5AGYA

Crystal structure of a tau class gst mutant from glycine
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
219
structure length
219
Chain Sequence
MQDEVVLLDFWPSPFGMRVRIALAEKGIKYEYKEEDLQNKSPLLLKMNPVHKKIPVLIHNGKPICESLIAVQYIEEVWNDRNPLLPSDPYQRAQTRFWADYVDKKIYDLGRKICTSKGEEKEAAKKEFIEALKLLEEQLGDKTYFGGDNLGFVDIALVPFYTWFKAYETFGTLNIESECPKFVAWAKRCLQKESVAKSLPDQQKVYEFIMDLRKKLGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Directed Evolution of Tau Class Glutathione Transferases Reveals a Site that Regulates Catalytic Efficiency and Masks Cooperativity.
pubmed doi rcsb
source organism Glycine max
molecule tags Transferase
total genus 84
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5agyA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5agyA01
1WMJA 4GSTA 1LU4A 2XPDA 4NAXA 3IR4A 4PXOA 2HNLA 4NV5A 3UBLA 3ZLPA 1NHYA 1XCCA 2A2RA 3C71A 4ECBA 1T00A 2J23A 3D22A 2OE1A 4LMVA 3FZ5A 2MBTA 4DSSB 4N10A 1SYRA 4G10A 1PD21 4GCIA 1ABAA 2OBIA 5F05A 4WF4A 4L0WA 5G5FA 1V98A 5IOWA 1Z6NA 3IRAA 2NTOA 3EU4A 4MF6A 1QQ2A 3GURA 2AB6A 1N8JA 3CBUA 5FHIA 4Q5RA 2CAIA 2O8VB 4YQUA 5IIZA 3LJRA 6GSVA 2F51A 1ERWA 4BA7A 3R2QA 2B3SA 4K7NA 2UZ8A 1FO5A 2DC5A 4WR4A 3FR9A 3TKQA 4TXVA 3A2XA 3GKKA 2BMXA 3A5WA 2YCDA 3A3TA 2H74A 4KE3A 3PR8A 1ON4A 3UOMA 4IP6A 2OKAA 3WT2A 4ZBAA 2JSZA 3U6VA 3MAKA 5ECNB 1QMVA 7GSSA 1OYJA 4MF5A 3ZMLA 1ILOA 3BCKA 1G7EA 3CSIA 4KUNA 2PERA 4IQ1A 1FB6A 2PN8A 4DSSA 4POLA 2RM5A 3C7MA 3H4KA 5IO0A 1ZOFA 4EE0A 4KCAA 5G1KA 5CNWA 2V6KA 3M1GA 2HT9A 5AIVA 1A0RP 4XS4B 2JU5A 5LNKe 3S9FA 5IPHA 4F82A 4F0CA 5DCGA 2H73A 5HR1A 2VLUA 4ML1A 2E0QA 1EV4A 1YEXA 2N5BA 5INYA 1MEKA 1PX7A 2MMNA 4GQCA 2A4VA 1GTUA 2GT6A 4JBBA 5A4UA 1TKDB 4D73B 2H66A 1AQWA 1XWKA 4K8MA 3GL5A 6GSSA 2MMZA 3L9SA 4Q5QA 1X5CA 1VRSD 1W89A 3VPTA 3O3TA 1PSQA 1SYXA 4IP1A 3TOTA 2GLRA 3FY7A 2DJ2A 1K0DA 4EC0A 2R3XA 1XW9A 4N30A 2AHEA 1BX9A 2L6CA 1OAZA 3DWVA 4EUYA 2GS3A 2IFQB 4OWYA 3D21A 2HYXA 2I1UA 3UARA 2X8GA 4IN0A 4EKZA 3HKRA 3ZITA 2NVLA 4JR6A 1A24A 4PQ1A 3UMAA 3F6DA 2C80A 5ELGA 1FG4A 4NV2A 3RHBA 2H1BA 2EIQA 4EF0A 3F4RA 3VI5A 1HNAA 4XS4A 3O6TA 3IA1A 2PU9C 1TJDA 4PTSA 4E8EA 3KMNA 4ZB6A 2VD1A 5GAND 1SK0A 3QCPA 3IV4A 5HQPA 3ZTLA 5CRDA 3BJ5A 3ZVJA 4IVFA 1TW9A 1PL2A 4D73A 5D9TA 4J57E 2L4QA 5IMAA 1BEDA 1EOHA 2F8FA 3CYNA 2YWOA 4PNFA 4ECCA 1NM3A 3IHQA 1NHOA 3HZ8A 1MD4A 2IMIA 2MZCA 5JCUA 1NSWA 1SJZA 5DALB 3F9UA 2NPBA 3VWUA 4V1Ag 4DSRA 1SU9A 5AISA 2GGTA 2IFQA 1K3YA 1MTCA 2GSSA 3LXZA 1ZYEA 1USBA 4MCUA 1K3LA 3QFBC 1A2MA 1F3AA 2O85A 4GRFA 4KNDA 1E2YA 1DBYA 1FW1A 4MZBA 4QL7A 5ECHB 4HJMA 5H5SA 2I4AA 2I9HA 4KAEA 3NOFA 2AV4A 4HEA2 20GSA 1WPIA 4TR1B 2YWIA 3HCZA 4J56E 1NW2A 3EURA 1JHBA 4RUVA 1M2DA 2QGVA 2H75A 1YKCA 5LCZA 1SJIA 3TJBA 3UEMA 1LBKA 4POMA 2GTUA 4TN8A 3GH9A 2IMFA 3L4NA 2RLIA 5DALA 4XTSA 1O85A 3KP9A 2C3NA 2IIYA 4F9ZA 3D0ZA 1GH2A 4ACSA 2OJLA 1V40A 3ZIJA 2KP1A 3QFAC 1MD3A 3ME8A 2IL3A 3WGXA 3F3RA 4RI6A 2CX3A 5E59A 5DQSA 2L59A 3US3A 2WZ9A 22GSA 5IM9A 5CO3A 1X9MB 1SD8A 1VGLA 4JU5A 4IJIA 3TKSE 1TDIA 1HYUA 5D73A 2HE3A 4OO5A 2GT5A 2H0IA 1O8XA 3L78A 1XXUA 3KTLA 3IDVA 1XW5A 4NHZA 1JLWA 2JZRA 4AJ7A 4XCSA 3ZREA 4TR1A 2L57A 4O32A 1R7HA 1X9SB 1K0NA 3FHKA 2FWFA 1RK4A 3DRNA 5KN3A 5ID2B 3E3EA 1BAYA 4P3YB 1B9YC 3GX0A 4OFNA 3C73A 3IK7A 3P2AA 2VOCA 4CHSA 2R5GA 4HJ2A 2LV3A 1O81A 2VM1A 2PPTA 4HOJA 1B4PA 2DJJA 3KEBA 5IMVA 1GNWA 4O5RA 3LG6A 2TRXA 3FKFA 1SK1A 4IJ3A 4MF7A 2L4CA 3K8NA 3LFLA 1ST9A 1PKWA 1VF1A 2HSYA 2NDOA 4HQZA 2G0FA 1N2AA 1GTBA 3VK9A 5ECMB 3UL3A 4MJBA 1IYIA 3DXBA 3GNJA 3IBHA 3KH7A 1I9DA 1H75A 2FY6A 4BPYA 3H1NA 3IXRA 1PRXA 3ZVJD 1UC7A 3HVSA 4YAVA 3CMIA 1F6MC 2RUFA 3DD3A 2N5AA 2JZTA 3M9JA 1PX6A 1FB0A 2C4JA 5ID2A 3QOUA 3G7IA 4TW5A 3OR5A 1THOA 2VO4A 1MDJA 4OO4A 3EMXA 2MBSA 3LQ7A 4TR4A 3ED3A 1Z9HA 1QUWA 1U3AA 4V1Ap 3W8SA 2LEGA 3ERFA 3QMXA 4KDXA 3LWAA 1YJ6A 5IMDA 13GSA 1ML6A 1S3CA 3WT1A 1U88A 2LRCA 3J7Yk 4E8HA 5G1LA 3LXTA 2FWHA 2H0HA 1SJ6A 3F6FA 3CSJA 1WRYA 2IJYA 2B5YA 5G31A 4KX4A 5J3RA 1GNEA 1R5PA 2XC2A 3UJ1A 3FZAA 3GX8A 2QC7A 3I6AA 1G0TA 5G5EA 1EOGA 2JADA 1T3BA 3D4TA 2DJ1A 3MSZA 3QDNA 2OE3A 2H30A 4HU7A 2VAFA 3IAS2 3KJYA 4TXOB 5CRGA 3NIVA 19GSA 3J7Yb 2LSTA 3KP8A 4KH7A 1WOUA 5BMUA 4Z7XA 1AQXA 3E0UA 3FW2A 1F3BA 2YV9A 1QFNA 4PQHA 4CW9A 4GTUA 3HVXA 2FA8A 2R6KA 2VLTA 5AN1A 2R4VA 2WGRA 5C04A 3IC4A 2HSNB 6GSWA 3F4TA 4MJEA 4MPGA 3P8WA 4MH2A 1Z7RA 4EVMA 1ERUA 11GSA 4OFTA 1UN2A 5F07A 1SL0B 3ZL5A 5HR2A 1JLVA 2LTKA 2IMEA 1ERTA 5DJMA 2GZZA 4G0LA 4WBRD 5JCGA 5H5RA 3ISOA 4MMMA 4X1UA 3GL3A 3DEXA 2X8CA 2E2GA 8GSSA 3RHCA 3BOAA 1Z6MA 3M3MA 2YZHA 3TJGA 2OACA 4TXOA 3EU3A 4LL4B 1M9BA 1GLPA 3GTUB 4DEJA 2H6XA 4N11A 3F8UA 17GSA 2GQLA 1T7PB 1GWCA 4MLYA 2VCTA 1GSFA 4MJCA 2Z9SA 5J5NA 5G30A 4DVCA 2FUG2 5FT3A 3GUSA 2GSQA 2DBCA 1GLQA 3N5OA 5IQYA 5ECOB 4KDUA 4MH3A 3LYPA 1E6BA 4PQIA 1G6WA 2VD0A 3I43A 4FH8A 1WJKA 2WB9A 1KEBA 3HY2A 5J4UA 2VCVA 1J9BA 1S3DA 1XW6A 2H01A 1ZGNA 3VWXA 2P0GA 2GZYA 4K6XA 2B7JA 2L5OA 1QXHA 4KB3A 4OCFA 5B6NA 1OVNA 3KGKA 1PGTA 2H8LA 2YPMA 2C0DA 4WF5A 3DMLA 4WR5A 2GQMA 2VUPA 4IKHA 4MK3A 4K2DA 2M46A 4EXJA 2KHPA 5EPFA 4BVYB 1B9XC 4FYUA 2X99A 3RAZA 3D4MA 1OC3A 5EVOA 4OMVA 4EDYA 2ALBA 4WETA 1AIUA 1GRXA 2VCXA 1AC1A 3G7YA 2VM2A 5CYYA 3PPUA 1EP7A 3GTUA 3HYPA 2TRCP 4I2TA 2FA4A 3DIEA 4MJAA 2D2ZA 3KMOA 2P5QA 1URMA 1AUCA 3TKPA 2E7PA 3KM6A 1T8EB 3FK8A 3V1WA 2AJQB 2MMAA 4G2EA 2GSRA 4L5OA 2H1AA 2H19A 1S3AA 5KN1A 3IC8A 2LQQA 1YF1A 1T1VA 2AUVA 2IMKA 2H76A 3DVXA 1PN9A 2YV7A 2OE0A 5J9BA 4DSQA 1X5DA 2VL3A 1V9WA 6GSUA 2JACA 3BD2A 5IO2A 1OKTA 4X43A 1TRVA 1GSQA 2IWTA 3KCMA 1BG5A 4OD7A 3TB2A 3TRQA 1JFUA 2H71A 4BVYA 3RPPA 3TJFA 4WBJA 1A8YA 5LD0A 4POKA 2HXKA 1Z7PA 1ZCPA 2CAQA 5DCHA 3GIXA 3KD0A 2LNTA 2JSYA 1GSDA 2H1DA 1GUKA 1XVQA 2LJAA 1SL1B 4GWRA 2X64A 2H6ZA 4KSMA 2YJHA 1HD2A 2GVPA 4LLRA 4BVXB 1YDKA 5D93A 2B1KA 1O6JA 2DJ0A 3SBCA 2GSTA 2EIRA 3CXGA 3CRUA 5HR0A 3M0FA 5GAPD 3M9KA 2VLVA 4KA0A 3FR6A 5GSTA 5CREA 1TI1A 2DMMA 3W6GA 4HS1A 3FZ4A 1ZZYA 1EGOA 3HJPA 3QAWA 1R5AA 1TU8A 2K8SA 5FWGA 1AQVA 5F8BA 3C1SA 2XHFA 1TI3A 3F3QA 1TP9A 3JCML 2OBKA 3TCOA 3C1RA 5D9VA 3H8QA 3F63A 5ECSA 2AYTA 3LGCA 4ZIJA 5DQYA 3EC3A 1M2BA 5JCWA 5GZZB 1J08A 1HNCA 3EWLA 1SL2B 4ZL8A 4G19A 3TUEA 5B8BA 2I3YA 4ZB9A 1OE7A 3ZFLA 1ERVA 9GSSA 4BVXA 2YZUA 4MZWA 2P5RA 2IMDA 5B7CA 2HZFA 4L0UA 2VL2A 4HUAA 3R3EA 3APOA 2H0GA 1UA5A 1Y25A 3WYWA 2NBSA 4K0GA 1AAZA 1R4WA 4MABA 2HZEB 5KEJA 1YF0A 4IELA 2V2GA 2BTOT 2FHEA 5DAKB 3RBTA 2HRFA 2WDUA 4RQRA 3DVWA 2ZNMA 2F9SA 5D8IA 2GQKA 4ISDA 1HQOA 3GA4A 3O76A 4K0NA 4TR3A 2X8HA 2V32A 3ZRDA 4XIHA 5ECPB 4F03A 2CV4A 1K0OA 4ZBBA 2H6YA 3FZ9A 3W8JA 1R26A 1G7OA 1FVKA 4L8EA 2IN3A 4WXTA 2LS5A 2HI7A 4AJ8A 1M0UA 5D9WA 1A2LA 2LQOA 2HSMB 3IOSA 1BYEA 4PX1A 3GN3A 3GKMA 2FD3A 3ME7A 3U5RE 3GHAA 3UVHA 5KN0A 4G0IA 3M8NA 3DYRA 5B8AA 1Y6EA 2HZEA 1TK0B 1XWBA 2H72A 3MWHA 5DAKA 2YN1A 2EC4A 3WGEA 2VL9A 1XWAA 3EINA 5AGYA 5F06A 1W4VA 4K1FA 5D96A 4PNGA 3C8EA 3RPNA 2DIYA 3WD6A 3GKNA 5E4WA 2YNXA 2B7KA 1EV9A 2N5FA 1TXXA 3H93A 4I5QA 4V2LA 4NPBA 5JWOB 2B5EA 4GLTA 2PGTA 2G2QA 1FVJA 1GUHA 1Z3EA 5G2ZA 3BBYA 1A8LA 2YOIA 2K9FA 6GSXA 3PINA 4V2MA 1X0RA 2XBIA 2K6VA 5ENUA 1PQNA 3L0HA 1O7UA 1M7TA 1BJXA 1VF4A 2E2MA 2O87A 3VLNA 4IGJA 2C0EA 2WULA 4MZCA 2MMOA 3VWVA 1K0MA 2KOKA 1TOFA 1F37A 3FR3A 5DJLA 2HSMA 1AW9A 1PA3A 3HHVA 2LKUA 1Q98A 3CTFA 4N0ZA 4EL1A 3RDWA 14GSA 3MNGA 3HJOA 3GH6A 3FEUA 1PMTA 3GSTA 2VL2C 4PURA 3G9BA 5IMFA 1GUMA 3P7XA 1T4YA 4TR0A 1ZYQB 4I2UA 2VCQA 3VWWA 1TU7A 3TKRA 3I9V2 3GYKA 1ACVA 2M80A 3BCIA 3APSA 4WEYA 3ZZXA 2XPEA 4L5LA 2BJXA 3Q18A 2DLXA 12GSA 2M72A 3LEFA 5JWQB 2DSAA 1IYHA 10GSA 2GZPA 4GXZA 3HVVA 2C1YA 2DJ3A 4YQVA 2CT6A 2CVDA 18GSA 5AIXA 2DJKA 3HXSA 4XS1A 5DBQA 3VFIA 1MDIA 3HJMA 2B6MA 2A2SA 4XRAA 4GQFA 1XWGA 4HZ2A 5J41A 1K3OA 4KW6A 4BL7B 2LNSA 2TIRA 1K0AA 4ID0A 4IHUA 1YY7A 2HQTA 2WS2A 2CZ3A 2KP2A 1Q4JA 1OC8A 1VF3A 1ZMAA 3TDGA 5ECLB 2HRKB 3TRXA 1Z5YE 1FAAA 5IPGA 1JZOA 1GSYA 3F0IA 1XOAA 4K7IA 5F0GA 2C8UA 1YQ1A 1ZL9A 2GDRA 4HI7A 2F8AA 4FQUA 1EP8A 4LL1B 4GF0A 1KNGA 2F3MA 3ZMKA 1JZDA 4JR4A 4O92A 1SKSB 3Q19A 1B4QA 2OA7A 3UVTA 4QQ7A 3A2WA 3APQA 2FNOA 4JZQA 1QGVA 5H5QA 3DGQA 2B5XA 2VCZA 3VURA 2CQ9A 2MYGA 2ZCTA 4CDOA 1GL8A 2CVBA 3TKSC 2ZUPA 5COHA 5CRHA 1GTIA 5C00A 4K7OA 4AF2A 4BWQA 4USSA 1DE1A 1RW1A 3HA9A 3Q74A 2FLSA 5ABRA 4V2NA 4KF9A 1VF2A 5DVBA 3GRXA 1QK8A 2ON5A 4WKWA 1B48A 3ERGA 1XBSA 4XS6A 2C0FA 4OCEA 2FWEA 4BL7A 4KCEA 2KLXA 5ECQB 4PUAA 2RM6A 4FO5A 4XHMA 4F0BA 2HRKA 2WJUA 5HFGA 3I69A 1V58A 2CVKA 4H86A 2B1LA 2O89A 2V41A 3VPQA 4G9HA 5CP1A 2JZSA 2ON7A 2IPAA 3HDCA 4ULXA 4MA9A 4EDZA 1TRSA 3GMFA 1DSBA 3FYGA 2LJKA 4IS0A 1UVZA 3ERWA 3LORA 4MDCA 1THXA 2H70A 1H4OA 4RI7A 1TRUA 1XIYA 4NWYA 4ZILA 2FCHA 5ECRB 1XWCA 5D9XA 2H1GA 2J9HA 4Q5NA 1I5GA 5EY6A 1GSEA 5HR3A 2HRAA 2QSIA 3TGZA 1OKDA 4IW9A 5HFKA 1LJRA 3NZNA 2WCIA 3LSZA 4ML6A 4ILFA 1SK2A 6GSYA 3QAGA 2I81A 4J2FA 1WIKA 1EZKA 2ES7A 3H79A 3D5JA 2CA8A 1SENA 1X9WB 4NXIA 1AXDA 2DIZA 2OADA 1SD9A 4LMWA 2EIOA 3QAVA 3AY8A 1CQHA 4ZXGA 4GSSA 2DMLA 1GTAA 3E9JB 4FIWA 1XZOA 2R37A 4JE1A 1V57A 1YZXA 5HFIA 1TRWA 3PGTA 4HU9A 1FHEA 1G6YA 2PVQA 1EGRA 5L71A 1RQMA 2LUSA 1YKAA 4HQSA 3IE3A 1BQ7A 3KIJA 2PUKC 3CRTA 2WFCA 4TVEA 3UAPA 1XOBA 2LRTA 4YAPA 2C0GA 4YQMA 2PWJA 3TRPA 2PVOC 1A0FA 3UIWA 5A4WA 1U87A 4ZL7A 3FRCA 4HZ4A 3EVIA 2FWGA 3KTBA 4I6XA 2QKEA 3TOUA 4TOPA 3TJJA 3KXOA 2KUCA 4IQAA 1PL1A 2AAWA 4N0VA 4I8BA 1C72A 2VIMA 3PH9A 1KTEA 3SWLA 1SKWB 4TKYA 4RQXA 1WE0A 1FOVA 4TRXA 2VCWA 3VI7A 16GSA 1O73A 4ZB8A 2C3TA 3GSSA 5IOXA 1V2AA 4ZBDA 3ZYWA 2RUEA 5A4VA 1PKZA 1EWXA 1J0FA 2YJ7A 3KH9A 4IBPA 4Q5FA 3A2VA 4FYBA 1SKRB 2HSHA 1CQGA 4JEDA 4PUFC 3HZ4A 6GSTA 3IPZA 4JRRA 3QD9A 3DKSA 1OC9B 1F2EA 1U3IA 3UBKA 2WRTA 3Q6OA 2HRNA 3LYKA 3QR6A 2L5LA 5IMZA 1M2AA 3P90A 4ECJA 5ELAA 2XBQA 2YWNA 1K0CA 3D6IA 4BWSA 3N9JA 5GSSA 4X0XA 3EE2A 1MDKA 1X5EA 1GULA 4HDEA 1JZRA 2K8VA 4KDYA 5B6MA 3MDKA 5EL8A 3GKXA 3L9VA 1M9AA 1XFLA 5CAXA 4GSNA 1K0BA 5JWRB 5DDLA 4YH2A 1TTZA 3IK9A 1YEPA 1DE2A 4MPFA 4ZL9A 1EEJA 1GSSA 3HD5A 2R2JA 5J9CA 5KN2A 4AGSA 2REMA 2YWMA 3F4SA 2P31A 2PMTA 1WP0A 2V6OA 1KBNA 3TJKA 1HNBA 2O7KA 5A5KA 4G0KA 3ZFBA 1GSUA 2K18A 2HLSA 4PGTA 2HFDA 4O7HA 4QL9A 3KZQA 1TK5B 2JL4A 4POBA 4NMUA 4F2IA 2YANA 1O8WA 4XRDA 1JZWA 3QPMA 4FYCA 3IAM2 2C3QA 2CZ2A 4EO3A 2FGXA 2L6DA 1A23A 5IMCA 2LJRA 5ECKB 1OE8A 1M99A 3GFKA 1XVWA 1OC9A 3EYTA 1WWJA 2CX4A 3TKSA 4I97A 1GP1A 3GV1A 4KSOA 2RIIA 3L9UA 4KGIA 1B8XA 2PBJA 2LRNA 4NHWA 2YP6A 4K9ZA 4ECIA 2V1MA 1F9MA 1TK8B 3WGDA 4LA1A 5CRWA 1DUGA 1XPVA 3EMPA 4MP4A 3G7JA 3ZIVA 3CSHA 4OFMA 3CTGA 5ECIB 1A2JA 4AJ6A 1U6TA 1T4ZA 1EEMA
chains in the Genus database with same CATH superfamily
1WMJA 1ZYNA 4GSTA 1LU4A 4W66A 2XPDA 4NAXA 3IR4A 4PXOA 2HNLA 4NV5A 3UBLA 3ZLPA 1NHYA 1XCCA 2A2RA 3C71A 4ECBA 1T00A 2J23A 3D22A 2OE1A 4LMVA 3FZ5A 2MBTA 4DSSB 4N10A 1SYRA 4G10A 1PD21 4GCIA 1ABAA 2OBIA 5F05A 4WF4A 4L0WA 2WZSA 5G5FA 1V98A 5IOWA 1Z6NA 2A2PA 3IRAA 2NTOA 3EU4A 4MF6A 1QQ2A 3GURA 2AB6A 1N8JA 3CBUA 5FHIA 4Q5RA 2CAIA 2O8VB 4ZB7A 4YQUA 3LJRA 5IIZA 6GSVA 2F51A 1ERWA 4BA7A 2OT3A 3R2QA 2B3SA 4K7NA 2UZ8A 1FO5A 2DC5A 4WR4A 3FR9A 3TKQA 4TXVA 3A2XA 3GKKA 2BMXA 3A5WA 2YCDA 3A3TA 2H74A 4KE3A 3PR8A 1ON4A 3UOMA 4IP6A 2OKAA 3WT2A 4ZBAA 2JSZA 3U6VA 3MAKA 5ECNB 1QMVA 7GSSA 1OYJA 4MF5A 3ZMLA 1ILOA 5A34A 3BCKA 1G7EA 3CSIA 2R0PA 4KUNA 2PERA 4IQ1A 2PN8A 5J47A 1FB6A 4DSSA 4POLA 2RM5A 3C7MA 3H4KA 5IO0A 1ZOFA 4EE0A 4KCAA 5G1KA 2O5VA 5CNWA 2V6KA 3M1GA 2HT9A 5AIVA 1A0RP 1FOHA 4XS4B 2JU5A 5LNKe 3S9FA 5IPHA 4F82A 4F0CA 5DCGA 2H73A 5HR1A 2VLUA 4ML1A 2E0QA 1EV4A 1YEXA 2N5BA 5INYA 1MEKA 1PX7A 2MMNA 4GQCA 2A4VA 1GTUA 2GT6A 4JBBA 5A4UA 1TKDB 4D73B 2H66A 1AQWA 1XWKA 4K8MA 3GL5A 4CY6A 6GSSA 2MMZA 3L9SA 4Q5QA 1X5CA 1VRSD 1W89A 3VPTA 3O3TA 1PSQA 1SYXA 4IP1A 3TOTA 2GLRA 3FY7A 2DJ2A 1K0DA 4EC0A 2R3XA 1XW9A 4N30A 2AHEA 1BX9A 2L6CA 1OAZA 4EIQA 4Z2UA 3DWVA 4EUYA 2GS3A 2IFQB 4OWYA 3D21A 2HYXA 2I1UA 3UARA 2X8GA 4IN0A 4K5RA 4EKZA 3HKRA 3ZITA 4G01A 2NVLA 4JR6A 1A24A 4PQ1A 3UMAA 3F6DA 2C80A 5ELGA 1FG4A 4NV2A 3RHBA 2H1BA 2EIQA 4EF0A 3F4RA 3VI5A 1HNAA 4XS4A 3O6TA 3IA1A 2PU9C 1TJDA 4PTSA 4E8EA 5J40A 3KMNA 4ZB6A 2VD1A 5GAND 1SK0A 3QCPA 3IV4A 5HQPA 3ZTLA 5CRDA 3BJ5A 3ZVJA 4IVFA 1TW9A 1PL2A 4D73A 5D9TA 4J57E 2L4QA 5IMAA 1BEDA 1EOHA 2F8FA 3CYNA 2YWOA 4PNFA 2O3EA 4ECCA 1NM3A 1BF5A 3IHQA 1NHOA 3HZ8A 1MD4A 2IMIA 2MZCA 5JCUA 1NSWA 1SJZA 5DALB 3F9UA 2NPBA 3FMWA 3VWUA 4V1Ag 4DSRA 1SU9A 5AISA 2GGTA 2IFQA 1K3YA 1MTCA 2GSSA 4Z2TA 3LXZA 1ZYEA 1USBA 4MCUA 1K3LA 3CHXC 3QFBC 1A2MA 1F3AA 2O85A 4GRFA 4KNDA 1E2YA 1DBYA 1FW1A 2DKIA 4MZBA 4QL7A 5ECHB 4HJMA 5H5SA 2I4AA 2I9HA 4KAEA 3NOFA 1TXUA 2AV4A 4HEA2 20GSA 1WPIA 4TR1B 2YWIA 3HCZA 3TU3B 4J56E 1NW2A 3EURA 1JHBA 4RUVA 1M2DA 2QGVA 2H75A 1YKCA 5LCZA 1SJIA 3TJBA 3UEMA 1LBKA 4POMA 2GTUA 4TN8A 3GH9A 2IMFA 3L4NA 2RLIA 5DALA 5J4YA 4XTSA 1O85A 3KP9A 2C3NA 2IIYA 4F9ZA 3D0ZA 1GH2A 4ACSA 2OJLA 1V40A 3ZIJA 2EFCA 2KP1A 3QFAC 1MD3A 3ME8A 2IL3A 3WGXA 3F3RA 4RI6A 2CX3A 5E59A 5DQSA 2L59A 2X49A 3US3A 2WZ9A 22GSA 5IM9A 5CO3A 1X9MB 1SD8A 1VGLA 4JU5A 4IJIA 3TKSE 1TDIA 1HYUA 5D73A 2HE3A 4OO5A 2GT5A 2H0IA 1O8XA 3L78A 1XXUA 3KTLA 3IDVA 1XW5A 4NHZA 1JLWA 2JZRA 4AJ7A 4XCSA 3ZREA 4TR1A 2L57A 4O32A 1R7HA 1X9SB 1K0NA 3FHKA 2FWFA 3MIXA 1RK4A 3DRNA 5KN3A 5ID2B 3E3EA 1BAYA 4P3YB 4AKHA 1B9YC 3GX0A 4OFNA 3C73A 3IK7A 3P2AA 2VOCA 4CHSA 2R5GA 4HJ2A 4AKXB 2LV3A 1O81A 2VM1A 2PPTA 4HOJA 1B4PA 2DJJA 3KEBA 2UV8G 5IMVA 1GNWA 4O5RA 3LG6A 2TRXA 3FKFA 1SK1A 4IJ3A 4MF7A 2A4HA 2L4CA 3K8NA 3LFLA 1ST9A 1PKWA 1VF1A 2HSYA 2NDOA 4HQZA 2G0FA 1N2AA 1GTBA 3VK9A 5ECMB 3UL3A 4MJBA 1IYIA 3DXBA 3GNJA 3IBHA 3KH7A 1I9DA 1H75A 2FY6A 4BPYA 3H1NA 3IXRA 2WW3A 1PRXA 3ZVJD 1UC7A 3HVSA 4YAVA 3CMIA 1F6MC 2RUFA 3DD3A 2N5AA 2JZTA 3M9JA 1PX6A 1FB0A 2C4JA 5ID2A 3QOUA 3G7IA 4TW5A 3OR5A 5BMUB 1THOA 2VO4A 1MDJA 4OO4A 3EMXA 2MBSA 3LQ7A 1M3JA 4TR4A 3ED3A 4O5UA 1Z9HA 1QUWA 1U3AA 4V1Ap 3W8SA 2LEGA 3ERFA 3QMXA 3HMJG 4KDXA 3LWAA 1YJ6A 5IMDA 13GSA 1ML6A 1S3CA 3WT1A 1U88A 4AKGA 2LRCA 3J7Yk 4E8HA 5G1LA 3LXTA 2FWHA 2H0HA 1SJ6A 3F6FA 3CSJA 1WRYA 2IJYA 2B5YA 5G31A 4KX4A 5J3RA 1GNEA 1R5PA 2XC2A 4CY8A 3A5IA 3UJ1A 3FZAA 3GX8A 2QC7A 5A34B 3I6AA 1G0TA 5G5EA 1EOGA 2JADA 1T3BA 3D4TA 2DJ1A 3MSZA 1YVLA 3QDNA 2OE3A 2H30A 4HU7A 2VAFA 3IAS2 3KJYA 4TXOB 5CRGA 3NIVA 19GSA 3J7Yb 2LSTA 3KP8A 4KH7A 1WOUA 5BMUA 4Z7XA 1AQXA 3E0UA 3FW2A 1F3BA 2YV9A 1QFNA 3LW9A 4PQHA 4CW9A 4GTUA 3HVXA 2FA8A 2R6KA 2VLTA 5AN1A 2R4VA 2WGRA 5C04A 3IC4A 2HSNB 6GSWA 3F4TA 4MJEA 4MPGA 3P8WA 4MH2A 1Z7RA 4EVMA 1ERUA 11GSA 4OFTA 1UN2A 5F07A 1SL0B 3ZL5A 5HR2A 1JLVA 2LTKA 2IMEA 1ERTA 5DJMA 2GZZA 4G0LA 4WBRD 5KOXA 5JCGA 5H5RA 3ISOA 4MMMA 4X1UA 3GL3A 3RGBC 3DEXA 2WW1A 2X8CA 2E2GA 8GSSA 3RHCA 3CQFA 3BOAA 1Z6MA 3M3MA 2YZHA 3TJGA 2OACA 4TXOA 3EU3A 4LL4B 1M9BA 1GLPA 3GTUB 4DEJA 2H6XA 4N11A 3F8UA 17GSA 2GQLA 1T7PB 1GWCA 4MLYA 2VCTA 1GSFA 4MJCA 2Z9SA 5J5NA 5G30A 4DVCA 2FUG2 5FT3A 3GUSA 2GSQA 2DBCA 4N3ZA 2HSNA 1GLQA 3N5OA 5IQYA 5ECOB 4KDUA 4MH3A 3RFRC 3LYPA 1E6BA 4PQIA 1G6WA 2VD0A 3I43A 4FH8A 1WJKA 2WB9A 2WW0A 1KEBA 3HY2A 5J4UA 2VCVA 1J9BA 1S3DA 1XW6A 2H01A 1ZGNA 3VWXA 2P0GA 2GZYA 4K6XA 2B7JA 2L5OA 1QXHA 4KB3A 4OCFA 5B6NA 1OVNA 3KGKA 1PGTA 3MYDA 2H8LA 2YPMA 2C0DA 4WF5A 3DMLA 4WR5A 2GQMA 2VUPA 2R0GA 4IKHA 4MK3A 4K2DA 2M46A 4EXJA 2KHPA 5EPFA 4BVYB 1B9XC 4FYUA 2X99A 3RAZA 3D4MA 1OC3A 5EVOA 4OMVA 4EDYA 2ALBA 4WETA 1AIUA 1GRXA 2VCXA 1AC1A 3G7YA 2VM2A 5CYYA 3PPUA 1EP7A 3GTUA 3HYPA 2TRCP 4I2TA 2FA4A 3DIEA 4MJAA 2D2ZA 3KMOA 2P5QA 1URMA 1AUCA 3TKPA 2E7PA 3KM6A 1T8EB 3FK8A 3V1WA 2AJQB 2MMAA 4G2EA 2GSRA 4L5OA 2H1AA 2H19A 1YEWC 1S3AA 5KN1A 3IC8A 2LQQA 1YF1A 1T1VA 2AUVA 2IMKA 2H76A 3DVXA 1PN9A 2YV7A 2OE0A 5J9BA 4DSQA 1X5DA 2VL3A 1V9WA 6GSUA 2QA2A 2JACA 3BD2A 5IO2A 1OKTA 4MNNA 4X43A 4GDFA 1TRVA 1GSQA 2IWTA 3KCMA 1BG5A 4OD7A 3TB2A 3TRQA 1JFUA 2H71A 4BVYA 4O5QA 3RPPA 3TJFA 4WBJA 1A8YA 5LD0A 4POKA 2HXKA 1Z7PA 1ZCPA 2CAQA 1XG8A 5DCHA 3GIXA 2WVXB 3KD0A 2LNTA 2JSYA 1GSDA 2H1DA 1GUKA 1XVQA 2LJAA 1SL1B 4GWRA 2X64A 2H6ZA 4KSMA 2YJHA 1HD2A 2GVPA 4LLRA 4BVXB 1YDKA 5D93A 2B1KA 1O6JA 2DJ0A 3SBCA 2GSTA 1SVLA 1PN0A 2EIRA 3CXGA 2QA1A 3CRUA 5HR0A 3M0FA 5GAPD 3M9KA 2VLVA 4KA0A 3FR6A 5GSTA 5CREA 2VKZG 1TI1A 2DMMA 3W6GA 4HS1A 3FZ4A 1ZZYA 1EGOA 3HJPA 3QAWA 1R5AA 1TU8A 2K8SA 5FWGA 1AQVA 5F8BA 3C1SA 2XHFA 1TI3A 3F3QA 1TP9A 3JCML 2OBKA 3TCOA 3C1RA 5D9VA 3H8QA 3F63A 4QMKA 5ECSA 2AYTA 3LGCA 3IHGA 4ZIJA 5DQYA 3EC3A 1M2BA 5JCWA 5GZZB 2WVXA 1J08A 1N25A 1M3IA 1HNCA 3EWLA 1SL2B 4ZL8A 4G19A 3TUEA 5B8BA 2I3YA 4ZB9A 1OE7A 3ZFLA 1ERVA 9GSSA 4BVXA 2YZUA 4MZWA 2P5RA 2IMDA 5B7CA 2HZFA 4L0UA 2VL2A 4HUAA 3R3EA 3APOA 2H0GA 1UA5A 1SVOA 1Y25A 3WYWA 2NBSA 4K0GA 1AAZA 1R4WA 4MABA 2HZEB 5KEJA 1YF0A 4IELA 2V2GA 2BTOT 2FHEA 5DAKB 3RBTA 2HRFA 2WDUA 4RQRA 3DVWA 2ZNMA 2F9SA 5D8IA 2GQKA 4ISDA 1HQOA 3GA4A 3O76A 4AI6A 4K0NA 2WVYA 4TR3A 2X8HA 2V32A 3ZRDA 4XIHA 4FXYP 5ECPB 4F03A 2CV4A 1K0OA 4ZBBA 2H6YA 3FZ9A 2X4AA 1R26A 3W8JA 1G7OA 1FVKA 4L8EA 2IN3A 4WXTA 2LS5A 2HI7A 4A5PA 4AJ8A 1M0UA 5D9WA 1A2LA 2LQOA 2HSMB 3IOSA 1BYEA 4PX1A 3GN3A 3GKMA 2FD3A 3ME7A 3U5RE 3GHAA 3UVHA 5KN0A 4G0IA 3M8NA 5A1NB 3DYRA 5B8AA 1Y6EA 4Z2RA 2HZEA 1TK0B 1XWBA 2H72A 3MWHA 5DAKA 2YN1A 2EC4A 3WGEA 2VL9A 1XWAA 3EINA 5AGYA 5F06A 1W4VA 4K1FA 2EFEA 5D96A 4PNGA 3C8EA 3RPNA 2DIYA 3WD6A 3GKNA 5E4WA 2YNXA 2B7KA 1EV9A 2N5FA 1TXXA 3H93A 4I5QA 4V2LA 2O36A 4NPBA 5JWOB 2B5EA 4GLTA 2PGTA 2G2QA 1FVJA 1GUHA 1Z3EA 4AKIA 5G2ZA 3BBYA 1A8LA 2H1LA 2YOIA 2K9FA 6GSXA 3PINA 4PI2C 1X0RA 2XBIA 4V2MA 2K6VA 5ENUA 1PQNA 3L0HA 1O7UA 1M7TA 1BJXA 1VF4A 2E2MA 2O87A 3VLNA 4IGJA 2C0EA 2WULA 4MZCA 2MMOA 3VWVA 1K0MA 2WW2A 2KOKA 1TOFA 1F37A 3FR3A 5DJLA 2HSMA 1AW9A 1PA3A 3HHVA 2LKUA 1Q98A 3CTFA 4N0ZA 4EL1A 3RDWA 2EFHA 5A1NA 14GSA 3MNGA 3HJOA 3GH6A 3FEUA 1PMTA 3GSTA 2VL2C 4PURA 3G9BA 5IMFA 1GUMA 3P7XA 1T4YA 4TR0A 1ZYQB 4I2UA 2VCQA 3VWWA 1TU7A 3TKRA 3I9V2 3GYKA 1ACVA 2M80A 3BCIA 3APSA 4WEYA 3ZZXA 2XPEA 4L5LA 2BJXA 3Q18A 2DLXA 1PFOA 12GSA 2M72A 3LEFA 5JWQB 2DSAA 1IYHA 10GSA 2GZPA 4GXZA 3HVVA 2C1YA 2DJ3A 4YQVA 2CT6A 2CVDA 18GSA 5AIXA 2DJKA 3HXSA 4XS1A 5DBQA 3VFIA 1MDIA 3HJMA 2B6MA 2A2SA 4XRAA 4GQFA 1XWGA 4HZ2A 5J41A 1K3OA 5BRTA 4KW6A 4BL7B 2LNSA 2TIRA 1K0AA 4ID0A 4IHUA 1YY7A 2HQTA 2WS2A 2CZ3A 2KP2A 1Q4JA 1OC8A 1VF3A 1ZMAA 3TDGA 5ECLB 2HRKB 3TRXA 1Z5YE 1FAAA 5IPGA 1JZOA 1GSYA 3F0IA 1XOAA 4K7IA 5F0GA 2C8UA 1YQ1A 1ZL9A 2GDRA 4HI7A 2F8AA 4FQUA 1EP8A 5J4VA 4LL1B 4GF0A 1KNGA 2F3MA 3ZMKA 1JZDA 4JR4A 4O92A 1SKSB 3Q19A 1B4QA 2OA7A 3UVTA 4QQ7A 3A2WA 3APQA 2FNOA 4JZQA 1QGVA 2DKHA 5H5QA 3DGQA 2B5XA 2VCZA 3VURA 2CQ9A 2MYGA 2ZCTA 4CDOA 1GL8A 2CVBA 3TKSC 2ZUPA 5COHA 5CRHA 1GTIA 5C00A 4K7OA 4AF2A 4BWQA 4USSA 1DE1A 1RW1A 3HA9A 3Q74A 5A5HB 2FLSA 5ABRA 4V2NA 4KF9A 1VF2A 5DVBA 3GRXA 1QK8A 2ON5A 4WKWA 1B48A 3ERGA 1XBSA 4XS6A 2C0FA 4OCEA 2FWEA 4BL7A 4KCEA 2KLXA 5ECQB 1Y1UA 4PUAA 2RM6A 4FO5A 4XHMA 4F0BA 2HRKA 2WJUA 5HFGA 3I69A 1V58A 2CVKA 4H86A 2B1LA 2O89A 2V41A 3VPQA 4G9HA 5CP1A 2JZSA 2ON7A 2IPAA 3HDCA 4ULXA 4MA9A 1I1IP 4EDZA 1TRSA 3GMFA 1DSBA 4E68A 3FYGA 2LJKA 4IS0A 1UVZA 3ERWA 3HVNA 3LORA 4MDCA 1THXA 2H70A 4BIKA 1H4OA 4RI7A 1TRUA 1XIYA 4NWYA 4ZILA 2FCHA 5ECRB 1XWCA 5D9XA 2H1GA 2J9HA 4PI0C 4Q5NA 1S4BP 1I5GA 5EY6A 1GSEA 5HR3A 3CWGA 2HRAA 2QSIA 3TGZA 5A5HA 1OKDA 4IW9A 5HFKA 1LJRA 3NZNA 2WCIA 4HSCX 3LSZA 4ML6A 4ILFA 1SK2A 6GSYA 3QAGA 2I81A 4J2FA 1WIKA 1EZKA 2ES7A 3H79A 3D5JA 2CA8A 1SVMA 1SENA 1X9WB 4NXIA 1AXDA 2DIZA 2OADA 1SD9A 4LMWA 2EIOA 3QAVA 3AY8A 1CQHA 4ZXGA 4GSSA 2DMLA 1GTAA 2WVZA 3E9JB 4FIWA 1XZOA 2R37A 4JE1A 1V57A 1YZXA 5HFIA 1TRWA 4X4JA 3PGTA 4HU9A 1FHEA 1G6YA 2PVQA 1EGRA 5L71A 1RQMA 2LUSA 2EFDA 1YKAA 4HQSA 3IE3A 1BQ7A 1ZYPA 3KIJA 2PUKC 3CRTA 2WFCA 4TVEA 3UAPA 1XOBA 2LRTA 4YAPA 2C0GA 4YQMA 2PWJA 3TRPA 2PVOC 1A0FA 3UIWA 5A4WA 1U87A 4ZL7A 4YKFA 3FRCA 4HZ4A 3EVIA 2FWGA 3KTBA 4I6XA 4K2XA 2QKEA 3TOUA 4TOPA 2R0CA 3TJJA 3KXOA 2KUCA 4IQAA 1PL1A 2AAWA 4N0VA 4I8BA 1C72A 2VIMA 3PH9A 1KTEA 3SWLA 1SKWB 4TKYA 4RQXA 1WE0A 1FOVA 4TRXA 2VCWA 3VI7A 16GSA 1O73A 4K5SA 4ZB8A 2C3TA 3GSSA 5IOXA 1V2AA 4ZBDA 1BG1A 3ZYWA 2RUEA 5A4VA 1PKZA 1EWXA 1J0FA 2YJ7A 3KH9A 4IBPA 4Q5FA 3A2VA 4FYBA 1SKRB 2HSHA 1CQGA 4JEDA 4PUFC 5KOWA 3HZ4A 6GSTA 3IPZA 4JRRA 3QD9A 3DKSA 1OC9B 1F2EA 1U3IA 3UBKA 2WRTA 3Q6OA 2HRNA 3LYKA 3QR6A 2L5LA 5IMZA 1M2AA 3P90A 4ECJA 5ELAA 2XBQA 2YWNA 1K0CA 3EPTA 3D6IA 4BWSA 3N9JA 5GSSA 4X0XA 3EE2A 1MDKA 1X5EA 1GULA 4HDEA 1JZRA 2K8VA 4KDYA 5B6MA 3MDKA 5EL8A 3GKXA 3L9VA 1M9AA 1XFLA 5CAXA 4GSNA 1K0BA 5JWRB 5DDLA 4YH2A 1TTZA 3IK9A 1YEPA 1DE2A 4MPFA 4ZL9A 1EEJA 1GSSA 3HD5A 2R2JA 5J9CA 5KN2A 4AGSA 2REMA 2YWMA 3F4SA 4PHZC 2P31A 2PMTA 1WP0A 2V6OA 1KBNA 3TJKA 1HNBA 2O7KA 5A5KA 4G0KA 3ZFBA 1GSUA 2K18A 2HLSA 4PGTA 2HFDA 4O7HA 4QL9A 3KZQA 4EIPA 1TK5B 2JL4A 4POBA 4NMUA 4F2IA 2YANA 1O8WA 4XRDA 1JZWA 3QPMA 4FYCA 3IAM2 2C3QA 2CZ2A 4EO3A 2FGXA 2L6DA 1A23A 5IMCA 2LJRA 5ECKB 1OE8A 1M99A 3GFKA 1XVWA 1OC9A 3EYTA 1WWJA 2CX4A 3TKSA 4I97A 1GP1A 3GV1A 4KSOA 2RIIA 3L9UA 4KGIA 1B8XA 2PBJA 2LRNA 4NHWA 2YP6A 4K9ZA 4ECIA 2V1MA 1F9MA 1TK8B 3WGDA 4LA1A 4YKGA 5CRWA 1S3RA 1DUGA 1XPVA 3EMPA 4MP4A 3G7JA 3ZIVA 3CSHA 4OFMA 3CTGA 5ECIB 1A2JA 4AJ6A 1U6TA 4ICYA 1T4ZA 1EEMA
chains in the Genus database with same CATH topology
1WMJA 1ZYNA 4GSTA 1LU4A 4W66A 2XPDA 4NAXA 3IR4A 4PXOA 2HNLA 4NV5A 3UBLA 3ZLPA 1NHYA 1XCCA 2A2RA 3C71A 4ECBA 1T00A 2J23A 3D22A 2OE1A 4LMVA 3FZ5A 2MBTA 4DSSB 4N10A 1SYRA 4G10A 1PD21 4GCIA 1ABAA 2OBIA 5F05A 4WF4A 4L0WA 5G5FA 1V98A 5IOWA 1Z6NA 2A2PA 3IRAA 2NTOA 3EU4A 4MF6A 1QQ2A 3GURA 2AB6A 1N8JA 3CBUA 5FHIA 4Q5RA 2CAIA 2O8VB 4ZB7A 4YQUA 3LJRA 5IIZA 6GSVA 2F51A 1ERWA 4BA7A 2OT3A 3R2QA 2B3SA 4K7NA 2UZ8A 1FO5A 2DC5A 4WR4A 3FR9A 3TKQA 4TXVA 3A2XA 3GKKA 2BMXA 3A5WA 2YCDA 3A3TA 2H74A 4KE3A 3PR8A 1ON4A 3UOMA 4IP6A 2OKAA 3WT2A 4ZBAA 2JSZA 3U6VA 3MAKA 5ECNB 1QMVA 7GSSA 1OYJA 4MF5A 3ZMLA 1ILOA 5A34A 3BCKA 1G7EA 3CSIA 2R0PA 4KUNA 2PERA 4IQ1A 5J47A 1FB6A 2PN8A 4DSSA 4POLA 2RM5A 3C7MA 3H4KA 5IO0A 1ZOFA 4EE0A 4KCAA 5G1KA 2O5VA 5CNWA 2V6KA 3M1GA 2HT9A 5AIVA 1A0RP 1FOHA 4XS4B 2JU5A 5LNKe 3S9FA 5IPHA 4F82A 4F0CA 5DCGA 2H73A 5HR1A 2VLUA 4ML1A 2E0QA 1EV4A 1YEXA 2N5BA 5INYA 1MEKA 1PX7A 2MMNA 4GQCA 2A4VA 1GTUA 2GT6A 4JBBA 5A4UA 1TKDB 4D73B 2H66A 1AQWA 1XWKA 4K8MA 3GL5A 4CY6A 6GSSA 2MMZA 3L9SA 4Q5QA 1X5CA 1VRSD 1W89A 3VPTA 3O3TA 1PSQA 1SYXA 4IP1A 3TOTA 2GLRA 3FY7A 2DJ2A 1K0DA 4EC0A 2R3XA 1XW9A 4N30A 2AHEA 1BX9A 2L6CA 1OAZA 4EIQA 4Z2UA 3DWVA 4EUYA 2GS3A 2IFQB 4OWYA 3D21A 2HYXA 2I1UA 3UARA 2X8GA 4IN0A 4K5RA 4EKZA 3HKRA 3ZITA 4G01A 2NVLA 4JR6A 1A24A 4PQ1A 3UMAA 3F6DA 2C80A 5ELGA 1FG4A 4NV2A 3RHBA 2H1BA 2EIQA 4EF0A 3F4RA 3VI5A 1HNAA 4XS4A 3O6TA 3IA1A 2PU9C 1TJDA 4PTSA 4E8EA 5J40A 3KMNA 4ZB6A 2VD1A 5GAND 1SK0A 3QCPA 3IV4A 5HQPA 3ZTLA 5CRDA 3BJ5A 3ZVJA 4IVFA 1TW9A 1PL2A 4D73A 5D9TA 4J57E 2L4QA 5IMAA 1BEDA 1EOHA 2F8FA 3CYNA 2YWOA 4PNFA 4ECCA 1NM3A 1BF5A 3IHQA 1NHOA 3HZ8A 1MD4A 2IMIA 2MZCA 5JCUA 1NSWA 1SJZA 5DALB 3F9UA 2NPBA 3FMWA 3VWUA 4V1Ag 4DSRA 1SU9A 5AISA 2GGTA 2IFQA 1K3YA 1MTCA 2GSSA 4Z2TA 3LXZA 1ZYEA 1USBA 4MCUA 1K3LA 3QFBC 1A2MA 1F3AA 2O85A 4GRFA 4KNDA 1E2YA 1DBYA 1FW1A 2DKIA 4MZBA 4QL7A 5ECHB 4HJMA 5H5SA 2I4AA 2I9HA 4KAEA 3NOFA 1TXUA 2AV4A 4HEA2 20GSA 1WPIA 4TR1B 2YWIA 3HCZA 3TU3B 4J56E 1NW2A 3EURA 1JHBA 4RUVA 1M2DA 2QGVA 2H75A 1YKCA 5LCZA 1SJIA 3TJBA 3UEMA 1LBKA 4POMA 2GTUA 4TN8A 3GH9A 2IMFA 3L4NA 2RLIA 5DALA 5J4YA 4XTSA 1O85A 3KP9A 2C3NA 2IIYA 4F9ZA 3D0ZA 1GH2A 4ACSA 2OJLA 1V40A 3ZIJA 2EFCA 2KP1A 3QFAC 1MD3A 3ME8A 2IL3A 3WGXA 3F3RA 4RI6A 2CX3A 5E59A 5DQSA 2L59A 2X49A 3US3A 2WZ9A 22GSA 5IM9A 5CO3A 1X9MB 1SD8A 1VGLA 4JU5A 4IJIA 3TKSE 1TDIA 1HYUA 5D73A 2HE3A 4OO5A 2GT5A 2H0IA 1O8XA 3L78A 1XXUA 3KTLA 3IDVA 1XW5A 4NHZA 1JLWA 2JZRA 4AJ7A 4XCSA 3ZREA 4TR1A 2L57A 4O32A 1R7HA 1X9SB 1K0NA 3FHKA 2FWFA 3MIXA 1RK4A 3DRNA 5KN3A 5ID2B 3E3EA 1BAYA 4P3YB 4AKHA 1B9YC 3GX0A 4OFNA 3C73A 3IK7A 3P2AA 2VOCA 4CHSA 2R5GA 4HJ2A 4AKXB 2LV3A 1O81A 2VM1A 2PPTA 4HOJA 1B4PA 2DJJA 3KEBA 2UV8G 5IMVA 1GNWA 4O5RA 3LG6A 2TRXA 3FKFA 1SK1A 4IJ3A 4MF7A 2A4HA 2L4CA 3K8NA 3LFLA 1ST9A 1PKWA 1VF1A 2HSYA 2NDOA 4HQZA 2G0FA 1N2AA 1GTBA 3VK9A 5ECMB 3UL3A 4MJBA 1IYIA 3DXBA 3GNJA 3IBHA 3KH7A 1I9DA 1H75A 2FY6A 4BPYA 3H1NA 3IXRA 1PRXA 3ZVJD 1UC7A 3HVSA 4YAVA 3CMIA 1F6MC 2RUFA 3DD3A 2N5AA 2JZTA 3M9JA 1PX6A 1FB0A 2C4JA 5ID2A 3QOUA 3G7IA 4TW5A 3OR5A 5BMUB 1THOA 2VO4A 1MDJA 4OO4A 3EMXA 2MBSA 3LQ7A 4TR4A 3ED3A 4O5UA 1Z9HA 1QUWA 1U3AA 4V1Ap 3W8SA 2LEGA 3ERFA 3QMXA 3HMJG 4KDXA 3LWAA 1YJ6A 5IMDA 13GSA 1ML6A 1S3CA 3WT1A 1U88A 4AKGA 2LRCA 3J7Yk 4E8HA 5G1LA 3LXTA 2FWHA 2H0HA 1SJ6A 3F6FA 3CSJA 1WRYA 2IJYA 2B5YA 5G31A 4KX4A 5J3RA 1GNEA 1R5PA 2XC2A 4CY8A 3A5IA 3UJ1A 3FZAA 3GX8A 2QC7A 5A34B 3I6AA 1G0TA 5G5EA 1EOGA 2JADA 1T3BA 3D4TA 2DJ1A 3MSZA 1YVLA 3QDNA 2OE3A 2H30A 4HU7A 2VAFA 3IAS2 3KJYA 4TXOB 5CRGA 3NIVA 19GSA 3J7Yb 2LSTA 3KP8A 4KH7A 1WOUA 5BMUA 4Z7XA 1AQXA 3E0UA 3FW2A 1F3BA 2YV9A 1QFNA 3LW9A 4PQHA 4CW9A 4GTUA 3HVXA 2FA8A 2R6KA 2VLTA 5AN1A 2R4VA 2WGRA 5C04A 3IC4A 2HSNB 6GSWA 3F4TA 4MJEA 4MPGA 3P8WA 4MH2A 1Z7RA 4EVMA 1ERUA 11GSA 4OFTA 1UN2A 5F07A 1SL0B 3ZL5A 5HR2A 1JLVA 2LTKA 2IMEA 1ERTA 5DJMA 2GZZA 4G0LA 4WBRD 5KOXA 5JCGA 5H5RA 3ISOA 4MMMA 4X1UA 3GL3A 3DEXA 2X8CA 2E2GA 8GSSA 3RHCA 3BOAA 1Z6MA 3M3MA 2YZHA 3TJGA 2OACA 4TXOA 3EU3A 4LL4B 1M9BA 1GLPA 3GTUB 4DEJA 2H6XA 4N11A 3F8UA 17GSA 2GQLA 1T7PB 1GWCA 4MLYA 2VCTA 1GSFA 4MJCA 2Z9SA 5J5NA 5G30A 4DVCA 2FUG2 5FT3A 3GUSA 2GSQA 2DBCA 4N3ZA 2HSNA 1GLQA 3N5OA 5IQYA 5ECOB 4KDUA 4MH3A 3LYPA 1E6BA 4PQIA 1G6WA 2VD0A 3I43A 4FH8A 1WJKA 2WB9A 1KEBA 3HY2A 5J4UA 2VCVA 1J9BA 1S3DA 1XW6A 2H01A 1ZGNA 3VWXA 2P0GA 2GZYA 4K6XA 2B7JA 2L5OA 1QXHA 4KB3A 4OCFA 5B6NA 1OVNA 3KGKA 1PGTA 3MYDA 2H8LA 2YPMA 2C0DA 4WF5A 3DMLA 4WR5A 2GQMA 2VUPA 2R0GA 4IKHA 4MK3A 4K2DA 2M46A 4EXJA 2KHPA 5EPFA 4BVYB 1B9XC 4FYUA 2X99A 3RAZA 3D4MA 1OC3A 5EVOA 4OMVA 4EDYA 2ALBA 4WETA 1AIUA 1GRXA 2VCXA 1AC1A 3G7YA 2VM2A 5CYYA 3PPUA 1EP7A 3GTUA 3HYPA 2TRCP 4I2TA 2FA4A 3DIEA 4MJAA 2D2ZA 3KMOA 2P5QA 1URMA 1AUCA 3TKPA 2E7PA 3KM6A 1T8EB 3FK8A 3V1WA 2AJQB 2MMAA 4G2EA 2GSRA 4L5OA 2H1AA 2H19A 1S3AA 5KN1A 3IC8A 2LQQA 1YF1A 1T1VA 2AUVA 2IMKA 2H76A 3DVXA 1PN9A 2YV7A 2OE0A 5J9BA 4DSQA 1X5DA 2VL3A 1V9WA 6GSUA 2QA2A 2JACA 3BD2A 5IO2A 1OKTA 4MNNA 4X43A 4GDFA 1TRVA 1GSQA 2IWTA 3KCMA 1BG5A 4OD7A 3TB2A 3TRQA 1JFUA 2H71A 4BVYA 4O5QA 3RPPA 3TJFA 4WBJA 1A8YA 5LD0A 4POKA 2HXKA 1Z7PA 1ZCPA 2CAQA 5DCHA 3GIXA 3KD0A 2LNTA 2JSYA 1GSDA 2H1DA 1GUKA 1XVQA 2LJAA 1SL1B 4GWRA 2X64A 2H6ZA 4KSMA 2YJHA 1HD2A 2GVPA 4LLRA 4BVXB 1YDKA 5D93A 2B1KA 1O6JA 2DJ0A 3SBCA 2GSTA 1SVLA 1PN0A 2EIRA 3CXGA 2QA1A 3CRUA 5HR0A 3M0FA 5GAPD 3M9KA 2VLVA 4KA0A 3FR6A 5GSTA 5CREA 2VKZG 1TI1A 2DMMA 3W6GA 4HS1A 3FZ4A 1ZZYA 1EGOA 3HJPA 3QAWA 1R5AA 1TU8A 2K8SA 5FWGA 1AQVA 5F8BA 3C1SA 2XHFA 1TI3A 3F3QA 1TP9A 3JCML 2OBKA 3TCOA 3C1RA 5D9VA 3H8QA 3F63A 4QMKA 5ECSA 2AYTA 3LGCA 3IHGA 4ZIJA 5DQYA 3EC3A 1M2BA 5JCWA 5GZZB 1J08A 1N25A 1HNCA 3EWLA 1SL2B 4ZL8A 4G19A 3TUEA 5B8BA 2I3YA 4ZB9A 1OE7A 3ZFLA 1ERVA 9GSSA 4BVXA 2YZUA 4MZWA 2P5RA 2IMDA 5B7CA 2HZFA 4L0UA 2VL2A 4HUAA 3R3EA 3APOA 2H0GA 1UA5A 1SVOA 1Y25A 3WYWA 2NBSA 4K0GA 1AAZA 1R4WA 4MABA 2HZEB 5KEJA 1YF0A 4IELA 2V2GA 2BTOT 2FHEA 5DAKB 3RBTA 2HRFA 2WDUA 4RQRA 3DVWA 2ZNMA 2F9SA 5D8IA 2GQKA 4ISDA 1HQOA 3GA4A 3O76A 4AI6A 4K0NA 4TR3A 2X8HA 2V32A 3ZRDA 4XIHA 5ECPB 4F03A 2CV4A 1K0OA 4ZBBA 2H6YA 3FZ9A 2X4AA 1R26A 3W8JA 1G7OA 1FVKA 4L8EA 2IN3A 4WXTA 2LS5A 2HI7A 4A5PA 4AJ8A 1M0UA 5D9WA 1A2LA 2LQOA 2HSMB 3IOSA 1BYEA 4PX1A 3GN3A 3GKMA 2FD3A 3ME7A 3U5RE 3GHAA 3UVHA 5KN0A 4G0IA 3M8NA 5A1NB 3DYRA 5B8AA 1Y6EA 4Z2RA 2HZEA 1TK0B 1XWBA 2H72A 3MWHA 5DAKA 2YN1A 2EC4A 3WGEA 2VL9A 1XWAA 3EINA 5AGYA 5F06A 1W4VA 4K1FA 2EFEA 5D96A 4PNGA 3C8EA 3RPNA 2DIYA 3WD6A 3GKNA 5E4WA 2YNXA 2B7KA 1EV9A 2N5FA 1TXXA 3H93A 4I5QA 4V2LA 4NPBA 5JWOB 2B5EA 4GLTA 2PGTA 2G2QA 1FVJA 1GUHA 1Z3EA 4AKIA 5G2ZA 3BBYA 1A8LA 2H1LA 2YOIA 2K9FA 6GSXA 3PINA 4V2MA 1X0RA 2XBIA 2K6VA 5ENUA 1PQNA 3L0HA 1O7UA 1M7TA 1BJXA 1VF4A 2E2MA 2O87A 3VLNA 4IGJA 2C0EA 2WULA 4MZCA 2MMOA 3VWVA 1K0MA 2KOKA 1TOFA 1F37A 3FR3A 5DJLA 2HSMA 1AW9A 1PA3A 3HHVA 2LKUA 1Q98A 3CTFA 4N0ZA 4EL1A 3RDWA 2EFHA 5A1NA 14GSA 3MNGA 3HJOA 3GH6A 3FEUA 1PMTA 3GSTA 2VL2C 4PURA 3G9BA 5IMFA 1GUMA 3P7XA 1T4YA 4TR0A 1ZYQB 4I2UA 2VCQA 3VWWA 1TU7A 3TKRA 3I9V2 3GYKA 1ACVA 2M80A 3BCIA 3APSA 4WEYA 3ZZXA 2XPEA 4L5LA 2BJXA 3Q18A 2DLXA 12GSA 2M72A 3LEFA 5JWQB 2DSAA 1IYHA 10GSA 2GZPA 4GXZA 3HVVA 2C1YA 2DJ3A 4YQVA 2CT6A 2CVDA 18GSA 5AIXA 2DJKA 3HXSA 4XS1A 5DBQA 3VFIA 1MDIA 3HJMA 2B6MA 2A2SA 4XRAA 4GQFA 1XWGA 4HZ2A 5J41A 1K3OA 5BRTA 4KW6A 4BL7B 2LNSA 2TIRA 1K0AA 4ID0A 4IHUA 1YY7A 2HQTA 2WS2A 2CZ3A 2KP2A 1Q4JA 1OC8A 1VF3A 1ZMAA 3TDGA 5ECLB 2HRKB 3TRXA 1Z5YE 1FAAA 5IPGA 1JZOA 1GSYA 3F0IA 1XOAA 4K7IA 5F0GA 2C8UA 1YQ1A 1ZL9A 2GDRA 4HI7A 2F8AA 4FQUA 1EP8A 5J4VA 4LL1B 4GF0A 1KNGA 2F3MA 3ZMKA 1JZDA 4JR4A 4O92A 1SKSB 3Q19A 1B4QA 2OA7A 3UVTA 4QQ7A 3A2WA 3APQA 2FNOA 4JZQA 1QGVA 2DKHA 5H5QA 3DGQA 2B5XA 2VCZA 3VURA 2CQ9A 2MYGA 2ZCTA 4CDOA 1GL8A 2CVBA 3TKSC 2ZUPA 5COHA 5CRHA 1GTIA 5C00A 4K7OA 4AF2A 4BWQA 4USSA 1DE1A 1RW1A 3HA9A 3Q74A 5A5HB 2FLSA 5ABRA 4V2NA 4KF9A 1VF2A 5DVBA 3GRXA 1QK8A 2ON5A 4WKWA 1B48A 3ERGA 1XBSA 4XS6A 2C0FA 4OCEA 2FWEA 4BL7A 4KCEA 2KLXA 5ECQB 1Y1UA 4PUAA 2RM6A 4FO5A 4XHMA 4F0BA 2HRKA 2WJUA 5HFGA 3I69A 1V58A 2CVKA 4H86A 2B1LA 2O89A 2V41A 3VPQA 4G9HA 5CP1A 2JZSA 2ON7A 2IPAA 3HDCA 4ULXA 4MA9A 4EDZA 1TRSA 3GMFA 1DSBA 4E68A 3FYGA 2LJKA 4IS0A 1UVZA 3ERWA 3LORA 4MDCA 1THXA 2H70A 1H4OA 4RI7A 1TRUA 1XIYA 4NWYA 4ZILA 2FCHA 5ECRB 1XWCA 5D9XA 2H1GA 2J9HA 4Q5NA 1I5GA 5EY6A 1GSEA 5HR3A 3CWGA 2HRAA 2QSIA 3TGZA 5A5HA 1OKDA 4IW9A 5HFKA 1LJRA 3NZNA 2WCIA 3LSZA 4ML6A 4ILFA 1SK2A 6GSYA 3QAGA 2I81A 4J2FA 1WIKA 1EZKA 2ES7A 3H79A 3D5JA 2CA8A 1SVMA 1SENA 1X9WB 4NXIA 1AXDA 2DIZA 2OADA 1SD9A 4LMWA 2EIOA 3QAVA 3AY8A 1CQHA 4ZXGA 4GSSA 2DMLA 1GTAA 3E9JB 4FIWA 1XZOA 2R37A 4JE1A 1V57A 1YZXA 5HFIA 1TRWA 4X4JA 3PGTA 4HU9A 1FHEA 1G6YA 2PVQA 1EGRA 5L71A 1RQMA 2LUSA 2EFDA 1YKAA 4HQSA 3IE3A 1BQ7A 1ZYPA 3KIJA 2PUKC 3CRTA 2WFCA 4TVEA 3UAPA 1XOBA 2LRTA 4YAPA 2C0GA 4YQMA 2PWJA 3TRPA 2PVOC 1A0FA 3UIWA 5A4WA 1U87A 4ZL7A 4YKFA 3FRCA 4HZ4A 3EVIA 2FWGA 3KTBA 4I6XA 4K2XA 2QKEA 3TOUA 4TOPA 2R0CA 3TJJA 3KXOA 2KUCA 4IQAA 1PL1A 2AAWA 4N0VA 4I8BA 1C72A 2VIMA 3PH9A 1KTEA 3SWLA 1SKWB 4TKYA 4RQXA 1WE0A 1FOVA 4TRXA 2VCWA 3VI7A 16GSA 1O73A 4K5SA 4ZB8A 2C3TA 3GSSA 5IOXA 1V2AA 4ZBDA 1BG1A 3ZYWA 2RUEA 5A4VA 1PKZA 1EWXA 1J0FA 2YJ7A 3KH9A 4IBPA 4Q5FA 3A2VA 4FYBA 1SKRB 2HSHA 1CQGA 4JEDA 4PUFC 5KOWA 3HZ4A 6GSTA 3IPZA 4JRRA 3QD9A 3DKSA 1OC9B 1F2EA 1U3IA 3UBKA 2WRTA 3Q6OA 2HRNA 3LYKA 3QR6A 2L5LA 5IMZA 1M2AA 3P90A 4ECJA 5ELAA 2XBQA 2YWNA 1K0CA 3EPTA 3D6IA 4BWSA 3N9JA 5GSSA 4X0XA 3EE2A 1MDKA 1X5EA 1GULA 4HDEA 1JZRA 2K8VA 4KDYA 5B6MA 3MDKA 5EL8A 3GKXA 3L9VA 1M9AA 1XFLA 5CAXA 4GSNA 1K0BA 5JWRB 5DDLA 4YH2A 1TTZA 3IK9A 1YEPA 1DE2A 4MPFA 4ZL9A 1EEJA 1GSSA 3HD5A 2R2JA 5J9CA 5KN2A 4AGSA 2REMA 2YWMA 3F4SA 2P31A 2PMTA 1WP0A 2V6OA 1KBNA 3TJKA 1HNBA 2O7KA 5A5KA 4G0KA 3ZFBA 1GSUA 2K18A 2HLSA 4PGTA 2HFDA 4O7HA 4QL9A 3KZQA 4EIPA 1TK5B 2JL4A 4POBA 4NMUA 4F2IA 2YANA 1O8WA 4XRDA 1JZWA 3QPMA 4FYCA 3IAM2 2C3QA 2CZ2A 4EO3A 2FGXA 2L6DA 1A23A 5IMCA 2LJRA 5ECKB 1OE8A 1M99A 3GFKA 1XVWA 1OC9A 3EYTA 1WWJA 2CX4A 3TKSA 4I97A 1GP1A 3GV1A 4KSOA 2RIIA 3L9UA 4KGIA 1B8XA 2PBJA 2LRNA 4NHWA 2YP6A 4K9ZA 4ECIA 2V1MA 1F9MA 1TK8B 3WGDA 4LA1A 4YKGA 5CRWA 1DUGA 1XPVA 3EMPA 4MP4A 3G7JA 3ZIVA 3CSHA 4OFMA 3CTGA 5ECIB 1A2JA 4AJ6A 1U6TA 4ICYA 1T4ZA 1EEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WMJ A;  4GST A;  1LU4 A;  2XPD A;  4NAX A;  3IR4 A;  4PXO A;  2HNL A;  4NV5 A;  3UBL A;  3ZLP A;  1NHY A;  1XCC A;  2A2R A;  3C71 A;  4ECB A;  1T00 A;  2J23 A;  3D22 A;  2OE1 A;  4LMV A;  3FZ5 A;  2MBT A;  4DSS B;  4N10 A;  1SYR A;  4G10 A;  1PD2 1;  4GCI A;  1ABA A;  2OBI A;  5F05 A;  4WF4 A;  4L0W A;  5G5F A;  1V98 A;  5IOW A;  1Z6N A;  3IRA A;  2NTO A;  3EU4 A;  4MF6 A;  1QQ2 A;  3GUR A;  2AB6 A;  1N8J A;  3CBU A;  5FHI A;  4Q5R A;  2CAI A;  2O8V B;  4YQU A;  5IIZ A;  3LJR A;  6GSV A;  2F51 A;  1ERW A;  4BA7 A;  3R2Q A;  2B3S A;  4K7N A;  2UZ8 A;  1FO5 A;  2DC5 A;  4WR4 A;  3FR9 A;  3TKQ A;  4TXV A;  3A2X A;  3GKK A;  2BMX A;  3A5W A;  2YCD A;  3A3T A;  2H74 A;  4KE3 A;  3PR8 A;  1ON4 A;  3UOM A;  4IP6 A;  2OKA A;  3WT2 A;  4ZBA A;  2JSZ A;  3U6V A;  3MAK A;  5ECN B;  1QMV A;  7GSS A;  1OYJ A;  4MF5 A;  3ZML A;  1ILO A;  3BCK A;  1G7E A;  3CSI A;  4KUN A;  2PER A;  4IQ1 A;  1FB6 A;  2PN8 A;  4DSS A;  4POL A;  2RM5 A;  3C7M A;  3H4K A;  5IO0 A;  1ZOF A;  4EE0 A;  4KCA A;  5G1K A;  5CNW A;  2V6K A;  3M1G A;  2HT9 A;  5AIV A;  1A0R P;  4XS4 B;  2JU5 A;  5LNK e;  3S9F A;  5IPH A;  4F82 A;  4F0C A;  5DCG A;  2H73 A;  5HR1 A;  2VLU A;  4ML1 A;  2E0Q A;  1EV4 A;  1YEX A;  2N5B A;  5INY A;  1MEK A;  1PX7 A;  2MMN A;  4GQC A;  2A4V A;  1GTU A;  2GT6 A;  4JBB A;  5A4U A;  1TKD B;  4D73 B;  2H66 A;  1AQW A;  1XWK A;  4K8M A;  3GL5 A;  6GSS A;  2MMZ A;  3L9S A;  4Q5Q A;  1X5C A;  1VRS D;  1W89 A;  3VPT A;  3O3T A;  1PSQ A;  1SYX A;  4IP1 A;  3TOT A;  2GLR A;  3FY7 A;  2DJ2 A;  1K0D A;  4EC0 A;  2R3X A;  1XW9 A;  4N30 A;  2AHE A;  1BX9 A;  2L6C A;  1OAZ A;  3DWV A;  4EUY A;  2GS3 A;  2IFQ B;  4OWY A;  3D21 A;  2HYX A;  2I1U A;  3UAR A;  2X8G A;  4IN0 A;  4EKZ A;  3HKR A;  3ZIT A;  2NVL A;  4JR6 A;  1A24 A;  4PQ1 A;  3UMA A;  3F6D A;  2C80 A;  5ELG A;  1FG4 A;  4NV2 A;  3RHB A;  2H1B A;  2EIQ A;  4EF0 A;  3F4R A;  3VI5 A;  1HNA A;  4XS4 A;  3O6T A;  3IA1 A;  2PU9 C;  1TJD A;  4PTS A;  4E8E A;  3KMN A;  4ZB6 A;  2VD1 A;  5GAN D;  1SK0 A;  3QCP A;  3IV4 A;  5HQP A;  3ZTL A;  5CRD A;  3BJ5 A;  3ZVJ A;  4IVF A;  1TW9 A;  1PL2 A;  4D73 A;  5D9T A;  4J57 E;  2L4Q A;  5IMA A;  1BED A;  1EOH A;  2F8F A;  3CYN A;  2YWO A;  4PNF A;  4ECC A;  1NM3 A;  3IHQ A;  1NHO A;  3HZ8 A;  1MD4 A;  2IMI A;  2MZC A;  5JCU A;  1NSW A;  1SJZ A;  5DAL B;  3F9U A;  2NPB A;  3VWU A;  4V1A g;  4DSR A;  1SU9 A;  5AIS A;  2GGT A;  2IFQ A;  1K3Y A;  1MTC A;  2GSS A;  3LXZ A;  1ZYE A;  1USB A;  4MCU A;  1K3L A;  3QFB C;  1A2M A;  1F3A A;  2O85 A;  4GRF A;  4KND A;  1E2Y A;  1DBY A;  1FW1 A;  4MZB A;  4QL7 A;  5ECH B;  4HJM A;  5H5S A;  2I4A A;  2I9H A;  4KAE A;  3NOF A;  2AV4 A;  4HEA 2;  20GS A;  1WPI A;  4TR1 B;  2YWI A;  3HCZ A;  4J56 E;  1NW2 A;  3EUR A;  1JHB A;  4RUV A;  1M2D A;  2QGV A;  2H75 A;  1YKC A;  5LCZ A;  1SJI A;  3TJB A;  3UEM A;  1LBK A;  4POM A;  2GTU A;  4TN8 A;  3GH9 A;  2IMF A;  3L4N A;  2RLI A;  5DAL A;  4XTS A;  1O85 A;  3KP9 A;  2C3N A;  2IIY A;  4F9Z A;  3D0Z A;  1GH2 A;  4ACS A;  2OJL A;  1V40 A;  3ZIJ A;  2KP1 A;  3QFA C;  1MD3 A;  3ME8 A;  2IL3 A;  3WGX A;  3F3R A;  4RI6 A;  2CX3 A;  5E59 A;  5DQS A;  2L59 A;  3US3 A;  2WZ9 A;  22GS A;  5IM9 A;  5CO3 A;  1X9M B;  1SD8 A;  1VGL A;  4JU5 A;  4IJI A;  3TKS E;  1TDI A;  1HYU A;  5D73 A;  2HE3 A;  4OO5 A;  2GT5 A;  2H0I A;  1O8X A;  3L78 A;  1XXU A;  3KTL A;  3IDV A;  1XW5 A;  4NHZ A;  1JLW A;  2JZR A;  4AJ7 A;  4XCS A;  3ZRE A;  4TR1 A;  2L57 A;  4O32 A;  1R7H A;  1X9S B;  1K0N A;  3FHK A;  2FWF A;  1RK4 A;  3DRN A;  5KN3 A;  5ID2 B;  3E3E A;  1BAY A;  4P3Y B;  1B9Y C;  3GX0 A;  4OFN A;  3C73 A;  3IK7 A;  3P2A A;  2VOC A;  4CHS A;  2R5G A;  4HJ2 A;  2LV3 A;  1O81 A;  2VM1 A;  2PPT A;  4HOJ A;  1B4P A;  2DJJ A;  3KEB A;  5IMV A;  1GNW A;  4O5R A;  3LG6 A;  2TRX A;  3FKF A;  1SK1 A;  4IJ3 A;  4MF7 A;  2L4C A;  3K8N A;  3LFL A;  1ST9 A;  1PKW A;  1VF1 A;  2HSY A;  2NDO A;  4HQZ A;  2G0F A;  1N2A A;  1GTB A;  3VK9 A;  5ECM B;  3UL3 A;  4MJB A;  1IYI A;  3DXB A;  3GNJ A;  3IBH A;  3KH7 A;  1I9D A;  1H75 A;  2FY6 A;  4BPY A;  3H1N A;  3IXR A;  1PRX A;  3ZVJ D;  1UC7 A;  3HVS A;  4YAV A;  3CMI A;  1F6M C;  2RUF A;  3DD3 A;  2N5A A;  2JZT A;  3M9J A;  1PX6 A;  1FB0 A;  2C4J A;  5ID2 A;  3QOU A;  3G7I A;  4TW5 A;  3OR5 A;  1THO A;  2VO4 A;  1MDJ A;  4OO4 A;  3EMX A;  2MBS A;  3LQ7 A;  4TR4 A;  3ED3 A;  1Z9H A;  1QUW A;  1U3A A;  4V1A p;  3W8S A;  2LEG A;  3ERF A;  3QMX A;  4KDX A;  3LWA A;  1YJ6 A;  5IMD A;  13GS A;  1ML6 A;  1S3C A;  3WT1 A;  1U88 A;  2LRC A;  3J7Y k;  4E8H A;  5G1L A;  3LXT A;  2FWH A;  2H0H A;  1SJ6 A;  3F6F A;  3CSJ A;  1WRY A;  2IJY A;  2B5Y A;  5G31 A;  4KX4 A;  5J3R A;  1GNE A;  1R5P A;  2XC2 A;  3UJ1 A;  3FZA A;  3GX8 A;  2QC7 A;  3I6A A;  1G0T A;  5G5E A;  1EOG A;  2JAD A;  1T3B A;  3D4T A;  2DJ1 A;  3MSZ A;  3QDN A;  2OE3 A;  2H30 A;  4HU7 A;  2VAF A;  3IAS 2;  3KJY A;  4TXO B;  5CRG A;  3NIV A;  19GS A;  3J7Y b;  2LST A;  3KP8 A;  4KH7 A;  1WOU A;  5BMU A;  4Z7X A;  1AQX A;  3E0U A;  3FW2 A;  1F3B A;  2YV9 A;  1QFN A;  4PQH A;  4CW9 A;  4GTU A;  3HVX A;  2FA8 A;  2R6K A;  2VLT A;  5AN1 A;  2R4V A;  2WGR A;  5C04 A;  3IC4 A;  2HSN B;  6GSW A;  3F4T A;  4MJE A;  4MPG A;  3P8W A;  4MH2 A;  1Z7R A;  4EVM A;  1ERU A;  11GS A;  4OFT A;  1UN2 A;  5F07 A;  1SL0 B;  3ZL5 A;  5HR2 A;  1JLV A;  2LTK A;  2IME A;  1ERT A;  5DJM A;  2GZZ A;  4G0L A;  4WBR D;  5JCG A;  5H5R A;  3ISO A;  4MMM A;  4X1U A;  3GL3 A;  3DEX A;  2X8C A;  2E2G A;  8GSS A;  3RHC A;  3BOA A;  1Z6M A;  3M3M A;  2YZH A;  3TJG A;  2OAC A;  4TXO A;  3EU3 A;  4LL4 B;  1M9B A;  1GLP A;  3GTU B;  4DEJ A;  2H6X A;  4N11 A;  3F8U A;  17GS A;  2GQL A;  1T7P B;  1GWC A;  4MLY A;  2VCT A;  1GSF A;  4MJC A;  2Z9S A;  5J5N A;  5G30 A;  4DVC A;  2FUG 2;  5FT3 A;  3GUS A;  2GSQ A;  2DBC A;  1GLQ A;  3N5O A;  5IQY A;  5ECO B;  4KDU A;  4MH3 A;  3LYP A;  1E6B A;  4PQI A;  1G6W A;  2VD0 A;  3I43 A;  4FH8 A;  1WJK A;  2WB9 A;  1KEB A;  3HY2 A;  5J4U A;  2VCV A;  1J9B A;  1S3D A;  1XW6 A;  2H01 A;  1ZGN A;  3VWX A;  2P0G A;  2GZY A;  4K6X A;  2B7J A;  2L5O A;  1QXH A;  4KB3 A;  4OCF A;  5B6N A;  1OVN A;  3KGK A;  1PGT A;  2H8L A;  2YPM A;  2C0D A;  4WF5 A;  3DML A;  4WR5 A;  2GQM A;  2VUP A;  4IKH A;  4MK3 A;  4K2D A;  2M46 A;  4EXJ A;  2KHP A;  5EPF A;  4BVY B;  1B9X C;  4FYU A;  2X99 A;  3RAZ A;  3D4M A;  1OC3 A;  5EVO A;  4OMV A;  4EDY A;  2ALB A;  4WET A;  1AIU A;  1GRX A;  2VCX A;  1AC1 A;  3G7Y A;  2VM2 A;  5CYY A;  3PPU A;  1EP7 A;  3GTU A;  3HYP A;  2TRC P;  4I2T A;  2FA4 A;  3DIE A;  4MJA A;  2D2Z A;  3KMO A;  2P5Q A;  1URM A;  1AUC A;  3TKP A;  2E7P A;  3KM6 A;  1T8E B;  3FK8 A;  3V1W A;  2AJQ B;  2MMA A;  4G2E A;  2GSR A;  4L5O A;  2H1A A;  2H19 A;  1S3A A;  5KN1 A;  3IC8 A;  2LQQ A;  1YF1 A;  1T1V A;  2AUV A;  2IMK A;  2H76 A;  3DVX A;  1PN9 A;  2YV7 A;  2OE0 A;  5J9B A;  4DSQ A;  1X5D A;  2VL3 A;  1V9W A;  6GSU A;  2JAC A;  3BD2 A;  5IO2 A;  1OKT A;  4X43 A;  1TRV A;  1GSQ A;  2IWT A;  3KCM A;  1BG5 A;  4OD7 A;  3TB2 A;  3TRQ A;  1JFU A;  2H71 A;  4BVY A;  3RPP A;  3TJF A;  4WBJ A;  1A8Y A;  5LD0 A;  4POK A;  2HXK A;  1Z7P A;  1ZCP A;  2CAQ A;  5DCH A;  3GIX A;  3KD0 A;  2LNT A;  2JSY A;  1GSD A;  2H1D A;  1GUK A;  1XVQ A;  2LJA A;  1SL1 B;  4GWR A;  2X64 A;  2H6Z A;  4KSM A;  2YJH A;  1HD2 A;  2GVP A;  4LLR A;  4BVX B;  1YDK A;  5D93 A;  2B1K A;  1O6J A;  2DJ0 A;  3SBC A;  2GST A;  2EIR A;  3CXG A;  3CRU A;  5HR0 A;  3M0F A;  5GAP D;  3M9K A;  2VLV A;  4KA0 A;  3FR6 A;  5GST A;  5CRE A;  1TI1 A;  2DMM A;  3W6G A;  4HS1 A;  3FZ4 A;  1ZZY A;  1EGO A;  3HJP A;  3QAW A;  1R5A A;  1TU8 A;  2K8S A;  5FWG A;  1AQV A;  5F8B A;  3C1S A;  2XHF A;  1TI3 A;  3F3Q A;  1TP9 A;  3JCM L;  2OBK A;  3TCO A;  3C1R A;  5D9V A;  3H8Q A;  3F63 A;  5ECS A;  2AYT A;  3LGC A;  4ZIJ A;  5DQY A;  3EC3 A;  1M2B A;  5JCW A;  5GZZ B;  1J08 A;  1HNC A;  3EWL A;  1SL2 B;  4ZL8 A;  4G19 A;  3TUE A;  5B8B A;  2I3Y A;  4ZB9 A;  1OE7 A;  3ZFL A;  1ERV A;  9GSS A;  4BVX A;  2YZU A;  4MZW A;  2P5R A;  2IMD A;  5B7C A;  2HZF A;  4L0U A;  2VL2 A;  4HUA A;  3R3E A;  3APO A;  2H0G A;  1UA5 A;  1Y25 A;  3WYW A;  2NBS A;  4K0G A;  1AAZ A;  1R4W A;  4MAB A;  2HZE B;  5KEJ A;  1YF0 A;  4IEL A;  2V2G A;  2BTO T;  2FHE A;  5DAK B;  3RBT A;  2HRF A;  2WDU A;  4RQR A;  3DVW A;  2ZNM A;  2F9S A;  5D8I A;  2GQK A;  4ISD A;  1HQO A;  3GA4 A;  3O76 A;  4K0N A;  4TR3 A;  2X8H A;  2V32 A;  3ZRD A;  4XIH A;  5ECP B;  4F03 A;  2CV4 A;  1K0O A;  4ZBB A;  2H6Y A;  3FZ9 A;  3W8J A;  1R26 A;  1G7O A;  1FVK A;  4L8E A;  2IN3 A;  4WXT A;  2LS5 A;  2HI7 A;  4AJ8 A;  1M0U A;  5D9W A;  1A2L A;  2LQO A;  2HSM B;  3IOS A;  1BYE A;  4PX1 A;  3GN3 A;  3GKM A;  2FD3 A;  3ME7 A;  3U5R E;  3GHA A;  3UVH A;  5KN0 A;  4G0I A;  3M8N A;  3DYR A;  5B8A A;  1Y6E A;  2HZE A;  1TK0 B;  1XWB A;  2H72 A;  3MWH A;  5DAK A;  2YN1 A;  2EC4 A;  3WGE A;  2VL9 A;  1XWA A;  3EIN A;  5AGY A;  5F06 A;  1W4V A;  4K1F A;  5D96 A;  4PNG A;  3C8E A;  3RPN A;  2DIY A;  3WD6 A;  3GKN A;  5E4W A;  2YNX A;  2B7K A;  1EV9 A;  2N5F A;  1TXX A;  3H93 A;  4I5Q A;  4V2L A;  4NPB A;  5JWO B;  2B5E A;  4GLT A;  2PGT A;  2G2Q A;  1FVJ A;  1GUH A;  1Z3E A;  5G2Z A;  3BBY A;  1A8L A;  2YOI A;  2K9F A;  6GSX A;  3PIN A;  4V2M A;  1X0R A;  2XBI A;  2K6V A;  5ENU A;  1PQN A;  3L0H A;  1O7U A;  1M7T A;  1BJX A;  1VF4 A;  2E2M A;  2O87 A;  3VLN A;  4IGJ A;  2C0E A;  2WUL A;  4MZC A;  2MMO A;  3VWV A;  1K0M A;  2KOK A;  1TOF A;  1F37 A;  3FR3 A;  5DJL A;  2HSM A;  1AW9 A;  1PA3 A;  3HHV A;  2LKU A;  1Q98 A;  3CTF A;  4N0Z A;  4EL1 A;  3RDW A;  14GS A;  3MNG A;  3HJO A;  3GH6 A;  3FEU A;  1PMT A;  3GST A;  2VL2 C;  4PUR A;  3G9B A;  5IMF A;  1GUM A;  3P7X A;  1T4Y A;  4TR0 A;  1ZYQ B;  4I2U A;  2VCQ A;  3VWW A;  1TU7 A;  3TKR A;  3I9V 2;  3GYK A;  1ACV A;  2M80 A;  3BCI A;  3APS A;  4WEY A;  3ZZX A;  2XPE A;  4L5L A;  2BJX A;  3Q18 A;  2DLX A;  12GS A;  2M72 A;  3LEF A;  5JWQ B;  2DSA A;  1IYH A;  10GS A;  2GZP A;  4GXZ A;  3HVV A;  2C1Y A;  2DJ3 A;  4YQV A;  2CT6 A;  2CVD A;  18GS A;  5AIX A;  2DJK A;  3HXS A;  4XS1 A;  5DBQ A;  3VFI A;  1MDI A;  3HJM A;  2B6M A;  2A2S A;  4XRA A;  4GQF A;  1XWG A;  4HZ2 A;  5J41 A;  1K3O A;  4KW6 A;  4BL7 B;  2LNS A;  2TIR A;  1K0A A;  4ID0 A;  4IHU A;  1YY7 A;  2HQT A;  2WS2 A;  2CZ3 A;  2KP2 A;  1Q4J A;  1OC8 A;  1VF3 A;  1ZMA A;  3TDG A;  5ECL B;  2HRK B;  3TRX A;  1Z5Y E;  1FAA A;  5IPG A;  1JZO A;  1GSY A;  3F0I A;  1XOA A;  4K7I A;  5F0G A;  2C8U A;  1YQ1 A;  1ZL9 A;  2GDR A;  4HI7 A;  2F8A A;  4FQU A;  1EP8 A;  4LL1 B;  4GF0 A;  1KNG A;  2F3M A;  3ZMK A;  1JZD A;  4JR4 A;  4O92 A;  1SKS B;  3Q19 A;  1B4Q A;  2OA7 A;  3UVT A;  4QQ7 A;  3A2W A;  3APQ A;  2FNO A;  4JZQ A;  1QGV A;  5H5Q A;  3DGQ A;  2B5X A;  2VCZ A;  3VUR A;  2CQ9 A;  2MYG A;  2ZCT A;  4CDO A;  1GL8 A;  2CVB A;  3TKS C;  2ZUP A;  5COH A;  5CRH A;  1GTI A;  5C00 A;  4K7O A;  4AF2 A;  4BWQ A;  4USS A;  1DE1 A;  1RW1 A;  3HA9 A;  3Q74 A;  2FLS A;  5ABR A;  4V2N A;  4KF9 A;  1VF2 A;  5DVB A;  3GRX A;  1QK8 A;  2ON5 A;  4WKW A;  1B48 A;  3ERG A;  1XBS A;  4XS6 A;  2C0F A;  4OCE A;  2FWE A;  4BL7 A;  4KCE A;  2KLX A;  5ECQ B;  4PUA A;  2RM6 A;  4FO5 A;  4XHM A;  4F0B A;  2HRK A;  2WJU A;  5HFG A;  3I69 A;  1V58 A;  2CVK A;  4H86 A;  2B1L A;  2O89 A;  2V41 A;  3VPQ A;  4G9H A;  5CP1 A;  2JZS A;  2ON7 A;  2IPA A;  3HDC A;  4ULX A;  4MA9 A;  4EDZ A;  1TRS A;  3GMF A;  1DSB A;  3FYG A;  2LJK A;  4IS0 A;  1UVZ A;  3ERW A;  3LOR A;  4MDC A;  1THX A;  2H70 A;  1H4O A;  4RI7 A;  1TRU A;  1XIY A;  4NWY A;  4ZIL A;  2FCH A;  5ECR B;  1XWC A;  5D9X A;  2H1G A;  2J9H A;  4Q5N A;  1I5G A;  5EY6 A;  1GSE A;  5HR3 A;  2HRA A;  2QSI A;  3TGZ A;  1OKD A;  4IW9 A;  5HFK A;  1LJR A;  3NZN A;  2WCI A;  3LSZ A;  4ML6 A;  4ILF A;  1SK2 A;  6GSY A;  3QAG A;  2I81 A;  4J2F A;  1WIK A;  1EZK A;  2ES7 A;  3H79 A;  3D5J A;  2CA8 A;  1SEN A;  1X9W B;  4NXI A;  1AXD A;  2DIZ A;  2OAD A;  1SD9 A;  4LMW A;  2EIO A;  3QAV A;  3AY8 A;  1CQH A;  4ZXG A;  4GSS A;  2DML A;  1GTA A;  3E9J B;  4FIW A;  1XZO A;  2R37 A;  4JE1 A;  1V57 A;  1YZX A;  5HFI A;  1TRW A;  3PGT A;  4HU9 A;  1FHE A;  1G6Y A;  2PVQ A;  1EGR A;  5L71 A;  1RQM A;  2LUS A;  1YKA A;  4HQS A;  3IE3 A;  1BQ7 A;  3KIJ A;  2PUK C;  3CRT A;  2WFC A;  4TVE A;  3UAP A;  1XOB A;  2LRT A;  4YAP A;  2C0G A;  4YQM A;  2PWJ A;  3TRP A;  2PVO C;  1A0F A;  3UIW A;  5A4W A;  1U87 A;  4ZL7 A;  3FRC A;  4HZ4 A;  3EVI A;  2FWG A;  3KTB A;  4I6X A;  2QKE A;  3TOU A;  4TOP A;  3TJJ A;  3KXO A;  2KUC A;  4IQA A;  1PL1 A;  2AAW A;  4N0V A;  4I8B A;  1C72 A;  2VIM A;  3PH9 A;  1KTE A;  3SWL A;  1SKW B;  4TKY A;  4RQX A;  1WE0 A;  1FOV A;  4TRX A;  2VCW A;  3VI7 A;  16GS A;  1O73 A;  4ZB8 A;  2C3T A;  3GSS A;  5IOX A;  1V2A A;  4ZBD A;  3ZYW A;  2RUE A;  5A4V A;  1PKZ A;  1EWX A;  1J0F A;  2YJ7 A;  3KH9 A;  4IBP A;  4Q5F A;  3A2V A;  4FYB A;  1SKR B;  2HSH A;  1CQG A;  4JED A;  4PUF C;  3HZ4 A;  6GST A;  3IPZ A;  4JRR A;  3QD9 A;  3DKS A;  1OC9 B;  1F2E A;  1U3I A;  3UBK A;  2WRT A;  3Q6O A;  2HRN A;  3LYK A;  3QR6 A;  2L5L A;  5IMZ A;  1M2A A;  3P90 A;  4ECJ A;  5ELA A;  2XBQ A;  2YWN A;  1K0C A;  3D6I A;  4BWS A;  3N9J A;  5GSS A;  4X0X A;  3EE2 A;  1MDK A;  1X5E A;  1GUL A;  4HDE A;  1JZR A;  2K8V A;  4KDY A;  5B6M A;  3MDK A;  5EL8 A;  3GKX A;  3L9V A;  1M9A A;  1XFL A;  5CAX A;  4GSN A;  1K0B A;  5JWR B;  5DDL A;  4YH2 A;  1TTZ A;  3IK9 A;  1YEP A;  1DE2 A;  4MPF A;  4ZL9 A;  1EEJ A;  1GSS A;  3HD5 A;  2R2J A;  5J9C A;  5KN2 A;  4AGS A;  2REM A;  2YWM A;  3F4S A;  2P31 A;  2PMT A;  1WP0 A;  2V6O A;  1KBN A;  3TJK A;  1HNB A;  2O7K A;  5A5K A;  4G0K A;  3ZFB A;  1GSU A;  2K18 A;  2HLS A;  4PGT A;  2HFD A;  4O7H A;  4QL9 A;  3KZQ A;  1TK5 B;  2JL4 A;  4POB A;  4NMU A;  4F2I A;  2YAN A;  1O8W A;  4XRD A;  1JZW A;  3QPM A;  4FYC A;  3IAM 2;  2C3Q A;  2CZ2 A;  4EO3 A;  2FGX A;  2L6D A;  1A23 A;  5IMC A;  2LJR A;  5ECK B;  1OE8 A;  1M99 A;  3GFK A;  1XVW A;  1OC9 A;  3EYT A;  1WWJ A;  2CX4 A;  3TKS A;  4I97 A;  1GP1 A;  3GV1 A;  4KSO A;  2RII A;  3L9U A;  4KGI A;  1B8X A;  2PBJ A;  2LRN A;  4NHW A;  2YP6 A;  4K9Z A;  4ECI A;  2V1M A;  1F9M A;  1TK8 B;  3WGD A;  4LA1 A;  5CRW A;  1DUG A;  1XPV A;  3EMP A;  4MP4 A;  3G7J A;  3ZIV A;  3CSH A;  4OFM A;  3CTG A;  5ECI B;  1A2J A;  4AJ6 A;  1U6T A;  1T4Z A;  1EEM A; 
#chains in the Genus database with same CATH topology
 1WMJ A;  1ZYN A;  4GST A;  1LU4 A;  4W66 A;  2XPD A;  4NAX A;  3IR4 A;  4PXO A;  2HNL A;  4NV5 A;  3UBL A;  3ZLP A;  1NHY A;  1XCC A;  2A2R A;  3C71 A;  4ECB A;  1T00 A;  2J23 A;  3D22 A;  2OE1 A;  4LMV A;  3FZ5 A;  2MBT A;  4DSS B;  4N10 A;  1SYR A;  4G10 A;  1PD2 1;  4GCI A;  1ABA A;  2OBI A;  5F05 A;  4WF4 A;  4L0W A;  2WZS A;  5G5F A;  1V98 A;  5IOW A;  1Z6N A;  2A2P A;  3IRA A;  2NTO A;  3EU4 A;  4MF6 A;  1QQ2 A;  3GUR A;  2AB6 A;  1N8J A;  3CBU A;  5FHI A;  4Q5R A;  2CAI A;  2O8V B;  4ZB7 A;  4YQU A;  3LJR A;  5IIZ A;  6GSV A;  2F51 A;  1ERW A;  4BA7 A;  2OT3 A;  3R2Q A;  2B3S A;  4K7N A;  2UZ8 A;  1FO5 A;  2DC5 A;  4WR4 A;  3FR9 A;  3TKQ A;  4TXV A;  3A2X A;  3GKK A;  2BMX A;  3A5W A;  2YCD A;  3A3T A;  2H74 A;  4KE3 A;  3PR8 A;  1ON4 A;  3UOM A;  4IP6 A;  2OKA A;  3WT2 A;  4ZBA A;  2JSZ A;  3U6V A;  3MAK A;  5ECN B;  1QMV A;  7GSS A;  1OYJ A;  4MF5 A;  3ZML A;  1ILO A;  5A34 A;  3BCK A;  1G7E A;  3CSI A;  2R0P A;  4KUN A;  2PER A;  4IQ1 A;  2PN8 A;  5J47 A;  1FB6 A;  4DSS A;  4POL A;  2RM5 A;  3C7M A;  3H4K A;  5IO0 A;  1ZOF A;  4EE0 A;  4KCA A;  5G1K A;  2O5V A;  5CNW A;  2V6K A;  3M1G A;  2HT9 A;  5AIV A;  1A0R P;  1FOH A;  4XS4 B;  2JU5 A;  5LNK e;  3S9F A;  5IPH A;  4F82 A;  4F0C A;  5DCG A;  2H73 A;  5HR1 A;  2VLU A;  4ML1 A;  2E0Q A;  1EV4 A;  1YEX A;  2N5B A;  5INY A;  1MEK A;  1PX7 A;  2MMN A;  4GQC A;  2A4V A;  1GTU A;  2GT6 A;  4JBB A;  5A4U A;  1TKD B;  4D73 B;  2H66 A;  1AQW A;  1XWK A;  4K8M A;  3GL5 A;  4CY6 A;  6GSS A;  2MMZ A;  3L9S A;  4Q5Q A;  1X5C A;  1VRS D;  1W89 A;  3VPT A;  3O3T A;  1PSQ A;  1SYX A;  4IP1 A;  3TOT A;  2GLR A;  3FY7 A;  2DJ2 A;  1K0D A;  4EC0 A;  2R3X A;  1XW9 A;  4N30 A;  2AHE A;  1BX9 A;  2L6C A;  1OAZ A;  4EIQ A;  4Z2U A;  3DWV A;  4EUY A;  2GS3 A;  2IFQ B;  4OWY A;  3D21 A;  2HYX A;  2I1U A;  3UAR A;  2X8G A;  4IN0 A;  4K5R A;  4EKZ A;  3HKR A;  3ZIT A;  4G01 A;  2NVL A;  4JR6 A;  1A24 A;  4PQ1 A;  3UMA A;  3F6D A;  2C80 A;  5ELG A;  1FG4 A;  4NV2 A;  3RHB A;  2H1B A;  2EIQ A;  4EF0 A;  3F4R A;  3VI5 A;  1HNA A;  4XS4 A;  3O6T A;  3IA1 A;  2PU9 C;  1TJD A;  4PTS A;  4E8E A;  5J40 A;  3KMN A;  4ZB6 A;  2VD1 A;  5GAN D;  1SK0 A;  3QCP A;  3IV4 A;  5HQP A;  3ZTL A;  5CRD A;  3BJ5 A;  3ZVJ A;  4IVF A;  1TW9 A;  1PL2 A;  4D73 A;  5D9T A;  4J57 E;  2L4Q A;  5IMA A;  1BED A;  1EOH A;  2F8F A;  3CYN A;  2YWO A;  4PNF A;  2O3E A;  4ECC A;  1NM3 A;  1BF5 A;  3IHQ A;  1NHO A;  3HZ8 A;  1MD4 A;  2IMI A;  2MZC A;  5JCU A;  1NSW A;  1SJZ A;  5DAL B;  3F9U A;  2NPB A;  3FMW A;  3VWU A;  4V1A g;  4DSR A;  1SU9 A;  5AIS A;  2GGT A;  2IFQ A;  1K3Y A;  1MTC A;  2GSS A;  4Z2T A;  3LXZ A;  1ZYE A;  1USB A;  4MCU A;  1K3L A;  3CHX C;  3QFB C;  1A2M A;  1F3A A;  2O85 A;  4GRF A;  4KND A;  1E2Y A;  1DBY A;  1FW1 A;  2DKI A;  4MZB A;  4QL7 A;  5ECH B;  4HJM A;  5H5S A;  2I4A A;  2I9H A;  4KAE A;  3NOF A;  1TXU A;  2AV4 A;  4HEA 2;  20GS A;  1WPI A;  4TR1 B;  2YWI A;  3HCZ A;  3TU3 B;  4J56 E;  1NW2 A;  3EUR A;  1JHB A;  4RUV A;  1M2D A;  2QGV A;  2H75 A;  1YKC A;  5LCZ A;  1SJI A;  3TJB A;  3UEM A;  1LBK A;  4POM A;  2GTU A;  4TN8 A;  3GH9 A;  2IMF A;  3L4N A;  2RLI A;  5DAL A;  5J4Y A;  4XTS A;  1O85 A;  3KP9 A;  2C3N A;  2IIY A;  4F9Z A;  3D0Z A;  1GH2 A;  4ACS A;  2OJL A;  1V40 A;  3ZIJ A;  2EFC A;  2KP1 A;  3QFA C;  1MD3 A;  3ME8 A;  2IL3 A;  3WGX A;  3F3R A;  4RI6 A;  2CX3 A;  5E59 A;  5DQS A;  2L59 A;  2X49 A;  3US3 A;  2WZ9 A;  22GS A;  5IM9 A;  5CO3 A;  1X9M B;  1SD8 A;  1VGL A;  4JU5 A;  4IJI A;  3TKS E;  1TDI A;  1HYU A;  5D73 A;  2HE3 A;  4OO5 A;  2GT5 A;  2H0I A;  1O8X A;  3L78 A;  1XXU A;  3KTL A;  3IDV A;  1XW5 A;  4NHZ A;  1JLW A;  2JZR A;  4AJ7 A;  4XCS A;  3ZRE A;  4TR1 A;  2L57 A;  4O32 A;  1R7H A;  1X9S B;  1K0N A;  3FHK A;  2FWF A;  3MIX A;  1RK4 A;  3DRN A;  5KN3 A;  5ID2 B;  3E3E A;  1BAY A;  4P3Y B;  4AKH A;  1B9Y C;  3GX0 A;  4OFN A;  3C73 A;  3IK7 A;  3P2A A;  2VOC A;  4CHS A;  2R5G A;  4HJ2 A;  4AKX B;  2LV3 A;  1O81 A;  2VM1 A;  2PPT A;  4HOJ A;  1B4P A;  2DJJ A;  3KEB A;  2UV8 G;  5IMV A;  1GNW A;  4O5R A;  3LG6 A;  2TRX A;  3FKF A;  1SK1 A;  4IJ3 A;  4MF7 A;  2A4H A;  2L4C A;  3K8N A;  3LFL A;  1ST9 A;  1PKW A;  1VF1 A;  2HSY A;  2NDO A;  4HQZ A;  2G0F A;  1N2A A;  1GTB A;  3VK9 A;  5ECM B;  3UL3 A;  4MJB A;  1IYI A;  3DXB A;  3GNJ A;  3IBH A;  3KH7 A;  1I9D A;  1H75 A;  2FY6 A;  4BPY A;  3H1N A;  3IXR A;  2WW3 A;  1PRX A;  3ZVJ D;  1UC7 A;  3HVS A;  4YAV A;  3CMI A;  1F6M C;  2RUF A;  3DD3 A;  2N5A A;  2JZT A;  3M9J A;  1PX6 A;  1FB0 A;  2C4J A;  5ID2 A;  3QOU A;  3G7I A;  4TW5 A;  3OR5 A;  5BMU B;  1THO A;  2VO4 A;  1MDJ A;  4OO4 A;  3EMX A;  2MBS A;  3LQ7 A;  1M3J A;  4TR4 A;  3ED3 A;  4O5U A;  1Z9H A;  1QUW A;  1U3A A;  4V1A p;  3W8S A;  2LEG A;  3ERF A;  3QMX A;  3HMJ G;  4KDX A;  3LWA A;  1YJ6 A;  5IMD A;  13GS A;  1ML6 A;  1S3C A;  3WT1 A;  1U88 A;  4AKG A;  2LRC A;  3J7Y k;  4E8H A;  5G1L A;  3LXT A;  2FWH A;  2H0H A;  1SJ6 A;  3F6F A;  3CSJ A;  1WRY A;  2IJY A;  2B5Y A;  5G31 A;  4KX4 A;  5J3R A;  1GNE A;  1R5P A;  2XC2 A;  4CY8 A;  3A5I A;  3UJ1 A;  3FZA A;  3GX8 A;  2QC7 A;  5A34 B;  3I6A A;  1G0T A;  5G5E A;  1EOG A;  2JAD A;  1T3B A;  3D4T A;  2DJ1 A;  3MSZ A;  1YVL A;  3QDN A;  2OE3 A;  2H30 A;  4HU7 A;  2VAF A;  3IAS 2;  3KJY A;  4TXO B;  5CRG A;  3NIV A;  19GS A;  3J7Y b;  2LST A;  3KP8 A;  4KH7 A;  1WOU A;  5BMU A;  4Z7X A;  1AQX A;  3E0U A;  3FW2 A;  1F3B A;  2YV9 A;  1QFN A;  3LW9 A;  4PQH A;  4CW9 A;  4GTU A;  3HVX A;  2FA8 A;  2R6K A;  2VLT A;  5AN1 A;  2R4V A;  2WGR A;  5C04 A;  3IC4 A;  2HSN B;  6GSW A;  3F4T A;  4MJE A;  4MPG A;  3P8W A;  4MH2 A;  1Z7R A;  4EVM A;  1ERU A;  11GS A;  4OFT A;  1UN2 A;  5F07 A;  1SL0 B;  3ZL5 A;  5HR2 A;  1JLV A;  2LTK A;  2IME A;  1ERT A;  5DJM A;  2GZZ A;  4G0L A;  4WBR D;  5KOX A;  5JCG A;  5H5R A;  3ISO A;  4MMM A;  4X1U A;  3GL3 A;  3RGB C;  3DEX A;  2WW1 A;  2X8C A;  2E2G A;  8GSS A;  3RHC A;  3CQF A;  3BOA A;  1Z6M A;  3M3M A;  2YZH A;  3TJG A;  2OAC A;  4TXO A;  3EU3 A;  4LL4 B;  1M9B A;  1GLP A;  3GTU B;  4DEJ A;  2H6X A;  4N11 A;  3F8U A;  17GS A;  2GQL A;  1T7P B;  1GWC A;  4MLY A;  2VCT A;  1GSF A;  4MJC A;  2Z9S A;  5J5N A;  5G30 A;  4DVC A;  2FUG 2;  5FT3 A;  3GUS A;  2GSQ A;  2DBC A;  4N3Z A;  2HSN A;  1GLQ A;  3N5O A;  5IQY A;  5ECO B;  4KDU A;  4MH3 A;  3RFR C;  3LYP A;  1E6B A;  4PQI A;  1G6W A;  2VD0 A;  3I43 A;  4FH8 A;  1WJK A;  2WB9 A;  2WW0 A;  1KEB A;  3HY2 A;  5J4U A;  2VCV A;  1J9B A;  1S3D A;  1XW6 A;  2H01 A;  1ZGN A;  3VWX A;  2P0G A;  2GZY A;  4K6X A;  2B7J A;  2L5O A;  1QXH A;  4KB3 A;  4OCF A;  5B6N A;  1OVN A;  3KGK A;  1PGT A;  3MYD A;  2H8L A;  2YPM A;  2C0D A;  4WF5 A;  3DML A;  4WR5 A;  2GQM A;  2VUP A;  2R0G A;  4IKH A;  4MK3 A;  4K2D A;  2M46 A;  4EXJ A;  2KHP A;  5EPF A;  4BVY B;  1B9X C;  4FYU A;  2X99 A;  3RAZ A;  3D4M A;  1OC3 A;  5EVO A;  4OMV A;  4EDY A;  2ALB A;  4WET A;  1AIU A;  1GRX A;  2VCX A;  1AC1 A;  3G7Y A;  2VM2 A;  5CYY A;  3PPU A;  1EP7 A;  3GTU A;  3HYP A;  2TRC P;  4I2T A;  2FA4 A;  3DIE A;  4MJA A;  2D2Z A;  3KMO A;  2P5Q A;  1URM A;  1AUC A;  3TKP A;  2E7P A;  3KM6 A;  1T8E B;  3FK8 A;  3V1W A;  2AJQ B;  2MMA A;  4G2E A;  2GSR A;  4L5O A;  2H1A A;  2H19 A;  1YEW C;  1S3A A;  5KN1 A;  3IC8 A;  2LQQ A;  1YF1 A;  1T1V A;  2AUV A;  2IMK A;  2H76 A;  3DVX A;  1PN9 A;  2YV7 A;  2OE0 A;  5J9B A;  4DSQ A;  1X5D A;  2VL3 A;  1V9W A;  6GSU A;  2QA2 A;  2JAC A;  3BD2 A;  5IO2 A;  1OKT A;  4MNN A;  4X43 A;  4GDF A;  1TRV A;  1GSQ A;  2IWT A;  3KCM A;  1BG5 A;  4OD7 A;  3TB2 A;  3TRQ A;  1JFU A;  2H71 A;  4BVY A;  4O5Q A;  3RPP A;  3TJF A;  4WBJ A;  1A8Y A;  5LD0 A;  4POK A;  2HXK A;  1Z7P A;  1ZCP A;  2CAQ A;  1XG8 A;  5DCH A;  3GIX A;  2WVX B;  3KD0 A;  2LNT A;  2JSY A;  1GSD A;  2H1D A;  1GUK A;  1XVQ A;  2LJA A;  1SL1 B;  4GWR A;  2X64 A;  2H6Z A;  4KSM A;  2YJH A;  1HD2 A;  2GVP A;  4LLR A;  4BVX B;  1YDK A;  5D93 A;  2B1K A;  1O6J A;  2DJ0 A;  3SBC A;  2GST A;  1SVL A;  1PN0 A;  2EIR A;  3CXG A;  2QA1 A;  3CRU A;  5HR0 A;  3M0F A;  5GAP D;  3M9K A;  2VLV A;  4KA0 A;  3FR6 A;  5GST A;  5CRE A;  2VKZ G;  1TI1 A;  2DMM A;  3W6G A;  4HS1 A;  3FZ4 A;  1ZZY A;  1EGO A;  3HJP A;  3QAW A;  1R5A A;  1TU8 A;  2K8S A;  5FWG A;  1AQV A;  5F8B A;  3C1S A;  2XHF A;  1TI3 A;  3F3Q A;  1TP9 A;  3JCM L;  2OBK A;  3TCO A;  3C1R A;  5D9V A;  3H8Q A;  3F63 A;  4QMK A;  5ECS A;  2AYT A;  3LGC A;  3IHG A;  4ZIJ A;  5DQY A;  3EC3 A;  1M2B A;  5JCW A;  5GZZ B;  2WVX A;  1J08 A;  1N25 A;  1M3I A;  1HNC A;  3EWL A;  1SL2 B;  4ZL8 A;  4G19 A;  3TUE A;  5B8B A;  2I3Y A;  4ZB9 A;  1OE7 A;  3ZFL A;  1ERV A;  9GSS A;  4BVX A;  2YZU A;  4MZW A;  2P5R A;  2IMD A;  5B7C A;  2HZF A;  4L0U A;  2VL2 A;  4HUA A;  3R3E A;  3APO A;  2H0G A;  1UA5 A;  1SVO A;  1Y25 A;  3WYW A;  2NBS A;  4K0G A;  1AAZ A;  1R4W A;  4MAB A;  2HZE B;  5KEJ A;  1YF0 A;  4IEL A;  2V2G A;  2BTO T;  2FHE A;  5DAK B;  3RBT A;  2HRF A;  2WDU A;  4RQR A;  3DVW A;  2ZNM A;  2F9S A;  5D8I A;  2GQK A;  4ISD A;  1HQO A;  3GA4 A;  3O76 A;  4AI6 A;  4K0N A;  2WVY A;  4TR3 A;  2X8H A;  2V32 A;  3ZRD A;  4XIH A;  4FXY P;  5ECP B;  4F03 A;  2CV4 A;  1K0O A;  4ZBB A;  2H6Y A;  3FZ9 A;  2X4A A;  1R26 A;  3W8J A;  1G7O A;  1FVK A;  4L8E A;  2IN3 A;  4WXT A;  2LS5 A;  2HI7 A;  4A5P A;  4AJ8 A;  1M0U A;  5D9W A;  1A2L A;  2LQO A;  2HSM B;  3IOS A;  1BYE A;  4PX1 A;  3GN3 A;  3GKM A;  2FD3 A;  3ME7 A;  3U5R E;  3GHA A;  3UVH A;  5KN0 A;  4G0I A;  3M8N A;  5A1N B;  3DYR A;  5B8A A;  1Y6E A;  4Z2R A;  2HZE A;  1TK0 B;  1XWB A;  2H72 A;  3MWH A;  5DAK A;  2YN1 A;  2EC4 A;  3WGE A;  2VL9 A;  1XWA A;  3EIN A;  5AGY A;  5F06 A;  1W4V A;  4K1F A;  2EFE A;  5D96 A;  4PNG A;  3C8E A;  3RPN A;  2DIY A;  3WD6 A;  3GKN A;  5E4W A;  2YNX A;  2B7K A;  1EV9 A;  2N5F A;  1TXX A;  3H93 A;  4I5Q A;  4V2L A;  2O36 A;  4NPB A;  5JWO B;  2B5E A;  4GLT A;  2PGT A;  2G2Q A;  1FVJ A;  1GUH A;  1Z3E A;  4AKI A;  5G2Z A;  3BBY A;  1A8L A;  2H1L A;  2YOI A;  2K9F A;  6GSX A;  3PIN A;  4PI2 C;  1X0R A;  2XBI A;  4V2M A;  2K6V A;  5ENU A;  1PQN A;  3L0H A;  1O7U A;  1M7T A;  1BJX A;  1VF4 A;  2E2M A;  2O87 A;  3VLN A;  4IGJ A;  2C0E A;  2WUL A;  4MZC A;  2MMO A;  3VWV A;  1K0M A;  2WW2 A;  2KOK A;  1TOF A;  1F37 A;  3FR3 A;  5DJL A;  2HSM A;  1AW9 A;  1PA3 A;  3HHV A;  2LKU A;  1Q98 A;  3CTF A;  4N0Z A;  4EL1 A;  3RDW A;  2EFH A;  5A1N A;  14GS A;  3MNG A;  3HJO A;  3GH6 A;  3FEU A;  1PMT A;  3GST A;  2VL2 C;  4PUR A;  3G9B A;  5IMF A;  1GUM A;  3P7X A;  1T4Y A;  4TR0 A;  1ZYQ B;  4I2U A;  2VCQ A;  3VWW A;  1TU7 A;  3TKR A;  3I9V 2;  3GYK A;  1ACV A;  2M80 A;  3BCI A;  3APS A;  4WEY A;  3ZZX A;  2XPE A;  4L5L A;  2BJX A;  3Q18 A;  2DLX A;  1PFO A;  12GS A;  2M72 A;  3LEF A;  5JWQ B;  2DSA A;  1IYH A;  10GS A;  2GZP A;  4GXZ A;  3HVV A;  2C1Y A;  2DJ3 A;  4YQV A;  2CT6 A;  2CVD A;  18GS A;  5AIX A;  2DJK A;  3HXS A;  4XS1 A;  5DBQ A;  3VFI A;  1MDI A;  3HJM A;  2B6M A;  2A2S A;  4XRA A;  4GQF A;  1XWG A;  4HZ2 A;  5J41 A;  1K3O A;  5BRT A;  4KW6 A;  4BL7 B;  2LNS A;  2TIR A;  1K0A A;  4ID0 A;  4IHU A;  1YY7 A;  2HQT A;  2WS2 A;  2CZ3 A;  2KP2 A;  1Q4J A;  1OC8 A;  1VF3 A;  1ZMA A;  3TDG A;  5ECL B;  2HRK B;  3TRX A;  1Z5Y E;  1FAA A;  5IPG A;  1JZO A;  1GSY A;  3F0I A;  1XOA A;  4K7I A;  5F0G A;  2C8U A;  1YQ1 A;  1ZL9 A;  2GDR A;  4HI7 A;  2F8A A;  4FQU A;  1EP8 A;  5J4V A;  4LL1 B;  4GF0 A;  1KNG A;  2F3M A;  3ZMK A;  1JZD A;  4JR4 A;  4O92 A;  1SKS B;  3Q19 A;  1B4Q A;  2OA7 A;  3UVT A;  4QQ7 A;  3A2W A;  3APQ A;  2FNO A;  4JZQ A;  1QGV A;  2DKH A;  5H5Q A;  3DGQ A;  2B5X A;  2VCZ A;  3VUR A;  2CQ9 A;  2MYG A;  2ZCT A;  4CDO A;  1GL8 A;  2CVB A;  3TKS C;  2ZUP A;  5COH A;  5CRH A;  1GTI A;  5C00 A;  4K7O A;  4AF2 A;  4BWQ A;  4USS A;  1DE1 A;  1RW1 A;  3HA9 A;  3Q74 A;  5A5H B;  2FLS A;  5ABR A;  4V2N A;  4KF9 A;  1VF2 A;  5DVB A;  3GRX A;  1QK8 A;  2ON5 A;  4WKW A;  1B48 A;  3ERG A;  1XBS A;  4XS6 A;  2C0F A;  4OCE A;  2FWE A;  4BL7 A;  4KCE A;  2KLX A;  5ECQ B;  1Y1U A;  4PUA A;  2RM6 A;  4FO5 A;  4XHM A;  4F0B A;  2HRK A;  2WJU A;  5HFG A;  3I69 A;  1V58 A;  2CVK A;  4H86 A;  2B1L A;  2O89 A;  2V41 A;  3VPQ A;  4G9H A;  5CP1 A;  2JZS A;  2ON7 A;  2IPA A;  3HDC A;  4ULX A;  4MA9 A;  1I1I P;  4EDZ A;  1TRS A;  3GMF A;  1DSB A;  4E68 A;  3FYG A;  2LJK A;  4IS0 A;  1UVZ A;  3ERW A;  3HVN A;  3LOR A;  4MDC A;  1THX A;  2H70 A;  4BIK A;  1H4O A;  4RI7 A;  1TRU A;  1XIY A;  4NWY A;  4ZIL A;  2FCH A;  5ECR B;  1XWC A;  5D9X A;  2H1G A;  2J9H A;  4PI0 C;  4Q5N A;  1S4B P;  1I5G A;  5EY6 A;  1GSE A;  5HR3 A;  3CWG A;  2HRA A;  2QSI A;  3TGZ A;  5A5H A;  1OKD A;  4IW9 A;  5HFK A;  1LJR A;  3NZN A;  2WCI A;  4HSC X;  3LSZ A;  4ML6 A;  4ILF A;  1SK2 A;  6GSY A;  3QAG A;  2I81 A;  4J2F A;  1WIK A;  1EZK A;  2ES7 A;  3H79 A;  3D5J A;  2CA8 A;  1SVM A;  1SEN A;  1X9W B;  4NXI A;  1AXD A;  2DIZ A;  2OAD A;  1SD9 A;  4LMW A;  2EIO A;  3QAV A;  3AY8 A;  1CQH A;  4ZXG A;  4GSS A;  2DML A;  1GTA A;  2WVZ A;  3E9J B;  4FIW A;  1XZO A;  2R37 A;  4JE1 A;  1V57 A;  1YZX A;  5HFI A;  1TRW A;  4X4J A;  3PGT A;  4HU9 A;  1FHE A;  1G6Y A;  2PVQ A;  1EGR A;  5L71 A;  1RQM A;  2LUS A;  2EFD A;  1YKA A;  4HQS A;  3IE3 A;  1BQ7 A;  1ZYP A;  3KIJ A;  2PUK C;  3CRT A;  2WFC A;  4TVE A;  3UAP A;  1XOB A;  2LRT A;  4YAP A;  2C0G A;  4YQM A;  2PWJ A;  3TRP A;  2PVO C;  1A0F A;  3UIW A;  5A4W A;  1U87 A;  4ZL7 A;  4YKF A;  3FRC A;  4HZ4 A;  3EVI A;  2FWG A;  3KTB A;  4I6X A;  4K2X A;  2QKE A;  3TOU A;  4TOP A;  2R0C A;  3TJJ A;  3KXO A;  2KUC A;  4IQA A;  1PL1 A;  2AAW A;  4N0V A;  4I8B A;  1C72 A;  2VIM A;  3PH9 A;  1KTE A;  3SWL A;  1SKW B;  4TKY A;  4RQX A;  1WE0 A;  1FOV A;  4TRX A;  2VCW A;  3VI7 A;  16GS A;  1O73 A;  4K5S A;  4ZB8 A;  2C3T A;  3GSS A;  5IOX A;  1V2A A;  4ZBD A;  1BG1 A;  3ZYW A;  2RUE A;  5A4V A;  1PKZ A;  1EWX A;  1J0F A;  2YJ7 A;  3KH9 A;  4IBP A;  4Q5F A;  3A2V A;  4FYB A;  1SKR B;  2HSH A;  1CQG A;  4JED A;  4PUF C;  5KOW A;  3HZ4 A;  6GST A;  3IPZ A;  4JRR A;  3QD9 A;  3DKS A;  1OC9 B;  1F2E A;  1U3I A;  3UBK A;  2WRT A;  3Q6O A;  2HRN A;  3LYK A;  3QR6 A;  2L5L A;  5IMZ A;  1M2A A;  3P90 A;  4ECJ A;  5ELA A;  2XBQ A;  2YWN A;  1K0C A;  3EPT A;  3D6I A;  4BWS A;  3N9J A;  5GSS A;  4X0X A;  3EE2 A;  1MDK A;  1X5E A;  1GUL A;  4HDE A;  1JZR A;  2K8V A;  4KDY A;  5B6M A;  3MDK A;  5EL8 A;  3GKX A;  3L9V A;  1M9A A;  1XFL A;  5CAX A;  4GSN A;  1K0B A;  5JWR B;  5DDL A;  4YH2 A;  1TTZ A;  3IK9 A;  1YEP A;  1DE2 A;  4MPF A;  4ZL9 A;  1EEJ A;  1GSS A;  3HD5 A;  2R2J A;  5J9C A;  5KN2 A;  4AGS A;  2REM A;  2YWM A;  3F4S A;  4PHZ C;  2P31 A;  2PMT A;  1WP0 A;  2V6O A;  1KBN A;  3TJK A;  1HNB A;  2O7K A;  5A5K A;  4G0K A;  3ZFB A;  1GSU A;  2K18 A;  2HLS A;  4PGT A;  2HFD A;  4O7H A;  4QL9 A;  3KZQ A;  4EIP A;  1TK5 B;  2JL4 A;  4POB A;  4NMU A;  4F2I A;  2YAN A;  1O8W A;  4XRD A;  1JZW A;  3QPM A;  4FYC A;  3IAM 2;  2C3Q A;  2CZ2 A;  4EO3 A;  2FGX A;  2L6D A;  1A23 A;  5IMC A;  2LJR A;  5ECK B;  1OE8 A;  1M99 A;  3GFK A;  1XVW A;  1OC9 A;  3EYT A;  1WWJ A;  2CX4 A;  3TKS A;  4I97 A;  1GP1 A;  3GV1 A;  4KSO A;  2RII A;  3L9U A;  4KGI A;  1B8X A;  2PBJ A;  2LRN A;  4NHW A;  2YP6 A;  4K9Z A;  4ECI A;  2V1M A;  1F9M A;  1TK8 B;  3WGD A;  4LA1 A;  4YKG A;  5CRW A;  1S3R A;  1DUG A;  1XPV A;  3EMP A;  4MP4 A;  3G7J A;  3ZIV A;  3CSH A;  4OFM A;  3CTG A;  5ECI B;  1A2J A;  4AJ6 A;  1U6T A;  4ICY A;  1T4Z A;  1EEM A; 
#chains in the Genus database with same CATH homology
 1WMJ A;  1ZYN A;  4GST A;  1LU4 A;  4W66 A;  2XPD A;  4NAX A;  3IR4 A;  4PXO A;  2HNL A;  4NV5 A;  3UBL A;  3ZLP A;  1NHY A;  1XCC A;  2A2R A;  3C71 A;  4ECB A;  1T00 A;  2J23 A;  3D22 A;  2OE1 A;  4LMV A;  3FZ5 A;  2MBT A;  4DSS B;  4N10 A;  1SYR A;  4G10 A;  1PD2 1;  4GCI A;  1ABA A;  2OBI A;  5F05 A;  4WF4 A;  4L0W A;  5G5F A;  1V98 A;  5IOW A;  1Z6N A;  2A2P A;  3IRA A;  2NTO A;  3EU4 A;  4MF6 A;  1QQ2 A;  3GUR A;  2AB6 A;  1N8J A;  3CBU A;  5FHI A;  4Q5R A;  2CAI A;  2O8V B;  4ZB7 A;  4YQU A;  3LJR A;  5IIZ A;  6GSV A;  2F51 A;  1ERW A;  4BA7 A;  2OT3 A;  3R2Q A;  2B3S A;  4K7N A;  2UZ8 A;  1FO5 A;  2DC5 A;  4WR4 A;  3FR9 A;  3TKQ A;  4TXV A;  3A2X A;  3GKK A;  2BMX A;  3A5W A;  2YCD A;  3A3T A;  2H74 A;  4KE3 A;  3PR8 A;  1ON4 A;  3UOM A;  4IP6 A;  2OKA A;  3WT2 A;  4ZBA A;  2JSZ A;  3U6V A;  3MAK A;  5ECN B;  1QMV A;  7GSS A;  1OYJ A;  4MF5 A;  3ZML A;  1ILO A;  5A34 A;  3BCK A;  1G7E A;  3CSI A;  2R0P A;  4KUN A;  2PER A;  4IQ1 A;  5J47 A;  1FB6 A;  2PN8 A;  4DSS A;  4POL A;  2RM5 A;  3C7M A;  3H4K A;  5IO0 A;  1ZOF A;  4EE0 A;  4KCA A;  5G1K A;  2O5V A;  5CNW A;  2V6K A;  3M1G A;  2HT9 A;  5AIV A;  1A0R P;  1FOH A;  4XS4 B;  2JU5 A;  5LNK e;  3S9F A;  5IPH A;  4F82 A;  4F0C A;  5DCG A;  2H73 A;  5HR1 A;  2VLU A;  4ML1 A;  2E0Q A;  1EV4 A;  1YEX A;  2N5B A;  5INY A;  1MEK A;  1PX7 A;  2MMN A;  4GQC A;  2A4V A;  1GTU A;  2GT6 A;  4JBB A;  5A4U A;  1TKD B;  4D73 B;  2H66 A;  1AQW A;  1XWK A;  4K8M A;  3GL5 A;  4CY6 A;  6GSS A;  2MMZ A;  3L9S A;  4Q5Q A;  1X5C A;  1VRS D;  1W89 A;  3VPT A;  3O3T A;  1PSQ A;  1SYX A;  4IP1 A;  3TOT A;  2GLR A;  3FY7 A;  2DJ2 A;  1K0D A;  4EC0 A;  2R3X A;  1XW9 A;  4N30 A;  2AHE A;  1BX9 A;  2L6C A;  1OAZ A;  4EIQ A;  4Z2U A;  3DWV A;  4EUY A;  2GS3 A;  2IFQ B;  4OWY A;  3D21 A;  2HYX A;  2I1U A;  3UAR A;  2X8G A;  4IN0 A;  4K5R A;  4EKZ A;  3HKR A;  3ZIT A;  4G01 A;  2NVL A;  4JR6 A;  1A24 A;  4PQ1 A;  3UMA A;  3F6D A;  2C80 A;  5ELG A;  1FG4 A;  4NV2 A;  3RHB A;  2H1B A;  2EIQ A;  4EF0 A;  3F4R A;  3VI5 A;  1HNA A;  4XS4 A;  3O6T A;  3IA1 A;  2PU9 C;  1TJD A;  4PTS A;  4E8E A;  5J40 A;  3KMN A;  4ZB6 A;  2VD1 A;  5GAN D;  1SK0 A;  3QCP A;  3IV4 A;  5HQP A;  3ZTL A;  5CRD A;  3BJ5 A;  3ZVJ A;  4IVF A;  1TW9 A;  1PL2 A;  4D73 A;  5D9T A;  4J57 E;  2L4Q A;  5IMA A;  1BED A;  1EOH A;  2F8F A;  3CYN A;  2YWO A;  4PNF A;  4ECC A;  1NM3 A;  1BF5 A;  3IHQ A;  1NHO A;  3HZ8 A;  1MD4 A;  2IMI A;  2MZC A;  5JCU A;  1NSW A;  1SJZ A;  5DAL B;  3F9U A;  2NPB A;  3FMW A;  3VWU A;  4V1A g;  4DSR A;  1SU9 A;  5AIS A;  2GGT A;  2IFQ A;  1K3Y A;  1MTC A;  2GSS A;  4Z2T A;  3LXZ A;  1ZYE A;  1USB A;  4MCU A;  1K3L A;  3QFB C;  1A2M A;  1F3A A;  2O85 A;  4GRF A;  4KND A;  1E2Y A;  1DBY A;  1FW1 A;  2DKI A;  4MZB A;  4QL7 A;  5ECH B;  4HJM A;  5H5S A;  2I4A A;  2I9H A;  4KAE A;  3NOF A;  1TXU A;  2AV4 A;  4HEA 2;  20GS A;  1WPI A;  4TR1 B;  2YWI A;  3HCZ A;  3TU3 B;  4J56 E;  1NW2 A;  3EUR A;  1JHB A;  4RUV A;  1M2D A;  2QGV A;  2H75 A;  1YKC A;  5LCZ A;  1SJI A;  3TJB A;  3UEM A;  1LBK A;  4POM A;  2GTU A;  4TN8 A;  3GH9 A;  2IMF A;  3L4N A;  2RLI A;  5DAL A;  5J4Y A;  4XTS A;  1O85 A;  3KP9 A;  2C3N A;  2IIY A;  4F9Z A;  3D0Z A;  1GH2 A;  4ACS A;  2OJL A;  1V40 A;  3ZIJ A;  2EFC A;  2KP1 A;  3QFA C;  1MD3 A;  3ME8 A;  2IL3 A;  3WGX A;  3F3R A;  4RI6 A;  2CX3 A;  5E59 A;  5DQS A;  2L59 A;  2X49 A;  3US3 A;  2WZ9 A;  22GS A;  5IM9 A;  5CO3 A;  1X9M B;  1SD8 A;  1VGL A;  4JU5 A;  4IJI A;  3TKS E;  1TDI A;  1HYU A;  5D73 A;  2HE3 A;  4OO5 A;  2GT5 A;  2H0I A;  1O8X A;  3L78 A;  1XXU A;  3KTL A;  3IDV A;  1XW5 A;  4NHZ A;  1JLW A;  2JZR A;  4AJ7 A;  4XCS A;  3ZRE A;  4TR1 A;  2L57 A;  4O32 A;  1R7H A;  1X9S B;  1K0N A;  3FHK A;  2FWF A;  3MIX A;  1RK4 A;  3DRN A;  5KN3 A;  5ID2 B;  3E3E A;  1BAY A;  4P3Y B;  4AKH A;  1B9Y C;  3GX0 A;  4OFN A;  3C73 A;  3IK7 A;  3P2A A;  2VOC A;  4CHS A;  2R5G A;  4HJ2 A;  4AKX B;  2LV3 A;  1O81 A;  2VM1 A;  2PPT A;  4HOJ A;  1B4P A;  2DJJ A;  3KEB A;  2UV8 G;  5IMV A;  1GNW A;  4O5R A;  3LG6 A;  2TRX A;  3FKF A;  1SK1 A;  4IJ3 A;  4MF7 A;  2A4H A;  2L4C A;  3K8N A;  3LFL A;  1ST9 A;  1PKW A;  1VF1 A;  2HSY A;  2NDO A;  4HQZ A;  2G0F A;  1N2A A;  1GTB A;  3VK9 A;  5ECM B;  3UL3 A;  4MJB A;  1IYI A;  3DXB A;  3GNJ A;  3IBH A;  3KH7 A;  1I9D A;  1H75 A;  2FY6 A;  4BPY A;  3H1N A;  3IXR A;  1PRX A;  3ZVJ D;  1UC7 A;  3HVS A;  4YAV A;  3CMI A;  1F6M C;  2RUF A;  3DD3 A;  2N5A A;  2JZT A;  3M9J A;  1PX6 A;  1FB0 A;  2C4J A;  5ID2 A;  3QOU A;  3G7I A;  4TW5 A;  3OR5 A;  5BMU B;  1THO A;  2VO4 A;  1MDJ A;  4OO4 A;  3EMX A;  2MBS A;  3LQ7 A;  4TR4 A;  3ED3 A;  4O5U A;  1Z9H A;  1QUW A;  1U3A A;  4V1A p;  3W8S A;  2LEG A;  3ERF A;  3QMX A;  3HMJ G;  4KDX A;  3LWA A;  1YJ6 A;  5IMD A;  13GS A;  1ML6 A;  1S3C A;  3WT1 A;  1U88 A;  4AKG A;  2LRC A;  3J7Y k;  4E8H A;  5G1L A;  3LXT A;  2FWH A;  2H0H A;  1SJ6 A;  3F6F A;  3CSJ A;  1WRY A;  2IJY A;  2B5Y A;  5G31 A;  4KX4 A;  5J3R A;  1GNE A;  1R5P A;  2XC2 A;  4CY8 A;  3A5I A;  3UJ1 A;  3FZA A;  3GX8 A;  2QC7 A;  5A34 B;  3I6A A;  1G0T A;  5G5E A;  1EOG A;  2JAD A;  1T3B A;  3D4T A;  2DJ1 A;  3MSZ A;  1YVL A;  3QDN A;  2OE3 A;  2H30 A;  4HU7 A;  2VAF A;  3IAS 2;  3KJY A;  4TXO B;  5CRG A;  3NIV A;  19GS A;  3J7Y b;  2LST A;  3KP8 A;  4KH7 A;  1WOU A;  5BMU A;  4Z7X A;  1AQX A;  3E0U A;  3FW2 A;  1F3B A;  2YV9 A;  1QFN A;  3LW9 A;  4PQH A;  4CW9 A;  4GTU A;  3HVX A;  2FA8 A;  2R6K A;  2VLT A;  5AN1 A;  2R4V A;  2WGR A;  5C04 A;  3IC4 A;  2HSN B;  6GSW A;  3F4T A;  4MJE A;  4MPG A;  3P8W A;  4MH2 A;  1Z7R A;  4EVM A;  1ERU A;  11GS A;  4OFT A;  1UN2 A;  5F07 A;  1SL0 B;  3ZL5 A;  5HR2 A;  1JLV A;  2LTK A;  2IME A;  1ERT A;  5DJM A;  2GZZ A;  4G0L A;  4WBR D;  5KOX A;  5JCG A;  5H5R A;  3ISO A;  4MMM A;  4X1U A;  3GL3 A;  3DEX A;  2X8C A;  2E2G A;  8GSS A;  3RHC A;  3BOA A;  1Z6M A;  3M3M A;  2YZH A;  3TJG A;  2OAC A;  4TXO A;  3EU3 A;  4LL4 B;  1M9B A;  1GLP A;  3GTU B;  4DEJ A;  2H6X A;  4N11 A;  3F8U A;  17GS A;  2GQL A;  1T7P B;  1GWC A;  4MLY A;  2VCT A;  1GSF A;  4MJC A;  2Z9S A;  5J5N A;  5G30 A;  4DVC A;  2FUG 2;  5FT3 A;  3GUS A;  2GSQ A;  2DBC A;  4N3Z A;  2HSN A;  1GLQ A;  3N5O A;  5IQY A;  5ECO B;  4KDU A;  4MH3 A;  3LYP A;  1E6B A;  4PQI A;  1G6W A;  2VD0 A;  3I43 A;  4FH8 A;  1WJK A;  2WB9 A;  1KEB A;  3HY2 A;  5J4U A;  2VCV A;  1J9B A;  1S3D A;  1XW6 A;  2H01 A;  1ZGN A;  3VWX A;  2P0G A;  2GZY A;  4K6X A;  2B7J A;  2L5O A;  1QXH A;  4KB3 A;  4OCF A;  5B6N A;  1OVN A;  3KGK A;  1PGT A;  3MYD A;  2H8L A;  2YPM A;  2C0D A;  4WF5 A;  3DML A;  4WR5 A;  2GQM A;  2VUP A;  2R0G A;  4IKH A;  4MK3 A;  4K2D A;  2M46 A;  4EXJ A;  2KHP A;  5EPF A;  4BVY B;  1B9X C;  4FYU A;  2X99 A;  3RAZ A;  3D4M A;  1OC3 A;  5EVO A;  4OMV A;  4EDY A;  2ALB A;  4WET A;  1AIU A;  1GRX A;  2VCX A;  1AC1 A;  3G7Y A;  2VM2 A;  5CYY A;  3PPU A;  1EP7 A;  3GTU A;  3HYP A;  2TRC P;  4I2T A;  2FA4 A;  3DIE A;  4MJA A;  2D2Z A;  3KMO A;  2P5Q A;  1URM A;  1AUC A;  3TKP A;  2E7P A;  3KM6 A;  1T8E B;  3FK8 A;  3V1W A;  2AJQ B;  2MMA A;  4G2E A;  2GSR A;  4L5O A;  2H1A A;  2H19 A;  1S3A A;  5KN1 A;  3IC8 A;  2LQQ A;  1YF1 A;  1T1V A;  2AUV A;  2IMK A;  2H76 A;  3DVX A;  1PN9 A;  2YV7 A;  2OE0 A;  5J9B A;  4DSQ A;  1X5D A;  2VL3 A;  1V9W A;  6GSU A;  2QA2 A;  2JAC A;  3BD2 A;  5IO2 A;  1OKT A;  4MNN A;  4X43 A;  4GDF A;  1TRV A;  1GSQ A;  2IWT A;  3KCM A;  1BG5 A;  4OD7 A;  3TB2 A;  3TRQ A;  1JFU A;  2H71 A;  4BVY A;  4O5Q A;  3RPP A;  3TJF A;  4WBJ A;  1A8Y A;  5LD0 A;  4POK A;  2HXK A;  1Z7P A;  1ZCP A;  2CAQ A;  5DCH A;  3GIX A;  3KD0 A;  2LNT A;  2JSY A;  1GSD A;  2H1D A;  1GUK A;  1XVQ A;  2LJA A;  1SL1 B;  4GWR A;  2X64 A;  2H6Z A;  4KSM A;  2YJH A;  1HD2 A;  2GVP A;  4LLR A;  4BVX B;  1YDK A;  5D93 A;  2B1K A;  1O6J A;  2DJ0 A;  3SBC A;  2GST A;  1SVL A;  1PN0 A;  2EIR A;  3CXG A;  2QA1 A;  3CRU A;  5HR0 A;  3M0F A;  5GAP D;  3M9K A;  2VLV A;  4KA0 A;  3FR6 A;  5GST A;  5CRE A;  2VKZ G;  1TI1 A;  2DMM A;  3W6G A;  4HS1 A;  3FZ4 A;  1ZZY A;  1EGO A;  3HJP A;  3QAW A;  1R5A A;  1TU8 A;  2K8S A;  5FWG A;  1AQV A;  5F8B A;  3C1S A;  2XHF A;  1TI3 A;  3F3Q A;  1TP9 A;  3JCM L;  2OBK A;  3TCO A;  3C1R A;  5D9V A;  3H8Q A;  3F63 A;  4QMK A;  5ECS A;  2AYT A;  3LGC A;  3IHG A;  4ZIJ A;  5DQY A;  3EC3 A;  1M2B A;  5JCW A;  5GZZ B;  1J08 A;  1N25 A;  1HNC A;  3EWL A;  1SL2 B;  4ZL8 A;  4G19 A;  3TUE A;  5B8B A;  2I3Y A;  4ZB9 A;  1OE7 A;  3ZFL A;  1ERV A;  9GSS A;  4BVX A;  2YZU A;  4MZW A;  2P5R A;  2IMD A;  5B7C A;  2HZF A;  4L0U A;  2VL2 A;  4HUA A;  3R3E A;  3APO A;  2H0G A;  1UA5 A;  1SVO A;  1Y25 A;  3WYW A;  2NBS A;  4K0G A;  1AAZ A;  1R4W A;  4MAB A;  2HZE B;  5KEJ A;  1YF0 A;  4IEL A;  2V2G A;  2BTO T;  2FHE A;  5DAK B;  3RBT A;  2HRF A;  2WDU A;  4RQR A;  3DVW A;  2ZNM A;  2F9S A;  5D8I A;  2GQK A;  4ISD A;  1HQO A;  3GA4 A;  3O76 A;  4AI6 A;  4K0N A;  4TR3 A;  2X8H A;  2V32 A;  3ZRD A;  4XIH A;  5ECP B;  4F03 A;  2CV4 A;  1K0O A;  4ZBB A;  2H6Y A;  3FZ9 A;  2X4A A;  1R26 A;  3W8J A;  1G7O A;  1FVK A;  4L8E A;  2IN3 A;  4WXT A;  2LS5 A;  2HI7 A;  4A5P A;  4AJ8 A;  1M0U A;  5D9W A;  1A2L A;  2LQO A;  2HSM B;  3IOS A;  1BYE A;  4PX1 A;  3GN3 A;  3GKM A;  2FD3 A;  3ME7 A;  3U5R E;  3GHA A;  3UVH A;  5KN0 A;  4G0I A;  3M8N A;  5A1N B;  3DYR A;  5B8A A;  1Y6E A;  4Z2R A;  2HZE A;  1TK0 B;  1XWB A;  2H72 A;  3MWH A;  5DAK A;  2YN1 A;  2EC4 A;  3WGE A;  2VL9 A;  1XWA A;  3EIN A;  5AGY A;  5F06 A;  1W4V A;  4K1F A;  2EFE A;  5D96 A;  4PNG A;  3C8E A;  3RPN A;  2DIY A;  3WD6 A;  3GKN A;  5E4W A;  2YNX A;  2B7K A;  1EV9 A;  2N5F A;  1TXX A;  3H93 A;  4I5Q A;  4V2L A;  4NPB A;  5JWO B;  2B5E A;  4GLT A;  2PGT A;  2G2Q A;  1FVJ A;  1GUH A;  1Z3E A;  4AKI A;  5G2Z A;  3BBY A;  1A8L A;  2H1L A;  2YOI A;  2K9F A;  6GSX A;  3PIN A;  4V2M A;  1X0R A;  2XBI A;  2K6V A;  5ENU A;  1PQN A;  3L0H A;  1O7U A;  1M7T A;  1BJX A;  1VF4 A;  2E2M A;  2O87 A;  3VLN A;  4IGJ A;  2C0E A;  2WUL A;  4MZC A;  2MMO A;  3VWV A;  1K0M A;  2KOK A;  1TOF A;  1F37 A;  3FR3 A;  5DJL A;  2HSM A;  1AW9 A;  1PA3 A;  3HHV A;  2LKU A;  1Q98 A;  3CTF A;  4N0Z A;  4EL1 A;  3RDW A;  2EFH A;  5A1N A;  14GS A;  3MNG A;  3HJO A;  3GH6 A;  3FEU A;  1PMT A;  3GST A;  2VL2 C;  4PUR A;  3G9B A;  5IMF A;  1GUM A;  3P7X A;  1T4Y A;  4TR0 A;  1ZYQ B;  4I2U A;  2VCQ A;  3VWW A;  1TU7 A;  3TKR A;  3I9V 2;  3GYK A;  1ACV A;  2M80 A;  3BCI A;  3APS A;  4WEY A;  3ZZX A;  2XPE A;  4L5L A;  2BJX A;  3Q18 A;  2DLX A;  12GS A;  2M72 A;  3LEF A;  5JWQ B;  2DSA A;  1IYH A;  10GS A;  2GZP A;  4GXZ A;  3HVV A;  2C1Y A;  2DJ3 A;  4YQV A;  2CT6 A;  2CVD A;  18GS A;  5AIX A;  2DJK A;  3HXS A;  4XS1 A;  5DBQ A;  3VFI A;  1MDI A;  3HJM A;  2B6M A;  2A2S A;  4XRA A;  4GQF A;  1XWG A;  4HZ2 A;  5J41 A;  1K3O A;  5BRT A;  4KW6 A;  4BL7 B;  2LNS A;  2TIR A;  1K0A A;  4ID0 A;  4IHU A;  1YY7 A;  2HQT A;  2WS2 A;  2CZ3 A;  2KP2 A;  1Q4J A;  1OC8 A;  1VF3 A;  1ZMA A;  3TDG A;  5ECL B;  2HRK B;  3TRX A;  1Z5Y E;  1FAA A;  5IPG A;  1JZO A;  1GSY A;  3F0I A;  1XOA A;  4K7I A;  5F0G A;  2C8U A;  1YQ1 A;  1ZL9 A;  2GDR A;  4HI7 A;  2F8A A;  4FQU A;  1EP8 A;  5J4V A;  4LL1 B;  4GF0 A;  1KNG A;  2F3M A;  3ZMK A;  1JZD A;  4JR4 A;  4O92 A;  1SKS B;  3Q19 A;  1B4Q A;  2OA7 A;  3UVT A;  4QQ7 A;  3A2W A;  3APQ A;  2FNO A;  4JZQ A;  1QGV A;  2DKH A;  5H5Q A;  3DGQ A;  2B5X A;  2VCZ A;  3VUR A;  2CQ9 A;  2MYG A;  2ZCT A;  4CDO A;  1GL8 A;  2CVB A;  3TKS C;  2ZUP A;  5COH A;  5CRH A;  1GTI A;  5C00 A;  4K7O A;  4AF2 A;  4BWQ A;  4USS A;  1DE1 A;  1RW1 A;  3HA9 A;  3Q74 A;  5A5H B;  2FLS A;  5ABR A;  4V2N A;  4KF9 A;  1VF2 A;  5DVB A;  3GRX A;  1QK8 A;  2ON5 A;  4WKW A;  1B48 A;  3ERG A;  1XBS A;  4XS6 A;  2C0F A;  4OCE A;  2FWE A;  4BL7 A;  4KCE A;  2KLX A;  5ECQ B;  1Y1U A;  4PUA A;  2RM6 A;  4FO5 A;  4XHM A;  4F0B A;  2HRK A;  2WJU A;  5HFG A;  3I69 A;  1V58 A;  2CVK A;  4H86 A;  2B1L A;  2O89 A;  2V41 A;  3VPQ A;  4G9H A;  5CP1 A;  2JZS A;  2ON7 A;  2IPA A;  3HDC A;  4ULX A;  4MA9 A;  4EDZ A;  1TRS A;  3GMF A;  1DSB A;  4E68 A;  3FYG A;  2LJK A;  4IS0 A;  1UVZ A;  3ERW A;  3LOR A;  4MDC A;  1THX A;  2H70 A;  1H4O A;  4RI7 A;  1TRU A;  1XIY A;  4NWY A;  4ZIL A;  2FCH A;  5ECR B;  1XWC A;  5D9X A;  2H1G A;  2J9H A;  4Q5N A;  1I5G A;  5EY6 A;  1GSE A;  5HR3 A;  3CWG A;  2HRA A;  2QSI A;  3TGZ A;  5A5H A;  1OKD A;  4IW9 A;  5HFK A;  1LJR A;  3NZN A;  2WCI A;  3LSZ A;  4ML6 A;  4ILF A;  1SK2 A;  6GSY A;  3QAG A;  2I81 A;  4J2F A;  1WIK A;  1EZK A;  2ES7 A;  3H79 A;  3D5J A;  2CA8 A;  1SVM A;  1SEN A;  1X9W B;  4NXI A;  1AXD A;  2DIZ A;  2OAD A;  1SD9 A;  4LMW A;  2EIO A;  3QAV A;  3AY8 A;  1CQH A;  4ZXG A;  4GSS A;  2DML A;  1GTA A;  3E9J B;  4FIW A;  1XZO A;  2R37 A;  4JE1 A;  1V57 A;  1YZX A;  5HFI A;  1TRW A;  4X4J A;  3PGT A;  4HU9 A;  1FHE A;  1G6Y A;  2PVQ A;  1EGR A;  5L71 A;  1RQM A;  2LUS A;  2EFD A;  1YKA A;  4HQS A;  3IE3 A;  1BQ7 A;  1ZYP A;  3KIJ A;  2PUK C;  3CRT A;  2WFC A;  4TVE A;  3UAP A;  1XOB A;  2LRT A;  4YAP A;  2C0G A;  4YQM A;  2PWJ A;  3TRP A;  2PVO C;  1A0F A;  3UIW A;  5A4W A;  1U87 A;  4ZL7 A;  4YKF A;  3FRC A;  4HZ4 A;  3EVI A;  2FWG A;  3KTB A;  4I6X A;  4K2X A;  2QKE A;  3TOU A;  4TOP A;  2R0C A;  3TJJ A;  3KXO A;  2KUC A;  4IQA A;  1PL1 A;  2AAW A;  4N0V A;  4I8B A;  1C72 A;  2VIM A;  3PH9 A;  1KTE A;  3SWL A;  1SKW B;  4TKY A;  4RQX A;  1WE0 A;  1FOV A;  4TRX A;  2VCW A;  3VI7 A;  16GS A;  1O73 A;  4K5S A;  4ZB8 A;  2C3T A;  3GSS A;  5IOX A;  1V2A A;  4ZBD A;  1BG1 A;  3ZYW A;  2RUE A;  5A4V A;  1PKZ A;  1EWX A;  1J0F A;  2YJ7 A;  3KH9 A;  4IBP A;  4Q5F A;  3A2V A;  4FYB A;  1SKR B;  2HSH A;  1CQG A;  4JED A;  4PUF C;  5KOW A;  3HZ4 A;  6GST A;  3IPZ A;  4JRR A;  3QD9 A;  3DKS A;  1OC9 B;  1F2E A;  1U3I A;  3UBK A;  2WRT A;  3Q6O A;  2HRN A;  3LYK A;  3QR6 A;  2L5L A;  5IMZ A;  1M2A A;  3P90 A;  4ECJ A;  5ELA A;  2XBQ A;  2YWN A;  1K0C A;  3EPT A;  3D6I A;  4BWS A;  3N9J A;  5GSS A;  4X0X A;  3EE2 A;  1MDK A;  1X5E A;  1GUL A;  4HDE A;  1JZR A;  2K8V A;  4KDY A;  5B6M A;  3MDK A;  5EL8 A;  3GKX A;  3L9V A;  1M9A A;  1XFL A;  5CAX A;  4GSN A;  1K0B A;  5JWR B;  5DDL A;  4YH2 A;  1TTZ A;  3IK9 A;  1YEP A;  1DE2 A;  4MPF A;  4ZL9 A;  1EEJ A;  1GSS A;  3HD5 A;  2R2J A;  5J9C A;  5KN2 A;  4AGS A;  2REM A;  2YWM A;  3F4S A;  2P31 A;  2PMT A;  1WP0 A;  2V6O A;  1KBN A;  3TJK A;  1HNB A;  2O7K A;  5A5K A;  4G0K A;  3ZFB A;  1GSU A;  2K18 A;  2HLS A;  4PGT A;  2HFD A;  4O7H A;  4QL9 A;  3KZQ A;  4EIP A;  1TK5 B;  2JL4 A;  4POB A;  4NMU A;  4F2I A;  2YAN A;  1O8W A;  4XRD A;  1JZW A;  3QPM A;  4FYC A;  3IAM 2;  2C3Q A;  2CZ2 A;  4EO3 A;  2FGX A;  2L6D A;  1A23 A;  5IMC A;  2LJR A;  5ECK B;  1OE8 A;  1M99 A;  3GFK A;  1XVW A;  1OC9 A;  3EYT A;  1WWJ A;  2CX4 A;  3TKS A;  4I97 A;  1GP1 A;  3GV1 A;  4KSO A;  2RII A;  3L9U A;  4KGI A;  1B8X A;  2PBJ A;  2LRN A;  4NHW A;  2YP6 A;  4K9Z A;  4ECI A;  2V1M A;  1F9M A;  1TK8 B;  3WGD A;  4LA1 A;  4YKG A;  5CRW A;  1DUG A;  1XPV A;  3EMP A;  4MP4 A;  3G7J A;  3ZIV A;  3CSH A;  4OFM A;  3CTG A;  5ECI B;  1A2J A;  4AJ6 A;  1U6T A;  4ICY A;  1T4Z A;  1EEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...