5AGYA

Crystal structure of a tau class gst mutant from glycine
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
219
structure length
219
Chain Sequence
MQDEVVLLDFWPSPFGMRVRIALAEKGIKYEYKEEDLQNKSPLLLKMNPVHKKIPVLIHNGKPICESLIAVQYIEEVWNDRNPLLPSDPYQRAQTRFWADYVDKKIYDLGRKICTSKGEEKEAAKKEFIEALKLLEEQLGDKTYFGGDNLGFVDIALVPFYTWFKAYETFGTLNIESECPKFVAWAKRCLQKESVAKSLPDQQKVYEFIMDLRKKLGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Directed Evolution of Tau Class Glutathione Transferases Reveals a Site that Regulates Catalytic Efficiency and Masks Cooperativity.
pubmed doi rcsb
source organism Glycine max
molecule tags Transferase
total genus 84
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5agyA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5agyA01
1EEJA 2QKEA 5A4VA 3KJYA 2IMKA 4K7NA 3EMXA 3I9V2 5IMAA 2HE3A 4MJEA 3UBKA 1LBKA 3H93A 2V6OA 1EWXA 3FZ9A 2YZHA 2HSNB 1B9YC 3FR6A 3R3EA 3CRUA 2VLVA 3EE2A 2Z9SA 4X43A 5IMVA 4PX1A 1YZXA 5H5QA 4EF0A 4EKZA 1S3AA 2NBSA 3IHQA 5D9TA 1T4YA 2LV3A 2DSAA 5DAKB 3DIEA 5ECPB 3QDNA 2DJKA 3EINA 5IO0A 1H4OA 1QGVA 3KGKA 4BVYB 1ERVA 2O7KA 1TK0B 5FHIA 1JZRA 2FGXA 11GSA 2PUKC 6GSXA 4MMMA 1Z7RA 2HYXA 3Q74A 5ELAA 1KEBA 4FH8A 3TGZA 1ON4A 1WJKA 3GSSA 1XFLA 1PL2A 2IFQA 2YANA 1AIUA 2N5BA 4PUFC 3CSJA 2V32A 4ULXA 1T7PB 2OBIA 1QFNA 2WS2A 3WT2A 13GSA 1EGOA 3MWHA 5DVBA 4ZL7A 1YJ6A 1NSWA 2WCIA 3NZNA 1Z3EA 1F37A 3RDWA 2GT6A 5G5FA 4ZL8A 3RPPA 1C72A 3KP8A 1SL1B 16GSA 1IYHA 1WMJA 4LMVA 2GT5A 2MBSA 4KDYA 2E2MA 1A2LA 5A5KA 18GSA 4PURA 4AF2A 1MTCA 1O81A 2B3SA 2B1LA 4HJMA 2YCDA 3ME7A 12GSA 1GTAA 2C4JA 1BAYA 1XW9A 2HZEB 3UL3A 3IXRA 2WB9A 4EDYA 2JZTA 3EU4A 2RLIA 1OC8A 4K6XA 3BJ5A 4F82A 2HXKA 4BWQA 2ES7A 4XS4A 2HNLA 4IQ1A 4LL1B 4LLRA 5KN2A 2GTUA 3ERGA 1JZDA 2L59A 3IBHA 2LRCA 4BL7B 1T4ZA 2RM5A 4Z7XA 5ELGA 3ME8A 4E8EA 4WR4A 1O8WA 5B8AA 5HFGA 3CSIA 2LNSA 1U88A 1SENA 5IMFA 1TKDB 4MJBA 4IW9A 1GWCA 1URMA 2HSMA 2C3QA 3WYWA 1GL8A 5JCWA 3MAKA 1K0CA 5F05A 5ID2B 1Q4JA 1BYEA 2KUCA 2V2GA 2LJRA 4BA7A 4MJAA 4F0CA 5EL8A 3RPNA 4IN0A 4V2NA 1HQOA 1A8LA 5CRGA 4NXIA 1GSQA 2BJXA 3WGDA 3D0ZA 5IMZA 1FHEA 5JWRB 4K2DA 1YEPA 3PR8A 1G6YA 3GRXA 3F4TA 1QXHA 3EWLA 4LA1A 1XCCA 4ILFA 2ON5A 1J9BA 3D22A 3TRQA 2OJLA 5D9VA 1XWCA 4GQFA 4EC0A 1B4QA 4JE1A 4POLA 1TRUA 3P2AA 4KB3A 2E7PA 2H1GA 2F3MA 2PN8A 2LQQA 4KSMA 4L5OA 1B4PA 2IFQB 2PMTA 1TI3A 4PUAA 1WOUA 1OAZA 4Q5QA 3UARA 5IMDA 4HDEA 3QCPA 3KD0A 1HNCA 2M46A 3IPZA 4POBA 3F3QA 3ZFLA 4OO4A 3G7IA 2RM6A 3GURA 3HZ8A 4X1UA 2X8CA 4MA9A 3A2WA 3CMIA 3GFKA 5JCGA 4G0LA 3F8UA 4WBRD 4NV2A 3QAGA 2F9SA 2GDRA 2VL2A 1A0RP 3FK8A 3L0HA 1FAAA 3VPQA 3G9BA 2ON7A 5ECSA 5IPGA 1EEMA 2FD3A 4HS1A 2LQOA 3JCML 1R4WA 3HHVA 3ZVJA 1A2MA 4V1Ap 2CAQA 2FUG2 4ECJA 2GZPA 5D8IA 9GSSA 1AAZA 3LYPA 4Q5NA 4TR3A 2L4CA 2GS3A 1X9MB 2JU5A 2HZFA 2R2JA 4DSQA 3M1GA 2YV7A 3M3MA 3J7Yb 5EVOA 4F03A 3CXGA 3HXSA 1AC1A 5IIZA 4XS4B 4G9HA 1JZWA 5G1LA 4TVEA 1KBNA 2CVBA 5J5NA 4TR0A 2MYGA 2NVLA 1DE1A 5D93A 1YEXA 1FG4A 2JADA 4DVCA 3DD3A 5G30A 1JFUA 3LGCA 20GSA 3QOUA 2L5OA 3ZIJA 1PMTA 4P3YB 4QL9A 2HSMB 2B6MA 2FNOA 2FWGA 1UN2A 2O87A 2GGTA 2P31A 2O8VB 3J7Yk 2H6XA 1SYRA 2GSQA 4ZILA 3UIWA 1GTBA 2DJ3A 1HNBA 4KSOA 5ECMB 3L9UA 5J9CA 4NAXA 3VWVA 1XZOA 2XPDA 4EE0A 1DSBA 4I2UA 4KE3A 4ID0A 1XIYA 2VLUA 4DSSB 3UEMA 3L9SA 4IP1A 4ML1A 3IC4A 4EDZA 1SKSB 5AIXA 4ISDA 4HI7A 5A4WA 3HZ4A 3HA9A 5IM9A 2YN1A 1WIKA 2HFDA 2VLTA 2HRAA 3TJFA 3TUEA 5A4UA 2IMIA 4OFMA 3TKSA 4JBBA 5CRWA 3C73A 4O32A 1HYUA 3TRXA 3DGQA 1WE0A 3GYKA 4KUNA 2OE3A 3CSHA 1SKRB 4DSRA 4JEDA 1FVKA 3GN3A 2H01A 2VL3A 3KCMA 1JLVA 2H74A 2FWFA 4K7OA 1K0NA 3CRTA 2LJKA 6GSWA 2VIMA 4ZB8A 1OC3A 2KOKA 3N5OA 3ZITA 1ZZYA 2B7KA 4FYCA 2H0IA 2UZ8A 3HD5A 3BCIA 5H5SA 4N0ZA 3A2XA 3N9JA 1G7OA 3ZREA 3PPUA 3W8SA 2MBTA 3LFLA 4F0BA 5GZZB 3RHBA 4KCAA 1AUCA 2YV9A 3E3EA 4ECIA 4PQ1A 4G10A 4GSNA 4WETA 4FO5A 2HRNA 4V2MA 4EXJA 1SJZA 2PVOC 1NW2A 3LXZA 4G19A 1X5EA 2JACA 2HQTA 3KTLA 3FR3A 4FYUA 2HI7A 1UVZA 2C0EA 1PX6A 2VL9A 5ECNB 4Q5FA 5DDLA 3C8EA 2H0GA 3HKRA 3TKPA 3RAZA 3F63A 2D2ZA 2LNTA 1FO5A 4MH2A 3EYTA 1ILOA 3OR5A 4XRAA 5D9WA 2YWOA 4FIWA 3M9KA 5ID2A 1M9AA 3O76A 3LJRA 1PRXA 3FZAA 3H79A 3VPTA 2GVPA 2LEGA 4N11A 4IJIA 2QC7A 1ZYQB 5IPHA 2IWTA 1GSSA 2VD1A 4FQUA 4HU7A 3P8WA 4J2FA 2V1MA 2VD0A 3TKQA 1AQVA 1XPVA 4ZB9A 3E0UA 4OD7A 3IV4A 1PA3A 1X0RA 1XW5A 2IMDA 3WGXA 3CTFA 4AJ8A 3GA4A 10GSA 3TDGA 1TW9A 4GWRA 1ERTA 2TIRA 3IAS2 3S9FA 1MDKA 1T1VA 1NHYA 3HVVA 4GSTA 2HRFA 3RBTA 4KX4A 1M9BA 3CTGA 3VWWA 3GL5A 1LJRA 4DEJA 1R5PA 2GQLA 2E2GA 1A2JA 1S3CA 4WKWA 3BBYA 4HQZA 5D73A 1JZOA 1B9XC 2X64A 2CVKA 5AIVA 4RQRA 3KMOA 4E8HA 3KEBA 3LEFA 3H1NA 1XOAA 4KNDA 2KP2A 3NIVA 5L71A 4JU5A 5C00A 3ED3A 2CV4A 5LCZA 1GUKA 4J56E 5DCHA 1I5GA 1T3BA 2NPBA 1V40A 4MF5A 2GLRA 3C1RA 2P5RA 2X99A 5J41A 1A23A 1PX7A 3DRNA 1OC9A 1G7EA 1TRSA 2G0FA 1ZOFA 4TRXA 3A5WA 1WP0A 3GKXA 4ZXGA 4EVMA 2LUSA 2R3XA 3HJOA 5F07A 3F6FA 4KDUA 5DJMA 4GCIA 2VM1A 1E6BA 1GNEA 5IOWA 2EIQA 1TU7A 1GSDA 1EZKA 2DIZA 3WGEA 5CRDA 4BPYA 2VL2C 2R6KA 4K0GA 5IQYA 2AHEA 2YZUA 3EU3A 1FOVA 5GSTA 2BTOT 3TRPA 3LXTA 4WF4A 1GSUA 2CA8A 4KCEA 3UMAA 3F0IA 1RQMA 1SJ6A 1DUGA 3WD6A 1SJIA 3GMFA 5CNWA 1K0DA 1GTIA 3L78A 5IOXA 4L8EA 1M0UA 1W89A 4K7IA 1F6MC 4KA0A 3K8NA 1M99A 3ZFBA 3TJJA 2YJ7A 3AY8A 3GH9A 1ZYEA 5J4UA 2IMEA 1ST9A 2C8UA 3GX8A 1GSEA 5F06A 2DIYA 3I6AA 1N8JA 1WWJA 2C0GA 1QK8A 2LTKA 3D5JA 3GL3A 2VCVA 4ZBDA 2BMXA 1VF1A 4GTUA 3P7XA 4OCEA 3R2QA 1PSQA 1VF4A 1TOFA 1U6TA 4KAEA 3O6TA 3RHCA 4DSSA 2YJHA 3KIJA 1XWGA 4TR1A 5HR3A 5LNKe 1NM3A 4TN8A 1YDKA 8GSSA 3QFAC 3GIXA 1VGLA 1X9SB 1XBSA 2LRTA 5ECOB 2E0QA 2IN3A 4QQ7A 3UAPA 1TK8B 2FWEA 3DVWA 2LRNA 3CBUA 2DBCA 2AAWA 3A2VA 1ABAA 3ZLPA 2VM2A 5CAXA 1EV4A 2IJYA 1MD4A 3UBLA 2K9FA 1BX9A 1O7UA 5FT3A 4YAPA 2H73A 4MZWA 1JHBA 2F51A 1V2AA 2J9HA 3L4NA 3GSTA 1H75A 2WULA 2PBJA 3HYPA 2GQMA 4IKHA 3TJGA 3C71A 3FRCA 3D4TA 4MABA 1XWKA 1M2AA 5KN0A 2NTOA 2C3TA 3EVIA 1EP7A 5B6NA 2OKAA 2B1KA 3TKSC 4HUAA 5EY6A 2MMZA 1ZGNA 5COHA 5GSSA 4TKYA 4IQAA 4NPBA 4CDOA 3WT1A 2GZYA 5F0GA 2P0GA 1O85A 3KH9A 2MMAA 2KP1A 1G6WA 4CHSA 1Z5YE 1OC9B 1FB0A 4JRRA 5LD0A 4HQSA 4XS6A 3ZTLA 2H0HA 2GQKA 2C1YA 3MDKA 2B5XA 1R5AA 1SKWB 1EOGA 5AN1A 3HY2A 2A2RA 1SD8A 1SL0B 5JWQB 1EV9A 5DQSA 1AQWA 1GUMA 2PWJA 3QMXA 1MDIA 2A4VA 5ABRA 2NDOA 2PGTA 3IRAA 6GSUA 2YP6A 3ZZXA 4PXOA 4MPGA 1F3BA 4O5RA 2PVQA 2CZ2A 1MEKA 4HJ2A 4XIHA 3GUSA 4I8BA 6GSYA 2XC2A 3TJBA 1BG5A 3GV1A 4G0KA 1M2BA 1B48A 4TXVA 2CX4A 3KP9A 3IE3A 4XS1A 1A0FA 4G0IA 1BEDA 1TTZA 2X8GA 1Y6EA 1GH2A 3CYNA 2JSYA 5CRHA 3HCZA 1M2DA 2TRCP 2H1BA 3D21A 4OFTA 5ECQB 2R4VA 3IDVA 2CX3A 3Q6OA 4OWYA 3F4SA 2V41A 3F3RA 1K0OA 3FR9A 4I5QA 4HU9A 2JZSA 4CW9A 1OKTA 3TOTA 4GF0A 4TR1B 5D96A 3QAWA 1ZCPA 1OKDA 1GUHA 1BJXA 3PINA 2DC5A 4PGTA 3DMLA 4YQMA 3P90A 3KZQA 4WR5A 1YKAA 4EO3A 4AJ7A 6GSTA 4L0WA 3APSA 4J57E 1KTEA 5HR0A 2REMA 3IR4A 2OE0A 2TRXA 5HFIA 2C80A 4POKA 4LMWA 5E59A 2C3NA 4D73A 1WRYA 3TKSE 2VCZA 2MMOA 2WRTA 4IGJA 1PN9A 1GULA 2FHEA 3ZMKA 1XWBA 4ZIJA 7GSSA 2H6YA 2VAFA 3FHKA 1ML6A 1YF0A 1UC7A 2PERA 4K1FA 4OO5A 5HQPA 2MZCA 4HZ2A 3IOSA 2M72A 4KGIA 4Q5RA 2AB6A 2WDUA 1GTUA 2J23A 1XWAA 2WGRA 2FLSA 5KN3A 1O73A 4I6XA 1F9MA 1Z7PA 4GQCA 2A2SA 4MJCA 2C0DA 3IA1A 2EIOA 5G5EA 1TJDA 6GSSA 4WF5A 5ECIB 5DBQA 1YQ1A 1GP1A 2LS5A 3IK7A 2DJJA 4ECBA 3DEXA 5B7CA 4OMVA 4GLTA 5B6MA 4PQIA 3DWVA 5D9XA 1SK0A 4WXTA 2AJQB 2YWIA 2IMFA 2I3YA 3ISOA 1V9WA 2L4QA 2V6KA 3GKKA 1GRXA 4K0NA 1THOA 3IC8A 3U6VA 2H66A 4N0VA 3BCKA 1Q98A 1SK2A 3HVSA 3F6DA 2AV4A 4YAVA 1J08A 1VF3A 3D4MA 1I9DA 4IELA 4NV5A 1PKZA 1YY7A 2FA8A 2H8LA 5JWOB 2G2QA 2VCQA 1QUWA 5EPFA 4NHZA 2K18A 1GSFA 4MP4A 4BWSA 2XPEA 5JCUA 1SYXA 1T00A 2H75A 4H86A 1N2AA 1O6JA 4MF6A 2HSHA 4O7HA 4WEYA 4I2TA 3I43A 4MH3A 1A8YA 2XHFA 1X9WB 3US3A 3VFIA 3FKFA 3LWAA 2GSTA 5AGYA 3D6IA 3QPMA 4MLYA 5G2ZA 3DXBA 2H1AA 4MDCA 2K8VA 4F9ZA 1MD3A 2VOCA 1PGTA 3ERFA 5IMCA 4MZCA 3V1WA 3UVHA 5ECLB 3M0FA 4ACSA 4HEA2 2AUVA 3W6GA 2O85A 3UOMA 4D73B 3W8JA 3VI5A 1VF2A 1LU4A 1ERWA 2CQ9A 3Q18A 1XVWA 2B7JA 3SWLA 1AW9A 1XXUA 4XCSA 1M7TA 5DQYA 1K3LA 4V2LA 4XRDA 2GSSA 1G0TA 3GTUA 2FWHA 3Q19A 3ZMLA 4OFNA 4ZL9A 1T8EB 1UA5A 2H30A 3PGTA 2XBIA 2DJ2A 22GSA 1K3YA 3E9JB 2VCXA 3TCOA 4NHWA 4PNFA 1OYJA 1TK5B 1J0FA 5CYYA 2H1DA 1AXDA 1YF1A 14GSA 1TU8A 1WPIA 2JSZA 3FZ5A 2FCHA 1EP8A 4JZQA 3VURA 4KDXA 2HT9A 1Z9HA 3BD2A 3APQA 5G31A 4IJ3A 1K0BA 1YKCA 5ECKB 2FY6A 2KLXA 2OBKA 1V58A 2DJ1A 3EMPA 4F2IA 4PTSA 2OE1A 2I1UA 4AGSA 4ZBBA 1DBYA 3C1SA 3MNGA 2HSYA 3GH6A 2YWNA 3ERWA 4YQVA 2DJ0A 1Y25A 4OCFA 5H5RA 2GSRA 3KM6A 2VO4A 17GSA 1DE2A 1F2EA 2FA4A 2ALBA 1OE7A 2H72A 4JR4A 3UJ1A 3M9JA 5ECHB 5DJLA 5DALA 3ZIVA 2C0FA 3HJMA 2HRKA 1SU9A 1QQ2A 2EC4A 1HNAA 4RI7A 2R5GA 3IK9A 4ZBAA 1Z6NA 4EL1A 3TOUA 5KN1A 2X8HA 1OVNA 3KMNA 4POMA 4YH2A 2QSIA 4MCUA 1RK4A 3GHAA 3DKSA 2B5YA 3L9VA 3F9UA 1XVQA 5FWGA 1U87A 4GXZA 3HJPA 1THXA 4XTSA 1RW1A 4N10A 2HLSA 2WZ9A 4IHUA 2VCTA 4FYBA 2CZ3A 3ZRDA 4K9ZA 2QGVA 1SL2B 1R7HA 3KTBA 3ZVJD 2LSTA 4WBJA 1XW6A 1ZMAA 4KW6A 4IS0A 1ERUA 3DVXA 4L0UA 1NHOA 2H6ZA 2N5FA 4MZBA 5ECRB 4TXOA 4USSA 5F8BA 4GRFA 3H4KA 2GZZA 3TJKA 3UVTA 1K3OA 3O3TA 4IP6A 1V98A 4GSSA 19GSA 1IYIA 2YOIA 1SK1A 1TDIA 1BQ7A 4KF9A 3C7MA 4ML6A 5KEJA 1W4VA 2RIIA 5GAND 3IAM2 1X5DA 2H71A 1TXXA 1GNWA 3VLNA 1PQNA 2RUFA 4N30A 1QMVA 4IVFA 1TRVA 1GLPA 2KHPA 2ZUPA 2L6CA 2AYTA 5INYA 4BVXA 2VUPA 3GTUB 3VWXA 4ECCA 3LQ7A 1B8XA 3PH9A 5G1KA 1K0MA 1O8XA 5DCGA 2OADA 2DLXA 1F3AA 1X5CA 3VI7A 3NOFA 2H76A 4KH7A 2JZRA 2R37A 2N5AA 1USBA 4HZ4A 2IPAA 5E4WA 1MDJA 3QR6A 4TOPA 2VCWA 6GSVA 4EUYA 3U5RE 3FY7A 4MPFA 2L57A 3F4RA 1XOBA 2LJAA 1CQHA 1Z6MA 3M8NA 4PQHA 1TRWA 2MMNA 3FZ4A 1JLWA 3FEUA 2F8AA 2LKUA 1AQXA 3H8QA 2CT6A 5B8BA 2YPMA 2YNXA 4XHMA 3MSZA 1CQGA 4LL4B 2F8FA 1A24A 2WJUA 2RUEA 3GKMA 2CVDA 4X0XA 5J3RA 2OACA 2I81A 3EURA 3GNJA 4I97A 5DALB 2PPTA 3G7YA 5HFKA 3TKRA 2HRKB 3I69A 2B5EA 1PKWA 5DAKA 2I4AA 4MF7A 1FVJA 4MK3A 3VK9A 4BVYA 4G2EA 2CAIA 1S3DA 3G7JA 1ACVA 3HVXA 1SD9A 5AISA 1GSYA 1TI1A 3GX0A 3VWUA 2IL3A 5BMUA 1VRSD 4ZB6A 2K6VA 2JL4A 4RUVA 1OE8A 2IIYA 2L6DA 2YWMA 3DYRA 1E2YA 1U3AA 1EOHA 1PL1A 3LG6A 4JR6A 5IO2A 1R26A 5ENUA 5CP1A 4YQUA 4O92A 1V57A 1U3IA 3LYKA 2L5LA 4RQXA 4TXOB 3QD9A 4HOJA 3BOAA 2OA7A 3FYGA 2DMMA 3QAVA 3SBCA 1HD2A 4IBPA 4PNGA 2H70A 5CREA 3GKNA 5CO3A 2PU9C 2I9HA 1GLQA 2H19A 3LORA 2K8SA 5J9BA 1FW1A 4L5LA 4NWYA 1TP9A 3KH7A 1K0AA 5HR2A 1PD21 4QL7A 1KNGA 2EIRA 2P5QA 1FB6A 2O89A 3LSZA 3HDCA 4BVXB 4V1Ag 3A3TA 5GAPD 1ZL9A 4TW5A 2ZCTA 4TR4A 4RI6A 2HZEA 3TB2A 2WFCA 5HR1A 2XBQA 4AJ6A 4NMUA 2DMLA 3APOA 1EGRA 3QFBC 4BL7A 2M80A 4K8MA 3ZL5A 3ZYWA 2ZNMA 5C04A 3EC3A 3FW2A 3KXOA
chains in the Genus database with same CATH superfamily
1EEJA 2QKEA 5A4VA 3KJYA 2IMKA 4K7NA 3EMXA 3I9V2 5IMAA 1SVLA 4G01A 2HE3A 4MJEA 3UBKA 1LBKA 3H93A 2V6OA 1EWXA 3FZ9A 2YZHA 2HSNB 1B9YC 5J4YA 1SVMA 3FR6A 3R3EA 3CRUA 2VLVA 3EE2A 2Z9SA 4X43A 5IMVA 4PX1A 1YZXA 5H5QA 4EF0A 4EKZA 1S3AA 2NBSA 3IHQA 5D9TA 1T4YA 2LV3A 2DSAA 5DAKB 3DIEA 5ECPB 3QDNA 2DJKA 3EINA 5J4VA 5IO0A 1H4OA 1QGVA 3KGKA 4BVYB 1ERVA 2O7KA 3RGBC 2WW2A 1TK0B 5FHIA 1JZRA 2FGXA 11GSA 2PUKC 6GSXA 1M3JA 4MMMA 1Z7RA 2HYXA 3Q74A 5BMUB 5ELAA 1KEBA 4FH8A 4A5PA 3TGZA 1ON4A 1WJKA 3GSSA 1XFLA 1PL2A 2IFQA 2YANA 5A1NB 1AIUA 2N5BA 4PUFC 3CSJA 2V32A 4ULXA 1T7PB 2OBIA 1QFNA 4ICYA 2WS2A 3WT2A 13GSA 1EGOA 3MWHA 5DVBA 4ZL7A 1YJ6A 1NSWA 2WCIA 3NZNA 1Z3EA 1F37A 3RDWA 2GT6A 5G5FA 4ZL8A 3RPPA 1C72A 3KP8A 1SL1B 2QA2A 16GSA 1IYHA 1WMJA 4CY6A 4LMVA 2GT5A 2MBSA 4KDYA 2E2MA 1A2LA 2R0GA 5A5KA 18GSA 4PURA 4AF2A 1MTCA 1O81A 2B3SA 2B1LA 4HJMA 2YCDA 1XW9A 12GSA 1GTAA 2C4JA 1BAYA 2HZEB 3ME7A 3UL3A 3IXRA 2WB9A 4EDYA 2JZTA 3EU4A 2RLIA 1OC8A 4K6XA 3BJ5A 4F82A 2HXKA 4BWQA 2ES7A 4XS4A 2HNLA 4IQ1A 4LL1B 4LLRA 5KN2A 2GTUA 3ERGA 1JZDA 2L59A 3IBHA 2H1LA 2LRCA 4BL7B 1T4ZA 2RM5A 4Z7XA 5ELGA 3ME8A 4E8EA 4WR4A 1O8WA 5B8AA 4HSCX 5HFGA 3CSIA 2LNSA 1U88A 1SENA 2QA1A 5IMFA 1TKDB 4K5SA 4MJBA 4IW9A 1GWCA 1URMA 2HSMA 2C3QA 3WYWA 1GL8A 5JCWA 3MAKA 1K0CA 5F05A 5ID2B 1Q4JA 1BYEA 2KUCA 2V2GA 2LJRA 4BA7A 4MJAA 4F0CA 5EL8A 3RPNA 4IN0A 1S4BP 4V2NA 1HQOA 5A5HA 1A8LA 5CRGA 4NXIA 1GSQA 2BJXA 4QMKA 3WGDA 3D0ZA 5IMZA 1FHEA 5JWRB 4K2DA 1YEPA 3PR8A 1G6YA 2O36A 3GRXA 3F4TA 1QXHA 3EWLA 4LA1A 1XCCA 4ILFA 2ON5A 1J9BA 3D22A 3TRQA 2OJLA 5D9VA 1XWCA 4GQFA 4EC0A 1B4QA 4JE1A 4POLA 1TRUA 3P2AA 4KB3A 2E7PA 2H1GA 2F3MA 2PN8A 2LQQA 4KSMA 4L5OA 1B4PA 2IFQB 2PMTA 1TI3A 4PUAA 1WOUA 1OAZA 4Q5QA 3UARA 5IMDA 4HDEA 1HNCA 3KD0A 2M46A 3IPZA 3QCPA 4POBA 3F3QA 3ZFLA 4OO4A 3G7IA 2RM6A 3GURA 3HZ8A 4X1UA 2X8CA 4MA9A 3A2WA 1PN0A 3CMIA 3GFKA 5JCGA 1BG1A 4G0LA 3F8UA 4WBRD 4NV2A 3QAGA 2F9SA 2GDRA 2VL2A 1A0RP 2R0PA 3FK8A 3L0HA 1FAAA 3VPQA 3G9BA 2ON7A 5ECSA 5IPGA 1EEMA 2FD3A 4HS1A 2LQOA 3JCML 1R4WA 3HHVA 3ZVJA 1A2MA 4V1Ap 2CAQA 2FUG2 4ECJA 2GZPA 5D8IA 9GSSA 1AAZA 3LYPA 4Q5NA 4TR3A 2L4CA 2GS3A 1X9MB 2JU5A 2HZFA 2R2JA 4DSQA 3M1GA 2YV7A 3M3MA 3J7Yb 5EVOA 4F03A 3CXGA 3HXSA 1AC1A 5IIZA 4XS4B 4G9HA 1JZWA 5G1LA 4TVEA 1KBNA 2CVBA 5J5NA 4TR0A 2MYGA 2NVLA 1DE1A 5D93A 1YEXA 1FG4A 2JADA 4DVCA 3DD3A 5G30A 2EFHA 1JFUA 3LGCA 20GSA 3QOUA 2L5OA 3ZIJA 1PMTA 4P3YB 4QL9A 2HSMB 2B6MA 2FNOA 1PFOA 2FWGA 1UN2A 2O87A 2GGTA 2P31A 2O8VB 3J7Yk 2H6XA 1SYRA 2GSQA 4ZILA 3UIWA 1GTBA 2DJ3A 1HNBA 4KSOA 5ECMB 3L9UA 5J9CA 4NAXA 3VWVA 1XZOA 2XPDA 4EE0A 1DSBA 4I2UA 4KE3A 4ID0A 1XIYA 2VLUA 5A5HB 4DSSB 3UEMA 3L9SA 4IP1A 1BF5A 4ML1A 2O3EA 3IC4A 4AI6A 4EDZA 1SKSB 5AIXA 4ISDA 4HI7A 5A4WA 3HZ4A 3FMWA 3HA9A 5IM9A 2YN1A 1WIKA 2HFDA 2VLTA 2HRAA 3TJFA 3TUEA 5A4UA 2IMIA 4OFMA 3TKSA 4JBBA 5CRWA 2VKZG 3C73A 4O32A 1M3IA 1HYUA 3TRXA 3DGQA 1WE0A 4EIQA 2A4HA 3GYKA 4KUNA 2OE3A 3CSHA 1SKRB 4DSRA 4JEDA 1FVKA 3GN3A 2H01A 2VL3A 3KCMA 1JLVA 2H74A 2FWFA 4K7OA 1K0NA 4X4JA 3CRTA 2LJKA 6GSWA 2VIMA 4ZB8A 1OC3A 2KOKA 3N5OA 1YVLA 3ZITA 1ZZYA 2B7KA 4FYCA 2H0IA 2UZ8A 3HD5A 3BCIA 5H5SA 4N0ZA 3CHXC 3A2XA 3N9JA 1G7OA 3ZREA 3PPUA 3W8SA 2MBTA 3LFLA 4F0BA 5GZZB 3RHBA 4KCAA 1AUCA 2YV9A 3E3EA 4ECIA 4PQ1A 4G10A 4GSNA 4PI0C 4WETA 4FO5A 2HRNA 4V2MA 4EXJA 1SJZA 2PVOC 1NW2A 3LXZA 4G19A 1X5EA 2JACA 2HQTA 3KTLA 3FR3A 4FYUA 2HI7A 1UVZA 2C0EA 1PX6A 2VL9A 5ECNB 4Q5FA 5DDLA 3C8EA 2H0GA 3HKRA 3TKPA 2DKIA 4AKXB 3RAZA 3F63A 2D2ZA 2LNTA 1FO5A 4MH2A 3EYTA 1ILOA 3OR5A 4XRAA 5D9WA 2YWOA 4FIWA 3M9KA 5ID2A 1M9AA 2A2PA 3O76A 3LJRA 1PRXA 3FZAA 3H79A 3VPTA 4PI2C 2GVPA 2LEGA 4N11A 4IJIA 2QC7A 1ZYQB 5IPHA 2IWTA 1GSSA 2VD1A 4FQUA 4HU7A 3P8WA 4J2FA 2V1MA 2EFCA 2VD0A 3TKQA 1AQVA 1XPVA 4ZB9A 3E0UA 4YKGA 4OD7A 3IV4A 1PA3A 1X0RA 4FXYP 1XW5A 1I1IP 2IMDA 3WGXA 3CTFA 4AJ8A 3GA4A 10GSA 3TDGA 1TW9A 4GWRA 1ERTA 2TIRA 3IAS2 3S9FA 1MDKA 1T1VA 1NHYA 3HVVA 4GSTA 2HRFA 3RBTA 4KX4A 1M9BA 3CTGA 3VWWA 3GL5A 1LJRA 4DEJA 1R5PA 2GQLA 2E2GA 1A2JA 1S3CA 4WKWA 3BBYA 4HQZA 5D73A 1JZOA 1B9XC 2X64A 2CVKA 5AIVA 4RQRA 3KMOA 4E8HA 3KEBA 3LEFA 3H1NA 1XOAA 4KNDA 4EIPA 2KP2A 3NIVA 5L71A 4JU5A 5C00A 3ED3A 2CV4A 5LCZA 1GUKA 4J56E 5DCHA 1I5GA 1T3BA 2NPBA 1V40A 4MF5A 2GLRA 3C1RA 2P5RA 2WVYA 2X99A 5J40A 5J41A 1A23A 1PX7A 3DRNA 1OC9A 1G7EA 1TRSA 2G0FA 1ZOFA 4TRXA 3A5WA 1WP0A 3GKXA 4ZXGA 2O5VA 4EVMA 2LUSA 2R3XA 3HJOA 5F07A 3F6FA 4KDUA 5DJMA 4GCIA 1ZYPA 2VM1A 1E6BA 1GNEA 5IOWA 2EIQA 1TU7A 1GSDA 1EZKA 2DIZA 3WGEA 5CRDA 4BPYA 2VL2C 2R6KA 4K0GA 5IQYA 2AHEA 5KOWA 2YZUA 3EU3A 1FOVA 5GSTA 2BTOT 3TRPA 3LXTA 4WF4A 1GSUA 2CA8A 4KCEA 3UMAA 3F0IA 1RQMA 1SJ6A 1DUGA 3WD6A 1SJIA 3GMFA 5CNWA 1K0DA 3TU3B 1GTIA 3L78A 5IOXA 4L8EA 1M0UA 1W89A 4K7IA 1F6MC 4KA0A 3K8NA 4O5QA 1M99A 4PHZC 3ZFBA 3TJJA 2YJ7A 3AY8A 3GH9A 1ZYEA 5J4UA 2IMEA 1ST9A 2C8UA 3GX8A 1GSEA 5F06A 2DIYA 3I6AA 1N8JA 1WWJA 2C0GA 1QK8A 2LTKA 3D5JA 3GL3A 3MIXA 2VCVA 4ZBDA 2BMXA 1VF1A 4GTUA 3P7XA 4OCEA 3R2QA 1PSQA 1VF4A 1TOFA 1U6TA 4KAEA 3O6TA 3RHCA 4DSSA 2YJHA 3KIJA 1XWGA 4TR1A 5HR3A 5LNKe 1NM3A 4TN8A 1YDKA 8GSSA 3QFAC 3GIXA 1VGLA 1X9SB 1XBSA 2LRTA 5ECOB 2E0QA 2IN3A 4QQ7A 3UAPA 1TK8B 2FWEA 3DVWA 2LRNA 3CBUA 2DBCA 2AAWA 3A2VA 1ABAA 3ZLPA 2VM2A 5CAXA 1EV4A 2IJYA 1MD4A 3UBLA 2K9FA 1BX9A 1O7UA 5FT3A 4YAPA 2H73A 4MZWA 1JHBA 2F51A 1V2AA 2J9HA 3L4NA 3GSTA 1H75A 2WULA 2PBJA 3HYPA 2GQMA 4IKHA 3TJGA 3C71A 3FRCA 3D4TA 4MABA 1XWKA 1M2AA 5KN0A 2NTOA 2C3TA 3EVIA 1EP7A 5B6NA 2OKAA 2B1KA 3TKSC 4HUAA 5EY6A 2MMZA 1ZGNA 5COHA 5GSSA 4TKYA 4IQAA 4NPBA 4CDOA 3WT1A 2GZYA 5F0GA 2P0GA 1O85A 3KH9A 2MMAA 2KP1A 1G6WA 4CHSA 1Z5YE 2WZSA 4AKGA 1OC9B 1FB0A 4JRRA 1XG8A 5LD0A 4HQSA 4XS6A 3ZTLA 2H0HA 2GQKA 2C1YA 3MDKA 2B5XA 1R5AA 1SKWB 1EOGA 5AN1A 3HY2A 2A2RA 1SD8A 1SL0B 2X49A 5JWQB 1EV9A 5DQSA 1AQWA 1GUMA 2PWJA 3QMXA 1MDIA 2A4VA 5ABRA 2NDOA 2PGTA 3IRAA 6GSUA 2YP6A 4K2XA 3ZZXA 4PXOA 4MPGA 1F3BA 1ZYNA 4O5RA 2PVQA 4K5RA 2CZ2A 1MEKA 4HJ2A 4XIHA 3GUSA 4AKHA 6GSYA 4I8BA 2XC2A 3TJBA 1BG5A 3GV1A 4G0KA 1M2BA 1B48A 4TXVA 2CX4A 3KP9A 3IE3A 4XS1A 1A0FA 4G0IA 1BEDA 1TTZA 2X8GA 1Y6EA 1GH2A 3CYNA 2JSYA 5CRHA 3HCZA 1M2DA 2TRCP 2H1BA 3D21A 4OFTA 5ECQB 2R4VA 3IDVA 2CX3A 3Q6OA 4OWYA 3F4SA 2V41A 3F3RA 1K0OA 3FR9A 4I5QA 4HU9A 2JZSA 4CW9A 1OKTA 4O5UA 3TOTA 4GF0A 4TR1B 5BRTA 5D96A 3CWGA 3QAWA 1Y1UA 1ZCPA 1OKDA 1GUHA 1BJXA 3PINA 2DC5A 4PGTA 3DMLA 4YQMA 3P90A 3KZQA 4WR5A 1YKAA 4EO3A 4AJ7A 6GSTA 4L0WA 3APSA 4J57E 1KTEA 5HR0A 2REMA 3IR4A 2OE0A 2TRXA 5HFIA 2C80A 4POKA 4LMWA 5E59A 2C3NA 4D73A 1WRYA 3TKSE 2VCZA 2MMOA 2WRTA 4IGJA 1PN9A 1GULA 2FHEA 3ZMKA 1XWBA 4ZIJA 7GSSA 2H6YA 2VAFA 3FHKA 1ML6A 1YF0A 1UC7A 2PERA 4K1FA 4OO5A 5HQPA 2MZCA 4HZ2A 3IOSA 2M72A 4KGIA 4Q5RA 2AB6A 2WDUA 1GTUA 2J23A 1XWAA 2WGRA 2FLSA 5KN3A 1O73A 4I6XA 1F9MA 1Z7PA 4GQCA 2A2SA 1SVOA 4MJCA 2C0DA 3IA1A 3LW9A 2EIOA 5G5EA 1TJDA 2WVXA 3CQFA 6GSSA 4WF5A 5ECIB 5DBQA 1YQ1A 1GP1A 2LS5A 3IK7A 2WW0A 2DJJA 4ECBA 3DEXA 5B7CA 4OMVA 3A5IA 4GLTA 5B6MA 5KOXA 4PQIA 3DWVA 5D9XA 1SK0A 4WXTA 2AJQB 2YWIA 2IMFA 2WW3A 2I3YA 3ISOA 1V9WA 2R0CA 2L4QA 2V6KA 3GKKA 1GRXA 4K0NA 1THOA 3IC8A 3U6VA 2H66A 4N0VA 3BCKA 1Q98A 1SK2A 3HVSA 3F6DA 2AV4A 4YAVA 1J08A 1VF3A 3D4MA 1I9DA 4IELA 4NV5A 1PKZA 1YY7A 2FA8A 2H8LA 5JWOB 4YKFA 2G2QA 2VCQA 1QUWA 5EPFA 4NHZA 2K18A 1GSFA 4MP4A 4BWSA 2XPEA 5JCUA 1SYXA 1T00A 2H75A 4H86A 1N2AA 1O6JA 4MF6A 2HSHA 4O7HA 4N3ZA 4WEYA 4I2TA 3I43A 4MH3A 1A8YA 2XHFA 1X9WB 3US3A 3VFIA 3FKFA 3LWAA 2GSTA 4MNNA 5AGYA 3D6IA 3QPMA 4MLYA 2DKHA 5G2ZA 3DXBA 2H1AA 4MDCA 2K8VA 4F9ZA 1MD3A 2VOCA 1PGTA 3ERFA 5IMCA 4MZCA 3V1WA 3UVHA 5ECLB 3M0FA 4ACSA 4HEA2 2AUVA 3W6GA 4BIKA 2O85A 4W66A 3UOMA 4D73B 3W8JA 3VI5A 1VF2A 5J47A 1LU4A 1ERWA 2CQ9A 3Q18A 1XVWA 2B7JA 3SWLA 1AW9A 4Z2UA 1XXUA 3IHGA 4XCSA 1M7TA 5DQYA 1K3LA 4V2LA 4XRDA 2GSSA 1G0TA 3GTUA 2FWHA 3Q19A 3ZMLA 4OFNA 4ZL9A 1T8EB 1UA5A 2H30A 3PGTA 2XBIA 2X4AA 2DJ2A 22GSA 1K3YA 3E9JB 2VCXA 3TCOA 4NHWA 4PNFA 1OYJA 1TK5B 1J0FA 5CYYA 2H1DA 1AXDA 2WVXB 1YF1A 14GSA 5A34A 1TU8A 2EFDA 1WPIA 3FZ5A 2JSZA 2FCHA 1EP8A 4JZQA 3VURA 4KDXA 2HT9A 1Z9HA 3BD2A 3APQA 5G31A 4IJ3A 1K0BA 1YKCA 5ECKB 2FY6A 2KLXA 2OBKA 1V58A 2DJ1A 3EMPA 4F2IA 4PTSA 2OE1A 2I1UA 4AGSA 4ZBBA 1DBYA 3C1SA 3MNGA 2HSYA 3GH6A 2YWNA 3ERWA 4YQVA 4AKIA 2DJ0A 1Y25A 4OCFA 5H5RA 2GSRA 3KM6A 2VO4A 17GSA 1DE2A 1F2EA 1N25A 2ALBA 1OE7A 2FA4A 2H72A 4JR4A 3UJ1A 3M9JA 5ECHB 5DJLA 5DALA 3ZIVA 2C0FA 3HJMA 2HRKA 1SU9A 1QQ2A 2EC4A 1HNAA 4RI7A 2R5GA 3IK9A 4ZBAA 1Z6NA 4EL1A 3TOUA 5KN1A 2X8HA 1OVNA 3KMNA 4POMA 4YH2A 2QSIA 4MCUA 1RK4A 3GHAA 3DKSA 2B5YA 3L9VA 3F9UA 1XVQA 5FWGA 1U87A 4GXZA 3HJPA 1THXA 4XTSA 4GDFA 1RW1A 4N10A 2HLSA 2WZ9A 4IHUA 1FOHA 2VCTA 4FYBA 2CZ3A 3ZRDA 4K9ZA 2QGVA 3HMJG 1SL2B 1R7HA 1YEWC 3KTBA 3ZVJD 2LSTA 4WBJA 1XW6A 1ZMAA 4KW6A 4IS0A 1ERUA 3DVXA 4L0UA 2UV8G 1NHOA 2H6ZA 2N5FA 4MZBA 5ECRB 4TXOA 4USSA 5F8BA 4GRFA 3H4KA 2GZZA 3TJKA 3UVTA 2WW1A 1K3OA 3O3TA 4IP6A 1V98A 4GSSA 19GSA 1IYIA 2YOIA 1SK1A 1TDIA 1BQ7A 4KF9A 3C7MA 4ML6A 5KEJA 1W4VA 2RIIA 4Z2RA 5GAND 3IAM2 1X5DA 2H71A 1TXXA 1GNWA 3VLNA 1PQNA 2RUFA 4N30A 1QMVA 4IVFA 4ZB7A 1TRVA 1GLPA 2KHPA 2ZUPA 2L6CA 2AYTA 5INYA 4BVXA 2VUPA 3GTUB 3VWXA 4ECCA 3LQ7A 1B8XA 3PH9A 5G1KA 1K0MA 1O8XA 5DCGA 2OADA 2DLXA 1F3AA 3HVNA 1X5CA 3VI7A 3NOFA 2H76A 4KH7A 2JZRA 2R37A 2N5AA 1USBA 4HZ4A 5A34B 2IPAA 5E4WA 1MDJA 3QR6A 4TOPA 2VCWA 2OT3A 6GSVA 4EUYA 3U5RE 3FY7A 4MPFA 2L57A 3F4RA 1XOBA 2LJAA 1CQHA 1Z6MA 3M8NA 4PQHA 1TRWA 2MMNA 3FZ4A 1JLWA 3EPTA 3FEUA 2F8AA 2LKUA 1AQXA 3H8QA 2CT6A 5B8BA 2YPMA 2YNXA 4XHMA 3MSZA 1CQGA 2HSNA 4LL4B 2F8FA 1A24A 2WJUA 2RUEA 3GKMA 2CVDA 4X0XA 5J3RA 2OACA 2I81A 3EURA 3GNJA 4I97A 5DALB 2PPTA 3G7YA 5HFKA 3TKRA 2HRKB 3I69A 2B5EA 1PKWA 5DAKA 2I4AA 4MF7A 1FVJA 4MK3A 3VK9A 4BVYA 4G2EA 2CAIA 3MYDA 1S3DA 3G7JA 1ACVA 3HVXA 1SD9A 5AISA 1GSYA 1TI1A 3GX0A 3VWUA 2EFEA 2IL3A 5BMUA 2WVZA 1VRSD 4ZB6A 2K6VA 2JL4A 4RUVA 1OE8A 5A1NA 2IIYA 3DYRA 2L6DA 2YWMA 1E2YA 1U3AA 1EOHA 1PL1A 3LG6A 4JR6A 5IO2A 1R26A 5ENUA 4CY8A 5CP1A 4YQUA 4O92A 1V57A 1U3IA 3LYKA 2L5LA 4RQXA 4TXOB 3QD9A 4HOJA 3BOAA 2OA7A 3FYGA 2DMMA 3QAVA 3SBCA 1HD2A 1S3RA 4IBPA 4PNGA 2H70A 5CREA 3GKNA 5CO3A 2PU9C 2I9HA 3RFRC 1TXUA 1GLQA 2H19A 3LORA 2K8SA 5J9BA 1FW1A 4L5LA 4NWYA 1TP9A 3KH7A 4E68A 1K0AA 5HR2A 1PD21 4QL7A 1KNGA 2EIRA 2P5QA 1FB6A 2O89A 3LSZA 3HDCA 4BVXB 4V1Ag 3A3TA 5GAPD 1ZL9A 4TW5A 2ZCTA 4TR4A 4RI6A 2HZEA 3TB2A 2WFCA 5HR1A 2XBQA 4AJ6A 4NMUA 2DMLA 3APOA 1EGRA 3QFBC 4BL7A 4Z2TA 2M80A 4K8MA 3ZL5A 3ZYWA 2ZNMA 5C04A 3EC3A 3FW2A 3KXOA
chains in the Genus database with same CATH topology
1EEJA 2QKEA 5A4VA 3KJYA 2IMKA 4K7NA 3EMXA 3I9V2 5IMAA 1SVLA 4G01A 2HE3A 4MJEA 3UBKA 1LBKA 3H93A 2V6OA 1EWXA 3FZ9A 2YZHA 2HSNB 1B9YC 5J4YA 1SVMA 3FR6A 3R3EA 3CRUA 2VLVA 3EE2A 2Z9SA 4X43A 5IMVA 4PX1A 1YZXA 5H5QA 4EF0A 4EKZA 1S3AA 2NBSA 3IHQA 5D9TA 1T4YA 2LV3A 2DSAA 5DAKB 3DIEA 5ECPB 3QDNA 2DJKA 3EINA 5J4VA 5IO0A 1H4OA 1QGVA 3KGKA 4BVYB 1ERVA 2O7KA 1TK0B 5FHIA 1JZRA 2FGXA 11GSA 2PUKC 6GSXA 4MMMA 1Z7RA 2HYXA 3Q74A 5BMUB 5ELAA 1KEBA 4FH8A 4A5PA 3TGZA 1ON4A 1WJKA 3GSSA 1XFLA 1PL2A 2IFQA 2YANA 5A1NB 1AIUA 2N5BA 4PUFC 3CSJA 2V32A 4ULXA 1T7PB 2OBIA 1QFNA 4ICYA 2WS2A 3WT2A 13GSA 1EGOA 3MWHA 5DVBA 4ZL7A 1YJ6A 1NSWA 2WCIA 3NZNA 1Z3EA 1F37A 3RDWA 2GT6A 5G5FA 4ZL8A 3RPPA 1C72A 3KP8A 1SL1B 2QA2A 16GSA 1IYHA 1WMJA 4CY6A 4LMVA 2GT5A 2MBSA 4KDYA 2E2MA 1A2LA 2R0GA 5A5KA 18GSA 4PURA 4AF2A 1MTCA 1O81A 2B3SA 2B1LA 4HJMA 2YCDA 3ME7A 12GSA 1GTAA 2C4JA 1BAYA 1XW9A 2HZEB 3UL3A 3IXRA 2WB9A 4EDYA 2JZTA 3EU4A 2RLIA 1OC8A 4K6XA 3BJ5A 4F82A 2HXKA 4BWQA 2ES7A 4XS4A 2HNLA 4IQ1A 4LL1B 4LLRA 5KN2A 2GTUA 3ERGA 1JZDA 2L59A 3IBHA 2H1LA 2LRCA 4BL7B 1T4ZA 2RM5A 4Z7XA 5ELGA 3ME8A 4E8EA 4WR4A 1O8WA 5B8AA 5HFGA 3CSIA 2LNSA 1U88A 1SENA 2QA1A 5IMFA 1TKDB 4K5SA 4MJBA 4IW9A 1GWCA 1URMA 2HSMA 2C3QA 3WYWA 1GL8A 5JCWA 3MAKA 1K0CA 5F05A 5ID2B 1Q4JA 1BYEA 2KUCA 2V2GA 2LJRA 4BA7A 4MJAA 4F0CA 5EL8A 3RPNA 4IN0A 4V2NA 1HQOA 5A5HA 1A8LA 5CRGA 4NXIA 1GSQA 2BJXA 4QMKA 3WGDA 3D0ZA 5IMZA 1FHEA 5JWRB 4K2DA 1YEPA 3PR8A 1G6YA 3GRXA 3F4TA 1QXHA 3EWLA 4LA1A 1XCCA 4ILFA 2ON5A 1J9BA 3D22A 3TRQA 2OJLA 5D9VA 1XWCA 4GQFA 4EC0A 1B4QA 4JE1A 4POLA 1TRUA 3P2AA 4KB3A 2E7PA 2H1GA 2F3MA 2PN8A 2LQQA 4KSMA 4L5OA 1B4PA 2IFQB 2PMTA 1TI3A 4PUAA 1WOUA 1OAZA 4Q5QA 3UARA 5IMDA 4HDEA 1HNCA 3KD0A 2M46A 3IPZA 3QCPA 4POBA 3F3QA 3ZFLA 4OO4A 3G7IA 2RM6A 3GURA 3HZ8A 4X1UA 2X8CA 4MA9A 3A2WA 1PN0A 3CMIA 3GFKA 5JCGA 1BG1A 4G0LA 3F8UA 4WBRD 4NV2A 3QAGA 2F9SA 2GDRA 2VL2A 1A0RP 2R0PA 3FK8A 3L0HA 1FAAA 3VPQA 3G9BA 2ON7A 5ECSA 5IPGA 1EEMA 2FD3A 4HS1A 2LQOA 3JCML 1R4WA 3HHVA 3ZVJA 1A2MA 4V1Ap 2CAQA 2FUG2 4ECJA 2GZPA 5D8IA 9GSSA 1AAZA 3LYPA 4Q5NA 4TR3A 2L4CA 2GS3A 1X9MB 2JU5A 2HZFA 2R2JA 4DSQA 3M1GA 2YV7A 3M3MA 3J7Yb 5EVOA 4F03A 3CXGA 3HXSA 1AC1A 5IIZA 4XS4B 4G9HA 1JZWA 5G1LA 4TVEA 1KBNA 2CVBA 5J5NA 4TR0A 2MYGA 2NVLA 1DE1A 5D93A 1YEXA 1FG4A 2JADA 4DVCA 3DD3A 5G30A 2EFHA 1JFUA 3LGCA 20GSA 3QOUA 2L5OA 3ZIJA 1PMTA 4P3YB 4QL9A 2HSMB 2B6MA 2FNOA 2FWGA 1UN2A 2O87A 2GGTA 2P31A 2O8VB 3J7Yk 2H6XA 1SYRA 2GSQA 4ZILA 3UIWA 1GTBA 2DJ3A 1HNBA 4KSOA 5ECMB 3L9UA 5J9CA 4NAXA 3VWVA 1XZOA 2XPDA 4EE0A 1DSBA 4I2UA 4KE3A 4ID0A 1XIYA 2VLUA 5A5HB 4DSSB 3UEMA 3L9SA 4IP1A 1BF5A 4ML1A 3IC4A 4AI6A 4EDZA 1SKSB 5AIXA 4ISDA 4HI7A 5A4WA 3HZ4A 3FMWA 3HA9A 5IM9A 2YN1A 1WIKA 2HFDA 2VLTA 2HRAA 3TJFA 3TUEA 5A4UA 2IMIA 4OFMA 3TKSA 4JBBA 5CRWA 2VKZG 3C73A 4O32A 1HYUA 3TRXA 3DGQA 1WE0A 4EIQA 2A4HA 3GYKA 4KUNA 2OE3A 3CSHA 1SKRB 4DSRA 4JEDA 1FVKA 3GN3A 2H01A 2VL3A 3KCMA 1JLVA 2H74A 2FWFA 4K7OA 1K0NA 4X4JA 3CRTA 2LJKA 6GSWA 2VIMA 4ZB8A 1OC3A 2KOKA 3N5OA 1YVLA 3ZITA 1ZZYA 2B7KA 4FYCA 2H0IA 2UZ8A 3HD5A 3BCIA 5H5SA 4N0ZA 3A2XA 3N9JA 1G7OA 3ZREA 3PPUA 3W8SA 2MBTA 3LFLA 4F0BA 5GZZB 3RHBA 4KCAA 1AUCA 2YV9A 3E3EA 4ECIA 4PQ1A 4G10A 4GSNA 4WETA 4FO5A 2HRNA 4V2MA 4EXJA 1SJZA 2PVOC 1NW2A 3LXZA 4G19A 1X5EA 2JACA 2HQTA 3KTLA 3FR3A 4FYUA 2HI7A 1UVZA 2C0EA 1PX6A 2VL9A 5ECNB 4Q5FA 5DDLA 3C8EA 2H0GA 3HKRA 3TKPA 2DKIA 4AKXB 3RAZA 3F63A 2D2ZA 2LNTA 1FO5A 4MH2A 3EYTA 1ILOA 3OR5A 4XRAA 5D9WA 2YWOA 4FIWA 3M9KA 5ID2A 1M9AA 2A2PA 3O76A 3LJRA 1PRXA 3FZAA 3H79A 3VPTA 2GVPA 2LEGA 4N11A 4IJIA 2QC7A 1ZYQB 5IPHA 2IWTA 1GSSA 2VD1A 4FQUA 4HU7A 3P8WA 4J2FA 2V1MA 2EFCA 2VD0A 3TKQA 1AQVA 1XPVA 4ZB9A 3E0UA 4YKGA 4OD7A 3IV4A 1PA3A 1X0RA 1XW5A 2IMDA 3WGXA 3CTFA 4AJ8A 3GA4A 10GSA 3TDGA 1TW9A 4GWRA 1ERTA 2TIRA 3IAS2 3S9FA 1MDKA 1T1VA 1NHYA 3HVVA 4GSTA 2HRFA 3RBTA 4KX4A 1M9BA 3CTGA 3VWWA 3GL5A 1LJRA 4DEJA 1R5PA 2GQLA 2E2GA 1A2JA 1S3CA 4WKWA 3BBYA 4HQZA 5D73A 1JZOA 1B9XC 2X64A 2CVKA 5AIVA 4RQRA 3KMOA 4E8HA 3KEBA 3LEFA 3H1NA 1XOAA 4KNDA 4EIPA 2KP2A 3NIVA 5L71A 4JU5A 5C00A 3ED3A 2CV4A 5LCZA 1GUKA 4J56E 5DCHA 1I5GA 1T3BA 2NPBA 1V40A 4MF5A 2GLRA 3C1RA 2P5RA 2X99A 5J40A 5J41A 1A23A 1PX7A 3DRNA 1OC9A 1G7EA 1TRSA 2G0FA 1ZOFA 4TRXA 3A5WA 1WP0A 3GKXA 4ZXGA 2O5VA 4EVMA 2LUSA 2R3XA 3HJOA 5F07A 3F6FA 4KDUA 5DJMA 4GCIA 1ZYPA 2VM1A 1E6BA 1GNEA 5IOWA 2EIQA 1TU7A 1GSDA 1EZKA 2DIZA 3WGEA 5CRDA 4BPYA 2VL2C 2R6KA 4K0GA 5IQYA 2AHEA 5KOWA 2YZUA 3EU3A 1FOVA 5GSTA 2BTOT 3TRPA 3LXTA 4WF4A 1GSUA 2CA8A 4KCEA 3UMAA 3F0IA 1RQMA 1SJ6A 1DUGA 3WD6A 1SJIA 3GMFA 5CNWA 1K0DA 3TU3B 1GTIA 3L78A 5IOXA 4L8EA 1M0UA 1W89A 4K7IA 1F6MC 4KA0A 3K8NA 4O5QA 1M99A 3ZFBA 3TJJA 2YJ7A 3AY8A 3GH9A 1ZYEA 5J4UA 2IMEA 1ST9A 2C8UA 3GX8A 1GSEA 5F06A 2DIYA 3I6AA 1N8JA 1WWJA 2C0GA 1QK8A 2LTKA 3D5JA 3GL3A 3MIXA 2VCVA 4ZBDA 2BMXA 1VF1A 4GTUA 3P7XA 4OCEA 3R2QA 1PSQA 1VF4A 1TOFA 1U6TA 4KAEA 3O6TA 3RHCA 4DSSA 2YJHA 3KIJA 1XWGA 4TR1A 5HR3A 5LNKe 1NM3A 4TN8A 1YDKA 8GSSA 3QFAC 3GIXA 1VGLA 1X9SB 1XBSA 2LRTA 5ECOB 2E0QA 2IN3A 4QQ7A 3UAPA 1TK8B 2FWEA 3DVWA 2LRNA 3CBUA 2DBCA 2AAWA 3A2VA 1ABAA 3ZLPA 2VM2A 5CAXA 1EV4A 2IJYA 1MD4A 3UBLA 2K9FA 1BX9A 1O7UA 5FT3A 4YAPA 2H73A 4MZWA 1JHBA 2F51A 1V2AA 2J9HA 3L4NA 3GSTA 1H75A 2WULA 2PBJA 3HYPA 2GQMA 4IKHA 3TJGA 3C71A 3FRCA 3D4TA 4MABA 1XWKA 1M2AA 5KN0A 2NTOA 2C3TA 3EVIA 1EP7A 5B6NA 2OKAA 2B1KA 3TKSC 4HUAA 5EY6A 2MMZA 1ZGNA 5COHA 5GSSA 4TKYA 4IQAA 4NPBA 4CDOA 3WT1A 2GZYA 5F0GA 2P0GA 1O85A 3KH9A 2MMAA 2KP1A 1G6WA 4CHSA 1Z5YE 1OC9B 4AKGA 1FB0A 4JRRA 5LD0A 4HQSA 4XS6A 3ZTLA 2H0HA 2GQKA 2C1YA 3MDKA 2B5XA 1R5AA 1SKWB 1EOGA 5AN1A 3HY2A 2A2RA 1SD8A 1SL0B 2X49A 5JWQB 1EV9A 5DQSA 1AQWA 1GUMA 2PWJA 3QMXA 1MDIA 2A4VA 5ABRA 2NDOA 2PGTA 3IRAA 6GSUA 2YP6A 4K2XA 3ZZXA 4PXOA 4MPGA 1F3BA 1ZYNA 4O5RA 2PVQA 4K5RA 2CZ2A 1MEKA 4HJ2A 4XIHA 3GUSA 4AKHA 6GSYA 4I8BA 2XC2A 3TJBA 1BG5A 3GV1A 4G0KA 1M2BA 1B48A 4TXVA 2CX4A 3KP9A 3IE3A 4XS1A 1A0FA 4G0IA 1BEDA 1TTZA 2X8GA 1Y6EA 1GH2A 3CYNA 2JSYA 5CRHA 3HCZA 1M2DA 2TRCP 2H1BA 3D21A 4OFTA 5ECQB 2R4VA 3IDVA 2CX3A 3Q6OA 4OWYA 3F4SA 2V41A 3F3RA 1K0OA 3FR9A 4I5QA 4HU9A 2JZSA 4CW9A 1OKTA 4O5UA 3TOTA 4GF0A 4TR1B 5BRTA 5D96A 3CWGA 3QAWA 1Y1UA 1ZCPA 1OKDA 1GUHA 1BJXA 3PINA 2DC5A 4PGTA 3DMLA 4YQMA 3P90A 3KZQA 4WR5A 1YKAA 4EO3A 4AJ7A 6GSTA 4L0WA 3APSA 4J57E 1KTEA 5HR0A 2REMA 3IR4A 2OE0A 2TRXA 5HFIA 2C80A 4POKA 4LMWA 5E59A 2C3NA 4D73A 1WRYA 3TKSE 2VCZA 2MMOA 2WRTA 4IGJA 1PN9A 1GULA 2FHEA 3ZMKA 1XWBA 4ZIJA 7GSSA 2H6YA 2VAFA 3FHKA 1ML6A 1YF0A 1UC7A 2PERA 4K1FA 4OO5A 5HQPA 2MZCA 4HZ2A 3IOSA 2M72A 4KGIA 4Q5RA 2AB6A 2WDUA 1GTUA 2J23A 1XWAA 2WGRA 2FLSA 5KN3A 1O73A 4I6XA 1F9MA 1Z7PA 4GQCA 2A2SA 1SVOA 4MJCA 2C0DA 3IA1A 3LW9A 2EIOA 5G5EA 1TJDA 6GSSA 4WF5A 5ECIB 5DBQA 1YQ1A 1GP1A 2LS5A 3IK7A 2DJJA 4ECBA 3DEXA 5B7CA 4OMVA 3A5IA 4GLTA 5B6MA 5KOXA 4PQIA 3DWVA 5D9XA 1SK0A 4WXTA 2AJQB 2YWIA 2IMFA 2I3YA 3ISOA 1V9WA 2R0CA 2L4QA 2V6KA 3GKKA 1GRXA 4K0NA 1THOA 3IC8A 3U6VA 2H66A 4N0VA 3BCKA 1Q98A 1SK2A 3HVSA 3F6DA 2AV4A 4YAVA 1J08A 1VF3A 3D4MA 1I9DA 4IELA 4NV5A 1PKZA 1YY7A 2FA8A 2H8LA 5JWOB 4YKFA 2G2QA 2VCQA 1QUWA 5EPFA 4NHZA 2K18A 1GSFA 4MP4A 4BWSA 2XPEA 5JCUA 1SYXA 1T00A 2H75A 4H86A 1N2AA 1O6JA 4MF6A 2HSHA 4O7HA 4N3ZA 4WEYA 4I2TA 3I43A 4MH3A 1A8YA 2XHFA 1X9WB 3US3A 3VFIA 3FKFA 3LWAA 2GSTA 4MNNA 5AGYA 3D6IA 3QPMA 4MLYA 2DKHA 5G2ZA 3DXBA 2H1AA 4MDCA 2K8VA 4F9ZA 1MD3A 2VOCA 1PGTA 3ERFA 5IMCA 4MZCA 3V1WA 3UVHA 5ECLB 3M0FA 4ACSA 4HEA2 2AUVA 3W6GA 2O85A 4W66A 3UOMA 4D73B 3W8JA 3VI5A 1VF2A 5J47A 1LU4A 1ERWA 2CQ9A 3Q18A 1XVWA 2B7JA 3SWLA 1AW9A 4Z2UA 1XXUA 3IHGA 4XCSA 1M7TA 5DQYA 1K3LA 4V2LA 4XRDA 2GSSA 1G0TA 3GTUA 2FWHA 3Q19A 3ZMLA 4OFNA 4ZL9A 1T8EB 1UA5A 2H30A 3PGTA 2XBIA 2X4AA 2DJ2A 22GSA 1K3YA 3E9JB 2VCXA 3TCOA 4NHWA 4PNFA 1OYJA 1TK5B 1J0FA 5CYYA 2H1DA 1AXDA 1YF1A 14GSA 5A34A 1TU8A 2EFDA 1WPIA 3FZ5A 2JSZA 2FCHA 1EP8A 4JZQA 3VURA 4KDXA 2HT9A 1Z9HA 3BD2A 3APQA 5G31A 4IJ3A 1K0BA 1YKCA 5ECKB 2FY6A 2KLXA 2OBKA 1V58A 2DJ1A 3EMPA 4F2IA 4PTSA 2OE1A 2I1UA 4AGSA 4ZBBA 1DBYA 3C1SA 3MNGA 2HSYA 3GH6A 2YWNA 3ERWA 4YQVA 4AKIA 2DJ0A 1Y25A 4OCFA 5H5RA 2GSRA 3KM6A 2VO4A 17GSA 1DE2A 1F2EA 1N25A 2ALBA 1OE7A 2FA4A 2H72A 4JR4A 3UJ1A 3M9JA 5ECHB 5DJLA 5DALA 3ZIVA 2C0FA 3HJMA 2HRKA 1SU9A 1QQ2A 2EC4A 1HNAA 4RI7A 2R5GA 3IK9A 4ZBAA 1Z6NA 4EL1A 3TOUA 5KN1A 2X8HA 1OVNA 3KMNA 4POMA 4YH2A 2QSIA 4MCUA 1RK4A 3GHAA 3DKSA 2B5YA 3L9VA 3F9UA 1XVQA 5FWGA 1U87A 4GXZA 3HJPA 1THXA 4XTSA 4GDFA 1RW1A 4N10A 2HLSA 2WZ9A 4IHUA 1FOHA 2VCTA 4FYBA 2CZ3A 3ZRDA 4K9ZA 2QGVA 3HMJG 1SL2B 1R7HA 3KTBA 3ZVJD 2LSTA 4WBJA 1XW6A 1ZMAA 4KW6A 4IS0A 1ERUA 3DVXA 4L0UA 2UV8G 1NHOA 2H6ZA 2N5FA 4MZBA 5ECRB 4TXOA 4USSA 5F8BA 4GRFA 3H4KA 2GZZA 3TJKA 3UVTA 1K3OA 3O3TA 4IP6A 1V98A 4GSSA 19GSA 1IYIA 2YOIA 1SK1A 1TDIA 1BQ7A 4KF9A 3C7MA 4ML6A 5KEJA 1W4VA 2RIIA 4Z2RA 5GAND 3IAM2 1X5DA 2H71A 1TXXA 1GNWA 3VLNA 1PQNA 2RUFA 4N30A 1QMVA 4IVFA 4ZB7A 1TRVA 1GLPA 2KHPA 2ZUPA 2L6CA 2AYTA 5INYA 4BVXA 2VUPA 3GTUB 3VWXA 4ECCA 3LQ7A 1B8XA 3PH9A 5G1KA 1K0MA 1O8XA 5DCGA 2OADA 2DLXA 1F3AA 1X5CA 3VI7A 3NOFA 2H76A 4KH7A 2JZRA 2R37A 2N5AA 1USBA 4HZ4A 5A34B 2IPAA 5E4WA 1MDJA 3QR6A 4TOPA 2VCWA 2OT3A 6GSVA 4EUYA 3U5RE 3FY7A 4MPFA 2L57A 3F4RA 1XOBA 2LJAA 1CQHA 1Z6MA 3M8NA 4PQHA 1TRWA 2MMNA 3FZ4A 1JLWA 3EPTA 3FEUA 2F8AA 2LKUA 1AQXA 3H8QA 2CT6A 5B8BA 2YPMA 2YNXA 4XHMA 3MSZA 1CQGA 2HSNA 4LL4B 2F8FA 1A24A 2WJUA 2RUEA 3GKMA 2CVDA 4X0XA 5J3RA 2OACA 2I81A 3EURA 3GNJA 4I97A 5DALB 2PPTA 3G7YA 5HFKA 3TKRA 2HRKB 3I69A 2B5EA 1PKWA 5DAKA 2I4AA 4MF7A 1FVJA 4MK3A 3VK9A 4BVYA 4G2EA 2CAIA 3MYDA 1S3DA 3G7JA 1ACVA 3HVXA 1SD9A 5AISA 1GSYA 1TI1A 3GX0A 3VWUA 2EFEA 2IL3A 5BMUA 1VRSD 4ZB6A 2K6VA 2JL4A 4RUVA 1OE8A 5A1NA 2IIYA 3DYRA 2L6DA 2YWMA 1E2YA 1U3AA 1EOHA 1PL1A 3LG6A 4JR6A 5IO2A 1R26A 5ENUA 4CY8A 5CP1A 4YQUA 4O92A 1V57A 1U3IA 3LYKA 2L5LA 4RQXA 4TXOB 3QD9A 4HOJA 3BOAA 2OA7A 3FYGA 2DMMA 3QAVA 3SBCA 1HD2A 4IBPA 4PNGA 2H70A 5CREA 3GKNA 5CO3A 2PU9C 2I9HA 1TXUA 1GLQA 2H19A 3LORA 2K8SA 5J9BA 1FW1A 4L5LA 4NWYA 1TP9A 3KH7A 4E68A 1K0AA 5HR2A 1PD21 4QL7A 1KNGA 2EIRA 2P5QA 1FB6A 2O89A 3LSZA 3HDCA 4BVXB 4V1Ag 3A3TA 5GAPD 1ZL9A 4TW5A 2ZCTA 4TR4A 4RI6A 2HZEA 3TB2A 2WFCA 5HR1A 2XBQA 4AJ6A 4NMUA 2DMLA 3APOA 1EGRA 3QFBC 4BL7A 4Z2TA 2M80A 4K8MA 3ZL5A 3ZYWA 2ZNMA 5C04A 3EC3A 3FW2A 3KXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EEJ A;  2QKE A;  5A4V A;  3KJY A;  2IMK A;  4K7N A;  3EMX A;  3I9V 2;  5IMA A;  2HE3 A;  4MJE A;  3UBK A;  1LBK A;  3H93 A;  2V6O A;  1EWX A;  3FZ9 A;  2YZH A;  2HSN B;  1B9Y C;  3FR6 A;  3R3E A;  3CRU A;  2VLV A;  3EE2 A;  2Z9S A;  4X43 A;  5IMV A;  4PX1 A;  1YZX A;  5H5Q A;  4EF0 A;  4EKZ A;  1S3A A;  2NBS A;  3IHQ A;  5D9T A;  1T4Y A;  2LV3 A;  2DSA A;  5DAK B;  3DIE A;  5ECP B;  3QDN A;  2DJK A;  3EIN A;  5IO0 A;  1H4O A;  1QGV A;  3KGK A;  4BVY B;  1ERV A;  2O7K A;  1TK0 B;  5FHI A;  1JZR A;  2FGX A;  11GS A;  2PUK C;  6GSX A;  4MMM A;  1Z7R A;  2HYX A;  3Q74 A;  5ELA A;  1KEB A;  4FH8 A;  3TGZ A;  1ON4 A;  1WJK A;  3GSS A;  1XFL A;  1PL2 A;  2IFQ A;  2YAN A;  1AIU A;  2N5B A;  4PUF C;  3CSJ A;  2V32 A;  4ULX A;  1T7P B;  2OBI A;  1QFN A;  2WS2 A;  3WT2 A;  13GS A;  1EGO A;  3MWH A;  5DVB A;  4ZL7 A;  1YJ6 A;  1NSW A;  2WCI A;  3NZN A;  1Z3E A;  1F37 A;  3RDW A;  2GT6 A;  5G5F A;  4ZL8 A;  3RPP A;  1C72 A;  3KP8 A;  1SL1 B;  16GS A;  1IYH A;  1WMJ A;  4LMV A;  2GT5 A;  2MBS A;  4KDY A;  2E2M A;  1A2L A;  5A5K A;  18GS A;  4PUR A;  4AF2 A;  1MTC A;  1O81 A;  2B3S A;  2B1L A;  4HJM A;  2YCD A;  3ME7 A;  12GS A;  1GTA A;  2C4J A;  1BAY A;  1XW9 A;  2HZE B;  3UL3 A;  3IXR A;  2WB9 A;  4EDY A;  2JZT A;  3EU4 A;  2RLI A;  1OC8 A;  4K6X A;  3BJ5 A;  4F82 A;  2HXK A;  4BWQ A;  2ES7 A;  4XS4 A;  2HNL A;  4IQ1 A;  4LL1 B;  4LLR A;  5KN2 A;  2GTU A;  3ERG A;  1JZD A;  2L59 A;  3IBH A;  2LRC A;  4BL7 B;  1T4Z A;  2RM5 A;  4Z7X A;  5ELG A;  3ME8 A;  4E8E A;  4WR4 A;  1O8W A;  5B8A A;  5HFG A;  3CSI A;  2LNS A;  1U88 A;  1SEN A;  5IMF A;  1TKD B;  4MJB A;  4IW9 A;  1GWC A;  1URM A;  2HSM A;  2C3Q A;  3WYW A;  1GL8 A;  5JCW A;  3MAK A;  1K0C A;  5F05 A;  5ID2 B;  1Q4J A;  1BYE A;  2KUC A;  2V2G A;  2LJR A;  4BA7 A;  4MJA A;  4F0C A;  5EL8 A;  3RPN A;  4IN0 A;  4V2N A;  1HQO A;  1A8L A;  5CRG A;  4NXI A;  1GSQ A;  2BJX A;  3WGD A;  3D0Z A;  5IMZ A;  1FHE A;  5JWR B;  4K2D A;  1YEP A;  3PR8 A;  1G6Y A;  3GRX A;  3F4T A;  1QXH A;  3EWL A;  4LA1 A;  1XCC A;  4ILF A;  2ON5 A;  1J9B A;  3D22 A;  3TRQ A;  2OJL A;  5D9V A;  1XWC A;  4GQF A;  4EC0 A;  1B4Q A;  4JE1 A;  4POL A;  1TRU A;  3P2A A;  4KB3 A;  2E7P A;  2H1G A;  2F3M A;  2PN8 A;  2LQQ A;  4KSM A;  4L5O A;  1B4P A;  2IFQ B;  2PMT A;  1TI3 A;  4PUA A;  1WOU A;  1OAZ A;  4Q5Q A;  3UAR A;  5IMD A;  4HDE A;  3QCP A;  3KD0 A;  1HNC A;  2M46 A;  3IPZ A;  4POB A;  3F3Q A;  3ZFL A;  4OO4 A;  3G7I A;  2RM6 A;  3GUR A;  3HZ8 A;  4X1U A;  2X8C A;  4MA9 A;  3A2W A;  3CMI A;  3GFK A;  5JCG A;  4G0L A;  3F8U A;  4WBR D;  4NV2 A;  3QAG A;  2F9S A;  2GDR A;  2VL2 A;  1A0R P;  3FK8 A;  3L0H A;  1FAA A;  3VPQ A;  3G9B A;  2ON7 A;  5ECS A;  5IPG A;  1EEM A;  2FD3 A;  4HS1 A;  2LQO A;  3JCM L;  1R4W A;  3HHV A;  3ZVJ A;  1A2M A;  4V1A p;  2CAQ A;  2FUG 2;  4ECJ A;  2GZP A;  5D8I A;  9GSS A;  1AAZ A;  3LYP A;  4Q5N A;  4TR3 A;  2L4C A;  2GS3 A;  1X9M B;  2JU5 A;  2HZF A;  2R2J A;  4DSQ A;  3M1G A;  2YV7 A;  3M3M A;  3J7Y b;  5EVO A;  4F03 A;  3CXG A;  3HXS A;  1AC1 A;  5IIZ A;  4XS4 B;  4G9H A;  1JZW A;  5G1L A;  4TVE A;  1KBN A;  2CVB A;  5J5N A;  4TR0 A;  2MYG A;  2NVL A;  1DE1 A;  5D93 A;  1YEX A;  1FG4 A;  2JAD A;  4DVC A;  3DD3 A;  5G30 A;  1JFU A;  3LGC A;  20GS A;  3QOU A;  2L5O A;  3ZIJ A;  1PMT A;  4P3Y B;  4QL9 A;  2HSM B;  2B6M A;  2FNO A;  2FWG A;  1UN2 A;  2O87 A;  2GGT A;  2P31 A;  2O8V B;  3J7Y k;  2H6X A;  1SYR A;  2GSQ A;  4ZIL A;  3UIW A;  1GTB A;  2DJ3 A;  1HNB A;  4KSO A;  5ECM B;  3L9U A;  5J9C A;  4NAX A;  3VWV A;  1XZO A;  2XPD A;  4EE0 A;  1DSB A;  4I2U A;  4KE3 A;  4ID0 A;  1XIY A;  2VLU A;  4DSS B;  3UEM A;  3L9S A;  4IP1 A;  4ML1 A;  3IC4 A;  4EDZ A;  1SKS B;  5AIX A;  4ISD A;  4HI7 A;  5A4W A;  3HZ4 A;  3HA9 A;  5IM9 A;  2YN1 A;  1WIK A;  2HFD A;  2VLT A;  2HRA A;  3TJF A;  3TUE A;  5A4U A;  2IMI A;  4OFM A;  3TKS A;  4JBB A;  5CRW A;  3C73 A;  4O32 A;  1HYU A;  3TRX A;  3DGQ A;  1WE0 A;  3GYK A;  4KUN A;  2OE3 A;  3CSH A;  1SKR B;  4DSR A;  4JED A;  1FVK A;  3GN3 A;  2H01 A;  2VL3 A;  3KCM A;  1JLV A;  2H74 A;  2FWF A;  4K7O A;  1K0N A;  3CRT A;  2LJK A;  6GSW A;  2VIM A;  4ZB8 A;  1OC3 A;  2KOK A;  3N5O A;  3ZIT A;  1ZZY A;  2B7K A;  4FYC A;  2H0I A;  2UZ8 A;  3HD5 A;  3BCI A;  5H5S A;  4N0Z A;  3A2X A;  3N9J A;  1G7O A;  3ZRE A;  3PPU A;  3W8S A;  2MBT A;  3LFL A;  4F0B A;  5GZZ B;  3RHB A;  4KCA A;  1AUC A;  2YV9 A;  3E3E A;  4ECI A;  4PQ1 A;  4G10 A;  4GSN A;  4WET A;  4FO5 A;  2HRN A;  4V2M A;  4EXJ A;  1SJZ A;  2PVO C;  1NW2 A;  3LXZ A;  4G19 A;  1X5E A;  2JAC A;  2HQT A;  3KTL A;  3FR3 A;  4FYU A;  2HI7 A;  1UVZ A;  2C0E A;  1PX6 A;  2VL9 A;  5ECN B;  4Q5F A;  5DDL A;  3C8E A;  2H0G A;  3HKR A;  3TKP A;  3RAZ A;  3F63 A;  2D2Z A;  2LNT A;  1FO5 A;  4MH2 A;  3EYT A;  1ILO A;  3OR5 A;  4XRA A;  5D9W A;  2YWO A;  4FIW A;  3M9K A;  5ID2 A;  1M9A A;  3O76 A;  3LJR A;  1PRX A;  3FZA A;  3H79 A;  3VPT A;  2GVP A;  2LEG A;  4N11 A;  4IJI A;  2QC7 A;  1ZYQ B;  5IPH A;  2IWT A;  1GSS A;  2VD1 A;  4FQU A;  4HU7 A;  3P8W A;  4J2F A;  2V1M A;  2VD0 A;  3TKQ A;  1AQV A;  1XPV A;  4ZB9 A;  3E0U A;  4OD7 A;  3IV4 A;  1PA3 A;  1X0R A;  1XW5 A;  2IMD A;  3WGX A;  3CTF A;  4AJ8 A;  3GA4 A;  10GS A;  3TDG A;  1TW9 A;  4GWR A;  1ERT A;  2TIR A;  3IAS 2;  3S9F A;  1MDK A;  1T1V A;  1NHY A;  3HVV A;  4GST A;  2HRF A;  3RBT A;  4KX4 A;  1M9B A;  3CTG A;  3VWW A;  3GL5 A;  1LJR A;  4DEJ A;  1R5P A;  2GQL A;  2E2G A;  1A2J A;  1S3C A;  4WKW A;  3BBY A;  4HQZ A;  5D73 A;  1JZO A;  1B9X C;  2X64 A;  2CVK A;  5AIV A;  4RQR A;  3KMO A;  4E8H A;  3KEB A;  3LEF A;  3H1N A;  1XOA A;  4KND A;  2KP2 A;  3NIV A;  5L71 A;  4JU5 A;  5C00 A;  3ED3 A;  2CV4 A;  5LCZ A;  1GUK A;  4J56 E;  5DCH A;  1I5G A;  1T3B A;  2NPB A;  1V40 A;  4MF5 A;  2GLR A;  3C1R A;  2P5R A;  2X99 A;  5J41 A;  1A23 A;  1PX7 A;  3DRN A;  1OC9 A;  1G7E A;  1TRS A;  2G0F A;  1ZOF A;  4TRX A;  3A5W A;  1WP0 A;  3GKX A;  4ZXG A;  4EVM A;  2LUS A;  2R3X A;  3HJO A;  5F07 A;  3F6F A;  4KDU A;  5DJM A;  4GCI A;  2VM1 A;  1E6B A;  1GNE A;  5IOW A;  2EIQ A;  1TU7 A;  1GSD A;  1EZK A;  2DIZ A;  3WGE A;  5CRD A;  4BPY A;  2VL2 C;  2R6K A;  4K0G A;  5IQY A;  2AHE A;  2YZU A;  3EU3 A;  1FOV A;  5GST A;  2BTO T;  3TRP A;  3LXT A;  4WF4 A;  1GSU A;  2CA8 A;  4KCE A;  3UMA A;  3F0I A;  1RQM A;  1SJ6 A;  1DUG A;  3WD6 A;  1SJI A;  3GMF A;  5CNW A;  1K0D A;  1GTI A;  3L78 A;  5IOX A;  4L8E A;  1M0U A;  1W89 A;  4K7I A;  1F6M C;  4KA0 A;  3K8N A;  1M99 A;  3ZFB A;  3TJJ A;  2YJ7 A;  3AY8 A;  3GH9 A;  1ZYE A;  5J4U A;  2IME A;  1ST9 A;  2C8U A;  3GX8 A;  1GSE A;  5F06 A;  2DIY A;  3I6A A;  1N8J A;  1WWJ A;  2C0G A;  1QK8 A;  2LTK A;  3D5J A;  3GL3 A;  2VCV A;  4ZBD A;  2BMX A;  1VF1 A;  4GTU A;  3P7X A;  4OCE A;  3R2Q A;  1PSQ A;  1VF4 A;  1TOF A;  1U6T A;  4KAE A;  3O6T A;  3RHC A;  4DSS A;  2YJH A;  3KIJ A;  1XWG A;  4TR1 A;  5HR3 A;  5LNK e;  1NM3 A;  4TN8 A;  1YDK A;  8GSS A;  3QFA C;  3GIX A;  1VGL A;  1X9S B;  1XBS A;  2LRT A;  5ECO B;  2E0Q A;  2IN3 A;  4QQ7 A;  3UAP A;  1TK8 B;  2FWE A;  3DVW A;  2LRN A;  3CBU A;  2DBC A;  2AAW A;  3A2V A;  1ABA A;  3ZLP A;  2VM2 A;  5CAX A;  1EV4 A;  2IJY A;  1MD4 A;  3UBL A;  2K9F A;  1BX9 A;  1O7U A;  5FT3 A;  4YAP A;  2H73 A;  4MZW A;  1JHB A;  2F51 A;  1V2A A;  2J9H A;  3L4N A;  3GST A;  1H75 A;  2WUL A;  2PBJ A;  3HYP A;  2GQM A;  4IKH A;  3TJG A;  3C71 A;  3FRC A;  3D4T A;  4MAB A;  1XWK A;  1M2A A;  5KN0 A;  2NTO A;  2C3T A;  3EVI A;  1EP7 A;  5B6N A;  2OKA A;  2B1K A;  3TKS C;  4HUA A;  5EY6 A;  2MMZ A;  1ZGN A;  5COH A;  5GSS A;  4TKY A;  4IQA A;  4NPB A;  4CDO A;  3WT1 A;  2GZY A;  5F0G A;  2P0G A;  1O85 A;  3KH9 A;  2MMA A;  2KP1 A;  1G6W A;  4CHS A;  1Z5Y E;  1OC9 B;  1FB0 A;  4JRR A;  5LD0 A;  4HQS A;  4XS6 A;  3ZTL A;  2H0H A;  2GQK A;  2C1Y A;  3MDK A;  2B5X A;  1R5A A;  1SKW B;  1EOG A;  5AN1 A;  3HY2 A;  2A2R A;  1SD8 A;  1SL0 B;  5JWQ B;  1EV9 A;  5DQS A;  1AQW A;  1GUM A;  2PWJ A;  3QMX A;  1MDI A;  2A4V A;  5ABR A;  2NDO A;  2PGT A;  3IRA A;  6GSU A;  2YP6 A;  3ZZX A;  4PXO A;  4MPG A;  1F3B A;  4O5R A;  2PVQ A;  2CZ2 A;  1MEK A;  4HJ2 A;  4XIH A;  3GUS A;  4I8B A;  6GSY A;  2XC2 A;  3TJB A;  1BG5 A;  3GV1 A;  4G0K A;  1M2B A;  1B48 A;  4TXV A;  2CX4 A;  3KP9 A;  3IE3 A;  4XS1 A;  1A0F A;  4G0I A;  1BED A;  1TTZ A;  2X8G A;  1Y6E A;  1GH2 A;  3CYN A;  2JSY A;  5CRH A;  3HCZ A;  1M2D A;  2TRC P;  2H1B A;  3D21 A;  4OFT A;  5ECQ B;  2R4V A;  3IDV A;  2CX3 A;  3Q6O A;  4OWY A;  3F4S A;  2V41 A;  3F3R A;  1K0O A;  3FR9 A;  4I5Q A;  4HU9 A;  2JZS A;  4CW9 A;  1OKT A;  3TOT A;  4GF0 A;  4TR1 B;  5D96 A;  3QAW A;  1ZCP A;  1OKD A;  1GUH A;  1BJX A;  3PIN A;  2DC5 A;  4PGT A;  3DML A;  4YQM A;  3P90 A;  3KZQ A;  4WR5 A;  1YKA A;  4EO3 A;  4AJ7 A;  6GST A;  4L0W A;  3APS A;  4J57 E;  1KTE A;  5HR0 A;  2REM A;  3IR4 A;  2OE0 A;  2TRX A;  5HFI A;  2C80 A;  4POK A;  4LMW A;  5E59 A;  2C3N A;  4D73 A;  1WRY A;  3TKS E;  2VCZ A;  2MMO A;  2WRT A;  4IGJ A;  1PN9 A;  1GUL A;  2FHE A;  3ZMK A;  1XWB A;  4ZIJ A;  7GSS A;  2H6Y A;  2VAF A;  3FHK A;  1ML6 A;  1YF0 A;  1UC7 A;  2PER A;  4K1F A;  4OO5 A;  5HQP A;  2MZC A;  4HZ2 A;  3IOS A;  2M72 A;  4KGI A;  4Q5R A;  2AB6 A;  2WDU A;  1GTU A;  2J23 A;  1XWA A;  2WGR A;  2FLS A;  5KN3 A;  1O73 A;  4I6X A;  1F9M A;  1Z7P A;  4GQC A;  2A2S A;  4MJC A;  2C0D A;  3IA1 A;  2EIO A;  5G5E A;  1TJD A;  6GSS A;  4WF5 A;  5ECI B;  5DBQ A;  1YQ1 A;  1GP1 A;  2LS5 A;  3IK7 A;  2DJJ A;  4ECB A;  3DEX A;  5B7C A;  4OMV A;  4GLT A;  5B6M A;  4PQI A;  3DWV A;  5D9X A;  1SK0 A;  4WXT A;  2AJQ B;  2YWI A;  2IMF A;  2I3Y A;  3ISO A;  1V9W A;  2L4Q A;  2V6K A;  3GKK A;  1GRX A;  4K0N A;  1THO A;  3IC8 A;  3U6V A;  2H66 A;  4N0V A;  3BCK A;  1Q98 A;  1SK2 A;  3HVS A;  3F6D A;  2AV4 A;  4YAV A;  1J08 A;  1VF3 A;  3D4M A;  1I9D A;  4IEL A;  4NV5 A;  1PKZ A;  1YY7 A;  2FA8 A;  2H8L A;  5JWO B;  2G2Q A;  2VCQ A;  1QUW A;  5EPF A;  4NHZ A;  2K18 A;  1GSF A;  4MP4 A;  4BWS A;  2XPE A;  5JCU A;  1SYX A;  1T00 A;  2H75 A;  4H86 A;  1N2A A;  1O6J A;  4MF6 A;  2HSH A;  4O7H A;  4WEY A;  4I2T A;  3I43 A;  4MH3 A;  1A8Y A;  2XHF A;  1X9W B;  3US3 A;  3VFI A;  3FKF A;  3LWA A;  2GST A;  5AGY A;  3D6I A;  3QPM A;  4MLY A;  5G2Z A;  3DXB A;  2H1A A;  4MDC A;  2K8V A;  4F9Z A;  1MD3 A;  2VOC A;  1PGT A;  3ERF A;  5IMC A;  4MZC A;  3V1W A;  3UVH A;  5ECL B;  3M0F A;  4ACS A;  4HEA 2;  2AUV A;  3W6G A;  2O85 A;  3UOM A;  4D73 B;  3W8J A;  3VI5 A;  1VF2 A;  1LU4 A;  1ERW A;  2CQ9 A;  3Q18 A;  1XVW A;  2B7J A;  3SWL A;  1AW9 A;  1XXU A;  4XCS A;  1M7T A;  5DQY A;  1K3L A;  4V2L A;  4XRD A;  2GSS A;  1G0T A;  3GTU A;  2FWH A;  3Q19 A;  3ZML A;  4OFN A;  4ZL9 A;  1T8E B;  1UA5 A;  2H30 A;  3PGT A;  2XBI A;  2DJ2 A;  22GS A;  1K3Y A;  3E9J B;  2VCX A;  3TCO A;  4NHW A;  4PNF A;  1OYJ A;  1TK5 B;  1J0F A;  5CYY A;  2H1D A;  1AXD A;  1YF1 A;  14GS A;  1TU8 A;  1WPI A;  2JSZ A;  3FZ5 A;  2FCH A;  1EP8 A;  4JZQ A;  3VUR A;  4KDX A;  2HT9 A;  1Z9H A;  3BD2 A;  3APQ A;  5G31 A;  4IJ3 A;  1K0B A;  1YKC A;  5ECK B;  2FY6 A;  2KLX A;  2OBK A;  1V58 A;  2DJ1 A;  3EMP A;  4F2I A;  4PTS A;  2OE1 A;  2I1U A;  4AGS A;  4ZBB A;  1DBY A;  3C1S A;  3MNG A;  2HSY A;  3GH6 A;  2YWN A;  3ERW A;  4YQV A;  2DJ0 A;  1Y25 A;  4OCF A;  5H5R A;  2GSR A;  3KM6 A;  2VO4 A;  17GS A;  1DE2 A;  1F2E A;  2FA4 A;  2ALB A;  1OE7 A;  2H72 A;  4JR4 A;  3UJ1 A;  3M9J A;  5ECH B;  5DJL A;  5DAL A;  3ZIV A;  2C0F A;  3HJM A;  2HRK A;  1SU9 A;  1QQ2 A;  2EC4 A;  1HNA A;  4RI7 A;  2R5G A;  3IK9 A;  4ZBA A;  1Z6N A;  4EL1 A;  3TOU A;  5KN1 A;  2X8H A;  1OVN A;  3KMN A;  4POM A;  4YH2 A;  2QSI A;  4MCU A;  1RK4 A;  3GHA A;  3DKS A;  2B5Y A;  3L9V A;  3F9U A;  1XVQ A;  5FWG A;  1U87 A;  4GXZ A;  3HJP A;  1THX A;  4XTS A;  1RW1 A;  4N10 A;  2HLS A;  2WZ9 A;  4IHU A;  2VCT A;  4FYB A;  2CZ3 A;  3ZRD A;  4K9Z A;  2QGV A;  1SL2 B;  1R7H A;  3KTB A;  3ZVJ D;  2LST A;  4WBJ A;  1XW6 A;  1ZMA A;  4KW6 A;  4IS0 A;  1ERU A;  3DVX A;  4L0U A;  1NHO A;  2H6Z A;  2N5F A;  4MZB A;  5ECR B;  4TXO A;  4USS A;  5F8B A;  4GRF A;  3H4K A;  2GZZ A;  3TJK A;  3UVT A;  1K3O A;  3O3T A;  4IP6 A;  1V98 A;  4GSS A;  19GS A;  1IYI A;  2YOI A;  1SK1 A;  1TDI A;  1BQ7 A;  4KF9 A;  3C7M A;  4ML6 A;  5KEJ A;  1W4V A;  2RII A;  5GAN D;  3IAM 2;  1X5D A;  2H71 A;  1TXX A;  1GNW A;  3VLN A;  1PQN A;  2RUF A;  4N30 A;  1QMV A;  4IVF A;  1TRV A;  1GLP A;  2KHP A;  2ZUP A;  2L6C A;  2AYT A;  5INY A;  4BVX A;  2VUP A;  3GTU B;  3VWX A;  4ECC A;  3LQ7 A;  1B8X A;  3PH9 A;  5G1K A;  1K0M A;  1O8X A;  5DCG A;  2OAD A;  2DLX A;  1F3A A;  1X5C A;  3VI7 A;  3NOF A;  2H76 A;  4KH7 A;  2JZR A;  2R37 A;  2N5A A;  1USB A;  4HZ4 A;  2IPA A;  5E4W A;  1MDJ A;  3QR6 A;  4TOP A;  2VCW A;  6GSV A;  4EUY A;  3U5R E;  3FY7 A;  4MPF A;  2L57 A;  3F4R A;  1XOB A;  2LJA A;  1CQH A;  1Z6M A;  3M8N A;  4PQH A;  1TRW A;  2MMN A;  3FZ4 A;  1JLW A;  3FEU A;  2F8A A;  2LKU A;  1AQX A;  3H8Q A;  2CT6 A;  5B8B A;  2YPM A;  2YNX A;  4XHM A;  3MSZ A;  1CQG A;  4LL4 B;  2F8F A;  1A24 A;  2WJU A;  2RUE A;  3GKM A;  2CVD A;  4X0X A;  5J3R A;  2OAC A;  2I81 A;  3EUR A;  3GNJ A;  4I97 A;  5DAL B;  2PPT A;  3G7Y A;  5HFK A;  3TKR A;  2HRK B;  3I69 A;  2B5E A;  1PKW A;  5DAK A;  2I4A A;  4MF7 A;  1FVJ A;  4MK3 A;  3VK9 A;  4BVY A;  4G2E A;  2CAI A;  1S3D A;  3G7J A;  1ACV A;  3HVX A;  1SD9 A;  5AIS A;  1GSY A;  1TI1 A;  3GX0 A;  3VWU A;  2IL3 A;  5BMU A;  1VRS D;  4ZB6 A;  2K6V A;  2JL4 A;  4RUV A;  1OE8 A;  2IIY A;  2L6D A;  2YWM A;  3DYR A;  1E2Y A;  1U3A A;  1EOH A;  1PL1 A;  3LG6 A;  4JR6 A;  5IO2 A;  1R26 A;  5ENU A;  5CP1 A;  4YQU A;  4O92 A;  1V57 A;  1U3I A;  3LYK A;  2L5L A;  4RQX A;  4TXO B;  3QD9 A;  4HOJ A;  3BOA A;  2OA7 A;  3FYG A;  2DMM A;  3QAV A;  3SBC A;  1HD2 A;  4IBP A;  4PNG A;  2H70 A;  5CRE A;  3GKN A;  5CO3 A;  2PU9 C;  2I9H A;  1GLQ A;  2H19 A;  3LOR A;  2K8S A;  5J9B A;  1FW1 A;  4L5L A;  4NWY A;  1TP9 A;  3KH7 A;  1K0A A;  5HR2 A;  1PD2 1;  4QL7 A;  1KNG A;  2EIR A;  2P5Q A;  1FB6 A;  2O89 A;  3LSZ A;  3HDC A;  4BVX B;  4V1A g;  3A3T A;  5GAP D;  1ZL9 A;  4TW5 A;  2ZCT A;  4TR4 A;  4RI6 A;  2HZE A;  3TB2 A;  2WFC A;  5HR1 A;  2XBQ A;  4AJ6 A;  4NMU A;  2DML A;  3APO A;  1EGR A;  3QFB C;  4BL7 A;  2M80 A;  4K8M A;  3ZL5 A;  3ZYW A;  2ZNM A;  5C04 A;  3EC3 A;  3FW2 A;  3KXO A; 
#chains in the Genus database with same CATH topology
 1EEJ A;  2QKE A;  5A4V A;  3KJY A;  2IMK A;  4K7N A;  3EMX A;  3I9V 2;  5IMA A;  1SVL A;  4G01 A;  2HE3 A;  4MJE A;  3UBK A;  1LBK A;  3H93 A;  2V6O A;  1EWX A;  3FZ9 A;  2YZH A;  2HSN B;  1B9Y C;  5J4Y A;  1SVM A;  3FR6 A;  3R3E A;  3CRU A;  2VLV A;  3EE2 A;  2Z9S A;  4X43 A;  5IMV A;  4PX1 A;  1YZX A;  5H5Q A;  4EF0 A;  4EKZ A;  1S3A A;  2NBS A;  3IHQ A;  5D9T A;  1T4Y A;  2LV3 A;  2DSA A;  5DAK B;  3DIE A;  5ECP B;  3QDN A;  2DJK A;  3EIN A;  5J4V A;  5IO0 A;  1H4O A;  1QGV A;  3KGK A;  4BVY B;  1ERV A;  2O7K A;  3RGB C;  2WW2 A;  1TK0 B;  5FHI A;  1JZR A;  2FGX A;  11GS A;  2PUK C;  6GSX A;  1M3J A;  4MMM A;  1Z7R A;  2HYX A;  3Q74 A;  5BMU B;  5ELA A;  1KEB A;  4FH8 A;  4A5P A;  3TGZ A;  1ON4 A;  1WJK A;  3GSS A;  1XFL A;  1PL2 A;  2IFQ A;  2YAN A;  5A1N B;  1AIU A;  2N5B A;  4PUF C;  3CSJ A;  2V32 A;  4ULX A;  1T7P B;  2OBI A;  1QFN A;  4ICY A;  2WS2 A;  3WT2 A;  13GS A;  1EGO A;  3MWH A;  5DVB A;  4ZL7 A;  1YJ6 A;  1NSW A;  2WCI A;  3NZN A;  1Z3E A;  1F37 A;  3RDW A;  2GT6 A;  5G5F A;  4ZL8 A;  3RPP A;  1C72 A;  3KP8 A;  1SL1 B;  2QA2 A;  16GS A;  1IYH A;  1WMJ A;  4CY6 A;  4LMV A;  2GT5 A;  2MBS A;  4KDY A;  2E2M A;  1A2L A;  2R0G A;  5A5K A;  18GS A;  4PUR A;  4AF2 A;  1MTC A;  1O81 A;  2B3S A;  2B1L A;  4HJM A;  2YCD A;  1XW9 A;  12GS A;  1GTA A;  2C4J A;  1BAY A;  2HZE B;  3ME7 A;  3UL3 A;  3IXR A;  2WB9 A;  4EDY A;  2JZT A;  3EU4 A;  2RLI A;  1OC8 A;  4K6X A;  3BJ5 A;  4F82 A;  2HXK A;  4BWQ A;  2ES7 A;  4XS4 A;  2HNL A;  4IQ1 A;  4LL1 B;  4LLR A;  5KN2 A;  2GTU A;  3ERG A;  1JZD A;  2L59 A;  3IBH A;  2H1L A;  2LRC A;  4BL7 B;  1T4Z A;  2RM5 A;  4Z7X A;  5ELG A;  3ME8 A;  4E8E A;  4WR4 A;  1O8W A;  5B8A A;  4HSC X;  5HFG A;  3CSI A;  2LNS A;  1U88 A;  1SEN A;  2QA1 A;  5IMF A;  1TKD B;  4K5S A;  4MJB A;  4IW9 A;  1GWC A;  1URM A;  2HSM A;  2C3Q A;  3WYW A;  1GL8 A;  5JCW A;  3MAK A;  1K0C A;  5F05 A;  5ID2 B;  1Q4J A;  1BYE A;  2KUC A;  2V2G A;  2LJR A;  4BA7 A;  4MJA A;  4F0C A;  5EL8 A;  3RPN A;  4IN0 A;  1S4B P;  4V2N A;  1HQO A;  5A5H A;  1A8L A;  5CRG A;  4NXI A;  1GSQ A;  2BJX A;  4QMK A;  3WGD A;  3D0Z A;  5IMZ A;  1FHE A;  5JWR B;  4K2D A;  1YEP A;  3PR8 A;  1G6Y A;  2O36 A;  3GRX A;  3F4T A;  1QXH A;  3EWL A;  4LA1 A;  1XCC A;  4ILF A;  2ON5 A;  1J9B A;  3D22 A;  3TRQ A;  2OJL A;  5D9V A;  1XWC A;  4GQF A;  4EC0 A;  1B4Q A;  4JE1 A;  4POL A;  1TRU A;  3P2A A;  4KB3 A;  2E7P A;  2H1G A;  2F3M A;  2PN8 A;  2LQQ A;  4KSM A;  4L5O A;  1B4P A;  2IFQ B;  2PMT A;  1TI3 A;  4PUA A;  1WOU A;  1OAZ A;  4Q5Q A;  3UAR A;  5IMD A;  4HDE A;  1HNC A;  3KD0 A;  2M46 A;  3IPZ A;  3QCP A;  4POB A;  3F3Q A;  3ZFL A;  4OO4 A;  3G7I A;  2RM6 A;  3GUR A;  3HZ8 A;  4X1U A;  2X8C A;  4MA9 A;  3A2W A;  1PN0 A;  3CMI A;  3GFK A;  5JCG A;  1BG1 A;  4G0L A;  3F8U A;  4WBR D;  4NV2 A;  3QAG A;  2F9S A;  2GDR A;  2VL2 A;  1A0R P;  2R0P A;  3FK8 A;  3L0H A;  1FAA A;  3VPQ A;  3G9B A;  2ON7 A;  5ECS A;  5IPG A;  1EEM A;  2FD3 A;  4HS1 A;  2LQO A;  3JCM L;  1R4W A;  3HHV A;  3ZVJ A;  1A2M A;  4V1A p;  2CAQ A;  2FUG 2;  4ECJ A;  2GZP A;  5D8I A;  9GSS A;  1AAZ A;  3LYP A;  4Q5N A;  4TR3 A;  2L4C A;  2GS3 A;  1X9M B;  2JU5 A;  2HZF A;  2R2J A;  4DSQ A;  3M1G A;  2YV7 A;  3M3M A;  3J7Y b;  5EVO A;  4F03 A;  3CXG A;  3HXS A;  1AC1 A;  5IIZ A;  4XS4 B;  4G9H A;  1JZW A;  5G1L A;  4TVE A;  1KBN A;  2CVB A;  5J5N A;  4TR0 A;  2MYG A;  2NVL A;  1DE1 A;  5D93 A;  1YEX A;  1FG4 A;  2JAD A;  4DVC A;  3DD3 A;  5G30 A;  2EFH A;  1JFU A;  3LGC A;  20GS A;  3QOU A;  2L5O A;  3ZIJ A;  1PMT A;  4P3Y B;  4QL9 A;  2HSM B;  2B6M A;  2FNO A;  1PFO A;  2FWG A;  1UN2 A;  2O87 A;  2GGT A;  2P31 A;  2O8V B;  3J7Y k;  2H6X A;  1SYR A;  2GSQ A;  4ZIL A;  3UIW A;  1GTB A;  2DJ3 A;  1HNB A;  4KSO A;  5ECM B;  3L9U A;  5J9C A;  4NAX A;  3VWV A;  1XZO A;  2XPD A;  4EE0 A;  1DSB A;  4I2U A;  4KE3 A;  4ID0 A;  1XIY A;  2VLU A;  5A5H B;  4DSS B;  3UEM A;  3L9S A;  4IP1 A;  1BF5 A;  4ML1 A;  2O3E A;  3IC4 A;  4AI6 A;  4EDZ A;  1SKS B;  5AIX A;  4ISD A;  4HI7 A;  5A4W A;  3HZ4 A;  3FMW A;  3HA9 A;  5IM9 A;  2YN1 A;  1WIK A;  2HFD A;  2VLT A;  2HRA A;  3TJF A;  3TUE A;  5A4U A;  2IMI A;  4OFM A;  3TKS A;  4JBB A;  5CRW A;  2VKZ G;  3C73 A;  4O32 A;  1M3I A;  1HYU A;  3TRX A;  3DGQ A;  1WE0 A;  4EIQ A;  2A4H A;  3GYK A;  4KUN A;  2OE3 A;  3CSH A;  1SKR B;  4DSR A;  4JED A;  1FVK A;  3GN3 A;  2H01 A;  2VL3 A;  3KCM A;  1JLV A;  2H74 A;  2FWF A;  4K7O A;  1K0N A;  4X4J A;  3CRT A;  2LJK A;  6GSW A;  2VIM A;  4ZB8 A;  1OC3 A;  2KOK A;  3N5O A;  1YVL A;  3ZIT A;  1ZZY A;  2B7K A;  4FYC A;  2H0I A;  2UZ8 A;  3HD5 A;  3BCI A;  5H5S A;  4N0Z A;  3CHX C;  3A2X A;  3N9J A;  1G7O A;  3ZRE A;  3PPU A;  3W8S A;  2MBT A;  3LFL A;  4F0B A;  5GZZ B;  3RHB A;  4KCA A;  1AUC A;  2YV9 A;  3E3E A;  4ECI A;  4PQ1 A;  4G10 A;  4GSN A;  4PI0 C;  4WET A;  4FO5 A;  2HRN A;  4V2M A;  4EXJ A;  1SJZ A;  2PVO C;  1NW2 A;  3LXZ A;  4G19 A;  1X5E A;  2JAC A;  2HQT A;  3KTL A;  3FR3 A;  4FYU A;  2HI7 A;  1UVZ A;  2C0E A;  1PX6 A;  2VL9 A;  5ECN B;  4Q5F A;  5DDL A;  3C8E A;  2H0G A;  3HKR A;  3TKP A;  2DKI A;  4AKX B;  3RAZ A;  3F63 A;  2D2Z A;  2LNT A;  1FO5 A;  4MH2 A;  3EYT A;  1ILO A;  3OR5 A;  4XRA A;  5D9W A;  2YWO A;  4FIW A;  3M9K A;  5ID2 A;  1M9A A;  2A2P A;  3O76 A;  3LJR A;  1PRX A;  3FZA A;  3H79 A;  3VPT A;  4PI2 C;  2GVP A;  2LEG A;  4N11 A;  4IJI A;  2QC7 A;  1ZYQ B;  5IPH A;  2IWT A;  1GSS A;  2VD1 A;  4FQU A;  4HU7 A;  3P8W A;  4J2F A;  2V1M A;  2EFC A;  2VD0 A;  3TKQ A;  1AQV A;  1XPV A;  4ZB9 A;  3E0U A;  4YKG A;  4OD7 A;  3IV4 A;  1PA3 A;  1X0R A;  4FXY P;  1XW5 A;  1I1I P;  2IMD A;  3WGX A;  3CTF A;  4AJ8 A;  3GA4 A;  10GS A;  3TDG A;  1TW9 A;  4GWR A;  1ERT A;  2TIR A;  3IAS 2;  3S9F A;  1MDK A;  1T1V A;  1NHY A;  3HVV A;  4GST A;  2HRF A;  3RBT A;  4KX4 A;  1M9B A;  3CTG A;  3VWW A;  3GL5 A;  1LJR A;  4DEJ A;  1R5P A;  2GQL A;  2E2G A;  1A2J A;  1S3C A;  4WKW A;  3BBY A;  4HQZ A;  5D73 A;  1JZO A;  1B9X C;  2X64 A;  2CVK A;  5AIV A;  4RQR A;  3KMO A;  4E8H A;  3KEB A;  3LEF A;  3H1N A;  1XOA A;  4KND A;  4EIP A;  2KP2 A;  3NIV A;  5L71 A;  4JU5 A;  5C00 A;  3ED3 A;  2CV4 A;  5LCZ A;  1GUK A;  4J56 E;  5DCH A;  1I5G A;  1T3B A;  2NPB A;  1V40 A;  4MF5 A;  2GLR A;  3C1R A;  2P5R A;  2WVY A;  2X99 A;  5J40 A;  5J41 A;  1A23 A;  1PX7 A;  3DRN A;  1OC9 A;  1G7E A;  1TRS A;  2G0F A;  1ZOF A;  4TRX A;  3A5W A;  1WP0 A;  3GKX A;  4ZXG A;  2O5V A;  4EVM A;  2LUS A;  2R3X A;  3HJO A;  5F07 A;  3F6F A;  4KDU A;  5DJM A;  4GCI A;  1ZYP A;  2VM1 A;  1E6B A;  1GNE A;  5IOW A;  2EIQ A;  1TU7 A;  1GSD A;  1EZK A;  2DIZ A;  3WGE A;  5CRD A;  4BPY A;  2VL2 C;  2R6K A;  4K0G A;  5IQY A;  2AHE A;  5KOW A;  2YZU A;  3EU3 A;  1FOV A;  5GST A;  2BTO T;  3TRP A;  3LXT A;  4WF4 A;  1GSU A;  2CA8 A;  4KCE A;  3UMA A;  3F0I A;  1RQM A;  1SJ6 A;  1DUG A;  3WD6 A;  1SJI A;  3GMF A;  5CNW A;  1K0D A;  3TU3 B;  1GTI A;  3L78 A;  5IOX A;  4L8E A;  1M0U A;  1W89 A;  4K7I A;  1F6M C;  4KA0 A;  3K8N A;  4O5Q A;  1M99 A;  4PHZ C;  3ZFB A;  3TJJ A;  2YJ7 A;  3AY8 A;  3GH9 A;  1ZYE A;  5J4U A;  2IME A;  1ST9 A;  2C8U A;  3GX8 A;  1GSE A;  5F06 A;  2DIY A;  3I6A A;  1N8J A;  1WWJ A;  2C0G A;  1QK8 A;  2LTK A;  3D5J A;  3GL3 A;  3MIX A;  2VCV A;  4ZBD A;  2BMX A;  1VF1 A;  4GTU A;  3P7X A;  4OCE A;  3R2Q A;  1PSQ A;  1VF4 A;  1TOF A;  1U6T A;  4KAE A;  3O6T A;  3RHC A;  4DSS A;  2YJH A;  3KIJ A;  1XWG A;  4TR1 A;  5HR3 A;  5LNK e;  1NM3 A;  4TN8 A;  1YDK A;  8GSS A;  3QFA C;  3GIX A;  1VGL A;  1X9S B;  1XBS A;  2LRT A;  5ECO B;  2E0Q A;  2IN3 A;  4QQ7 A;  3UAP A;  1TK8 B;  2FWE A;  3DVW A;  2LRN A;  3CBU A;  2DBC A;  2AAW A;  3A2V A;  1ABA A;  3ZLP A;  2VM2 A;  5CAX A;  1EV4 A;  2IJY A;  1MD4 A;  3UBL A;  2K9F A;  1BX9 A;  1O7U A;  5FT3 A;  4YAP A;  2H73 A;  4MZW A;  1JHB A;  2F51 A;  1V2A A;  2J9H A;  3L4N A;  3GST A;  1H75 A;  2WUL A;  2PBJ A;  3HYP A;  2GQM A;  4IKH A;  3TJG A;  3C71 A;  3FRC A;  3D4T A;  4MAB A;  1XWK A;  1M2A A;  5KN0 A;  2NTO A;  2C3T A;  3EVI A;  1EP7 A;  5B6N A;  2OKA A;  2B1K A;  3TKS C;  4HUA A;  5EY6 A;  2MMZ A;  1ZGN A;  5COH A;  5GSS A;  4TKY A;  4IQA A;  4NPB A;  4CDO A;  3WT1 A;  2GZY A;  5F0G A;  2P0G A;  1O85 A;  3KH9 A;  2MMA A;  2KP1 A;  1G6W A;  4CHS A;  1Z5Y E;  2WZS A;  4AKG A;  1OC9 B;  1FB0 A;  4JRR A;  1XG8 A;  5LD0 A;  4HQS A;  4XS6 A;  3ZTL A;  2H0H A;  2GQK A;  2C1Y A;  3MDK A;  2B5X A;  1R5A A;  1SKW B;  1EOG A;  5AN1 A;  3HY2 A;  2A2R A;  1SD8 A;  1SL0 B;  2X49 A;  5JWQ B;  1EV9 A;  5DQS A;  1AQW A;  1GUM A;  2PWJ A;  3QMX A;  1MDI A;  2A4V A;  5ABR A;  2NDO A;  2PGT A;  3IRA A;  6GSU A;  2YP6 A;  4K2X A;  3ZZX A;  4PXO A;  4MPG A;  1F3B A;  1ZYN A;  4O5R A;  2PVQ A;  4K5R A;  2CZ2 A;  1MEK A;  4HJ2 A;  4XIH A;  3GUS A;  4AKH A;  6GSY A;  4I8B A;  2XC2 A;  3TJB A;  1BG5 A;  3GV1 A;  4G0K A;  1M2B A;  1B48 A;  4TXV A;  2CX4 A;  3KP9 A;  3IE3 A;  4XS1 A;  1A0F A;  4G0I A;  1BED A;  1TTZ A;  2X8G A;  1Y6E A;  1GH2 A;  3CYN A;  2JSY A;  5CRH A;  3HCZ A;  1M2D A;  2TRC P;  2H1B A;  3D21 A;  4OFT A;  5ECQ B;  2R4V A;  3IDV A;  2CX3 A;  3Q6O A;  4OWY A;  3F4S A;  2V41 A;  3F3R A;  1K0O A;  3FR9 A;  4I5Q A;  4HU9 A;  2JZS A;  4CW9 A;  1OKT A;  4O5U A;  3TOT A;  4GF0 A;  4TR1 B;  5BRT A;  5D96 A;  3CWG A;  3QAW A;  1Y1U A;  1ZCP A;  1OKD A;  1GUH A;  1BJX A;  3PIN A;  2DC5 A;  4PGT A;  3DML A;  4YQM A;  3P90 A;  3KZQ A;  4WR5 A;  1YKA A;  4EO3 A;  4AJ7 A;  6GST A;  4L0W A;  3APS A;  4J57 E;  1KTE A;  5HR0 A;  2REM A;  3IR4 A;  2OE0 A;  2TRX A;  5HFI A;  2C80 A;  4POK A;  4LMW A;  5E59 A;  2C3N A;  4D73 A;  1WRY A;  3TKS E;  2VCZ A;  2MMO A;  2WRT A;  4IGJ A;  1PN9 A;  1GUL A;  2FHE A;  3ZMK A;  1XWB A;  4ZIJ A;  7GSS A;  2H6Y A;  2VAF A;  3FHK A;  1ML6 A;  1YF0 A;  1UC7 A;  2PER A;  4K1F A;  4OO5 A;  5HQP A;  2MZC A;  4HZ2 A;  3IOS A;  2M72 A;  4KGI A;  4Q5R A;  2AB6 A;  2WDU A;  1GTU A;  2J23 A;  1XWA A;  2WGR A;  2FLS A;  5KN3 A;  1O73 A;  4I6X A;  1F9M A;  1Z7P A;  4GQC A;  2A2S A;  1SVO A;  4MJC A;  2C0D A;  3IA1 A;  3LW9 A;  2EIO A;  5G5E A;  1TJD A;  2WVX A;  3CQF A;  6GSS A;  4WF5 A;  5ECI B;  5DBQ A;  1YQ1 A;  1GP1 A;  2LS5 A;  3IK7 A;  2WW0 A;  2DJJ A;  4ECB A;  3DEX A;  5B7C A;  4OMV A;  3A5I A;  4GLT A;  5B6M A;  5KOX A;  4PQI A;  3DWV A;  5D9X A;  1SK0 A;  4WXT A;  2AJQ B;  2YWI A;  2IMF A;  2WW3 A;  2I3Y A;  3ISO A;  1V9W A;  2R0C A;  2L4Q A;  2V6K A;  3GKK A;  1GRX A;  4K0N A;  1THO A;  3IC8 A;  3U6V A;  2H66 A;  4N0V A;  3BCK A;  1Q98 A;  1SK2 A;  3HVS A;  3F6D A;  2AV4 A;  4YAV A;  1J08 A;  1VF3 A;  3D4M A;  1I9D A;  4IEL A;  4NV5 A;  1PKZ A;  1YY7 A;  2FA8 A;  2H8L A;  5JWO B;  4YKF A;  2G2Q A;  2VCQ A;  1QUW A;  5EPF A;  4NHZ A;  2K18 A;  1GSF A;  4MP4 A;  4BWS A;  2XPE A;  5JCU A;  1SYX A;  1T00 A;  2H75 A;  4H86 A;  1N2A A;  1O6J A;  4MF6 A;  2HSH A;  4O7H A;  4N3Z A;  4WEY A;  4I2T A;  3I43 A;  4MH3 A;  1A8Y A;  2XHF A;  1X9W B;  3US3 A;  3VFI A;  3FKF A;  3LWA A;  2GST A;  4MNN A;  5AGY A;  3D6I A;  3QPM A;  4MLY A;  2DKH A;  5G2Z A;  3DXB A;  2H1A A;  4MDC A;  2K8V A;  4F9Z A;  1MD3 A;  2VOC A;  1PGT A;  3ERF A;  5IMC A;  4MZC A;  3V1W A;  3UVH A;  5ECL B;  3M0F A;  4ACS A;  4HEA 2;  2AUV A;  3W6G A;  4BIK A;  2O85 A;  4W66 A;  3UOM A;  4D73 B;  3W8J A;  3VI5 A;  1VF2 A;  5J47 A;  1LU4 A;  1ERW A;  2CQ9 A;  3Q18 A;  1XVW A;  2B7J A;  3SWL A;  1AW9 A;  4Z2U A;  1XXU A;  3IHG A;  4XCS A;  1M7T A;  5DQY A;  1K3L A;  4V2L A;  4XRD A;  2GSS A;  1G0T A;  3GTU A;  2FWH A;  3Q19 A;  3ZML A;  4OFN A;  4ZL9 A;  1T8E B;  1UA5 A;  2H30 A;  3PGT A;  2XBI A;  2X4A A;  2DJ2 A;  22GS A;  1K3Y A;  3E9J B;  2VCX A;  3TCO A;  4NHW A;  4PNF A;  1OYJ A;  1TK5 B;  1J0F A;  5CYY A;  2H1D A;  1AXD A;  2WVX B;  1YF1 A;  14GS A;  5A34 A;  1TU8 A;  2EFD A;  1WPI A;  3FZ5 A;  2JSZ A;  2FCH A;  1EP8 A;  4JZQ A;  3VUR A;  4KDX A;  2HT9 A;  1Z9H A;  3BD2 A;  3APQ A;  5G31 A;  4IJ3 A;  1K0B A;  1YKC A;  5ECK B;  2FY6 A;  2KLX A;  2OBK A;  1V58 A;  2DJ1 A;  3EMP A;  4F2I A;  4PTS A;  2OE1 A;  2I1U A;  4AGS A;  4ZBB A;  1DBY A;  3C1S A;  3MNG A;  2HSY A;  3GH6 A;  2YWN A;  3ERW A;  4YQV A;  4AKI A;  2DJ0 A;  1Y25 A;  4OCF A;  5H5R A;  2GSR A;  3KM6 A;  2VO4 A;  17GS A;  1DE2 A;  1F2E A;  1N25 A;  2ALB A;  1OE7 A;  2FA4 A;  2H72 A;  4JR4 A;  3UJ1 A;  3M9J A;  5ECH B;  5DJL A;  5DAL A;  3ZIV A;  2C0F A;  3HJM A;  2HRK A;  1SU9 A;  1QQ2 A;  2EC4 A;  1HNA A;  4RI7 A;  2R5G A;  3IK9 A;  4ZBA A;  1Z6N A;  4EL1 A;  3TOU A;  5KN1 A;  2X8H A;  1OVN A;  3KMN A;  4POM A;  4YH2 A;  2QSI A;  4MCU A;  1RK4 A;  3GHA A;  3DKS A;  2B5Y A;  3L9V A;  3F9U A;  1XVQ A;  5FWG A;  1U87 A;  4GXZ A;  3HJP A;  1THX A;  4XTS A;  4GDF A;  1RW1 A;  4N10 A;  2HLS A;  2WZ9 A;  4IHU A;  1FOH A;  2VCT A;  4FYB A;  2CZ3 A;  3ZRD A;  4K9Z A;  2QGV A;  3HMJ G;  1SL2 B;  1R7H A;  1YEW C;  3KTB A;  3ZVJ D;  2LST A;  4WBJ A;  1XW6 A;  1ZMA A;  4KW6 A;  4IS0 A;  1ERU A;  3DVX A;  4L0U A;  2UV8 G;  1NHO A;  2H6Z A;  2N5F A;  4MZB A;  5ECR B;  4TXO A;  4USS A;  5F8B A;  4GRF A;  3H4K A;  2GZZ A;  3TJK A;  3UVT A;  2WW1 A;  1K3O A;  3O3T A;  4IP6 A;  1V98 A;  4GSS A;  19GS A;  1IYI A;  2YOI A;  1SK1 A;  1TDI A;  1BQ7 A;  4KF9 A;  3C7M A;  4ML6 A;  5KEJ A;  1W4V A;  2RII A;  4Z2R A;  5GAN D;  3IAM 2;  1X5D A;  2H71 A;  1TXX A;  1GNW A;  3VLN A;  1PQN A;  2RUF A;  4N30 A;  1QMV A;  4IVF A;  4ZB7 A;  1TRV A;  1GLP A;  2KHP A;  2ZUP A;  2L6C A;  2AYT A;  5INY A;  4BVX A;  2VUP A;  3GTU B;  3VWX A;  4ECC A;  3LQ7 A;  1B8X A;  3PH9 A;  5G1K A;  1K0M A;  1O8X A;  5DCG A;  2OAD A;  2DLX A;  1F3A A;  3HVN A;  1X5C A;  3VI7 A;  3NOF A;  2H76 A;  4KH7 A;  2JZR A;  2R37 A;  2N5A A;  1USB A;  4HZ4 A;  5A34 B;  2IPA A;  5E4W A;  1MDJ A;  3QR6 A;  4TOP A;  2VCW A;  2OT3 A;  6GSV A;  4EUY A;  3U5R E;  3FY7 A;  4MPF A;  2L57 A;  3F4R A;  1XOB A;  2LJA A;  1CQH A;  1Z6M A;  3M8N A;  4PQH A;  1TRW A;  2MMN A;  3FZ4 A;  1JLW A;  3EPT A;  3FEU A;  2F8A A;  2LKU A;  1AQX A;  3H8Q A;  2CT6 A;  5B8B A;  2YPM A;  2YNX A;  4XHM A;  3MSZ A;  1CQG A;  2HSN A;  4LL4 B;  2F8F A;  1A24 A;  2WJU A;  2RUE A;  3GKM A;  2CVD A;  4X0X A;  5J3R A;  2OAC A;  2I81 A;  3EUR A;  3GNJ A;  4I97 A;  5DAL B;  2PPT A;  3G7Y A;  5HFK A;  3TKR A;  2HRK B;  3I69 A;  2B5E A;  1PKW A;  5DAK A;  2I4A A;  4MF7 A;  1FVJ A;  4MK3 A;  3VK9 A;  4BVY A;  4G2E A;  2CAI A;  3MYD A;  1S3D A;  3G7J A;  1ACV A;  3HVX A;  1SD9 A;  5AIS A;  1GSY A;  1TI1 A;  3GX0 A;  3VWU A;  2EFE A;  2IL3 A;  5BMU A;  2WVZ A;  1VRS D;  4ZB6 A;  2K6V A;  2JL4 A;  4RUV A;  1OE8 A;  5A1N A;  2IIY A;  3DYR A;  2L6D A;  2YWM A;  1E2Y A;  1U3A A;  1EOH A;  1PL1 A;  3LG6 A;  4JR6 A;  5IO2 A;  1R26 A;  5ENU A;  4CY8 A;  5CP1 A;  4YQU A;  4O92 A;  1V57 A;  1U3I A;  3LYK A;  2L5L A;  4RQX A;  4TXO B;  3QD9 A;  4HOJ A;  3BOA A;  2OA7 A;  3FYG A;  2DMM A;  3QAV A;  3SBC A;  1HD2 A;  1S3R A;  4IBP A;  4PNG A;  2H70 A;  5CRE A;  3GKN A;  5CO3 A;  2PU9 C;  2I9H A;  3RFR C;  1TXU A;  1GLQ A;  2H19 A;  3LOR A;  2K8S A;  5J9B A;  1FW1 A;  4L5L A;  4NWY A;  1TP9 A;  3KH7 A;  4E68 A;  1K0A A;  5HR2 A;  1PD2 1;  4QL7 A;  1KNG A;  2EIR A;  2P5Q A;  1FB6 A;  2O89 A;  3LSZ A;  3HDC A;  4BVX B;  4V1A g;  3A3T A;  5GAP D;  1ZL9 A;  4TW5 A;  2ZCT A;  4TR4 A;  4RI6 A;  2HZE A;  3TB2 A;  2WFC A;  5HR1 A;  2XBQ A;  4AJ6 A;  4NMU A;  2DML A;  3APO A;  1EGR A;  3QFB C;  4BL7 A;  4Z2T A;  2M80 A;  4K8M A;  3ZL5 A;  3ZYW A;  2ZNM A;  5C04 A;  3EC3 A;  3FW2 A;  3KXO A; 
#chains in the Genus database with same CATH homology
 1EEJ A;  2QKE A;  5A4V A;  3KJY A;  2IMK A;  4K7N A;  3EMX A;  3I9V 2;  5IMA A;  1SVL A;  4G01 A;  2HE3 A;  4MJE A;  3UBK A;  1LBK A;  3H93 A;  2V6O A;  1EWX A;  3FZ9 A;  2YZH A;  2HSN B;  1B9Y C;  5J4Y A;  1SVM A;  3FR6 A;  3R3E A;  3CRU A;  2VLV A;  3EE2 A;  2Z9S A;  4X43 A;  5IMV A;  4PX1 A;  1YZX A;  5H5Q A;  4EF0 A;  4EKZ A;  1S3A A;  2NBS A;  3IHQ A;  5D9T A;  1T4Y A;  2LV3 A;  2DSA A;  5DAK B;  3DIE A;  5ECP B;  3QDN A;  2DJK A;  3EIN A;  5J4V A;  5IO0 A;  1H4O A;  1QGV A;  3KGK A;  4BVY B;  1ERV A;  2O7K A;  1TK0 B;  5FHI A;  1JZR A;  2FGX A;  11GS A;  2PUK C;  6GSX A;  4MMM A;  1Z7R A;  2HYX A;  3Q74 A;  5BMU B;  5ELA A;  1KEB A;  4FH8 A;  4A5P A;  3TGZ A;  1ON4 A;  1WJK A;  3GSS A;  1XFL A;  1PL2 A;  2IFQ A;  2YAN A;  5A1N B;  1AIU A;  2N5B A;  4PUF C;  3CSJ A;  2V32 A;  4ULX A;  1T7P B;  2OBI A;  1QFN A;  4ICY A;  2WS2 A;  3WT2 A;  13GS A;  1EGO A;  3MWH A;  5DVB A;  4ZL7 A;  1YJ6 A;  1NSW A;  2WCI A;  3NZN A;  1Z3E A;  1F37 A;  3RDW A;  2GT6 A;  5G5F A;  4ZL8 A;  3RPP A;  1C72 A;  3KP8 A;  1SL1 B;  2QA2 A;  16GS A;  1IYH A;  1WMJ A;  4CY6 A;  4LMV A;  2GT5 A;  2MBS A;  4KDY A;  2E2M A;  1A2L A;  2R0G A;  5A5K A;  18GS A;  4PUR A;  4AF2 A;  1MTC A;  1O81 A;  2B3S A;  2B1L A;  4HJM A;  2YCD A;  3ME7 A;  12GS A;  1GTA A;  2C4J A;  1BAY A;  1XW9 A;  2HZE B;  3UL3 A;  3IXR A;  2WB9 A;  4EDY A;  2JZT A;  3EU4 A;  2RLI A;  1OC8 A;  4K6X A;  3BJ5 A;  4F82 A;  2HXK A;  4BWQ A;  2ES7 A;  4XS4 A;  2HNL A;  4IQ1 A;  4LL1 B;  4LLR A;  5KN2 A;  2GTU A;  3ERG A;  1JZD A;  2L59 A;  3IBH A;  2H1L A;  2LRC A;  4BL7 B;  1T4Z A;  2RM5 A;  4Z7X A;  5ELG A;  3ME8 A;  4E8E A;  4WR4 A;  1O8W A;  5B8A A;  5HFG A;  3CSI A;  2LNS A;  1U88 A;  1SEN A;  2QA1 A;  5IMF A;  1TKD B;  4K5S A;  4MJB A;  4IW9 A;  1GWC A;  1URM A;  2HSM A;  2C3Q A;  3WYW A;  1GL8 A;  5JCW A;  3MAK A;  1K0C A;  5F05 A;  5ID2 B;  1Q4J A;  1BYE A;  2KUC A;  2V2G A;  2LJR A;  4BA7 A;  4MJA A;  4F0C A;  5EL8 A;  3RPN A;  4IN0 A;  4V2N A;  1HQO A;  5A5H A;  1A8L A;  5CRG A;  4NXI A;  1GSQ A;  2BJX A;  4QMK A;  3WGD A;  3D0Z A;  5IMZ A;  1FHE A;  5JWR B;  4K2D A;  1YEP A;  3PR8 A;  1G6Y A;  3GRX A;  3F4T A;  1QXH A;  3EWL A;  4LA1 A;  1XCC A;  4ILF A;  2ON5 A;  1J9B A;  3D22 A;  3TRQ A;  2OJL A;  5D9V A;  1XWC A;  4GQF A;  4EC0 A;  1B4Q A;  4JE1 A;  4POL A;  1TRU A;  3P2A A;  4KB3 A;  2E7P A;  2H1G A;  2F3M A;  2PN8 A;  2LQQ A;  4KSM A;  4L5O A;  1B4P A;  2IFQ B;  2PMT A;  1TI3 A;  4PUA A;  1WOU A;  1OAZ A;  4Q5Q A;  3UAR A;  5IMD A;  4HDE A;  1HNC A;  3KD0 A;  2M46 A;  3IPZ A;  3QCP A;  4POB A;  3F3Q A;  3ZFL A;  4OO4 A;  3G7I A;  2RM6 A;  3GUR A;  3HZ8 A;  4X1U A;  2X8C A;  4MA9 A;  3A2W A;  1PN0 A;  3CMI A;  3GFK A;  5JCG A;  1BG1 A;  4G0L A;  3F8U A;  4WBR D;  4NV2 A;  3QAG A;  2F9S A;  2GDR A;  2VL2 A;  1A0R P;  2R0P A;  3FK8 A;  3L0H A;  1FAA A;  3VPQ A;  3G9B A;  2ON7 A;  5ECS A;  5IPG A;  1EEM A;  2FD3 A;  4HS1 A;  2LQO A;  3JCM L;  1R4W A;  3HHV A;  3ZVJ A;  1A2M A;  4V1A p;  2CAQ A;  2FUG 2;  4ECJ A;  2GZP A;  5D8I A;  9GSS A;  1AAZ A;  3LYP A;  4Q5N A;  4TR3 A;  2L4C A;  2GS3 A;  1X9M B;  2JU5 A;  2HZF A;  2R2J A;  4DSQ A;  3M1G A;  2YV7 A;  3M3M A;  3J7Y b;  5EVO A;  4F03 A;  3CXG A;  3HXS A;  1AC1 A;  5IIZ A;  4XS4 B;  4G9H A;  1JZW A;  5G1L A;  4TVE A;  1KBN A;  2CVB A;  5J5N A;  4TR0 A;  2MYG A;  2NVL A;  1DE1 A;  5D93 A;  1YEX A;  1FG4 A;  2JAD A;  4DVC A;  3DD3 A;  5G30 A;  2EFH A;  1JFU A;  3LGC A;  20GS A;  3QOU A;  2L5O A;  3ZIJ A;  1PMT A;  4P3Y B;  4QL9 A;  2HSM B;  2B6M A;  2FNO A;  2FWG A;  1UN2 A;  2O87 A;  2GGT A;  2P31 A;  2O8V B;  3J7Y k;  2H6X A;  1SYR A;  2GSQ A;  4ZIL A;  3UIW A;  1GTB A;  2DJ3 A;  1HNB A;  4KSO A;  5ECM B;  3L9U A;  5J9C A;  4NAX A;  3VWV A;  1XZO A;  2XPD A;  4EE0 A;  1DSB A;  4I2U A;  4KE3 A;  4ID0 A;  1XIY A;  2VLU A;  5A5H B;  4DSS B;  3UEM A;  3L9S A;  4IP1 A;  1BF5 A;  4ML1 A;  3IC4 A;  4AI6 A;  4EDZ A;  1SKS B;  5AIX A;  4ISD A;  4HI7 A;  5A4W A;  3HZ4 A;  3FMW A;  3HA9 A;  5IM9 A;  2YN1 A;  1WIK A;  2HFD A;  2VLT A;  2HRA A;  3TJF A;  3TUE A;  5A4U A;  2IMI A;  4OFM A;  3TKS A;  4JBB A;  5CRW A;  2VKZ G;  3C73 A;  4O32 A;  1HYU A;  3TRX A;  3DGQ A;  1WE0 A;  4EIQ A;  2A4H A;  3GYK A;  4KUN A;  2OE3 A;  3CSH A;  1SKR B;  4DSR A;  4JED A;  1FVK A;  3GN3 A;  2H01 A;  2VL3 A;  3KCM A;  1JLV A;  2H74 A;  2FWF A;  4K7O A;  1K0N A;  4X4J A;  3CRT A;  2LJK A;  6GSW A;  2VIM A;  4ZB8 A;  1OC3 A;  2KOK A;  3N5O A;  1YVL A;  3ZIT A;  1ZZY A;  2B7K A;  4FYC A;  2H0I A;  2UZ8 A;  3HD5 A;  3BCI A;  5H5S A;  4N0Z A;  3A2X A;  3N9J A;  1G7O A;  3ZRE A;  3PPU A;  3W8S A;  2MBT A;  3LFL A;  4F0B A;  5GZZ B;  3RHB A;  4KCA A;  1AUC A;  2YV9 A;  3E3E A;  4ECI A;  4PQ1 A;  4G10 A;  4GSN A;  4WET A;  4FO5 A;  2HRN A;  4V2M A;  4EXJ A;  1SJZ A;  2PVO C;  1NW2 A;  3LXZ A;  4G19 A;  1X5E A;  2JAC A;  2HQT A;  3KTL A;  3FR3 A;  4FYU A;  2HI7 A;  1UVZ A;  2C0E A;  1PX6 A;  2VL9 A;  5ECN B;  4Q5F A;  5DDL A;  3C8E A;  2H0G A;  3HKR A;  3TKP A;  2DKI A;  4AKX B;  3RAZ A;  3F63 A;  2D2Z A;  2LNT A;  1FO5 A;  4MH2 A;  3EYT A;  1ILO A;  3OR5 A;  4XRA A;  5D9W A;  2YWO A;  4FIW A;  3M9K A;  5ID2 A;  1M9A A;  2A2P A;  3O76 A;  3LJR A;  1PRX A;  3FZA A;  3H79 A;  3VPT A;  2GVP A;  2LEG A;  4N11 A;  4IJI A;  2QC7 A;  1ZYQ B;  5IPH A;  2IWT A;  1GSS A;  2VD1 A;  4FQU A;  4HU7 A;  3P8W A;  4J2F A;  2V1M A;  2EFC A;  2VD0 A;  3TKQ A;  1AQV A;  1XPV A;  4ZB9 A;  3E0U A;  4YKG A;  4OD7 A;  3IV4 A;  1PA3 A;  1X0R A;  1XW5 A;  2IMD A;  3WGX A;  3CTF A;  4AJ8 A;  3GA4 A;  10GS A;  3TDG A;  1TW9 A;  4GWR A;  1ERT A;  2TIR A;  3IAS 2;  3S9F A;  1MDK A;  1T1V A;  1NHY A;  3HVV A;  4GST A;  2HRF A;  3RBT A;  4KX4 A;  1M9B A;  3CTG A;  3VWW A;  3GL5 A;  1LJR A;  4DEJ A;  1R5P A;  2GQL A;  2E2G A;  1A2J A;  1S3C A;  4WKW A;  3BBY A;  4HQZ A;  5D73 A;  1JZO A;  1B9X C;  2X64 A;  2CVK A;  5AIV A;  4RQR A;  3KMO A;  4E8H A;  3KEB A;  3LEF A;  3H1N A;  1XOA A;  4KND A;  4EIP A;  2KP2 A;  3NIV A;  5L71 A;  4JU5 A;  5C00 A;  3ED3 A;  2CV4 A;  5LCZ A;  1GUK A;  4J56 E;  5DCH A;  1I5G A;  1T3B A;  2NPB A;  1V40 A;  4MF5 A;  2GLR A;  3C1R A;  2P5R A;  2X99 A;  5J40 A;  5J41 A;  1A23 A;  1PX7 A;  3DRN A;  1OC9 A;  1G7E A;  1TRS A;  2G0F A;  1ZOF A;  4TRX A;  3A5W A;  1WP0 A;  3GKX A;  4ZXG A;  2O5V A;  4EVM A;  2LUS A;  2R3X A;  3HJO A;  5F07 A;  3F6F A;  4KDU A;  5DJM A;  4GCI A;  1ZYP A;  2VM1 A;  1E6B A;  1GNE A;  5IOW A;  2EIQ A;  1TU7 A;  1GSD A;  1EZK A;  2DIZ A;  3WGE A;  5CRD A;  4BPY A;  2VL2 C;  2R6K A;  4K0G A;  5IQY A;  2AHE A;  5KOW A;  2YZU A;  3EU3 A;  1FOV A;  5GST A;  2BTO T;  3TRP A;  3LXT A;  4WF4 A;  1GSU A;  2CA8 A;  4KCE A;  3UMA A;  3F0I A;  1RQM A;  1SJ6 A;  1DUG A;  3WD6 A;  1SJI A;  3GMF A;  5CNW A;  1K0D A;  3TU3 B;  1GTI A;  3L78 A;  5IOX A;  4L8E A;  1M0U A;  1W89 A;  4K7I A;  1F6M C;  4KA0 A;  3K8N A;  4O5Q A;  1M99 A;  3ZFB A;  3TJJ A;  2YJ7 A;  3AY8 A;  3GH9 A;  1ZYE A;  5J4U A;  2IME A;  1ST9 A;  2C8U A;  3GX8 A;  1GSE A;  5F06 A;  2DIY A;  3I6A A;  1N8J A;  1WWJ A;  2C0G A;  1QK8 A;  2LTK A;  3D5J A;  3GL3 A;  3MIX A;  2VCV A;  4ZBD A;  2BMX A;  1VF1 A;  4GTU A;  3P7X A;  4OCE A;  3R2Q A;  1PSQ A;  1VF4 A;  1TOF A;  1U6T A;  4KAE A;  3O6T A;  3RHC A;  4DSS A;  2YJH A;  3KIJ A;  1XWG A;  4TR1 A;  5HR3 A;  5LNK e;  1NM3 A;  4TN8 A;  1YDK A;  8GSS A;  3QFA C;  3GIX A;  1VGL A;  1X9S B;  1XBS A;  2LRT A;  5ECO B;  2E0Q A;  2IN3 A;  4QQ7 A;  3UAP A;  1TK8 B;  2FWE A;  3DVW A;  2LRN A;  3CBU A;  2DBC A;  2AAW A;  3A2V A;  1ABA A;  3ZLP A;  2VM2 A;  5CAX A;  1EV4 A;  2IJY A;  1MD4 A;  3UBL A;  2K9F A;  1BX9 A;  1O7U A;  5FT3 A;  4YAP A;  2H73 A;  4MZW A;  1JHB A;  2F51 A;  1V2A A;  2J9H A;  3L4N A;  3GST A;  1H75 A;  2WUL A;  2PBJ A;  3HYP A;  2GQM A;  4IKH A;  3TJG A;  3C71 A;  3FRC A;  3D4T A;  4MAB A;  1XWK A;  1M2A A;  5KN0 A;  2NTO A;  2C3T A;  3EVI A;  1EP7 A;  5B6N A;  2OKA A;  2B1K A;  3TKS C;  4HUA A;  5EY6 A;  2MMZ A;  1ZGN A;  5COH A;  5GSS A;  4TKY A;  4IQA A;  4NPB A;  4CDO A;  3WT1 A;  2GZY A;  5F0G A;  2P0G A;  1O85 A;  3KH9 A;  2MMA A;  2KP1 A;  1G6W A;  4CHS A;  1Z5Y E;  1OC9 B;  4AKG A;  1FB0 A;  4JRR A;  5LD0 A;  4HQS A;  4XS6 A;  3ZTL A;  2H0H A;  2GQK A;  2C1Y A;  3MDK A;  2B5X A;  1R5A A;  1SKW B;  1EOG A;  5AN1 A;  3HY2 A;  2A2R A;  1SD8 A;  1SL0 B;  2X49 A;  5JWQ B;  1EV9 A;  5DQS A;  1AQW A;  1GUM A;  2PWJ A;  3QMX A;  1MDI A;  2A4V A;  5ABR A;  2NDO A;  2PGT A;  3IRA A;  6GSU A;  2YP6 A;  4K2X A;  3ZZX A;  4PXO A;  4MPG A;  1F3B A;  1ZYN A;  4O5R A;  2PVQ A;  4K5R A;  2CZ2 A;  1MEK A;  4HJ2 A;  4XIH A;  3GUS A;  4AKH A;  6GSY A;  4I8B A;  2XC2 A;  3TJB A;  1BG5 A;  3GV1 A;  4G0K A;  1M2B A;  1B48 A;  4TXV A;  2CX4 A;  3KP9 A;  3IE3 A;  4XS1 A;  1A0F A;  4G0I A;  1BED A;  1TTZ A;  2X8G A;  1Y6E A;  1GH2 A;  3CYN A;  2JSY A;  5CRH A;  3HCZ A;  1M2D A;  2TRC P;  2H1B A;  3D21 A;  4OFT A;  5ECQ B;  2R4V A;  3IDV A;  2CX3 A;  3Q6O A;  4OWY A;  3F4S A;  2V41 A;  3F3R A;  1K0O A;  3FR9 A;  4I5Q A;  4HU9 A;  2JZS A;  4CW9 A;  1OKT A;  4O5U A;  3TOT A;  4GF0 A;  4TR1 B;  5BRT A;  5D96 A;  3CWG A;  3QAW A;  1Y1U A;  1ZCP A;  1OKD A;  1GUH A;  1BJX A;  3PIN A;  2DC5 A;  4PGT A;  3DML A;  4YQM A;  3P90 A;  3KZQ A;  4WR5 A;  1YKA A;  4EO3 A;  4AJ7 A;  6GST A;  4L0W A;  3APS A;  4J57 E;  1KTE A;  5HR0 A;  2REM A;  3IR4 A;  2OE0 A;  2TRX A;  5HFI A;  2C80 A;  4POK A;  4LMW A;  5E59 A;  2C3N A;  4D73 A;  1WRY A;  3TKS E;  2VCZ A;  2MMO A;  2WRT A;  4IGJ A;  1PN9 A;  1GUL A;  2FHE A;  3ZMK A;  1XWB A;  4ZIJ A;  7GSS A;  2H6Y A;  2VAF A;  3FHK A;  1ML6 A;  1YF0 A;  1UC7 A;  2PER A;  4K1F A;  4OO5 A;  5HQP A;  2MZC A;  4HZ2 A;  3IOS A;  2M72 A;  4KGI A;  4Q5R A;  2AB6 A;  2WDU A;  1GTU A;  2J23 A;  1XWA A;  2WGR A;  2FLS A;  5KN3 A;  1O73 A;  4I6X A;  1F9M A;  1Z7P A;  4GQC A;  2A2S A;  1SVO A;  4MJC A;  2C0D A;  3IA1 A;  3LW9 A;  2EIO A;  5G5E A;  1TJD A;  6GSS A;  4WF5 A;  5ECI B;  5DBQ A;  1YQ1 A;  1GP1 A;  2LS5 A;  3IK7 A;  2DJJ A;  4ECB A;  3DEX A;  5B7C A;  4OMV A;  3A5I A;  4GLT A;  5B6M A;  5KOX A;  4PQI A;  3DWV A;  5D9X A;  1SK0 A;  4WXT A;  2AJQ B;  2YWI A;  2IMF A;  2I3Y A;  3ISO A;  1V9W A;  2R0C A;  2L4Q A;  2V6K A;  3GKK A;  1GRX A;  4K0N A;  1THO A;  3IC8 A;  3U6V A;  2H66 A;  4N0V A;  3BCK A;  1Q98 A;  1SK2 A;  3HVS A;  3F6D A;  2AV4 A;  4YAV A;  1J08 A;  1VF3 A;  3D4M A;  1I9D A;  4IEL A;  4NV5 A;  1PKZ A;  1YY7 A;  2FA8 A;  2H8L A;  5JWO B;  4YKF A;  2G2Q A;  2VCQ A;  1QUW A;  5EPF A;  4NHZ A;  2K18 A;  1GSF A;  4MP4 A;  4BWS A;  2XPE A;  5JCU A;  1SYX A;  1T00 A;  2H75 A;  4H86 A;  1N2A A;  1O6J A;  4MF6 A;  2HSH A;  4O7H A;  4N3Z A;  4WEY A;  4I2T A;  3I43 A;  4MH3 A;  1A8Y A;  2XHF A;  1X9W B;  3US3 A;  3VFI A;  3FKF A;  3LWA A;  2GST A;  4MNN A;  5AGY A;  3D6I A;  3QPM A;  4MLY A;  2DKH A;  5G2Z A;  3DXB A;  2H1A A;  4MDC A;  2K8V A;  4F9Z A;  1MD3 A;  2VOC A;  1PGT A;  3ERF A;  5IMC A;  4MZC A;  3V1W A;  3UVH A;  5ECL B;  3M0F A;  4ACS A;  4HEA 2;  2AUV A;  3W6G A;  2O85 A;  4W66 A;  3UOM A;  4D73 B;  3W8J A;  3VI5 A;  1VF2 A;  5J47 A;  1LU4 A;  1ERW A;  2CQ9 A;  3Q18 A;  1XVW A;  2B7J A;  3SWL A;  1AW9 A;  4Z2U A;  1XXU A;  3IHG A;  4XCS A;  1M7T A;  5DQY A;  1K3L A;  4V2L A;  4XRD A;  2GSS A;  1G0T A;  3GTU A;  2FWH A;  3Q19 A;  3ZML A;  4OFN A;  4ZL9 A;  1T8E B;  1UA5 A;  2H30 A;  3PGT A;  2XBI A;  2X4A A;  2DJ2 A;  22GS A;  1K3Y A;  3E9J B;  2VCX A;  3TCO A;  4NHW A;  4PNF A;  1OYJ A;  1TK5 B;  1J0F A;  5CYY A;  2H1D A;  1AXD A;  1YF1 A;  14GS A;  5A34 A;  1TU8 A;  2EFD A;  1WPI A;  3FZ5 A;  2JSZ A;  2FCH A;  1EP8 A;  4JZQ A;  3VUR A;  4KDX A;  2HT9 A;  1Z9H A;  3BD2 A;  3APQ A;  5G31 A;  4IJ3 A;  1K0B A;  1YKC A;  5ECK B;  2FY6 A;  2KLX A;  2OBK A;  1V58 A;  2DJ1 A;  3EMP A;  4F2I A;  4PTS A;  2OE1 A;  2I1U A;  4AGS A;  4ZBB A;  1DBY A;  3C1S A;  3MNG A;  2HSY A;  3GH6 A;  2YWN A;  3ERW A;  4YQV A;  4AKI A;  2DJ0 A;  1Y25 A;  4OCF A;  5H5R A;  2GSR A;  3KM6 A;  2VO4 A;  17GS A;  1DE2 A;  1F2E A;  1N25 A;  2ALB A;  1OE7 A;  2FA4 A;  2H72 A;  4JR4 A;  3UJ1 A;  3M9J A;  5ECH B;  5DJL A;  5DAL A;  3ZIV A;  2C0F A;  3HJM A;  2HRK A;  1SU9 A;  1QQ2 A;  2EC4 A;  1HNA A;  4RI7 A;  2R5G A;  3IK9 A;  4ZBA A;  1Z6N A;  4EL1 A;  3TOU A;  5KN1 A;  2X8H A;  1OVN A;  3KMN A;  4POM A;  4YH2 A;  2QSI A;  4MCU A;  1RK4 A;  3GHA A;  3DKS A;  2B5Y A;  3L9V A;  3F9U A;  1XVQ A;  5FWG A;  1U87 A;  4GXZ A;  3HJP A;  1THX A;  4XTS A;  4GDF A;  1RW1 A;  4N10 A;  2HLS A;  2WZ9 A;  4IHU A;  1FOH A;  2VCT A;  4FYB A;  2CZ3 A;  3ZRD A;  4K9Z A;  2QGV A;  3HMJ G;  1SL2 B;  1R7H A;  3KTB A;  3ZVJ D;  2LST A;  4WBJ A;  1XW6 A;  1ZMA A;  4KW6 A;  4IS0 A;  1ERU A;  3DVX A;  4L0U A;  2UV8 G;  1NHO A;  2H6Z A;  2N5F A;  4MZB A;  5ECR B;  4TXO A;  4USS A;  5F8B A;  4GRF A;  3H4K A;  2GZZ A;  3TJK A;  3UVT A;  1K3O A;  3O3T A;  4IP6 A;  1V98 A;  4GSS A;  19GS A;  1IYI A;  2YOI A;  1SK1 A;  1TDI A;  1BQ7 A;  4KF9 A;  3C7M A;  4ML6 A;  5KEJ A;  1W4V A;  2RII A;  4Z2R A;  5GAN D;  3IAM 2;  1X5D A;  2H71 A;  1TXX A;  1GNW A;  3VLN A;  1PQN A;  2RUF A;  4N30 A;  1QMV A;  4IVF A;  4ZB7 A;  1TRV A;  1GLP A;  2KHP A;  2ZUP A;  2L6C A;  2AYT A;  5INY A;  4BVX A;  2VUP A;  3GTU B;  3VWX A;  4ECC A;  3LQ7 A;  1B8X A;  3PH9 A;  5G1K A;  1K0M A;  1O8X A;  5DCG A;  2OAD A;  2DLX A;  1F3A A;  1X5C A;  3VI7 A;  3NOF A;  2H76 A;  4KH7 A;  2JZR A;  2R37 A;  2N5A A;  1USB A;  4HZ4 A;  5A34 B;  2IPA A;  5E4W A;  1MDJ A;  3QR6 A;  4TOP A;  2VCW A;  2OT3 A;  6GSV A;  4EUY A;  3U5R E;  3FY7 A;  4MPF A;  2L57 A;  3F4R A;  1XOB A;  2LJA A;  1CQH A;  1Z6M A;  3M8N A;  4PQH A;  1TRW A;  2MMN A;  3FZ4 A;  1JLW A;  3EPT A;  3FEU A;  2F8A A;  2LKU A;  1AQX A;  3H8Q A;  2CT6 A;  5B8B A;  2YPM A;  2YNX A;  4XHM A;  3MSZ A;  1CQG A;  2HSN A;  4LL4 B;  2F8F A;  1A24 A;  2WJU A;  2RUE A;  3GKM A;  2CVD A;  4X0X A;  5J3R A;  2OAC A;  2I81 A;  3EUR A;  3GNJ A;  4I97 A;  5DAL B;  2PPT A;  3G7Y A;  5HFK A;  3TKR A;  2HRK B;  3I69 A;  2B5E A;  1PKW A;  5DAK A;  2I4A A;  4MF7 A;  1FVJ A;  4MK3 A;  3VK9 A;  4BVY A;  4G2E A;  2CAI A;  3MYD A;  1S3D A;  3G7J A;  1ACV A;  3HVX A;  1SD9 A;  5AIS A;  1GSY A;  1TI1 A;  3GX0 A;  3VWU A;  2EFE A;  2IL3 A;  5BMU A;  1VRS D;  4ZB6 A;  2K6V A;  2JL4 A;  4RUV A;  1OE8 A;  5A1N A;  2IIY A;  3DYR A;  2L6D A;  2YWM A;  1E2Y A;  1U3A A;  1EOH A;  1PL1 A;  3LG6 A;  4JR6 A;  5IO2 A;  1R26 A;  5ENU A;  4CY8 A;  5CP1 A;  4YQU A;  4O92 A;  1V57 A;  1U3I A;  3LYK A;  2L5L A;  4RQX A;  4TXO B;  3QD9 A;  4HOJ A;  3BOA A;  2OA7 A;  3FYG A;  2DMM A;  3QAV A;  3SBC A;  1HD2 A;  4IBP A;  4PNG A;  2H70 A;  5CRE A;  3GKN A;  5CO3 A;  2PU9 C;  2I9H A;  1TXU A;  1GLQ A;  2H19 A;  3LOR A;  2K8S A;  5J9B A;  1FW1 A;  4L5L A;  4NWY A;  1TP9 A;  3KH7 A;  4E68 A;  1K0A A;  5HR2 A;  1PD2 1;  4QL7 A;  1KNG A;  2EIR A;  2P5Q A;  1FB6 A;  2O89 A;  3LSZ A;  3HDC A;  4BVX B;  4V1A g;  3A3T A;  5GAP D;  1ZL9 A;  4TW5 A;  2ZCT A;  4TR4 A;  4RI6 A;  2HZE A;  3TB2 A;  2WFC A;  5HR1 A;  2XBQ A;  4AJ6 A;  4NMU A;  2DML A;  3APO A;  1EGR A;  3QFB C;  4BL7 A;  4Z2T A;  2M80 A;  4K8M A;  3ZL5 A;  3ZYW A;  2ZNM A;  5C04 A;  3EC3 A;  3FW2 A;  3KXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...