5AHEA

Crystal structure of salmonella enterica hisa
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
244
structure length
230
Chain Sequence
b'MIIPALDLIDGTVVRLQRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIGSTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGWQENSGVSLEQLVETYLPVGLKHVLCTDISGSNVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQWQN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATE ION
publication title Two-Step Ligand Binding in a Beta/Alpha8 Barrel Enzyme -Substrate-Bound Structures Shed New Light on the Catalytic Cycle of Hisa
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Isomerase
total genus 78
structure length 230
sequence length 244
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2015-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5aheA00
5AHEA 4CNOA 3TSDA 4GUIA 2BZNA 1SSGA 3DKLA 2E77A 2FJKA 3LRKA 3T55A 4N6FA 3SGUA 4AHQA 2Y7DA 3W7RA 3Q37A 1EP3A 2NLIA 4WX2A 2J27A 1DQXA 4DO6A 3G18A 5CZ0A 3PG9A 2A0NA 3FYPA 4UTWA 4Y8FA 1VR6A 5BW6A 1OFBA 2X30A 4HPJA 4H3DA 5K7JA 4ZQPA 2P10A 3LCHA 4CQAA 3UQNA 1VZWA 3PAJA 2NXIA 1DJQA 1A5SA 3NQAA 3W23A 3C8FA 2TSYA 3I68A 4UNLA 4WY0F 4CQ8A 4R34A 1O5KA 1NSJA 3FKKA 3G1HA 3C2EA 1Q6QA 4PODA 4O19A 4RR4A 3PR2A 1TPB1 4ZQRA 3DGRA 5G2HA 1UJPA 1W56A 3W7CA 5CKSA 2J9XA 3ABRA 1JVNA 3KOFA 1XUUA 2C0AA 4JX6A 3KAOA 2VEPA 1MZHA 3GDMA 4PTNA 3W1UA 1Q45A 1W31A 1OK6A 4UTTA 1L2UA 1TV7A 1QAPA 3NAVA 3TJXA 3GDLA 5AYZA 1DKWA 3FEMA 4CQ9A 1GVQA 3S5NA 3P5ZA 3W2UA 1R46A 1YPFA 3DI1A 2NX9A 4GE8A 1LBFA 5HWJA 3DFSA 4K7YA 4LW7A 2OCZA 3R12A 1OYBA 3F03K 1XCFA 3P8JA 1OFAA 3HB9A 4JGDA 4BI6A 3W74A 4FNSA 1O94A 4IXXA 4P61A 4ZZ9A 3TCEA 4M7SA 3HGSA 3SSJA 3N3MA 5L9FA 5CZJA 4U4MA 1IXOA 3BG3A 2EF9A 4Y9AA 5AOUA 3M44A 3KVMA 3N73A 3TFCA 1A50A 5EPDA 4XTDA 2ZRYA 3A21A 2VFGA 3M47A 2E6AA 3W2MA 4B5NA 2V9DA 5DBTA 1I4NA 3ZFHA 2C15A 1H7NA 1JUEA 4Z1DA 2FPTA 4IMDA 5HJLA 3CLMA 4JYEA 4UTMA 3P84A 4BF9A 2WPBA 3HJZA 2CLLA 3NQ8A 1RV8A 2G5WA 1QO5A 1GYLA 1CI1A 3S1UA 2AGKA 2FQIA 2HS8A 4KKXA 3G1DA 2X2GA 4KWVA 1GVSA 4X22A 4NX0A 3CIWA 3W7OA 4O0KA 3NM1A 1YLVA 3WK0A 4DBEA 4FX6M 1N7KA 4J9JA 3LI1A 2CFFA 3ABQA 1VQTA 2ZZ2A 2TMDA 4HNVA 2H3DA 4L4MA 2DZSA 3LRLA 3M5ZA 3W7PA 2FPVA 3W07A 2R8WA 3UY7A 1W3NA 2B7QA 3CM4A 1KBJA 4XKYB 3W7QA 2QCDB 4JTKA 4O28A 5F1UA 1TQJA 1AW5A 2BTMA 1DV7A 4FX7A 4QITA 5AFDA 5BMWA 1H7XA 4LU0A 4N4PA 5I3KA 3HG2A 5EMUA 4Y90A 2GJLA 1T96A 3CTLA 1FCUA 1F6KA 4FHAA 4AHPA 1AW1A 4LT9A 4AWSA 1KM5A 2CLOA 3G8RA 5FF0A 4AF0B 4JNMA 1GJPA 1XXXA 1YDNA 2Z1BA 1ICQA 3G1VA 4C1LA 3B8DA 2Y89A 4QJ1A 2YSWA 3PBWA 4O57A 2ABBA 1K7XA 1MEIA 2E6YA 3EXRA 2WJZA 2C18A 1WXJA 3LM7A 3N19B 4DF1A 3C61A 3DKJA 4O10A 2V2DA 2CLKA 4TX9A 3HGOA 4O15A 3T44A 5D2TA 3QSRA 3S0CA 3LHUA 3G1AA 1YXDA 5BOOA 5DCBA 3STCA 1G7VA 4JDYA 4K7VA 1F2JA 2VEKA 3FFSA 4N9DA 3P60A 3R89A 3W7DA 4K36A 4ADTA 2RFGA 4LOCA 3S9YA 4MIMA 3VFLA 1ME7A 1TPWA 4OU1A 2B0MA 1KV5A 1I45A 2CZEA 1F73A 3BGGA 4NT0A 5AB3A 3G1YA 1SZFA 2DJXA 2VFIA 5LKYA 1KM2A 1OK4A 3NEVA 4YWIA 3C2FA 3NOEA 3WJWA 1V5XA 1A5BA 3BPWA 4TU1A 4BK9A 1OG0A 4G1KA 1ZAHA 4R53A 3CHVA 1OF8A 1GVFA 4CNNA 3QZEA 3GAKA 4QIUA 3M1ZA 3VE9A 1VYRA 1G4SA 2WQPA 3RLUA 3B03A 1Y0EA 2V2HA 2NUXA 3OHIA 3LTPA 1LP6A 3UWUA 3S1WA 3W1PA 3I65A 1TB3A 1CW2A 1WA3A 3WFAA 3R5EA 1C29A 3TSBA 3QF0A 5H2ZA 1EP2A 4NJJA 5A5WA 5EKYA 3R2GA 1XDLA 1ZFJA 3N2MA 1FXQA 4ZMGA 2V82A 3LXAA 3PWAA 4NQ1A 1H1ZA 3AO0A 2Z2UA 3ZWSA 3QQ0A 5C55A 1VRDA 4MY9A 5DXXA 3HG4A 1XBYA 4W9TA 3LXCA 2UV8G 5LGZA 4K37A 5GVJA 3PSWA 3TXZA 4LVDA 2BXVA 3IGSA 4LV9A 3IIXA 1QPNA 3M5VA 1KM0A 4Z0JA 2GQAA 3W83A 2Y7FA 4DEFA 4LV4A 1FWWA 3KVLA 3GXNA 1ZHAA 5FF3A 1J2WA 3GK0A 3LERA 1KFCA 2FPYA 3W2JA 2W6RA 3W7LA 4UTHA 1H7PA 1QMLA 1L6SA 3BO9A 4JTHA 4UTTC 4DBDA 1F74A 1EPXA 5C2XA 1OX5A 3SGZA 3LBMA 2I9EA 2CZDA 4JTSA 4UFIA 4WOZA 4Z1CA 4UFLA 4LVAA 1DOSA 4LS0A 1JCXA 4AB4A 5D2XA 1KFLA 2JGQA 3BW3A 1KA9F 1K7FA 4JYFA 5AN7A 3JR2A 4MFDA 4FNQA 4WZHA 2V8ZA 4BWLC 3UWVA 1SFLA 3HGRA 1KLZA 3W71A 1PS9A 3S5OA 4BFAA 2ZZ5A 2YGYA 2VFEA 3N9RA 4A29A 2VFHA 2QF7A 4E2BA 4NNBA 5CPLA 4NX5A 5HQEA 4JTTA 3L5LA 1ZENA 4UMAA 1Q3NA 1C9DA 6TIMA 4MZ1A 3VNDA 5K9DA 3LHWA 3UWZA 4RXGA 3TK7A 1KM1A 2OT1A 2Q8ZA 2ZYFA 1IF2A 3P67A 4PEKA 2QAPA 4CLMA 4BI7A 3OEXA 1ZAJA 3EX3A 3NVTA 4S2CA 4LRTA 1TRIA 4UNKA 1FCBA 4HKPA 4Y96A 2E1DA 2RKXA 1OF6A 4IXHA 3O16A 4AH7A 2B7OA 5A8GA 4AWUA 5KITA 1W54A 3LCGA 1ME9A 1D3GA 3E0IA 5AHNA 2ZZ1A 1BKSA 4XKYA 1LOSA 5CZTA 3R13A 3NPVA 1VHNA 3M5YA 2VKZG 1VHCA 3O6YX 3RLVA 1W5QA 1J5TA 4JIPA 2ATMA 2ZTKA 1G7UA 1KFBA 4ZVJA 3H55A 4GUHA 4NZFA 2YFOA 3NQDA 3PB2A 4AF0A 4MVAA 1TSIA 1TCDA 1N8FA 1OYAA 1ZY9A 3L68A 5K4ZA 1I2PA 3QW4B 2DZWA 1Z44A 3HQ1A 1LZOA 3L67A 3W1RA 1TPH1 3PS7A 4IJBA 1EEPA 3GKFA 2J9ZA 2NWSA 1H7OA 1JUKA 3TC7A 2I14A 4XBSA 4NJHA 3TUUA 2PRLA 3GNDA 1SZGA 4A2SA 1ONRA 3EWZA 1JULA 3OVQA 1FWSA 4C1KA 3L0GA 2ISVA 4RLIA 1NVMA 4K39A 5FF2A 1QNVA 1JJKA 3MI3A 2CZFA 3RFAA 4YCPA 4MYAA 3NPXA 2VC6A 4EWND 4BR1A 4M6VA 1RZMA 4H4IA 1JCLA 1NF0A 3IIOA 2PURA 3IGUA 2V81A 3ABSA 1P1XA 3LTYA 4JX4A 5DY2A 3GIYA 3DBPA 1S3HA 2E5DA 2ZFAA 2Q8LA 4IX0A 5G1YA 4AWTA 3SI9A 1TTPA 1RQEA 5EY5A 1AK5A 8TIMA 1LYXA 3TU9A 1NEYA 1SO6A 2E68A 4UTIA 1TPEA 2OT0A 1QWGA 1NF7A 3HPZA 4RX0A 2Y88A 5TQLA 3SW6A 3MHFA 3STFA 1T8XA 2NUYA 3FIGA 4ZQNA 3UD6A 1OX4B 3L0KA 1FUYA 2BLEA 3W84A 4IOTA 1SO5A 3W1QA 4CNPA 2DZVA 3RMJA 4HHPA 1PVNA 5AC8A 4MZYA 1S5WA 3QJAA 1HG3A 4FNRA 5AC7A 3BW4A 3EWUA 3W1TA 4CCEA 4FNUA 3UXDA 4ML9A 1PHQA 5KMYA 1VC4A 2WV8A 2OZ0A 1W5NA 4M6QA 3O06A 4O4WA 5F4XA 1XC4A 1SU5A 3KVKA 1GVOA 2VOMA 4I9AA 4I7UA 1DQWA 3VI2A 1TV8A 4EF9A 1GEQA 4Q4KA 2DU2A 3CC1A 1TJPA 3A5VA 3TAOA 3LCXA 3UZJA 3UZ5A 3GR8A 4JXCA 2FFCA 4O4VA 5FF4A 1JCJA 3KX6A 1PIIA 1W5MA 3NXFA 2HMCA 2BWGA 3EX4A 3EKLA 1HO1A 4UFMA 3G1FA 4UMCA 2ZDRA 4LRSA 1DHPA 3EXTA 5I3FA 2QDHA 1ME8A 3C6CA 1UASA 4GNJA 7TIMA 1K8XA 1F76A 1HO4A 2ZCGA 4GJ1A 5D2WA 1GT8A 3MP4A 3K30A 3SFKA 1GTEA 2A21A 1JQXA 3HPXA 3W2KA 2B7NA 4O11A 2YYTA 3T78A 4HSNA 2DZUA 2CU0A 2PC4A 3ELFA 4OE7A 3P61A 5G2IA 2E5CA 3SR7A 3A24A 4RZ5A 1W37A 2E09A 1M7PA 1H50A 3C56A 4LS2A 2XFWA 1P0KA 2Q3RA 4UMBA 2PRHA 4O1DA 1I8JA 2C13A 1YXYA 1PHWA 3RNDA 5D37A 3E96A 5TIMA 3LGEA 4POCA 1KTCA 4QAIA 3CPRA 3DH7A 3ATZA 4MLRA 1R30A 5IBXA 5LHEA 1ZJIA 4MZ8A 1LTDA 1SR9A 3DAQA 3TXVA 2FLIA 4Z08A 3UWYA 2GOUA 1VGAA 3MMTA 3QMRA 3STEA 1TREA 2GVJA 5FI8A 3BK0A 3GVGA 5HUOA 3SY5A 1H51A 3NPWA 3Q94A 3CB8A 1K02A 2V5LA 2ZTJA 2GUUA 1EUAA 1OX6A 1CX9A 4JYDA 1FX6A 3WK3A 1G4EA 1TTJA 5CSSA 1LOQA 3IGXA 1TPUA 4GFSA 3G8EA 3OG3A 3KRZA 1X1OA 1M5WA 1GYNA 4IPJA 2YFNA 1N55A 1OFEA 2V5BA 1XBXA 2QJGA 4DF0A 4AVFA 2QCMA 4UUIA 1LRQA 2I1OA 4QM1A 3S1XA 3UPWA 1JRCA 2ZRUA 4ICNA 3I7QA 2C1HA 3QMSA 4CCCA 1EIXA 4ZQCA 1RD5A 4WJEA 3QEZA 4I7VA 4MOZA 1Q6RA 2NV2A 4LVFA 1FWNA 3I7RA 4N4QA 5CPMA 3IIZA 1O60A 1LORA 1W5OA 2V30A 3C3NA 1BWLA 3BG5A 4XUGA 1KTBA 4O53A 5HNRA 3NZ1A 3TC6A 2HSAA 3ABOA 4I7WA 3LHVA 3NR0A 3E9AA 2CLHA 5LGXA 1VLWA 4D2JA 2HTMA 1NFBA 1ICSA 3Q58A 2JKAA 1VH7A 4JY8A 3BLIA 3W6YA 1W8SA 1AW2A 1W0MA 2QEZA 2RHGA 1HTIA 2PCQA 1A5AA 1R2RA 3NL2A 3Q2DA 4OHQA 4O13A 4DO5A 3IVSA 4N02A 3GX9A 3LCIA 4WQ6A 4FNPA 1KM4A 3DHDA 5C6MA 2TYSA 3N34A 4N9BA 2BSLA 4QSHA 2XN1A 4JEQA 4TO8A 1UUOA 2ISSA 2Y7EA 2ZA1A 4M7TA 4EF8A 3FS2A 3VCRA 5BRBA 2WNZA 1TYGA 1JCNA 5DCDA 3O05A 1OX4A 2Z6JA 4DO4A 3GR7A 3AJXA 5KZEA 4JIQA 3QPZA 5DELA 4A3UA 5E0KA 1SPQA 1F5ZA 3HBLA 4JY9A 3W73A 2DZTA 4E0CA 1SW0A 2FB3A 4S2BA 5D02A 1B4KA 1H7WA 4RZ6A 1H60A 2Z6IA 1HFBA 1B4EA 3EWYA 4UTWC 3DENA 3W2LA 4ADUA 3PUOA 5TBOA 3DFPA 3W3OA 1W1ZA 3E12A 5HUPA 4PCFA 1SFJA 1JRBA 1VCGA 3CQ0A 3W75A 2NZLA 3INPA 1TV5A 2W0UA 5K9CA 4Q33A 3RF9A 2H8ZA 5HWNA 2JGYA 1V7YA 2Y62A 3ZR4A 3TDFA 2WO5A 1H62A 5FESA 1T0OA 3HIJA 1GQNA 2A1YA 3GZ3A 2FDSA 3NYZA 2RDTA 3W86A 3MI6A 5BNKA 3IV3A 3GAYA 4K6AA 5H91A 5AC6A 2WNQA 3E49A 4WUIA 1K03A 1QPQA 3GDRA 2EPHA 3W87A 3W1XA 4LC8A 2YYUA 3TQKA 3NNTA 1WBHA 3B0VC 3IIVA 4DXVA 1VCFA 3NDOA 1XBVA 4PFMA 4UXDA 1QDSA 1GVRA 1T99A 4HT3A 3MWAA 1S5VA 2ABAA 2GQ9A 1YPIA 4O1AA 4NJGA 4LTSA 1FXPA 4GXMA 4K8HA 4DPQA 2RDUA 1UUMA 3DI0A 2LLEA 3C2VA 1XDMA 4JTIA 4MPQA 3OVRA 1L6YA 1FWTA 1EX5A 4NJKA 4HNNA 1TPFA 2YPIA 2Y61A 3N2XA 4JTFA 4JX5A 2TRSA 2NV1A 5DBUA 3F4WA 1SSDA 3LCWA 4OGZA 1GZGA 4O16A 3T7VA 4E2DA 1SZEA 2GVLA 5C54A 1UB3A 3NGJA 5DXYA 1O4UA 2QKFA 3NL5A 4OV4A 1KBIA 2C3ZA 3KHJA 4XZ9A 1QFEA 3W1NA 3I6RA 1B3OA 1LBLA 2NXGA 1IIGA 4QNEA 4EVZA 3NQEA 4TR9A 4JTLA 5DCEA 4IMFA 4KFNA 3MHUA 4IQLA 3A5FA 2YW3A 4NU7A 1MEHA 5D32A 4WY0B 3FJ6A 1XM3A 3ZS4A 5AYYA 2C6QA 2CZ5A 3BW2A 3WJYA 3RU6A 2XN2A 1OABA 3DU0A 1Z48A 3P8IA 1TQXA 1WBJA 2QCNA 2QCLA 4GC4A 2RH9A 4UR8A 1PE1A 4HPXA 1JR1A 3W7NA 2QCGA 3TW6A 5BMXA 5LNRA 3M43A 4AAJA 1SO4A 5E1QA 2Y6ZA 4OV9A 3QYQA 5EL1A 1FDZA 2H8XA 3LOTA 3TMQA 3WJXA 3M7WA 3NZRA 1OFOA 3TSMA 3EWXA 3C2OA 2NX3A 1EUNA 2QCDA 3GLCA 3B05A 4WXYA 3TA6A 3W7HA 4MFEA 1S5TA 3EX2A 1O95A 1QR7A 2PRMA 5CPOA 3QW3A 5ABTA 3IVUA 3TX9A 1RVGA 4ORMA 1OFPA 5CPNA 5FEWA 1NAL1 1YDVA 3QH2A 5DY3A 2WSQA 5D09A 4ORIA 5EA9A 3TQ0A 1EB3A 5AHIA 4PA8A 3G3MA 2A2IA 2VFFA 3MHGA 2X1RA 4M6PA 4O8RA 4UFKA 3KRSA 3ATYA 3JRKA 4FF7A 3GB6A 4ZQMA 1TTIA 3NQ2A 1W5PA 4O1BA 4N2YA 2A4AA 3S1VA 5KZMA 1TRDA 5D03A 2J6XA 3D0CA 5HULA 2YDAA 1XI3A 3LLDA 1FCVA 4RCXA 1WV2A 2QAFA 5D33A 2FTPA 4ZL1A 3UNDA 1GTHA 1TIMA 1J4EA 4HIBA 4U28A 1ZNNA 3LHYA 4DF2A 3M16A 4KWWA 3W1AA 3RK8A 1ML1A 2ZRZA 1I2QA 3NQMA 5KTLA 4KFPA 5IM51 1SZNA 4PC8A 3O8AA 5HWMA 2CLFA 4UR7A 4O52A 3CT7A 4FNTA 3W1LA 3UWQA 1DBTA 1KM3A 5FEZA 2J9YA 3LHZA 3CEPA 2X1TA 4YXGA 2OJPA 3W72A 3W85A 5I3GA 1JCYA 1KLYA 4K38A 4MJMA 4XTIA 5C5YA 1AL8A 4X2RA 3S5YA 3W22A 1FCQA 3W88A 1IGSA 4JTUA 1X6UA 2ZZ6A 4NVTA 3FYOA 5I3JA 1X1ZA 3B06A 3CEUA 5T26A 3NQFA 3TFXA 3HPSA 1OFRA 1BTMA 3S42A 3GYEA 1JCMP 2O7QA 1QPOA 2ISWA 1D9EA 2QDGA 3W7EA 3TNOA 2EGZA 3G24A 3LV5A 1GOXA 2QJHA 3PF3A 1YTDA 4LC6A 1AMKA 1F05A 3DXIA 4CCDA 5F2MA 3YPIA 3THQA 5F4WA 1I2NA 3L9CA 1WYIA 3TR2A 3MO7A 3IEBA 3HO8A 3DFTA 2NX1A 3OIXA 4AMAA 2IQTA 3F4NA 3M0ZA 2DZXA 4LY8A 1VLIA 4UTLA 1LLWA 2WSRA 3BG9A 2A6LA 3NL3A 3QQ1A 3TMLA 4RK8A 5KZDA 3A22A 1MSSA 1L9WA 3M9YA 3WK1A 2VELA 3HG3A 3LRMA 3T40A 1VYPX 2W79A 5LNVA 4O54A 3OBKA 1GWJA 2QR6A 3BLEA 1LBMA 3QSTA 4R7JA 1F6PA 1XKYA 2D73A 3W76A 1K8YA 1H5YA 1X7FA 3G0UA 5AHFA 4GWEA 3W70A 3PULA 2ZA2A 4IPIA 3LCLA 1VS1A 3UYCA 4O1CA 4MY8A 1LDCA 3NG3A 5LZLA 3UY8A 1QOQA 2E6DA 1H63A 2WSYA 3BGJA 3PG8A 4LNYA 2QUUA 5G2WA 4IWWA 4DQWA 2ATSA 5CZSA 4RXFA 1D3HA 1PL9A 4JICA 1IXNA 4ZQOA 2RDWA 3CWNA 3P62A 2A7PA 2QUTA 3B0PA 1OJXA 3TW7A 4RJEA 1QCWA 4RKAA 3EWWA 2QCFA 1OFDA 3W7MA 4AXKA 3A23A 5LHFA 2R91A 4IMEA 3L66A 3PBVA 4UTJA 1YXCA 2G95A 4FEZA 4YL2A 3QMTA 3P5YA 5K3VA 3FJLA 5J5DA 3R8RA 1AL7A 3LLFA 3BVJA 4Z1BA 3TIMA 4EIVA 4WY0A 3LX9A 4NXKA 1Z42A 4RZ4A 1TO3A 5FEPA 4LUIA 1AG1O 3MBFA 3NQVA 3DHFA 4N6EA 4LS1A 1QOPA 1YDOA 2FB2A 4JTEA 4UTKA 3BV4A 4O18A 1H1YA 2E6FA 3W1MA 2V0TA 3FKRA 4GRSA 2YXGA 3OA3A 4DPPA 1ICPA 4TMCA 1THFD 1ZAIA 4BWLA 4GUJA 3LXBA 3HMJG 1SW3A 2WNNA 3QRHA 1HL2A 3DFOA 1WX0A 1YYAA 3GXTA 3QM3A 4JDBA 4A22A 2DZPA 3TV8A 4MUZA 4QQ3A 3HG5A 1PCKA 2P0OA 2VXNA 3F1QA 1P0NA 3L5AA 3ZWTA 2YW4A 3LI0A 3PC0A 1DVJA 1WDWA 1FDJA 2YCEA 4FXRA 3VKJA 2CLIA 4E38A 5J5RA 3VE7A 3W7GA 5FF7A 4NXSA 2P1FA 1TPDA 3EEGA 2G96A 4H6KA 3TROA 1TJRA 2CLMA 1HUVA 2OX1A 1LRNA 4NZJA 4N9EA 3C0JA 3G0XA 4ALDA 1G4TA 1OVDA 5D04C 1WQ5A 4P2VA 4UCGA 2XN0A 2VEIA 3L65A 2GJNA 2B7PA 4LVBA 5G4EA 4MY1A 2BX7A 1BEUA 2JKEA 1G4PA 3M41A 3MI2A 4M19A 5L6UA 1B9BA 3GDTA 1X8FA 4FO4A 4MYXA 3KVJA 4X3ZA 5D05A 1DL3A 1EP1A 5U7SA 2ZQ0A 3WJZA 2NWRA 2CW6A 4N9CA 4UIOA 1FWRA 1RR2A 3WJSA 4R33A 3EWBX 3I7SA 1JQVA 4KFOA 3O6CA 1KW1A 4AHOA 2A6NA 3L0NA 3DZ1A 3PUDA 1LCOA 4YLWA 1KM6A 4MLJA 3UXAA 3PBYA 3DFNA 2C14A 3LBCA 4QNWA 5KINA 5D30A 5U4NA 4FB7A 2OMAA 1U83A 5EYWA 1TMHA 1ADOA 3PB0A 1VJIA 1KTNA 4WD0A 3C2RA 1LM1A 1TPC1 3LV6A 1TTQA 3BLFA 5HINA 2YR1A 3GDKA 3FLUA 4HNTA 4IMGA 1VYSX 2Y85A 1R2TA 1G67A 1SQ7A 3OVPA 1ZALA 3FA5A 2QCCA 1R47A 3CIXA 3JS3A 4NNAA 1IIHA 5F2GA 5D2VA 4JR5A 1IXPA 1FQ0A 3L5MA 4JTJA 3NQ7A 5LNUA 4GUFA 1SW7A 1IXQA 5HMSA 5G4WA 4FIQA 1XBZA 2Y7GA 3B04A 2H90A 3NQ6A 2PE4A 1Z41A 5LNWA 1XFBA 2VENA 3LHTA 3MW7A 4Q32A 4YCOA 3SZ8A 5DN1A 1KFEA 4FIRA 4AEOA 3G3DA 1UCWA 2A85A 5F4SA 3QPYA 3W9ZA 1FBAA 3GKAA 3V1PA 3MYOA 2V2CA 4MJZA 2J24A 2G97A 3T4CA 1W3TA 3A9IA 4UFHA 2X1UA 2AQWA 2HS6A 3IRDA 3NQCA 2ZA3A 2E5BA 2F84A 3USBA 4IX2A 4ONVA 3HGJA 3QFEA 1LROA 5AYXA 1EWDA 2Q3OA 3L21A 4LWWA 1EWEA 3EB2A 4O0ZA 4Y6GA 3PY2A 2WOQA 2Y63A 4X9SA 1K8ZA 1U5JA 1OFQA 1GG1A 1M6JA 1PV8A 1FDYA 4O17A 1K3UA 5F2LA 2DORA 4YMZA 3UWWA 3M6YA 3P74A 3W2NA 1RQHA 1K7EA 4K8EA 5I3IA 4XWUA 1OHLA 3NL6A 2ZRVA 2CLEA 2H3BA 5HR6A 4OWGA 4EOUA 4TIMA 3U8GA 5G1TA 1LOLA 4FXSA 3TQVA 5CG7A 3G1XA 4JTGA 1GG0A 3CWOX 5IBXC 3PUEA 3C52A 5K4XA 4WXZA 5MHBA 5D2YA 2FIQA 5K2ZA 3P82A 2R94A 1YTKA 4UTUA 2A7RA 3W7KA 1XL9A 3NA8A 5KSWA 4PH6A 5F2IA 4Z0SA 1VPXA 3P81A 3NM3A 4FX8A 3KRUA 3TAKA 4OQVA 4BI5A 3MBDA 4UC5A 1YTEA 2JKPA 2X16A 3MP3A 3N14A 4UFJA 1I2OA 1QO2A 1G69A 3MP5A 5K9XA 2GPTA 3NO5A 1W3IA 3S5ZA 3O07A 1MEWA 3KFTA 1O5XA 3EXSA 4ADSA 1P5BA 3U2OA 4QISA 5EBUA 5HR7A 2F7FA 2EAWA 4PL2A 2A7NA 4PL1A 3EKZA 1RPXA 5SWUA 4JD4A 3B0UX 4IGHA 3EX1A 1QPRA 2NXHA 3NQGA 5LSMA 3GXPA 3TKFA 3DFQA 2KZHA 3P7YA 1OYCA 3NPUA 2DP3A 2EHHA 2X1SA 1ZCOA 1DJNA 5CSRA 2JBMA 2ZRXA 2H6RA 3G1SA 3L2IA 1A5CA 3HF3A 1MO0A 2O7SA 4O50A 4MKNA 3UPBA 5G5IA 3TH6A 1FY6A 2C16A 3HOJA 2ZZ7A 1E51A 1H7RA 3FOKA 3KXQA 1M7OA 3CU2A 1LRTA 1Q6OA 1RQBA 3PVFA 1A53A 4JS3A 2R14A 2ZRWA 3G0SA 2GVGA 3PSVA 4WOQA 5F1VA 3E02A 4RV8A 4A2RA 3H53A 4S1FA 5DLCA 3BARA 1KV8A 1B57A 2ZZ3A 2A5HA 4O12A 5I3HA 3STGA 3O6DA 2TPSA 1Q6LA 3MJYA 3G22A 3MUXA 2CWNA 3QC3A 3TE9A 1PCWA 1WOBA 2VFDA 2JK2A 4HN4A 3PM6A 3O15A 3P80A 1SUXA 1C8VA 3S8HA 6ALDA 3LTSA 3PBUA 1JUBA 2QCHA 1WOAA 5AHMA 3O63A 4DELA 3MYPA 3O1NA 2QJIA 4M5PA 3THAA 1WAUA 4NUWA 2DJLA 2NUWA 1F7BA 4HNUA 3SECA 3V75A 2EKCA 4TMBA 3M5XA 3SJ3A 3LDVA 3LCFA 5E93A 3GNNA 1GPWA 4LUJA 2YX0A 4JN6A 4A21A 2YZRA 3WK2A 1DORA 1LLZA 3U6WA 3TJLA 4IUOA 3S6DA 3SIZA 3W7JA 1EA0A 2VEMA 3C4UA 1ALDA 1TPVA 1KFJA 2AAMA 2B4GA 4OT7A 1SO3A 1I2RA 4GUGA 1KFKA 5AHLA 3EX6A 4NJIA 4OBTA 4Z1AA 5D38A 3IIPA 3ANYA 2Y70A 1MXSA 4L4LA 4O14A 2ZZ4A 3H54A 4XBKA 2GQ8A 2C19A 3LB0A 1L6WA 4GBUA 5FEXA 5LNSA 2ZBTA 1H61A 2Z0IA 1G6CA 3B4UA 1BWKA 1YADA 1VCVA 4XQ6A 4LVGA 2ALDA 1P4CA 3N9SA 4HSOA 4IMCA 2J88A 3W7IA 2QCEA 5CGQA 2WKJA 2QUVA 3IVTA 1UBSA 4NNCA 1XUZA 1R2SA
chains in the Genus database with same CATH superfamily
1EJTC 1P7TA 4ZBCA 1CIUA 3T55A 4N6FA 4RE4A 3CZGA 1DE6A 3W7RA 4EXAA 4KRUA 4KEZA 1S39A 3A6OA 4DO6A 3H2CA 4Q4QA 4QAWA 3T09A 5BW6A 3DG6A 1V51A 5JBFA 4TVDA 1S2VA 5HNUA 1T7LA 1A5LC 1VZWA 1DJQA 1A5SA 3CWHA 3FJNA 3OVGA 3F2DA 4WY0F 2J79A 4FA3A 4R34A 2QHAA 1OD8A 1KCXA 3G1HA 5EMJA 1DIEA 3VGGA 2ADAA 2WK2A 4PODA 3PR2A 2H9AA 1OT1A 4IM4A 3WH5A 4GZEA 3B8IA 3W7CA 9XIMA 3VDCA 1AQFA 1XUUA 4XAGA 5BXTA 2PZ0A 2VEPA 1MZHA 1TUXA 3ORWA 3QV8A 4IHCA 1TV7A 1DKWA 3W53A 1PDZA 1M1BA 3FYYA 3DFYA 3QTPA 3S5NA 3DI1A 1YPFA 4GE8A 3IJ6A 1JEZA 3BWWA 1E73M 4P7RA 1NWUA 4MTVA 1H1NA 4K68A 3VNJA 1A3XA 4U4MA 2XZ9A 3MSDA 2EF9A 5AOUA 4PYSA 1RALA 2VC9A 4XTDA 3M47A 1PZ3A 1I4NA 3ZFHA 2C15A 1A5MC 4TQTA 1H7NA 3MSGA 4R7OA 1W3KA 1WKYA 2FPTA 3LM3A 4IMDA 5HJLA 1AFSA 2ZVIA 3P84A 2CLLA 1BWVA 1NU5A 1RV8A 1GYLA 1UP0A 5IFTA 3ID7A 4DUXA 3LGGA 4Y9NA 1W32A 1JDFA 1ITUA 4X22A 4NX0A 4O0KA 3NM1A 2X1IA 3WK0A 2YLAA 2DSUA 2JEPA 3N2CA 2TMDA 4H9MA 3LRLA 4QX4A 3M5ZA 1Q66A 2FPVA 3W07A 1V0NA 1W3NA 3V0UA 3MV11 2QCDB 4JTKA 4O28A 1TQJA 4L1XA 4PUDA 1BKHA 1H7XA 3V7PA 5EMUA 1C7TA 2GJLA 2J8FA 3QR0A 4AHPA 3WQ8A 3IANA 1TUFA 2YL5A 4QEEA 1HGYA 2CLOA 3HQPA 1NY1A 3QR3A 4AF0B 4C1NA 1GJPA 1TV4A 1PPIA 1XXXA 3PTMA 1LUCA 4V1YA 3IJ8A 4C1LA 3B8DA 3DYOA 1UQYA 3CPGA 4O57A 4A8NA 1XLKA 2XFYA 1TVPA 2PTYA 4MG4A 1V77A 4QFUA 3C61A 1RUSA 2CLKA 1T5AA 2NLYA 1AH4A 1O1HA 3NIYA 1A5KC 5BOOA 5DCBA 3VX1A 1G7VA 1MQQA 4REQA 1EC7A 4N9DA 2Z26A 4ADTA 2RFGA 3H7UA 3VD3A 3WH9A 1UKPA 4KF1A 1A3WA 3CAVA 4MIMA 4H9YA 3SY8A 1J0ZA 2V6AA 1BXCA 1AJZA 1I45A 1RLCL 1F73A 4GINA 5CBBA 1Q2SA 1K9FA 3BLKA 3C2FA 3NOEA 3WJWA 4XAYA 4U31A 3POHA 4BK9A 4QG6A 4IIBA 1ZAHA 3EZ4A 4GGHA 4PBFA 1GVFA 3VOIA 2EPNA 3QZEA 4QIUA 2EPLX 4JOMA 2F38A 3B03A 1Y0EA 3SCQA 1LP6A 3CBWA 3W37A 3UYIA 4ZB0A 4B3ZA 2V69A 3I65A 2WMGA 1A5NC 4Q22A 3WFAA 1ZTVA 2FZMA 2PCEA 5E0CA 5H2ZA 4MUPA 4IQEA 3R2GA 3N2MA 1BFNA 3LXAA 3PWAA 4IH3A 3ZWSA 2Z2UA 1R3WA 3GSMA 3QQ0A 4MY9A 4ZXOA 2DVXA 4W9TA 1DXIA 1QI3A 1FWDC 2UV8G 2GK1A 3TXZA 4LVDA 1Q6CA 5BRQA 4YYFA 4K8GA 4QE4A 3QLDA 4LV9A 1KM0A 3R8HA 1DJGA 3W83A 4GA8A 3TJIA 1UD5A 5JH2A 1XICA 5AYIA 3GK0A 5CJNA 2FPYA 3W2JA 1QMLA 2PWFA 1A3HA 3AU6A 4JTHA 4DBDA 1TWSA 4OOZA 3WH6A 1EPXA 3PZMA 2PS2A 4K2SA 4UFIA 3PFMA 4UFLA 4LVAA 2PGRA 4JTQA 1XINA 3PJWA 1JCXA 4AB4A 1KFLA 4YTQA 3WYZA 3SUVA 3BW3A 4Y9PA 1X1NA 3JR2A 5CJ5A 1H3GA 3GU2A 1KBLA 3N6QA 1A49A 3LENA 3T42A 1DHKA 2YGYA 4B16A 3B9NA 3VZXA 4A29A 3RCMA 3G6MA 2VZOA 3AHTA 1DQUA 4J7RA 1UWQA 4J2PA 1H0GA 2XINA 1W1PA 1NJJA 2PC8A 4LSBA 1VJZA 4QS5A 5J8LA 1KM1A 5I6SA 1QVBA 4MJ2A 2OYKA 1KGUA 2OPJA 3OEXA 4BI7A 5IHSA 3EX3A 1XH1A 3RGTA 4S2CA 4U2YA 2PPGA 3CUXA 3W25A 1TRIA 4UNKA 2CBIA 2ZOXA 4Y96A 2RKXA 4AH7A 1FFRA 1NIUA 5A8GA 2OO0A 2OODA 2W4XA 1KO0A 4M81A 2WAGA 3VGDA 1D3GA 5AHNA 4NRSA 1JZ8A 4JCMA 1GGOA 1VHNA 1VF8A 4QLLA 3GZAA 1VHCA 2QPSA 1UR2A 2GOKA 3RLVA 4JIPA 1J5TA 3TTEA 2Q8XA 4JKLA 3B97A 4ZVJA 4GUHA 4ZTXA 4US5D 3GC2A 1BD0A 1P0DA 4DJED 1N8FA 2HWGA 2DZWA 4I9JA 3HQ1A 1TPH1 2DDXA 1H7OA 1JUKA 2ZX7A 2EJ1A 1EOKA 1JULA 3L0GA 3HFYA 2ISVA 2MANA 5FF2A 5JBEA 3MI3A 3RXZA 2R1LA 4YCPA 4BF7A 2GVEA 3AIVA 4IL2A 4LALA 1SR0A 4I9MA 4M6VA 2XHYA 1SVDA 3WN6A 2FGBA 1GEHA 3GIYA 1VD6A 4AWTA 2PF0A 5G1YA 5TD4A 4KEUA 3AYRA 3RR4A 3UETA 2GWGA 4NI8A 3XIMA 1TPEA 4D6HA 1QWGA 1VFHA 3VDHA 3EOEA 2HBVA 3GG1A 4AIEA 4FZIA 3CUHA 4NG3A 2JF7A 1ISVA 2WHKA 3STFA 2J8GA 4JIEA 3UD6A 4WGXA 4XZHA 4ZQNA 4Z2IA 3WMSA 3BC9A 5E70A 3ZLGA 1FUYA 1CGVA 2PDBA 2BLEA 3W84A 4IOTA 2VVNA 1OINA 1PVNA 4CQCA 4MZYA 1S5WA 4JTRA 2VC7A 3OA5A 1IR1A 4FNRA 5AC7A 3BW4A 3KE0A 3EWUA 3VMOA 2GGJA 4ES4A 1FTXA 3UXDA 1S3TC 5ECUA 4QHRA 5KMYA 1CB7B 3BOLA 1O5RA 2XIJA 5F4XA 3ECQA 1DWIM 2XZ7A 4XIAA 3VXGA 1NFPA 4H7ZA 2HEJA 1E56A 3UF9A 2VOMA 3KS5A 1DQWA 1TA3B 1ZRQA 2PDFA 1GEQA 3UZ5A 3CC1A 1FRBA 2QNEA 1EJXC 3KX6A 2WZEA 1HKWA 1PIIA 4GQGA 1W5MA 2HMCA 4JTAA 2E8YA 4UFMA 5I3FA 4S39A 3VKKA 4S38A 1UASA 2O9PA 2EPMX 2ZCGA 3HMCA 4CN1A 5D2WA 1GT8A 2IKJA 2CETA 1K9EA 3SFKA 3VGEA 3H24A 1JQXA 3HPXA 1DXFA 2B7NA 4O11A 1JZ5A 4JFUA 2DZUA 4F0KA 5G2IA 1JYWA 1BPLB 1ZU8A 2AAAA 1QATA 2E09A 4HZ8A 3M6DA 1LT8A 1OB0A 4E2VA 1VFSA 2XFWA 2ZX6A 3H2EA 1MUWA 1YXYA 4AQLA 5D37A 3A47A 3E96A 1TX2A 4LAKA 4POCA 3VINA 3I4KA 1HGWA 1NQ6A 4QE5A 2D2OA 3CQHA 3SN0A 5IBXA 3SRFA 1TE1A 4MZ8A 1IEIA 2VCCA 1LTDA 3G77A 1SR9A 3WQDA 4J5NA 3MMTA 3BAWA 3QMRA 1DJWA 2VJXA 5DT7A 4F2BA 3SY5A 2E8ZA 3MMDA 1HN1A 1CX9A 4JYDA 4RDVA 1UD4A 3AIBA 5CSSA 2X7WA 4OTKA 2QDDA 2V5BA 2VDGA 2QJGA 2WM0A 3S1XA 5BYWA 1JFHA 1DPMA 4ICNA 4RZBA 4ZSTA 3QGVA 3LLXA 4NIRA 4KPLA 1VBGA 3T1GA 1QPKA 3T81A 3WNKA 2CHOA 4J2MA 2YCLB 4KMQA 4I7VA 1DYSA 4WJEA 1Q6RA 2Z1VA 3AWOA 1J12A 2Q6ZA 3ZT6A 6PTDA 4N4QA 4LB3A 1IT0A 2DV0A 1P0EA 2V30A 4Q8WA 4KEVA 3BG5A 2X0SA 3NZ1A 1FH8A 2W5FA 3CMFA 2G3IA 4FLOA 1U1UA 1VLWA 1LL7A 4QJ3B 3K8MA 1NFBA 3MSYA 1VH7A 4JY8A 4DXXA 2GFTA 1YNYA 2DH2A 2QQ6A 1KWKA 3OHMB 3ITGA 3VOGA 2DIJA 3RU8X 1W0MA 4DM1A 4IP4A 3W02A 4QG8A 5CXPA 4I5UA 1A5AA 3KOWA 2FHFA 1WDRA 4FNPA 4AD3A 2TYSA 3FV9A 5DT5A 4N9BA 2A3BA 4M7TA 3WG6A 4P8UA 4XV0A 1M03A 5A8OA 3A4AA 5DCDA 1CXFA 4AFYA 2O4QA 4DO4A 2WCSA 5KZEA 3T9PA 3CB3A 1M7XA 5BU9A 3AC0A 5FJOA 2DZTA 2Z25A 4A3RA 2FB3A 4HOXA 4RZ6A 4Z2HA 1HFBA 2INEA 2HDJA 3GIPA 4RNHA 1UZ4A 4ZO8A 4H9VA 3W2LA 4ADUA 1HXJA 3W3OA 3WMBA 1SFJA 3TN5A 2VR2A 1JRBA 2D0FA 3ZZ1A 5K9CA 4Q33A 2H8ZA 1US2A 2O56A 3QOMA 2J13A 4A3HA 5CSUA 4MWAB 3HIJA 2A1YA 3ALGA 3NYZA 4IL0A 2ZX9A 2RDTA 3KBSA 2E4TA 2PWUA 4WJXA 2YIHA 4PMZA 2QVNA 4ZXLA 4S3BA 3PBGA 3GDRA 5IRPA 2EPHA 3W87A 2XSAA 1XW8A 5AZ1A 3NZGA 3TQKA 1DIKA 4H2CA 1F9CA 1KGXA 1VCFA 1EC9A 1XBVA 1JAEA 3WQGA 1BQCA 4DNHA 4Q4RA 3MUIA 2HE5A 3QN3A 4PUNA 1GVRA 1ESWA 3TLQA 3AICA 5FCZA 1YPIA 2Y0FA 1EGVA 1HL8A 2P3EA 1BYAA 4LF1A 1OSEA 3PZNA 4H9TA 3ALFA 1L6YA 4XZMX 1PIGA 4JTFA 2HPIA 2NV1A 4Z2JA 2INZA 5BCAA 5TAOA 3T7VA 1I9CB 3SCSA 4J3ZA 4E2DA 2GVLA 1JZ3A 2H9AB 5DXYA 4JFVA 1NM9A 4AZCB 1Q63A 1KBIA 4OV4A 3LZ3A 4JFWA 4D72A 4C91A 1QFEA 1XKJA 1XYMA 1QXLA 4YVXA 1PKYA 2BHZA 4QNEA 1KQZA 4IMFA 4ZTYA 2DT3A 4Z42C 1XM3A 4HYRA 3F4CA 5AYYA 3TN6A 3AU2A 2CBJA 3TYUA 3K4AA 1SM9A 2PDXA 1OABA 2BODX 2W62A 1HJVA 5E09A 3ONCA 1N8WA 1F4HA 1EJWC 1JDCA 2DSWA 4HPXA 2QCGA 3TW6A 2Z24A 2Y6ZA 1GW9A 1C3FA 1FDZA 3LOTA 3TMQA 3KZPA 3D5HA 3EWXA 3CQIA 1S5NA 4AZIA 1UP2A 4WXYA 4HPNA 5DEZA 3TA6A 2NSOA 7TAAA 1QR7A 3IAPA 3BAIA 3WBWA 4HA3A 4QP0A 3QW3A 4U5KA 4DUOA 3ITTA 3WF0A 5ABTA 3CUZA 3ZR6A 4ORMA 4P7QA 2AMXA 5D09A 1TZ7A 5EA9A 5I23A 1EB3A 2YB4A 2VFFA 4A4AA 2FH8A 2X1RA 4Q7BA 4O8RA 4P7NA 4UFKA 4ZGYA 1UD6A 1XJBA 3CMJA 2BDQA 4MHBA 3V16A 2VI0A 3UZZA 3E74A 3E3HA 2R1MA 4O1BA 4N2YA 2A4AA 5D8WA 1NWRA 5D03A 4EK7A 3UEQA 1KC7A 3K5XA 2XU2A 5HULA 1JZ7A 1CENA 2IUZA 2YDAA 5BZAA 3AROA 3LLDA 3L4YA 3GD6A 1WV2A 1LWIA 4DVOA 3Q45A 4U28A 4H19A 1ZNNA 2OVLA 3LHYA 3W1AA 1ZB5A 3W4RA 3RJXA 2WWCA 3RN6A 5IM51 1SZNA 4C6EA 3MDWA 2CBUA 3UNTA 3OGSA 1KCLA 1V0LA 1LQ0A 5I03A 2CZVA 1WZAA 1E0XA 4F8XA 3T2QA 4GGBA 1QRQA 3LHZA 2YDSA 4YXGA 3W85A 4W5ZA 3NWRA 4AD2A 1S5MA 1KLYA 3OW1A 1UMLA 4XTIA 5C5YA 2ESCA 4FR6A 4XISA 4JFTA 4NVTA 4R5EA 3B06A 3NQFA 4HA1A 4QQUA 3S42A 1JCMP 1GOWA 1BYCA 2VGGA 3FEQA 2QDGA 1E9YB 4D6GA 3PZTA 1GOXA 1JXJA 1UR1A 4PUJA 1YTDA 1HJSA 1BLIA 4MB4A 1Q5MA 3DXIA 4ACYA 1CZ1A 4C6MA 1MDRA 1R8LA 1XF0A 4GY7A 1WYIA 3G2GA 3TR2A 2BHYA 3IEBA 1H41A 5GNYA 5IXEA 1U5HA 1JAKA 3DFTA 3HO8A 1K6WA 2NX1A 3OIXA 3F4NA 3JZEA 4LY8A 5LIKX 4UTLA 3BG9A 4S3CA 1XSJA 3NL3A 3TMLA 4RK8A 3WIJA 1L9WA 2DT2A 4U33A 4RW3A 3LRMA 2F2HA 1REQB 3S5SA 2W79A 3AHZA 3V35A 7CGTA 5B7YA 4O54A 1CGXA 8XIMA 3BLEA 4CNTA 3DC0A 1OG6A 6REQB 3ENLA 1F6PA 3AXKA 3BZJA 1YPXA 1K8YA 4JNZA 1X7FA 4GWEA 4RPQA 4IPIA 4MWAD 1DJIA 3SN4A 3RAOA 5LZLA 5FOOA 4KCVA 1V6WA 4LNYA 1BF6A 1C8QA 3B8SA 2O0TA 3KW3A 3WF1A 3VIFA 4ZQOA 4JQ2A 2RDWA 3N2OA 3CWNA 3P62A 3IACA 1CLKA 1WP6A 1UIOA 2QCFA 3EWWA 3VMNA 1ITCA 2XM2A 3U5UA 3PZ9A 3MUY1 4UQ9A 5LHFA 3FHQA 2XGZA 4LBUA 3PBVA 4FEZA 1C7SA 3LPPA 5J04A 2E3ZA 1UWIA 3TIMA 5DRIA 3FY1A 2WQDA 2PTZA 3MBFA 3NQVA 3RRXA 1GVYA 1QOPA 2FB2A 4BEQA 2A3AA 3BV4A 4O18A 5CLWA 2OGYA 3W1MA 2V0TA 5FA5A 2PLKA 4A35A 2QGHA 3HU7A 3WBEA 1KFWA 3UA4A 1ZAIA 2YDQA 4GUJA 4DIAA 1JGIA 2HVNA 1YYAA 2WLZA 2WJEA 4HZ6A 3QM3A 4JDBA 2DZPA 4MUZA 3VNZA 2C0HA 3LYEA 3BUVA 3GNOA 4QQ3A 1PCKA 3HG5A 4AIUA 3ZWTA 1YE4A 3LEPA 3VM5A 3H7RA 1FDJA 4FXRA 4E38A 4IGMA 4AY7A 2P1FA 3EEGA 3REQA 3TROA 5JQ9A 1KRMA 3KBJA 1Z9AA 4DWSB 4NZJA 2XWEA 3C0JA 3IUDA 1OVDA 1KBKA 3GVWA 1WQ5A 1V8EA 2VEIA 3KTCA 2GJNA 2WMHA 1BEUA 5FSDC 1RBAA 1AZ2A 3UA3A 4LH8A 1EL3A 1FOBA 1G4PA 1JXKA 4IT1A 1QW9A 3WDQA 1B9BA 2J78A 3IJIA 3GDTA 4DXKA 3GQYA 4GI6A 4DAIA 1JF6A 1AD4A 3GC4A 4R27A 1BRLB 4ICMA 3R1ZA 3ZJ8A 1EP1A 4D71A 1SGJA 3HM7A 2OYLA 4UIOA 5I24A 3CH0A 4R33A 1UD2A 1Z7AA 3SY1A 3PUDA 2OYMA 3SRKA 1XLJA 5KINA 4HA4A 5D30A 3SCPA 4QS6A 3RLHA 3ARPA 2CHNA 2ZUNA 3U7BA 4ZOBA 3VIGA 3LD5A 2EKGA 3WMCA 4HNTA 1VYSX 4LQ1A 3TP4A 1E3ZA 1FWIC 1G67A 4AZGA 4O1EA 1ZALA 4AYGA 1A4LA 2G3FA 1EFZA 1RJRA 1IXPA 1JGMA 5LNUA 1SW7A 4EX4A 4YTTA 1IXQA 5G4WA 2EG7A 4FIQA 1XIJA 2NQHA 4Q32A 4AEOA 3MTWA 1O6IA 3SUUA 5F4SA 3W9ZA 2UZ9A 4CU8A 1PX4A 2V2CA 4MJZA 4GI4A 2G97A 2ODOA 3T4CA 4L5ZA 1GPFA 3IRDA 4I5XA 4ZOEA 3USBA 4IX2A 1KKOA 3WEOA 3QFEA 3KDNA 1EWDA 3EOLA 4JHMA 1L8NA 4B9ZA 2B81A 1RPKA 4X9SA 2PWEA 1K8ZA 3SO7A 4K1WA 1M6JA 3B0XA 1D7FA 4PZVA 1K3UA 3M6YA 2PDLA 1RQHA 3WD3A 3V36A 4XWUA 3NL6A 3R79A 3M4HA 4XZNX 5HR6A 3KL3A 4EOUA 3QYSA 5G1TA 3AZRA 1OEPA 1LOLA 5DMLA 5CG7A 1GG0A 1EO7A 3PUEA 5GJNA 2QYGA 3C52A 5K4XA 3DYPA 4KT2A 1QWKA 2DUAA 1E6RA 4F48A 5IFPA 5MHBA 1X6NA 2BOGX 5K2ZA 1XIIA 1ISXA 1YTKA 4UTUA 3W7KA 1JZ2A 2BY3A 1XL9A 3NA8A 5ABFA 5KSWA 5F2IA 4Z0SA 4Q7IA 2WJDA 4EP8C 3KRUA 1ZBKA 3TAKA 1QK2A 4OQVA 2RGLA 4UC5A 1YTEA 4YU1A 3MP3A 1NDWA 1QO2A 3MP5A 2WNWA 3ARRA 3NO5A 3KFTA 1XIGA 2ACUA 3U2OA 4QISA 1E6QM 1E72M 2O92A 2EAWA 6CGTA 3W28A 1RPXA 4IGNA 5SWUA 3BMVA 2V5KA 3UXIA 4GBDA 4DJFC 1R0MA 1W1VA 2DH3A 4E2OA 1DJNA 4PTDA 2JBMA 1EF3A 5LA2A 4GI9A 2H6RA 3L2IA 3TZNA 3SEPA 3MKCA 3TWBA 2O7SA 4MKNA 4L4PA 5G5IA 2VZSA 1PUDA 3BL3A 4S23A 2HZGA 5ENLA 2ZZ7A 4Q8VA 3FOKA 1GJWA 1M7OA 1CBGA 4XZWA 1RQBA 3R10A 3VC5A 2BP1A 2GVGA 4WOQA 5F1VA 4GQ0A 2XISA 4A2RA 3U2EA 1V4YA 3OIHA 4HHLA 5DLCA 1KV8A 1B57A 3ZOAA 2PLJA 4A05A 1GHRA 4J35A 3VKCA 3RHGA 5I3HA 4YHGA 2CWNA 1KGWA 2VFDA 3PM6A 3EA3A 5CC6A 2QS8A 1C93A 2DQXA 4Y9OA 1C8VA 5CC5A 1P6WA 3E0LA 3PBUA 4MB5A 3IJQA 4DJDD 3CUIA 3O63A 2PGWA 4DELA 2QJIA 3MYPA 2AL2A 3THAA 1XIHA 2J7EA 4DWSD 2DJLA 3WD0A 4M29A 2YCJA 4LNCA 4HNUA 3V75A 4TMBA 3M5XA 5CG0A 2P76A 1RA0A 3LDVA 2RJHA 3LCFA 5E93A 4H7CA 3W29A 3UZXA 2BB0A 4JN6A 3KZSA 1ADSA 3ARWA 3U6WA 4IUOA 1W1A1 1JF5A 3CL8A 3TZFA 4CGTA 1EA0A 3G6LA 3PJXA 4JTCA 2Y8KA 3WQWA 3PZVA 1SO3A 1I2RA 4GUGA 5HQLA 3R0KA 1KFKA 2SFPA 3SUSA 3WZ0E 3VK5A 1QASA 2QVHA 5I79A 4Z1AA 3FCPA 1UWUA 2IPFA 4IJRA 4KEMA 2GQ8A 3LB0A 3AIEA 3RR1A 2J7BA 2PTWA 2ZBTA 1AZ1A 2TAAA 3GC5A 1H61A 1X98A 1BWKA 2DY3A 3WLLA 1YADA 2OOFA 1ZBVA 4ZODA 4LVGA 1P4CA 3N9SA 3NUKA 3W7IA 1P43A 4QCFA 4IG2B 5M1TA 5CGQA 4QLKA 3C3UA 4NNCA 4DZHA 5CZKA 1XUZA 3VD9A 3EPNA 2XVKA 1P6CA 5EMKA 4CNOA 3TYDA 4GUIA 5JXQA 2BZNA 1WE5A 4M8UA 2ZUTA 4AHQA 4GHRA 3C8NA 1OT2A 5CZ0A 2OLHA 3PG9A 4JPGA 3U2CA 4XD3A 2A0NA 3FYPA 2VGIA 3K8LA 2ZX5A 1EO5A 1XIFA 4HPJA 2PFHA 4PUKA 3E2SA 1CECA 4H3DA 4Q8QA 1GK8A 1DWGM 3LCHA 1I60A 3TR9A 3PAJA 2NXIA 1EIBA 1UC4A 3E1F1 2TSYA 2GL5A 2FVLA 2ZUVA 3I68A 3RM8A 3UCCA 5JMUA 2YKKA 4I6VA 2V38A 1O5KA 1NSJA 5GQBA 3C2EA 2WSPA 2IKHA 2X2YA 1XH2A 1QW7A 4ZQRA 3DGRA 3H2NA 5CKSA 3UU0A 2J9XA 3WQ5A 3WF4A 2HROA 4JX6A 3KAOA 1HKMA 3GO2A 4C6BA 1Q45A 4UTTA 1QAPA 3TJXA 1JNDA 3T0BA 2EO7A 4CQ9A 1UA3A 3N2BA 1TFVA 4ILSA 4ERGA 1MW3A 4GO9A 4GYFA 1Q7ZA 3B8WA 3NJ3A 3R12A 1OYBA 3F03K 1NDVA 1XCFA 3H2OA 3HB9A 4JGDA 2DIKA 4QXIA 4P61A 2PWHA 7PTDA 4ZZ9A 4BKNA 4M7SA 4UQDA 1FWJC 1JPDX 3HGSA 1MDLA 3SSJA 1OGSA 1R3YA 1IXOA 3BG3A 1AQMA 3N73A 1H2JA 3WLIA 3T2PA 3A21A 3W2MA 3IUIA 4XZIA 4OECA 1JUEA 3AMKA 3CLMA 2QMJA 3VIHA 5H8PA 4BF9A 2G5WA 1QO5A 1EJ7L 1NTHA 3KCLA 4WSKA 1FVPA 3S1UA 3U9IA 5A8NA 1TCMA 3K4WA 1OGGA 3QXBA 1GVSA 3A4WA 1CGUA 4W87A 4J9JA 4PCPA 3LI1A 3ABQA 2ZZ2A 1JD9A 1VPYA 4L4MA 2DZSA 3QHNA 1IYXA 2R8WA 3O6AA 5D9PA 3UY7A 4S3DA 2J47A 3KRBA 4J3UA 5F7UA 4XKYB 1Y65A 4NRRA 4BQ4A 4OFCA 4N4PA 1EJVC 4Y90A 1F6KA 2CKRA 1AW1A 4LT9A 2HVMA 4AWSA 3CLWA 2OZTA 2WHMA 3G8RA 2OR2A 2ZADA 2BS9A 4JNMA 9XIAA 2WHLA 2Z1BA 4PSPA 1ICQA 4DYKA 2Y5SA 2ZVRA 3M0IA 3LG3A 3H2AA 1MNZA 1FWEC 3PBWA 4GPNA 4FALA 2E6YA 3TYAA 3EXRA 4LF2A 2WJZA 4NYUA 6ENLA 4EANA 3C0LA 3LM7A 2R24A 5BOFA 4C5YA 2V2DA 1KB3A 4PTXA 3WLMA 2CKSA 4Q8PA 7REQB 2P53A 3G1AA 1YXDA 1VBRA 4JDYA 1VFOA 3FFSA 3R89A 4K36A 4MWAC 1US3A 1XLMA 4AYSA 3VFLA 4MJ4A 1ME7A 4PBEA 1EF2A 1TPWA 3RX4A 2CZEA 3BGGA 5AB3A 2EJAA 3G1YA 4F9DA 1G1YA 3S6OA 4DBWA 1OK4A 3OPSA 3NEVA 1TWDA 2QXWA 3L12A 2WVSA 5DMNA 3BPWA 1XYCA 2WC7A 1H0IA 1Q13A 3PHAA 3A3WA 4CNNA 4PEEA 5CBJA 4HK5A 1LJYA 4HMDA 3WUFA 1S2UA 3VE9A 4GX9A 5CGMA 1RCXB 3VOHA 2V2HA 3OZYA 2NUXA 4J4KA 4LEQA 1PYFA 3S1WA 2BY2A 2R1KA 4HU4A 4CVUA 4KRTA 3TSBA 3KHDA 4NYYA 3W01A 4NQ1A 1XS2A 3AO0A 1HQTA 3GXIA 3H6OA 3KL5A 3U5YA 1XBYA 3BANA 1B30A 4GIAA 1ZLPA 2R82A 2GDVA 4O0QA 4K37A 5LGZA 3PSWA 2BXVA 3IGSA 4B2DA 3GVRA 3M5VA 2GQAA 2I7GA 1TKKA 3KVLA 1Q4WA 5FF3A 5C9ZA 3S2LA 2GDUA 2CBVA 4ZEPA 4UTHA 1H7PA 2I5GA 3PZUA 3AWNA 4QLJA 1F74A 3AALA 2Z2AA 3WBYA 3SGZA 4JAWA 1XLGA 2CZDA 3PJUA 4GVFA 4Z1CA 4LS0A 5D2XA 4KBXA 1QHZA 2YA0A 5JVLA 3IS4A 5BXSA 1KA9F 1K7FA 1RBOB 4FR1A 4MFDA 4J1OA 4FNQA 4WZHA 1E1CB 3UZYA 3UWVA 3VD5A 5HBFA 1YEYA 4ATDA 4DM2A 3S5OA 4BFAA 2VFEA 2VFHA 4GIEA 3RUBL 4M80A 3ZSTA 3KOYA 5HQEA 3GM8A 3SCWA 1F6YA 3URBA 2DUZA 2HISA 4NAFB 3LHWA 2E0PA 3WUEA 3UWZA 4RXGA 3N04A 1TZZA 3H2MA 2QV4A 4PEKA 2WCAA 1N82A 4CD6A 4CLMA 5A2BA 1QUMA 1GUVA 3I3BA 1GZ1A 1FHVA 4US5A 1VENA 5GJMA 3QC0A 4DJEA 4HKPA 3ZVHA 1ELSA 5HXMA 1RH9A 1YIXA 4FLSA 2BV9A 4IXHA 3B0YA 3O16A 3VGHA 5D4YA 4AWUA 4R9OA 4FMVA 5KITA 3N1AA 1W54A 3P14A 2FZNA 3E0IA 4CU7A 4HCLA 3ZIZA 3C2YA 4BF5A 1LOSA 1R3SA 3R13A 1BSIA 1EZ2A 4JN8A 2A3EA 2ZTKA 2G41A 3OZMA 3ARVA 2CITA 4AXNA 4NZFA 3FK4A 3M0KA 3NQDA 4AF0A 3LPOA 4PN2A 1TCDA 1FA2A 3VA8A 3L68A 1CEOA 2ZWZA 1Z44A 4H9ZA 1W9UA 1Q7QA 3WY1A 2OELA 4DUWA 3GKFA 2J9ZA 2I14A 4NZCA 4NJHA 3TUUA 1E5NA 1SZGA 2CCRA 1ONRA 3TYCA 1RVKA 2D1ZA 4RV3A 4K39A 1QNVA 4PGLA 3RFAA 1VFFA 3FAXA 5BROA 3N17A 3NPXA 2PGFA 1PJ9A 1G94A 1GQJA 1NF0A 5CPSA 5IOBA 1E4MM 1P1XA 4HPHA 3DBPA 4XAZA 3O7UA 2ZFAA 2AGTA 2ZC1A 1IWAA 5KZ6A 1LYXA 5CLTA 1GHSA 1T8QA 1SO6A 1EA9C 3KP0A 2J7HA 1BYDA 2OT0A 4RW5A 4J40A 3UW6A 1NF7A 1C8XA 3HPZA 4GNKB 2Y88A 4AIOA 5TQLA 4MNLA 1E55A 1QNRA 2AQOA 3SW6A 1T8XA 2A3LA 3FIGA 2FJUB 1OX4B 5CAKA 4MNJA 4PB5A 2X8RA 4QJ4B 5JBDA 2PDKA 2DZVA 1H49A 4W84A 2X0YA 3QZAA 3DCPA 3CK5A 2W66A 4C6QA 4DNMA 1V7AA 1V6XA 1QHOA 4ACZB 2WLYA 1E15A 4M6QA 4J3TA 4WR3A 3UR7A 1XC4A 1MFUA 2UBPC 4NP7A 3GNXA 4AX7A 2YL8A 3GH7A 4CN6A 4X0NA 3A5VA 3PPGA 3UT0A 4O4VA 4GO8A 3L4VA 1JCJA 2VX5A 4HHHA 3P2VA 3EX4A 3U48A 3EKLA 1HO1A 1RCOB 1DHPA 1LQ2A 2QDHA 3WLNA 4KWSA 4GNJA 7TIMA 4LFYA 2E25A 2PBOA 2V68A 3WF2A 1F76A 4AEEA 3LU2A 5FIPA 2VWTA 5I77A 3K30A 3KDOA 4RL3A 3LK6A 2UY3A 3FGCA 3W2KA 5CPQA 2YYTA 4HSNA 3P61A 4CEXC 2E5CA 3CZJA 3A24A 5ECVA 4V1XA 1CT5A 5BWFA 2Q3RA 4UMBA 3SADA 3GE7A 4O1DA 3AS2A 2C13A 3APYA 4LUSB 1PHWA 2VUYA 3RNDA 4C6PA 4QAIA 3JU2A 2PDNA 3DH7A 3ATZA 3N4EA 4H04A 3MY9A 2YL9A 1R30A 5LHEA 4O1FA 1ZJIA 4Q8UA 2YXXA 3VDGA 1B0IA 2XIIA 4OKDA 3SQLA 1B3YA 2VR4A 3RM4A 3TXVA 2FLIA 2NSXA 1VGAA 3TTSA 3BQ5A 4DWSC 2GVJA 1XIMA 4F4RA 3BLOA 4LUTB 3BK0A 3CV1A 1IWPA 3NPWA 4IMAA 1PZ0A 1TZ9A 1HKKA 4LY4A 3CB8A 4NKCA 1OX6A 1R3VA 3EOOA 1S2AA 1UQZA 4P7LA 2VDIA 4PMUA 2OEKA 3THUA 1TPUA 3G8EA 3WELA 3OU8A 3KRZA 3WNNA 1UR3M 4IPJA 4GACA 1E1EA 3EEZA 7ENLA 1OFEA 1ONXA 4B5XA 4WSHA 5M5DA 4QM1A 4FXJA 3AJ7A 3ZMRA 2ZRUA 3ZO9A 1ISYA 3ARYA 1M68A 2C1HA 3U7VA 1X39A 1CYGA 3GFYA 3ITVA 4LCQA 4PBGA 4MOZA 4LVFA 1K1DA 3I7RA 4EXQA 4H6QA 4LJ3A 4DZ5A 5CPMA 4QDWA 1BWLA 4XUGA 1KTBA 3I3EA 4O53A 5HNRA 4AZHA 3GXDA 2HSAA 2PWGA 1IQ8A 4I7WA 1VFMA 3NR0A 4KERA 2GGEA 4JIIX 5RUBA 3MQTA 4PB3A 1W8SA 2BMBA 1UKTA 1QT1A 4W5UA 1IZKA 2PP3A 1WB0A 2RHGA 3THCA 1HTIA 2Z28A 5E6ZA 1R2RA 4O13A 1IEQA 4N02A 1WO2A 3GX9A 3LCIA 3APTA 1V3KA 3HV8A 5C6MA 3N34A 2Z1WA 2YZ5A 4QSHA 1JDAA 4JEQA 3OYXA 4DYEA 5A6AA 3CTTA 1YMYA 4I90A 3VCRA 1UHVA 1WDDA 2VOTA 4LGXA 3MCOA 1MRQA 4P8XA 4CNUA 2X0HA 5DELA 1F5ZA 4R9XA 2CESA 5BWAA 1ZBWA 2Z1SA 2QGYA 1W17A 4JY9A 1DWHM 4S2BA 5AKQA 1H7WA 3N29A 3V5CA 1XV8A 2HE8A 2E9BA 5C2CA 4H1ZA 4MDOA 4UCFA 3DC8A 4PCNA 3DFPA 4KS0A 1FWHC 1PWMA 2Z00A 2CEQA 5CGTA 4CUCA 2HQAA 1V3JA 4M82A 1VCGA 3LMZA 4IF2A 2NZLA 3W75A 1TA3A 4BQ3A 4GVGA 5HWNA 1V7YA 1KBBA 3LSBA 4MAVA 2Y62A 3ZR4A 3ZT7A 1K9TA 3ARSA 1RCQA 2C71A 1H62A 1NELA 3M0HA 4UWMA 3C86A 3GZ3A 4HGXA 4KWUA 4K6AA 5H91A 9CGTA 5AC6A 3WNOA 2GUBA 2YCKX 1K03A 1VAHA 2X40A 3UJ2A 4NSBA 2I17A 1WBHA 3BCDA 3WDHA 4ERAA 4IPLA 5BXPA 3NDOA 3RPDA 1IEXA 4PFMA 3GU9A 1T99A 3ZJ7A 4HVXA 1J79A 2YBTA 3MZNA 2ABAA 4O1AA 4L65A 4NJGA 1B2YA 1VFUA 3NGFA 1FXPA 2DW7A 2V67A 1UUMA 1XDMA 3BMXA 3VGFA 1IR2A 4MPQA 4ZENA 3OVRA 1EX5A 4JIHA 3DYMA 4HOZA 1EDTA 2YPIA 1JYNA 1CWYA 5IDIA 3VIMA 3LCWA 4OGZA 3PPFA 4O16A 3EA1A 4OVXA 4B92A 1RAKA 3VGBA 3NGJA 1CGYA 4F0MA 4NAEB 2C3ZA 1ZJAA 4AMCA 2BVYA 4XBJA 5G1MA 3U57A 3I6RA 3GW3A 3ZVIA 1B3OA 4C6JA 2F9RA 3NQEA 4KFNA 3MHUA 4IQLA 2YW3A 1QI4A 3WCZA 1EQCA 5D32A 4H6RA 3M0JA 5A6KA 4J27A 3KBVA 1ODZA 4GIYA 3BW2A 1XWYA 3WJYA 3SQMA 2RGMA 3DU0A 1Z48A 1WBJA 3W7NA 2GJRA 4AAJA 5E1QA 4UQBA 4C6LA 1BF2A 2H8XA 3AIRA 1ZZMA 3M7WA 3NZRA 1OFOA 4FPSA 3TSMA 4QJ5B 2YCLA 3GLCA 2XFFA 3W7HA 1E70M 4MFEA 3EX2A 3E38A 4DYJA 1TG7A 2J7FA 2PRMA 3KWSA 1NP0A 3MMWA 3NSMA 4QBXA 2WMIB 3GG8A 1VB9A 2XGIA 4GJIA 1NAL1 1TE6A 4ORIA 3TQ0A 3S2JA 3KOZA 2WMKA 3MHGA 4OZOA 1ISWA 1R86A 1IEVA 3SGGA 3ATYA 4PUUA 3EDEA 3JRKA 3GB6A 3MCNA 1UP3A 1TTIA 2O4MA 4YPJA 1VIWA 1TRDA 4C6FA 1BVZA 4P8WA 2J6XA 3UJRA 3D0CA 5ABGA 4DBSA 4RCXA 4ZL1A 5D33A 2FTPA 3UNDA 1GTHA 2NQZA 4UQEA 3M16A 2BY0A 4ZE5A 1I2QA 4KFPA 4IP5A 1ECQA 4U3CA 2CLFA 2XM1A 3CUGA 4UR7A 4W88A 5DO8A 4O52A 1M7JA 3EDDA 3UWQA 4S3EA 2P88A 1KM3A 3THDA 3QPEA 2J9YA 1TV2A 5I3GA 3W72A 4YN5A 1JCYA 1U5VA 2YBUA 4Q4PA 1AL8A 4X2RA 3W88A 3W22A 1FCQA 1W9DM 2ZZ6A 3BAJA 3FYOA 4I8YA 1U33A 5A2AA 3PZQA 2DZBA 5I09A 5T8GA 3HPSA 1OFRA 3T4WA 5I0DA 3TOPA 1XQLA 1Q7MA 3KBMA 4DHGA 1NOWA 3QHOA 3TNOA 2EGZA 3G24A 2QJHA 1EDQA 2GLKA 4LC6A 1W1B1 1F05A 5FJJA 2XH7A 4CCDA 4Y2WA 2WB5A 5F2MA 2OLAA 3AZSA 2NVCA 1J0IA 4MWAA 4GG9A 4KRZA 1U1JA 4URIA 3M0ZA 3USZA 4Q8OA 4H2HA 4E5TA 3TN3A 5HANA 3DG3A 3M9YA 1RK5A 2FMOA 1VYPX 1UC5A 2BOEX 3I3DA 1GWJA 2QR6A 4HYVA 1IZJA 1LBMA 3MUAA 4G9PA 2ON3A 1OCBA 2D73A 3W76A 2WW5A 1H5YA 3G0UA 1EJRC 5AHFA 1FP8A 2ZA2A 2HNHA 1VS1A 3UYCA 3B9OA 4WGHA 2PTXA 3GXFA 2VYOA 1MRAA 4Y9MA 2WZIA 2J62A 4HNLA 5G2WA 3CL7A 5AYBA 1Q6DA 4RXFA 4X61A 1ONWA 1IXNA 2V3FA 5XINA 2Y5EA 2ZC8A 4TUFA 4INFA 3B0PA 1S46A 1OJXA 3TW7A 1DJYA 3NZQA 4AZCA 4AXKA 4TX8A 3ABZA 2INFA 4CD4A 5PTDA 1K70A 4IMEA 1R9ZA 4UTJA 1YXCA 2DQWA 3D3AA 4V2XA 3FJLA 5J5DA 1AL7A 3BVJA 4Z1BA 3R94A 3LX9A 1HP4A 3GIQA 4LUIA 4GXWA 2FGZA 4YIWA 3DHFA 4J3XA 1K4GA 4JTEA 4GI8A 1H1YA 3F4DA 3UXKA 1ZJBA 2YXGA 4BCEA 3N12A 4DPPA 1Y5WA 4JCLA 1POJA 1EJSC 2OQHA 4AD1A 4F40A 3DFOA 4JEJA 4HNCA 1WX0A 2O9OA 1IEWA 3VO0A 3SIMA 2VUNA 1LQAA 4A22A 2Z29A 1TR9A 2ALRA 3H70A 3L5AA 3R58A 3HPAA 3LQLA 3UFYA 2AMGA 1DVJA 3CT2A 4C90A 3VKJA 1F8MA 3H7VA 3W7GA 5FF7A 3V18A 3TTYA 4H83A 1XGZA 4H6KA 2RAGA 1TJRA 4C7GA 1E0WA 3ZVHB 3ZT5A 1LRNA 1FKXA 4ZOCA 3B8TA 3BSMA 2VURA 1G4TA 8A3HA 3E2VA 4L56A 4UCGA 1V0KA 4HTBA 2B7PA 5G4EA 5LIUX 4MY1A 4C6KA 3MI2A 5L6UA 3FHAA 4GJJA 1JYVA 2HNEA 2VDHA 2Q71A 2D3LA 2C8NA 3A13A 4XAPA 2Y8VA 4WEVX 4FO4A 1EHNA 3FVDA 3N4FA 2VGFA 1DIDA 3ZM8A 2CWXA 3TOYA 3UCQA 6XIAA 5U7SA 1WNOA 3WJZA 3CMGA 2CW6A 4N9CA 2HVOA 4WJ8A 3WJSA 3EWBX 4KFOA 1SJAA 3O6CA 2P0IA 2PD9A 3ZSSA 4AHOA 2A6NA 1LWHA 3MCMA 4RE0A 4MLJA 3UXAA 2FTYA 4LCSA 2NQ9A 4QNWA 4AC1X 3F2CA 4WIWA 1EYEA 4HK7A 3UCDA 3CL6A 5DQPA 3NYDA 1TMHA 2BFGA 3ISIX 2Y24A 2Q01A 1J0HA 4XG1A 2XIMA 2XIBA 3ME3A 3C2RA 3SSZA 1W2PA 1YE6A 3LV6A 3WBAA 4HD5A 3BLFA 5HINA 2YR1A 3GDKA 2G3NA 5FAJA 3FLUA 3UG8A 5REQB 1R2TA 1SQ7A 3OVPA 5LA0A 4H8UA 1R47A 4NNAA 4YVVA 2J8TA 3L5MA 4JTJA 3VNMA 1UJQA 1SJBA 4MKSA 3W00A 2B31A 2BGSA 3SM0A 3EMZA 1UKOA 1XBZA 2Y7GA 1CGTA 3B04A 1REQA 2ASHA 1Z41A 4MNKA 3F4VA 1XFBA 3LHTA 3ONBA 2VMFA 4PE8A 4JQ3A 4FIRA 4JNYA 3JZUA 2A85A 6REQA 3V1PA 2A3HA 2VQTA 2J24A 3N6JA 1W3TA 2X1UA 2DFAA 3NQCA 2ZA3A 3S46A 1KRBC 1HJXA 4TVUA 2F84A 3TVAA 3HGJA 3ITOA 4B5TA 3EB2A 4Y6GA 1SMDA 1OFQA 3G1RA 1GG1A 4HK6A 1U2YA 1PV8A 3UERA 1T6MA 2ANUA 4L9YA 5F2LA 2DORA 3UWWA 3WLPA 3W2NA 1F3EA 1K7EA 5I3IA 3E0VA 5M3WA 1OHLA 3CXOA 2ZRVA 3UJFA 1R38A 4PTMA 1E6PA 3U8GA 4V27A 5HNNA 4C60A 3AMDA 2RUSA 4WXZA 3P82A 2R94A 1JD7A 2YA1A 2A7RA 2CPUA 4PH6A 3AXHA 4FXFA 1VPXA 1IZCA 2YA2A 4FX8A 4GZJA 3K2GA 4GKTA 1UKQA 5EFFA 1VIZA 3FGCB 2W3ZA 3B3DA 2NVDA 4B2DD 2JKPA 3GG0A 1I2OA 3WNMA 1G69A 1XYAA 4YTRA 4ADSA 5A8PA 2F7FA 2XIOA 3EKZA 3IJLA 4IQDA 4JD4A 2D24A 4IGHA 2NXHA 1LF1A 3N18A 1X96A 3TKFA 3DFQA 1OYCA 2F2KA 2OSYA 1HNYA 1I75A 2DP3A 3T0TA 1FFQA 2QV5A 2ZRXA 1X7IA 1CLXA 4AC7C 1Q6FA 3QV6A 4CD5A 3DX5A 3DG7A 1HJWA 1D7KA 4TX6A 3UPBA 1W8GA 4NILA 1W1TA 1EPVA 3TH6A 4DJDA 3VFCA 3NFUA 1PWLA 1H7RA 5JIPA 3KXQA 4DWSA 4IISA 1A53A 4LX4A 1XLBA 2R14A 3PSVA 3E02A 5A95A 3H53A 3MVTA 4S1FA 3BARA 2ZZ3A 1XSKA 3B8UA 2VZUA 3STGA 1Q6LA 3MUXA 2IXVA 3QC3A 3TE9A 1WOBA 3PBMA 1PDYA 2WVUA 4F66A 1BRLA 4L6HA 6ALDA 3S8HA 2OG9A 4H9UA 1BG4A 1R3RA 1WOAA 3O1NA 4Q8TA 3UWEA 4M5PA 4YNGA 5JUVA 3TN4A 2EBNA 3SRDA 4DBUA 1F7BA 2EKCA 1K8CA 2XG9A 2V3DA 4Z2GA 3PNZA 4QROA 4AD4A 1DORA 3HJEA 3EWDA 3W7JA 5A6JA 4MMWA 3H4GA 3OTRA 3MMUA 1ALDA 3WDPP 3LPFA 1TV3A 2IKIA 4OT7A 1KXTA 4D6DA 5D38A 3ANYA 4RDZA 1MXSA 4GVIA 4O14A 1F3XA 3NO3A 2XGBA 1L6WA 4GBUA 5LNSA 4XSMA 3WUGA 4FOJA 2Z0IA 1G6CA 2PDMA 2XTKA 5HJYA 3SRHA 2GSJA 2J7CA 7ODCA 3ITXA 3SUWA 2QUVA 3C0QA 3VKAA 1W9XA 3UXLA 1R2SA 1ADDA 3WQOA 4XIMA 3NO1A 3DKLA 2FJKA 8RUCA 3HURA 3ZYZA 5HATA 5LXEA 3WSUA 3RILA 1EP3A 5EMLA 2NLIA 1E0TA 3TTOA 3G18A 2VNCA 3MPGA 1YBQA 4Y8FA 1VR6A 3LGDA 3VCNA 2X30A 4GNVA 1F4AA 1J11A 1WPCA 2KX9A 7XIMA 4Q4OA 4ZQPA 2P10A 2QT3A 3UGVA 3M7SA 4H8NA 4CQAA 1UZ1A 5HOSA 3W23A 2OKTA 3C8FA 1ECEA 5BU6A 3G5EA 1CNVA 1V6UA 4KW2A 5B7ZA 3VPLA 1MW2A 4CQ8A 4WRHA 2DZAA 3FKKA 3CO8A 4FSAA 2BXYA 1Z3NA 1GQLA 4O19A 1TPB1 2VD8A 3BLDA 3N11A 3WDRA 3NQBA 1ZSXA 4C6IA 4FI4A 3ABRA 1JVNA 2AOSA 4NY2A 2YXOA 1E40A 2C0AA 2KAUC 3BTNA 3F7JA 4ZCWA 1V3LA 1WXYA 2WVTA 1POKA 3GDMA 3W1UA 1W31A 1L2UA 3Q65A 3NAVA 4AU0A 3GDLA 2Z7KA 1C90A 3N25A 5I00A 3FEMA 2IQ0A 1GVQA 2OX4A 3GDBA 1R46A 2NX9A 4HNOA 5HWJA 3DFSA 3E2QA 2OCZA 2OGJA 3P8JA 1OFAA 4E3TA 2PB1A 4BI6A 4PMRA 1O94A 4BY3A 3TCEA 3DUGA 3N3MA 3QBUA 5C9UA 1L8PA 1X97A 5CZJA 3ICJA 3W0KA 3GTXA 3GW0A 2Z1KA 4L1WA 5EPDA 2J25A 1KNWA 5DBTA 5MKGB 2WKGA 3EBVA 4NF7A 2NQJA 1EBHA 4Z1DA 3HJZA 4UTFA 4ZB2A 1A47A 3O3RA 1OD0A 3ANUA 2NW0A 4BQ5A 2AGKA 2HS8A 4KKXA 4CD8A 3G1DA 4W86A 1W3HA 3BH4A 2X2GA 5EGRA 2GQ3A 3CIWA 4AD0A 3W7OA 2R6OA 1N7KA 1B1YA 2FTWA 2CFFA 4E8GA 2H3DA 1TELA 1V03A 4W7WA 2B7QA 3CM4A 3MSRA 1KBJA 3P0XA 5F1UA 1FH7A 1AW5A 2BTMA 1DV7A 4FX7A 1S1PA 2G0WA 3S9ZA 3UPMA 1J5SA 1K9DA 1T96A 3CTLA 1PBGA 4FHAA 1J96A 1KM5A 1GOMA 1XSIA 2XVGA 3UR8A 4HPGA 1HKJA 5FF0A 3PZIA 4HOWA 1YDNA 4PULA 1GJUA 3G1VA 4PRWA 4BS0A 1GYMA 2Y89A 2ABBA 3H23A 2CHRA 4PUWA 2YCIX 3AMGA 5E6YA 2HK0A 4GOAA 1WXJA 3N19B 5EFDA 3W26A 3WLKX 1VFTA 1QU4A 2VQUA 4NI3A 3QY8A 3H12A 4TX9A 2XSBA 4PUEA 3BSHA 5D2TA 3LHUA 4AVOA 3B9EA 3WEMA 1J8VA 3W7DA 2XH0A 5DX7A 1JI1A 2PWVA 3XISA 3MT1A 4AG0A 5TNVA 3S9YA 2FHBA 3TCSA 4GYJA 2ACRA 3KM8A 5B80A 5A69A 2QUNA 2PSNA 1SZFA 4Q6JA 4B4HA 2CNCA 1FHDA 4IG2A 3CV6A 3OGRA 1V5XA 1A5BA 4TU1A 4PMVA 4G1KA 3NEHA 4R53A 3CHVA 1MI3A 3SCRA 2WQPA 3RLUA 1OC5A 4PMQA 4CU6A 1JYXA 4GC3A 4MAZA 3W1PA 1PTDA 1TB3A 3A3HA 3LZ5A 2R9RA 1M41A 3SN1A 2YL6A 1YKWA 3R5EA 4MWAE 3QF0A 3WLQA 1EP2A 1MNSA 4NJJA 4TVCA 5EKYA 1FXQA 4EPDC 1FP9A 5A6LA 1RY8A 2PZNA 4DB7A 1H1ZA 5DXXA 3VYLA 2F6XA 4ZE4A 1XR2A 3AFBA 3BQ6A 5GVJA 1NDYA 3IIXA 2PDIA 4DEFA 4LV4A 1TWZA 4IIFA 3GXNA 1ZHAA 3LERA 4HJWA 1KFCA 4CNSA 5A6BD 3OGVA 2CIPA 3JVAA 3VC6A 1L6SA 3BO9A 3RPTA 4UTTC 4XB3A 3TW9A 1UYQA 1I6NA 1JDEA 1OX5A 2OB3A 3CYJA 3IJDA 3AYSA 1GQKA 1RP8A 2I9EA 1TVLA 4FLQA 1DOSA 3MDUA 1NH6A 4Q7NA 1EJUC 5C71A 1WDPA 3BJFA 4UOJA 3CGTA 1G0CA 3PN8A 4JYFA 2ZXQA 5AN7A 3UG5A 5HNTA 4BWLC 1SFLA 3VDBA 4LEFA 4B9YA 1KLZA 3V3WA 4QSFA 1V0MA 3LUTA 1IHIA 3W71A 2ISDA 1PS9A 2BGQA 1YW1A 2ZZ5A 5CBIA 1TMLA 3QGKC 3WL0A 3N9RA 2IS7A 4A3QA 1XRTA 1WKFA 3W24A 4F2UA 5M03A 4E2BA 4NNBA 2XSXA 5CPLA 3UG3A 4HCHA 3UVAA 2CERA 2P5NA 4JTTA 1Q3NA 1XISA 1C9DA 4JZ5A 6TIMA 4LAMA 4MZ1A 3VNDA 5K9DA 3N9KA 5CC7A 1KWGA 1GKPA 4PMJA 2ZYFA 5FL0A 2QAPA 1ZAJA 1CXEA 3MA8A 3NVTA 3E5PA 3QKEA 1PO9A 1TJ1A 1D3CA 3AISA 3KCJA 4I8DA 2E1DA 3MC5A 4JKMA 2B7OA 4GKLA 3T8LA 3EB3A 3LPGA 3WFZA 4IIDA 2D22A 4XKYA 5CZTA 2VCBA 2P8CA 3NPVA 3FNDA 3M5YA 5I02A 2VKZG 1A0CA 3P6LA 2DW6A 2ATMA 3DGBA 1G7UA 4LPCA 3H55A 3TQPA 2VT0A 1WZMA 3PB2A 4MVAA 1TSIA 5CH9A 4U2ZA 4L61A 5K4ZA 1I2PA 3L67A 3EWCA 3PS7A 3W38A 4IJBA 4L1GA 1EEPA 2WC4A 4CD7A 2QDEA 2NWSA 4XKMA 4XBSA 1QJWA 2PRLA 3EWZA 2XDFA 3DN5A 3OVQA 1FWSA 1V08A 3UG4A 3GYCA 4C1KA 2BHUA 3AQUA 4QR6A 1UWAA 4RPPA 5AC4A 1FH9A 3D47A 7REQA 3F2BA 1NVMA 1Q6EA 3H4WA 1J0KA 4X60A 4IFKB 1O7AA 1Z69A 3WNPA 4OUIA 1ZJHA 1RZMA 1JCLA 3IIOA 4HB7A 3VX0A 3VIJA 3IGUA 2V81A 4W85A 3JW7A 4GQQA 3LTYA 5EBAA 5DY2A 1S3HA 5EU9A 3AHVA 2E5DA 4BQ2A 1MXGA 4KESA 3TC3A 1XPYA 3T6CA 3PP7A 3R25A 1TIWA 1RQEA 1TTPA 5EY5A 1QNPA 8TIMA 1NEYA 2PGEA 2E68A 1PYMA 3L2MA 4DX3A 1XH0A 1LLOA 4MSSA 3EOSA 3LA4A 4DO7A 4RX0A 1F8IA 4C7FA 3WQEA 3ARTA 3VD7A 3MHFA 2GGIA 1GONA 4D9PA 4A8IA 4K1GA 3E0FA 3CPUA 3BURA 4HHMA 3W1QA 4CNPA 3OP2A 4H7VA 1WUFA 5AC8A 3MUZ1 3FDGA 1V02A 4H01A 3MB9A 3RO6A 4L9ZA 4IIEA 5MF5A 3PJTA 4FNUA 3SAZA 2V63A 4KGLA 4ML9A 2VHLA 2WV8A 1W5NA 3O06A 4O4WA 1XD0A 5FACA 3BXWA 3D3FA 3L4XA 4I9AA 4I7UA 3ARZA 3VI2A 4OBRA 4EF9A 5DRCA 1M9HA 4Q4KA 2J77A 5C9XA 1QBAA 2E67A 3GR8A 4JXCA 4TTGA 2FFCA 1NOUA 3FA4A 3G1FA 4UMCA 5T91A 1DP0A 3W82A 4WK9A 4PMDA 1HO4A 4GJ1A 3MP4A 3HA1A 1GTEA 2EG8A 2L5HA 1E1CA 1CTNA 4NASA 2O9TA 4OE7A 3HV9A 4B90A 2BVDA 3VZZA 1MYRA 2PDYA 4RZ5A 4HN8A 4W93A 3RO8A 4LS2A 3M46A 1P0KA 2PRHA 3VNKA 4EE9A 1I8JA 1Z8AA 3LGEA 3ZXWA 1KTCA 2ZUMA 3FDKA 3VNYA 2WSKA 4NAFA 1Z89A 4CCZA 3VZYA 3EPMA 1UBPC 2ZKMX 5CPTA 4GYKA 1JZ6A 3UJSA 4DJEC 1EXBA 4IPNB 6TAAA 3STEA 5FI8A 1GVEA 1PB0A 4F0HA 3GVGA 5HUOA 1Z6KA 1H51A 3AMCA 3Q94A 1L6FA 1K02A 4U10A 2GVYA 2OEMA 2ZTJA 1E6NA 4PB4A 2VC5A 1IE7C 2WMJA 3WK3A 5FSEC 3H26A 2WZHA 1XLCA 3IGXA 4GFSA 1X1OA 1M5WA 3OG3A 3TNBA 1GYNA 5I06A 4Q3MA 1U22A 2FDMA 1BAGA 4DF0A 4MADA 1Z32X 4G6CA 1RLDA 4UUIA 3OQEA 4HSHA 3PWGA 3O0KA 2DT0A 3RX3A 3NVDA 5LYRA 4KH2A 4ZQCA 1RD5A 1FWNA 1OC7A 3WQFA 4CQBA 5I3DA 5T9BG 1O60A 1LORA 3C3NA 1EOMA 1XG3A 4MF4A 3HN3A 4FP1A 3TC6A 4DUVA 3WLTA 3LHVA 4XO7A 4UBPC 3OG2A 2CLHA 1DTUA 1SFSA 5M2FX 4XD6A