQ5 A;  3ZIB A;  1Z5Z A;  4LAC B;  3AQC A;  3QTH A;  2EIM C;  2IOQ A;  2PP4 A;  3H65 A;  2CCY A;  1J8M F;  3NRH A;  4E0I A;  1MMA A;  2Q4F A;  1S7Z A;  2WL8 A;  2XLV A;  3RH3 A;  1LI7 A;  3AQB A;  4PFP A;  2IBF A;  5E3A A;  4AE4 A;  3V5Y A;  5COG A;  4C3B A;  3J06 A;  3TUL A;  1HE9 A;  4WJ0 A;  2XXA B;  4GQH A;  1TR2 A;  1I4Z A;  1D0Z A;  1R5I D;  4MW8 A;  4JUR I;  1OXB A;  2YZS A;  3CEX A;  4NTF A;  3TOL A;  5JRA A;  3RW0 A;  5JP7 A;  1YJG A;  3NG1 A;  3KKB A;  3LUT B;  4XLN F;  4U5B E;  5BQG A;  5KYW B;  3IPM O;  1WTY A;  1M6T A;  4U5G A;  2YRF A;  4XQ1 A;  1BZ4 A;  3ABL C;  3K1H A;  1SZI A;  3R7C A;  4JCH A;  4PJN A;  4DBQ A;  3QVY A;  2IXN A;  2JD3 A;  4D4X A;  4CIH A;  2ICW G;  3EFO A;  3L0I A;  3PDM P;  1PCX A;  1PD1 A;  1O5H A;  2DYS C;  1BR4 A;  2OCC C;  1T6I A;  2EIL C;  2D4U A;  3X1O A;  3EPV A;  5BUO A;  1ZW2 A;  2O9X A;  4PR9 A;  5K0I A;  2L9J A;  2Q3T A;  2X51 A;  3RQF A;  2HSB A;  3JCU Q;  1K40 A;  5L0J A;  4RD9 A;  4HFF B;  1JAF A;  3M4B A;  3EHM A;  4XPX A;  4BPM A;  2LP4 A;  3L8I A;  2KGO A;  2GWW A;  1Z23 A;  3EG9 B;  4MTF A;  2X0C A;  4DXW A;  2V26 A;  1V74 B;  1UG7 A;  1GS9 A;  3HJC A;  3I4U A;  4IRU A;  2XLM A;  2W9Y A;  3Q7L A;  1I5N A;  4J7Y A;  2PX0 A;  3NYJ A;  4MVQ A;  1IZM A;  4N4W A;  3SNH A;  5DS4 A;  4CS7 A;  3EGX B;  5DS5 A;  2HZ8 A;  1RJ9 A;  5D91 A;  3HTK C;  3L34 A;  1U6H A;  2Z15 A;  1BR1 A;  2CGE A;  3B9Q A;  3S27 A;  4E7Z A;  3Q6N A;  1B68 A;  1MMN A;  3EZI A;  1MMD A;  2CW0 F;  4ONS A;  3O10 A;  1AUE A;  1TFK B;  2WB7 A;  2Y39 A;  5COM A;  4CJO A;  1MMG A;  2MWQ A;  2NUP A;  1JRA A;  1T5O A;  2G3V A;  4I3M A;  5A69 A;  2EPM X;  4U5D E;  1FMW A;  3ZTM A;  1LI5 A;  2LIG A;  3GAN A;  1BBH A;  2J0W A;  3QVZ A;  2A1D D;  1F1M A;  4MVU A;  1Y4C A;  2AU5 A;  2IXO A;  3QW1 A;  4HEA J;  5B1B C;  1YDI A;  3TJ6 A;  1QPU A;  3LJB A;  4I1O B;  5A6J A;  1E2X A;  3MBG A;  1BDJ B;  4PJM A;  1D0X A;  3DMD A;  4O6M A;  3SXZ A;  4PJL A;  3DKA A;  1YLM A;  2M64 A;  2YL3 A;  1NU9 C;  1YAR O;  3MX3 A;  3RYL A;  1YVI A;  4EKW A;  2NPU A;  2KC3 A;  2WZF A;  4C7O A;  1HY5 A;  3RF3 A;  3SZR A;  1FMV A;  3AJM A;  3I5Q A;  3HNK A;  3ZC4 A;  5AGF A;  2NUT B;  4J7T A;  3LEO A;  5KYX A;  2DYR C;  2C04 A;  2WZL A;  1OCZ C;  3DD7 A;  2Q9B A;  1TFO B;  3GM1 A;  3ATP A;  4XEK A;  3U3B A;  1KNY A;  1AVO B;  4C3E A;  4BJ5 A;  5F5H A;  3RVZ A;  1YYJ A;  3U9M A;  4W8P A;  2KQ9 A;  4NTB A;  4Z9I A;  3VAY A;  3EH1 A;  3G4Z A;  3CSK A;  3TOM A;  1OCR C;  3SP1 A;  1OW8 A;  4C3D A;  1VB5 A;  5A6B D;  5A6B A;  4MVS A;  2WVO A;  1Z63 A;  2Y3G A;  2ZXR A;  3ITF A;  3T6G B;  3WG7 C;  2XLE A;  3SXY A;  2R05 A;  2ZXO A;  3ZTZ A;  4DOZ A;  5B3I A;  1LS1 A;  3S84 A;  2ASR A;  2YLD A;  1EA8 A;  1Z3I X;  2CYD A;  2ETS A;  2GDC A;  3JRM O;  1OCC C;  4OD4 A;  1I4Y A;  1YZC A;  3HNI A;  1TWC A;  2Q9C A;  3VF0 A;  5FCL A;  1VTM P;  3K1I C;  3GEI A;  3AGT A;  3ZG1 A;  4BEJ A;  4DRI B;  2EIN C;  1G5Z A;  4JTC B;  2QNL A;  3W2W A;  3AOU A;  1FAP B;  2NG1 A;  1AEP A;  2YKZ A;  5D92 A;  3UGO A;  4NC3 A;  4LLE A;  1Q0D A;  2LSE A;  4YWQ A;  1T01 A;  1T6U A;  1ORS C;  5IY5 C;  1V4A A;  3AGU A;  2HSQ A;  1VLT A;  3FHD A;  3T6J A;  4CS8 A;  2G62 A;  3CZ6 A;  3FAP B;  2VB6 A;  3V7O A;  4YJW A;  4JZA A;  5FZT A;  3GOR A;  3JRT A;  4OIO F;  2A6E F;  3OWT A;  4L6R A;  1ZHW A;  2HUJ A;  2P1A A;  3KYI A;  5F28 E;  3AG3 C;  3M1C B;  4WAB A;  3ZQY A;  1TWH A;  1H6G A;  5KYN A;  3E70 C;  4P9T A;  3MYI A;  1O3U A;  1W2W A;  1SMY F;  2Q00 A;  3H2U A;  3N24 A;  4DJ9 A;  5L3Q A;  2QTV A;  1H7I A;  1C03 A;  1U89 A;  2A68 F;  1MQV A;  1LE4 A; 
#chains in the Genus database with same CATH homology
 1QQ3 A;  1NBB A;  3FOO A;  4ER9 A;  3NMK A;  4EIY A;  1RCP A;  1JAF A;  3M79 A;  3M4B A;  4U9E A;  5JSL A;  4WGY A;  4CJG A;  3M15 A;  3C63 A;  5JS5 A;  4JEB A;  1CPQ A;  2XLM A;  4N4W A;  4D4N A;  3C62 A;  3U8P A;  2XLW A;  4JKV A;  1GQA A;  1E84 A;  5JUA A;  1S05 A;  3NMI A;  4CIP A;  4CJO A;  1E85 A;  1LM3 B;  4CDV A;  3ZTM A;  1BBH A;  3QVZ A;  3QW1 A;  1QPU A;  4CX9 A;  2J8W A;  4IB4 A;  1CPR A;  2XLD A;  1YZA A;  4IAQ A;  2YLI A;  2YL3 A;  1CGN A;  3ZQV A;  2YL1 A;  4U9D A;  2XLH A;  3HNK A;  5AGF A;  3M4C A;  2XL6 A;  3VRC A;  3HNJ A;  2YL7 A;  1YYJ A;  2XM0 A;  3HNL A;  2QLA A;  3L1M A;  3TOM A;  4CDY A;  3DE8 A;  1E86 A;  3FOP A;  3NMJ A;  2YLG A;  2BC5 A;  5JT4 A;  1EKY A;  4IAR A;  4JE9 A;  5B3I A;  3ZTZ A;  2XLE A;  3IQ5 A;  4JEA A;  2J9B A;  4CDA A;  1E83 A;  5JVE A;  2CCY A;  2YLD A;  1YZC A;  3HNI A;  1MQV A;  4N6H A;  1CGO A;  4WGZ A;  2XLV A;  3QW0 A;  2YKZ A;  3DE9 A;  4NC3 A;  3ZWI A;  5JLI A;  3IQ6 A;  5JRA A;  3TOL A;  4L6R A;  1APC A;  5JP7 A;  1A7V A;  1YYX A;  2XM4 A;  256B A;  3ZQY A;  1M6T A;  2XL8 A;  2XLO A;  3QVY A;  4D4X A;  4ULV A;  2YL0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...