5AGHA

Crystal structure of the leurs editing domain of candida albicans mutant k510a
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
250
structure length
245
Chain Sequence
GYVGIKIRLTDVAPQAQELFKKESLDVKENKVYLVAATLRPETMYGQTCCFVSPKIDYGVFDAGNGDYFITTERAFKNMSFERGYYKPLFTINGKTLIGSRIDAPYAVNKNLRVLPMETVLATKGTGVVTCVPSDSPDDFVTTRDLANKPEYYGIEKDWVQTDIVPIVHTEKYGDKCAEFLVNDLKIQSPKDSVQLANAKELAYKEGFYNGTMLIGKYKGDKVEDAAPKVKQDLIDEGLAFVYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Analysis of the Resistance Mechanism of a Benzoxaborole Inhibitor Reveals Insight Into the Leucyl-tRNA Synthetase Editing Mechanism.
pubmed doi rcsb
source organism Candida albicans
molecule tags Ligase
molecule keywords POTENTIAL CYTOSOLIC LEUCYL TRNA SYNTHETASE
total genus 79
structure length 245
sequence length 250
ec nomenclature ec 6.1.1.4: Leucine--tRNA ligase.
pdb deposition date 2015-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.740.10 Alpha Beta Alpha-Beta Complex Isoleucyl-tRNA Synthetase; domain 2 Valyl/Leucyl/Isoleucyl-tRNA synthetase, editing domain 5aghA00
1GAXA 1IVSA 3ZJTA 1WK8A 4K47A 1WNZA 5AGHA 5AGIA 2AJHA 1JZSA 3O0AA 4AS1A 1ILEA 1OBCA 2AJIA 2V0GA 3ZJVA 1QU3A 1FFYA 1WNYA 1UDZA 4CQNA 1OBHA 3PZ0A 3ZGZA 1JZQA 5AGRA 1WZ2A 1WKBA 5AGTA 1UE0A 4ARIA 3PZ6A 2WFEA 2WFDA 2WFGA 5AGJA 4K48A 1WK9A 3PZ5A 1QU2A 4AQ7A 2BYTA 2BTEA 1WKAA 2AJGA 3ZJUA 5AGSA 2V0CA 1H3NA 4ARCA
chains in the Genus database with same CATH superfamily
1GAXA 1IVSA 3ZJTA 1WK8A 4K47A 1WNZA 5AGHA 5AGIA 2AJHA 1JZSA 3O0AA 4AS1A 1ILEA 1OBCA 2AJIA 2V0GA 3ZJVA 1QU3A 1FFYA 1WNYA 1UDZA 4CQNA 1OBHA 3PZ0A 3ZGZA 1JZQA 5AGRA 1WZ2A 1WKBA 5AGTA 1UE0A 4ARIA 3PZ6A 2WFEA 2WFDA 2WFGA 5AGJA 4K48A 1WK9A 3PZ5A 1QU2A 4AQ7A 2BYTA 2BTEA 1WKAA 2AJGA 3ZJUA 5AGSA 2V0CA 1H3NA 4ARCA
chains in the Genus database with same CATH topology
1GAXA 1IVSA 3ZJTA 1WK8A 4K47A 1WNZA 5AGHA 5AGIA 2AJHA 1JZSA 3O0AA 4AS1A 1ILEA 1OBCA 2AJIA 2V0GA 3ZJVA 1QU3A 1FFYA 1WNYA 1UDZA 4CQNA 1OBHA 3PZ0A 3ZGZA 1JZQA 5AGRA 1WZ2A 1WKBA 5AGTA 1UE0A 4ARIA 3PZ6A 2WFEA 2WFDA 2WFGA 5AGJA 4K48A 1WK9A 3PZ5A 1QU2A 4AQ7A 2BYTA 2BTEA 1WKAA 2AJGA 3ZJUA 5AGSA 2V0CA 1H3NA 4ARCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GAX A;  1IVS A;  3ZJT A;  1WK8 A;  4K47 A;  1WNZ A;  5AGH A;  5AGI A;  2AJH A;  1JZS A;  3O0A A;  4AS1 A;  1ILE A;  1OBC A;  2AJI A;  2V0G A;  3ZJV A;  1QU3 A;  1FFY A;  1WNY A;  1UDZ A;  4CQN A;  1OBH A;  3PZ0 A;  3ZGZ A;  1JZQ A;  5AGR A;  1WZ2 A;  1WKB A;  5AGT A;  1UE0 A;  4ARI A;  3PZ6 A;  2WFE A;  2WFD A;  2WFG A;  5AGJ A;  4K48 A;  1WK9 A;  3PZ5 A;  1QU2 A;  4AQ7 A;  2BYT A;  2BTE A;  1WKA A;  2AJG A;  3ZJU A;  5AGS A;  2V0C A;  1H3N A;  4ARC A; 
#chains in the Genus database with same CATH topology
 1GAX A;  1IVS A;  3ZJT A;  1WK8 A;  4K47 A;  1WNZ A;  5AGH A;  5AGI A;  2AJH A;  1JZS A;  3O0A A;  4AS1 A;  1ILE A;  1OBC A;  2AJI A;  2V0G A;  3ZJV A;  1QU3 A;  1FFY A;  1WNY A;  1UDZ A;  4CQN A;  1OBH A;  3PZ0 A;  3ZGZ A;  1JZQ A;  5AGR A;  1WZ2 A;  1WKB A;  5AGT A;  1UE0 A;  4ARI A;  3PZ6 A;  2WFE A;  2WFD A;  2WFG A;  5AGJ A;  4K48 A;  1WK9 A;  3PZ5 A;  1QU2 A;  4AQ7 A;  2BYT A;  2BTE A;  1WKA A;  2AJG A;  3ZJU A;  5AGS A;  2V0C A;  1H3N A;  4ARC A; 
#chains in the Genus database with same CATH homology
 1GAX A;  1IVS A;  3ZJT A;  1WK8 A;  4K47 A;  1WNZ A;  5AGH A;  5AGI A;  2AJH A;  1JZS A;  3O0A A;  4AS1 A;  1ILE A;  1OBC A;  2AJI A;  2V0G A;  3ZJV A;  1QU3 A;  1FFY A;  1WNY A;  1UDZ A;  4CQN A;  1OBH A;  3PZ0 A;  3ZGZ A;  1JZQ A;  5AGR A;  1WZ2 A;  1WKB A;  5AGT A;  1UE0 A;  4ARI A;  3PZ6 A;  2WFE A;  2WFD A;  2WFG A;  5AGJ A;  4K48 A;  1WK9 A;  3PZ5 A;  1QU2 A;  4AQ7 A;  2BYT A;  2BTE A;  1WKA A;  2AJG A;  3ZJU A;  5AGS A;  2V0C A;  1H3N A;  4ARC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...