5AHEA

Crystal structure of salmonella enterica hisa
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
244
structure length
230
Chain Sequence
MIIPALDLIDGTVVRLQRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIGSTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGWQENSGVSLEQLVETYLPVGLKHVLCTDISGSNVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQWQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two-Step Ligand Binding in a Beta/Alpha8 Barrel Enzyme -Substrate-Bound Structures Shed New Light on the Catalytic Cycle of Hisa
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Isomerase
molecule keywords PHOSPHATE ION
total genus 78
structure length 230
sequence length 244
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2015-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5aheA00
2D73A 3NEVA 4MJMA 3BG3A 3W2JA 3MO7A 4MYXA 3QF0A 1NFBA 1W56A 5TIMA 4A2SA 1TPH1 3NA8A 1WV2A 2YFOA 4HNUA 2AAMA 3W88A 3L5LA 1OVDA 3O15A 3SR7A 4BI5A 4WY0A 2NWSA 3QPZA 1TTQA 4YCPA 1D3GA 3QW4B 5AC8A 3DKJA 3DGRA 2HS8A 4BR1A 5F4SA 3QFEA 4LW7A 3LI1A 3NQEA 2OT1A 4X22A 1TPFA 1NVMA 5DCBA 4IGHA 4N4QA 5IM51 3EWWA 3KVLA 2NX9A 5D2XA 4MY9A 1VJIA 3MP3A 4UTUA 1K8ZA 1SZEA 2EHHA 1H7NA 1JQVA 3PAJA 3EWUA 3G1DA 1EEPA 3BW3A 3LHYA 4IXXA 1Z42A 1H7WA 3SJ3A 5KITA 4QSHA 4K7VA 3IGXA 4NJHA 1G67A 5DN1A 3KHJA 1PCKA 3M44A 1GVOA 1QOPA 1A5CA 3S5NA 4NX5A 2EGZA 4JS3A 5C5YA 2DZXA 4OV4A 2F84A 4O13A 3W2NA 1W3TA 4JD4A 3W7NA 4RXGA 4AMAA 4OHQA 3LB0A 5C2XA 4NJKA 2BXVA 3CB8A 4O8RA 3I6RA 1XBXA 4UCGA 1OX5A 2VFEA 2HMCA 2GVLA 3UNDA 4IJBA 5EA9A 1XC4A 3TXVA 5AC6A 2W0UA 1TREA 3DI1A 4JTHA 2FB3A 3W2KA 3MI3A 4L4LA 1GYNA 4UTTA 2E6YA 3DHDA 5AHFA 1KBIA 3C52A 3NQVA 2YYTA 4A29A 1FWTA 1KW1A 4A2RA 1KLZA 4YLWA 1IIGA 4B5NA 5AFDA 3M16A 5C55A 1VYSX 1W5OA 4ONVA 2C15A 2GOUA 1IXOA 5F2IA 2I14A 1H61A 3QSTA 3O6YX 3LHUA 1N8FA 1F2JA 1H62A 1LBLA 1O60A 3B03A 5F1UA 1K7XA 1FXQA 3G8EA 3G3MA 1FWNA 2QUTA 4BK9A 1L6WA 1GVRA 1WA3A 3IEBA 5FEXA 2G97A 4FF7A 2R91A 4LV4A 1LDCA 4J9JA 4N2YA 1R2TA 4ICNA 1ZENA 3FKKA 1ZAJA 4GUFA 2Z6IA 3DFNA 1ZAIA 2CZFA 3IV3A 4IXHA 4KFPA 1K7EA 1SO3A 5AC7A 1GT8A 1JCJA 4A22A 2NXHA 1MO0A 4JN6A 4XBSA 2O7QA 3SY5A 3S1UA 3BK0A 4A21A 4UTMA 3W83A 2A85A 1W3NA 2FPYA 2ZRXA 2V81A 2YX0A 4K38A 5DELA 4NJGA 4LVDA 2VXNA 3LLDA 5HQEA 2Y89A 2DU2A 3LCGA 3W1PA 1VRDA 3M9YA 1ADOA 1GVQA 1SW7A 4WX2A 1RZMA 1ZFJA 4NVTA 3O06A 3EKZA 2VFIA 3DENA 1O94A 1RD5A 1ZHAA 3HGRA 2A21A 4LU0A 3GKFA 2TYSA 1OFDA 4OGZA 1FCVA 1SO4A 4EIVA 1OF8A 1FDYA 1ZALA 1W0MA 2V30A 2CLKA 4GJ1A 2P1FA 1LM1A 1I2NA 1HFBA 4TMBA 4N6FA 1RQEA 4GWEA 1I45A 3W1QA 3BGJA 1C8VA 5DY2A 3EWZA 4WQ6A 3W7QA 3HG3A 2JKPA 1R2SA 5F2GA 2V2HA 1YADA 2C1HA 4I7VA 1OF6A 1XBYA 2CFFA 1KFEA 3FKRA 1H7PA 4OU1A 1S5TA 3BG9A 4I9AA 5FEPA 2I1OA 2YW4A 4JTUA 5KINA 4NT0A 4ADTA 3DFSA 4DPPA 2CZ5A 4O1DA 2YW3A 3G1SA 5DXYA 3E96A 2J9ZA 3HO8A 4CNPA 4GNJA 1JRBA 5FEZA 3U2OA 3VFLA 3P82A 5IBXC 4HNTA 1OFBA 3NQDA 4IPJA 1OX6A 5K7JA 3LV6A 2B7NA 3PC0A 4FNRA 2QJGA 3PWAA 2Y7GA 4LNYA 1CI1A 1B4EA 3MUXA 1FWRA 2ISSA 3NPXA 4MPQA 4XTIA 4ZQNA 3SW6A 5I3IA 3OEXA 3QQ1A 3FIGA 5CPNA 1QOQA 2E5BA 4ZVJA 5AYXA 1YPFA 3GK0A 4I7WA 2DP3A 3G1AA 3B8DA 1YTDA 2X30A 4MKNA 5H2ZA 3I7QA 3P7YA 1KM3A 1C9DA 1UB3A 3UWWA 3PG8A 3T7VA 1M7PA 1KV8A 3GR8A 4AHOA 3C2OA 3LCLA 2QDGA 5IBXA 2V5BA 5EMUA 1JCNA 5AHLA 3W70A 1XUZA 4AVFA 1DKWA 4ALDA 3NDOA 1YTEA 4O4VA 3HQ1A 4S2CA 2H8ZA 4O53A 5CG7A 4XWUA 4AAJA 3LCXA 1WYIA 3M5YA 1ONRA 5D09A 3S1WA 4JY9A 3EX1A 3GDTA 3KFTA 1R30A 1LOLA 3DFOA 4K39A 3P5YA 1AK5A 2NUWA 1G4TA 2NZLA 3A23A 3L5MA 3LCIA 4CQ9A 4FNQA 4YXGA 4MY1A 4GC4A 4N9DA 5K9DA 1VYPX 3QSRA 2DJLA 4OT7A 3W23A 3DAQA 4BI6A 4FNTA 1TB3A 3TKFA 3HJZA 1U83A 3NPVA 3DKLA 1EP2A 2Y62A 2VEIA 4ZQMA 2R94A 4JNMA 4XBKA 4CCDA 1F7BA 5DY3A 5FF3A 3BLEA 4MFEA 4O57A 2ZQ0A 5LNVA 4YCOA 5AOUA 4TIMA 1TPUA 2QDHA 1UCWA 5LSMA 4Z1CA 3NXFA 1X7FA 2V2DA 4O1CA 1O5XA 3CHVA 3HPXA 1A50A 1WOAA 2I9EA 3THQA 3ELFA 3O07A 1L6YA 4RR4A 3W7RA 2E6FA 2WNZA 2YGYA 4NUWA 4MLRA 2A2IA 2E5DA 4UMCA 1OABA 1Q6LA 1W5MA 4JEQA 1KTNA 5HWMA 3HG4A 3F03K 1DJQA 1ZJIA 3W73A 3WK0A 4N9BA 4NZFA 1SFJA 4E2BA 3NOEA 1XCFA 3IGSA 5D05A 2FLIA 3N19B 1P4CA 1G6CA 1W54A 2H3DA 3DFPA 4UMAA 1SPQA 1EX5A 3HBLA 4ZMGA 3CWNA 1QPOA 3W1NA 1F5ZA 3CIWA 4JTJA 4RXFA 2P10A 2J88A 4AB4A 1BWLA 3BG5A 4DQWA 3WJSA 3KRZA 4XUGA 1JUBA 2KZHA 2CW6A 4CQAA 1W8SA 3G1XA 1ICPA 4FIRA 3W76A 1LORA 4O0ZA 2VEMA 4O54A 4WZHA 3GB6A 2JBMA 3TUUA 2C19A 1BWKA 1LCOA 3LCWA 4K8EA 2WOQA 3GDRA 3IVTA 3LM7A 1DVJA 3P62A 3W7IA 2A6NA 2EAWA 2BSLA 3LV5A 2WKJA 4CNOA 4H6KA 4FO4A 1SUXA 1S3HA 1TCDA 1GZGA 2FDSA 1K03A 2RDTA 1ZNNA 3S1XA 2V82A 1QNVA 3C2FA 1KFJA 2EKCA 5KTLA 4RKAA 3SECA 4UMBA 1YXYA 1I2QA 3RMJA 1LBFA 3G0SA 3M41A 4Y96A 3G1FA 3EB2A 4EWND 1MXSA 3PS7A 1ME9A 3M43A 1FDZA 5AHMA 4H3DA 4M7SA 3PBWA 3LCHA 4PL1A 3TR2A 4JTFA 4KKXA 3MMTA 3RF9A 4LC6A 4JTGA 4DO4A 3GDMA 3E02A 3BO9A 1VYRA 1D9EA 1VR6A 1A5BA 5I3HA 1PVNA 1DHPA 3FS2A 3MI2A 4AWSA 2J24A 4LRTA 4O18A 1VHNA 3CEUA 4LWWA 3G18A 2YDAA 5I3JA 3T78A 2FB2A 3DU0A 4ORIA 1TTIA 2QF7A 4OE7A 4HSNA 1H60A 5AB3A 1WX0A 2E77A 5HJLA 1TPWA 2GQ8A 3TW7A 4DELA 3TSMA 5TQLA 4HNVA 1TJRA 1JRCA 2JK2A 3PBUA 3TQVA 1B9BA 1KM2A 3W2UA 4FNPA 3L66A 1O5KA 3GXTA 3R8RA 3UPBA 3U8GA 2VC6A 5AHIA 5HINA 1L2UA 3PULA 4LUIA 3GX9A 3R5EA 1JUKA 4NNAA 5KMYA 4Z0JA 5DLCA 4FXSA 4S2BA 3BPWA 3LGEA 4M6VA 5CZJA 2AQWA 3S1VA 3UY7A 1KFBA 1A5SA 3WK2A 2E68A 5BNKA 1GVFA 4BWLC 2H3BA 3MHFA 3UZ5A 3CLMA 1H1ZA 5L9FA 3EX6A 3H53A 4KFNA 4AF0B 4BWLA 4NXKA 1EA0A 1IXPA 2ZZ1A 2RFGA 1RVGA 3M5ZA 4XTDA 4UTWA 4ZQPA 3LXBA 1UUMA 1XBZA 1FCUA 4ZZ9A 4LUJA 6ALDA 3MP4A 1ZAHA 2OT0A 4K8HA 1B4KA 1OFEA 3TSDA 3B05A 5A5WA 1JJKA 3G0XA 4RJEA 4GUHA 3P60A 2X1SA 5D02A 5C6MA 3A5VA 1NEYA 1HUVA 3I7RA 1Q3NA 2A6LA 2YYUA 5G2WA 1GPWA 2Y88A 1LOSA 4C1LA 4OQVA 4QAIA 4NZJA 3AJXA 3DHFA 1KTCA 3P8JA 4CLMA 5HULA 2X16A 4JTSA 5F4XA 1DQXA 3F4WA 3BV4A 1VGAA 4WUIA 2DJXA 4ZL1A 3N14A 2DZSA 2QCNA 3A21A 3USBA 3UWVA 2YR1A 3W7MA 3T4CA 2JGYA 1QAPA 4HKPA 4IMEA 2XN2A 2GJNA 3A22A 3G22A 3ZFHA 1KFKA 1H50A 3LXCA 5FF2A 1PL9A 1SFLA 3TMLA 3LHTA 2NLIA 4POCA 3O8AA 5GVJA 2ZTKA 1WDWA 1EP1A 3JR2A 3SGUA 4Z1BA 2VELA 2DZPA 3GAKA 3N34A 2PRLA 1VPXA 3WJXA 3UXAA 3JRKA 1T99A 1XFBA 4I7UA 2Y63A 4JX6A 4XKYB 1RQHA 2ZBTA 5CZ0A 1KM5A 4DO5A 1X8FA 5K3VA 3G0UA 4GUJA 4JX4A 2ZRVA 2CLHA 4X3ZA 1X1OA 2QCLA 3EX4A 2ZZ4A 2QCCA 1Z44A 3LTYA 3R12A 5EYWA 4JDBA 3EX2A 4M6PA 1DL3A 4UUIA 1PV8A 2C3ZA 3QMTA 4JTEA 1QCWA 3LBMA 2NV2A 5G4WA 3OA3A 5G2HA 1WQ5A 1TRDA 2TPSA 3RNDA 5F1VA 1BKSA 4K7YA 2B0MA 5L6UA 3UY8A 3GDLA 4XQ6A 5D2WA 3OVQA 3CPRA 4GBUA 4UIOA 3CU2A 1XM3A 5KZEA 3NPUA 1ME7A 3GLCA 4FX8A 1OYAA 1IGSA 3N2XA 5HR6A 3HPSA 4K6AA 3NQ7A 2HTMA 3SI9A 3TMQA 1QMLA 2VKZG 1ME8A 4EF8A 2A0NA 3W7GA 4LV9A 2ZA2A 3ABOA 1OG0A 1DV7A 3W07A 2R8WA 3W7CA 4WY0B 1I2PA 2ISWA 1R2RA 2GUUA 3QH2A 3NQAA 3WJYA 5K9XA 1DBTA 1V5XA 2ZCGA 4KWWA 3IIPA 3NZRA 3KRUA 1GTHA 1NSJA 1OK4A 4JYFA 3RU6A 3W84A 3C61A 1TPEA 3W7HA 1AW1A 3NQMA 3TV8A 3KVJA 1F6KA 3E12A 4HT3A 3QEZA 5E1QA 1P0KA 1VZWA 2CLFA 1JR1A 1W5QA 3NG3A 5BOOA 1KM1A 4AWTA 3NQ8A 4EF9A 1SSDA 2ZA3A 1TQXA 3JS3A 2OX1A 4GRSA 2TSYA 2VEPA 1VCGA 4JTKA 3HB9A 1TYGA 3GR7A 5D2TA 5FF7A 1OX4B 1ZCOA 4UTIA 5J5RA 1Q6OA 3P81A 1H1YA 1IIHA 4G1KA 2WNNA 2X1RA 3G3DA 1TRIA 4PH6A 4UFHA 2QEZA 2ZYFA 3UWQA 2A1YA 3FFSA 5SWUA 5D33A 1TV7A 2QCDB 5AHNA 1EUAA 2H90A 4ADSA 4UTWC 3L68A 1QFEA 2VFHA 1VS1A 3FOKA 2QAFA 2Z2UA 3TFCA 2C0AA 3UYCA 1I4NA 4DF0A 1HO4A 4UFIA 3S5OA 2YPIA 3PUOA 4JGDA 7TIMA 1VCVA 2VFFA 1FXPA 1G7UA 1P5BA 1N7KA 3TAKA 5J5DA 3TROA 3PSWA 1H7RA 1HG3A 1SR9A 1OFOA 4YMZA 4IPIA 3PVFA 2VFGA 1UJPA 4HNNA 4RCXA 1LTDA 5HWJA 3C2VA 3FLUA 2ZZ3A 2Y85A 3W1TA 4JYEA 1FY6A 3O1NA 3W7EA 3STCA 1TPDA 3L0NA 2OMAA 1FWWA 1SO5A 1ICQA 1D3HA 2WSRA 4MYAA 4NJIA 4R53A 4LC8A 2ABBA 3W7OA 2ZTJA 3CM4A 5G1TA 2R14A 3S0CA 3PBVA 1I8JA 3GIYA 2WNQA 4UTTC 2PC4A 2GPTA 3CC1A 3W6YA 1M7OA 4O11A 3IRDA 2E6DA 4U28A 4CCCA 1JCYA 2NUXA 3NL5A 3Q58A 3C8FA 1MEHA 3NQFA 3KAOA 4O28A 1QPRA 1W3IA 3Q37A 1FCBA 4AEOA 2G5WA 1LRTA 4UTLA 4UNKA 3N9SA 4MFDA 1VLIA 1TTPA 2OZ0A 3GXNA 4IWWA 5I3GA 4DF1A 4UFMA 1EWEA 2FPTA 1Z41A 4OV9A 2O7SA 2GVGA 5BRBA 5DCDA 5EKYA 2C14A 3MJYA 3AO0A 2GVJA 3S6DA 3P74A 2PURA 4Y6GA 5LNUA 2YXGA 3KXQA 2ZZ6A 1WBHA 4UFJA 5LHFA 4WD0A 3DXIA 3LHWA 4GUGA 1L6SA 2Q3OA 1RQBA 4PODA 1OJXA 3LERA 1TSIA 4FB7A 1HTIA 3DBPA 1Y0EA 4MZYA 2YCEA 2BWGA 1O95A 3W86A 3ABQA 2XN1A 4W9TA 3KOFA 4Y9AA 4JIPA 3C0JA 4MY8A 4JTLA 1WAUA 3CIXA 1AW2A 1KFLA 3W7DA 5U4NA 1PS9A 3EXSA 3NR0A 4O17A 1Q6RA 3LRKA 3LLFA 1PHQA 5LGZA 1QPQA 3ZS4A 3G8RA 3NL3A 4RZ6A 3R13A 1G69A 2DZTA 3VE9A 2B7PA 4IX0A 2NX3A 3P84A 2PRMA 3B04A 5HNRA 1BEUA 2ATSA 4AWUA 2V5LA 4K36A 5G1YA 1DORA 1F73A 3RK8A 4AXKA 3FYOA 1M6JA 3FJ6A 5LHEA 5D04C 1KA9F 1F6PA 2CLOA 4TMCA 4FHAA 3F4NA 5DBUA 1OFQA 2FFCA 3S9YA 2E1DA 5FEWA 1JCLA 1RV8A 3O6CA 2A5HA 2OCZA 3G1YA 3I65A 3M47A 1GTEA 4IQLA 1H7OA 1FWSA 1FBAA 4IMDA 4P2VA 2Q8LA 5D2YA 4A3UA 4Z1DA 3T55A 4O1AA 4O12A 2QUVA 3P67A 4DEFA 4N02A 1M5WA 5F4WA 4JIQA 4RLIA 5CPLA 1XDMA 2BTMA 1KTBA 4R7JA 4UFKA 3IGUA 4LVGA 1B3OA 4DBDA 3Q94A 4Z08A 1EUNA 2QCHA 3EWBX 3OHIA 2RHGA 4XKYA 1KFCA 3CQ0A 2Y7FA 3LCFA 4IUOA 4X9SA 4QITA 3HF3A 3IIVA 2XFWA 1T96A 3A5FA 4UTHA 3V75A 3BARA 4CQ8A 3PR2A 1AG1O 1F05A 3NQGA 5E0KA 2A7PA 3W9ZA 1QR7A 1XBVA 4BI7A 3S42A 3GKAA 5AHEA 1F74A 2IQTA 3UWZA 4O10A 5LNWA 1TMHA 1KV5A 1ALDA 4AHPA 4FNSA 3GNDA 4S1FA 3B4UA 4EVZA 3MWAA 2VEKA 3VKJA 2NV1A 3GDKA 3TW6A 3P61A 1J2WA 3W1XA 4MUZA 4ZQRA 4CCEA 1U5JA 3ABRA 1Q45A 4O4WA 1H51A 1A53A 2HS6A 3W7PA 3CWOX 4FNUA 1IXQA 1W1ZA 4K37A 4NU7A 2WPBA 4ML9A 2A7NA 5LNRA 3CT7A 4RX0A 4UTJA 3L65A 3STGA 1N55A 1XXXA 4YL2A 4Z1AA 1AMKA 3LTSA 4BF9A 3TNOA 5EPDA 5G2IA 5I3FA 3B06A 1TPC1 4D2JA 3F1QA 3HG5A 2LLEA 3NQCA 3L67A 1XKYA 2B7QA 3NVTA 3M5XA 2EPHA 3IIXA 1A5AA 3EX3A 3LBCA 1SZGA 3C56A 3TU9A 4ADUA 3R89A 1YPIA 2X1TA 1MSSA 2GQ9A 1OYBA 1XI3A 2BZNA 2CWNA 4JYDA 3W7KA 3NGJA 3QZEA 3N9RA 3M7WA 4UNLA 4M7TA 1J4EA 3C2RA 5HMSA 1UASA 2FTPA 1LYXA 5KZDA 3TE9A 2CLMA 3NM1A 3BLFA 2ZRUA 5LZLA 3MHUA 3OG3A 3BW2A 4N6EA 2WQPA 4RZ4A 1HO1A 4ORMA 1H5YA 3EWXA 2CLEA 1ML1A 1JCMP 2QJHA 4TO8A 3C2EA 3FJLA 2QUUA 3TAOA 3W74A 3THAA 1VC4A 3O6DA 4JDYA 1TPVA 2FJKA 2GQAA 2RDUA 4JXCA 3NNTA 4M5PA 1K8XA 1GWJA 2FQIA 2YZRA 1VH7A 2EF9A 5CSRA 3TQKA 2ABAA 2F7FA 3WK3A 4LVFA 4RK8A 3HPZA 3LXAA 4EOUA 3TX9A 4N9CA 1K8YA 3LHZA 3W3OA 3NM3A 4AHQA 4RZ5A 3QYQA 5U7SA 5T26A 4TX9A 3CEPA 5EY5A 1SQ7A 2C16A 3HIJA 5MHBA 3NAVA 1LZOA 4QNWA 2X2GA 3NYZA 3O63A 1R47A 2ZZ5A 4O19A 3I68A 3VCRA 3OBKA 1E51A 1VHCA 5CKSA 3HG2A 4MZ8A 4PA8A 4IX2A 3M1ZA 3GXPA 3WK1A 3NL6A 3EXRA 1O4UA 3PY2A 3TXZA 2NXGA 1TQJA 2V2CA 2ZA1A 3E49A 3W87A 4PC8A 3NZ1A 3SIZA 2AGKA 1Z48A 1QPNA 3NQ6A 1B57A 1SU5A 5LGXA 4MLJA 3MI6A 2HSAA 3UWYA 1JVNA 2PE4A 1THFD 1GOXA 2DZVA 3BW4A 4JY8A 1Q6QA 1PIIA 1XUUA 2ALDA 3GYEA 4NNBA 2A7RA 4GE8A 1AL8A 3PB0A 3T40A 3W1LA 1XDLA 3ZWSA 2ISVA 4OBTA 3SGZA 4FX6M 1LLZA 2QAPA 5D37A 3TSBA 5KSWA 1YDNA 2RH9A 5CZSA 1W31A 1UBSA 1YXCA 2NXIA 4QQ3A 2Z0IA 4DPQA 1YDVA 4QM1A 2TRSA 1OFPA 3DFTA 5C54A 3MBDA 3PM6A 1GQNA 5FI8A 1CW2A 3K30A 3MHGA 1T0OA 1G4SA 4UXDA 4RV8A 3QMRA 2H6RA 2QJIA 4O50A 3PG9A 3GAYA 1WBJA 3KVMA 5CSSA 2FPVA 4MVAA 5K4XA 1KM4A 4BFAA 3HMJG 2VOMA 5EBUA 5KZMA 3LHVA 1JULA 4MJZA 4IOTA 2P0OA 1JCXA 3U6WA 3LDVA 3HGJA 1V7YA 4JR5A 5BMXA 2E6AA 2Y61A 4Z0SA 4ZQCA 3W1UA 3G1VA 3QJAA 5CGQA 4O15A 1C29A 1QWGA 1OHLA 3A9IA 1PCWA 4LVAA 4LS2A 1LRQA 4NX0A 2J9YA 3IVUA 2A4AA 1I2OA 3GVGA 3E0IA 3LOTA 3G24A 4GUIA 1LRNA 3W1RA 2ZRZA 2RKXA 4LVBA 4AH7A 4OWGA 1K02A 5DBTA 2JKEA 1KLYA 4WOZA 2DZUA 3ANYA 4LRSA 3PB2A 5F2MA 5A8GA 2B4GA 1WXJA 2H8XA 3FYPA 2W6RA 3V1PA 1TPB1 4Q33A 1GYLA 1NAL1 3D0CA 3R2GA 3LTPA 5HWNA 2X1UA 1VCFA 1RPXA 3RLUA 2C13A 1LLWA 2V8ZA 2E5CA 1JUEA 4X2RA 5ABTA 3KRSA 4PCFA 1PE1A 3ZWTA 1MZHA 2DORA 4PFMA 3UZJA 3B0PA 3TIMA 3DH7A 1GG1A 1IXNA 3TA6A 1LP6A 1X1ZA 2ZDRA 3S5YA 3VI2A 3HGSA 3L0GA 4UR7A 2UV8G 2JKAA 5CPOA 3T44A 1YDOA 2ZRYA 5TBOA 3UQNA 4PL2A 3FEMA 5D38A 4R34A 5AYZA 1XL9A 1GJPA 3SZ8A 5AYYA 1SO6A 3C3NA 5LNSA 2VENA 2QKFA 2Y6ZA 5DXXA 3C4UA 1GG0A 2Y7DA 2C18A 3L21A 4WY0F 1T8XA 4U4MA 3OVPA 3NO5A 2ATMA 3M0ZA 4M19A 4C1KA 2CU0A 3NL2A 3QPYA 1BTMA 3L5AA 1QO5A 3IIOA 5CPMA 1KM6A 3B0UX 1DQWA 2DZWA 3UXDA 3P8IA 3N3MA 3W7LA 3CTLA 4CNNA 1FCQA 2J6XA 4FEZA 4HN4A 4JTIA 3RLVA 1H7XA 5K2ZA 1W37A 1SW0A 1S5VA 3W2LA 3H54A 2NX1A 3WJWA 2CLLA 4IMGA 1X6UA 4KWVA 1J5TA 2ZRWA 1K3UA 1CX9A 3G1HA 3WJZA 1QDSA 4LT9A 3OIXA 5H91A 3NPWA 4O0KA 3HOJA 2Q3RA 3MP5A 3DI0A 2J9XA 3GZ3A 5K9CA 1TIMA 1NF0A 1UUOA 3C6CA 4JTTA 5D03A 3YPIA 4ZQOA 3UD6A 2NUYA 1MEIA 5I3KA 3UPWA 1I2RA 2VFDA 1G7VA 3VE7A 3BLIA 4WXZA 1H63A 1LOQA 4HPJA 3LI0A 2JGQA 2CZEA 1EB3A 3OVRA 1SZFA 1OFAA 3ZR4A 3TC7A 1HL2A 3SFKA 1OK6A 2PCQA 4NXSA 2ZZ7A 4LOCA 2QCFA 1DJNA 1YLVA 3GNNA 4QJ1A 3PUEA 2V9DA 4LS1A 1WOBA 3LRMA 3MW7A 1L9WA 2Z6JA 4UR8A 2QCEA 4N9EA 3IIZA 1FQ0A 1F76A 2Q8ZA 8TIMA 3BVJA 4O16A 3P5ZA 4YWIA 1FX6A 3Q2DA 1VQTA 3FA5A 5LKYA 3M6YA 3TDFA 1KM0A 3DZ1A 5BMWA 4H4IA 3W22A 3W7JA 1K7FA 1PHWA 4Y90A 2YFNA 3BGGA 3EKLA 4O1BA 4WJEA 1FUYA 4NNCA 1P0NA 4LS0A 4JICA 5EL1A 6TIMA 4WXYA 3O05A 4GXMA 4UTKA 3PUDA 1YXDA 4IMCA 4NJJA 3I7SA 4Y8FA 1LBMA 5K4ZA 3A24A 2C6QA 2BLEA 1EIXA 5HR7A 1GEQA 1NF7A 3TQ0A 4Q4KA 4HPXA 5G5IA 1AW5A 1G4EA 3KX6A 4GFSA 1QO2A 2CLIA 3QRHA 5D2VA 3TJXA 2Y7EA 5FF4A 2E09A 2CZDA 1SW3A 3STEA 1YYAA 1EPXA 3H55A 5E93A 1TV8A 1TO3A 4DXVA 5F2LA 2ZFAA 4UC5A 1SSGA 3L9CA 1JQXA 4TR9A 3INPA 2J27A 1W5PA 1VLWA 1AL7A 3TH6A 2PRHA 3MYOA 1OFRA 2W79A 3W71A 3W72A 3W85A 1SZNA 3L0KA 3IVSA 4O52A 3W2MA 4DF2A 2B7OA 4E2DA 1KBJA 1GVSA 2QCMA 2WSQA 3MBFA 4LTSA 3QQ0A 5CZTA 1W5NA 4UFLA 3SSJA 5FF0A 3QM3A 3KVKA 4MZ1A 1FDJA 3MYPA 1LROA 1S5WA 2WV8A 3LX9A 4KFOA 4QIUA 3RFAA 2GJLA 3EXTA 4E38A 4TU1A 4E0CA 1MEWA 1DOSA 3WFAA 1P1XA 3TCEA 4DBEA 2YSWA 3PBYA 4HHPA 4MIMA 5D30A 3ABSA 1TTJA 3STFA 3TC6A 3ATYA 1EP3A 3TJLA 4FIQA 2Y70A 3P80A 1TJPA 3O16A 3S5ZA 4WOQA 3TFXA 4HIBA 4O14A 3PF3A 3TK7A 3EEGA 4AF0A 2QCDA 3W75A 4MOZA 1OYCA 2QCGA 2RDWA 3S8HA 5HUOA 1IF2A 2Z1BA 4DO6A 3B0VC 2QR6A 3ATZA 3QW3A 4XZ9A 3HGOA 2XN0A 4QISA 4HSOA 1ICSA 2V0TA 4FXRA 2BX7A 4IMFA 1TV5A 4L4MA 3QC3A 2G96A 1OX4A 3VNDA 5BW6A 4PEKA 3N73A 2WJZA 4N4PA 3QMSA 4FX7A 3L2IA 4NQ1A 2NWRA 1ZY9A 5G4EA 4P61A 3W1MA 4LY8A 4M6QA 3DFQA 4PTNA 4QNEA 5HUPA 4Q32A 2G95A 3W1AA 4JX5A 5D32A 2WSYA 1R46A 4R33A 1YTKA 2FIQA 3NQ2A 5FESA 3N2MA 2TMDA 3LRLA 3M5VA 1RR2A 3PSVA 3EWYA 3E9AA 3UWUA 5DCEA 2WO5A 5AN7A 2ZZ2A 1EWDA 1G4PA 2OJPA
chains in the Genus database with same CATH superfamily
3BG3A 3W2JA 3MO7A 2KX9A 3BCDA 3H2OA 1TPH1 3AU2A 3NA8A 8CGTA 4P7NA 1WV2A 3AHZA 3BWWA 1BLIA 5D8ZA 3QPZA 1TTQA 4GNKB 2J8GA 5AC8A 1AMYA 3DGRA 4PB5A 1TKKA 2OT1A 4ILSA 4AYSA 4IGHA 2PDGA 1AH0A 1NU5A 3KVLA 2NX9A 1UD6A 3R94A 1VJIA 4A4AA 3LZ5A 3SCPA 4OOZA 3LHYA 3CZKA 1Z8AA 4PTMA 4QSHA 3AIUA 4K7VA 3E5PA 3S5NA 4MNJA 4QS6A 2C0HA 4O13A 1M1BA 2DGAA 3IPWA 3W2NA 3KBJA 4QG9A 5KZ6A 1EGMA 3BTNA 4RPPA 2IW0A 3GR4A 4JBRA 3KZPA 1RY0A 4OHQA 2OTDA 2PDQA 3I6RA 4UCGA 4PCTA 3D3FA 2GVLA 4IJBA 5EA9A 1XC4A 4DWDA 4IIGA 4EK7A 3V16A 4JTHA 4W4QA 5IDIA 4L4LA 4DNMA 2VJXA 1A5OC 2JIEA 5AHFA 3NQVA 2YYTA 2F6KA 1KLZA 2BXZA 4B5NA 4AIOA 3MDWA 4DHGA 3LEPA 3VIFA 4Q22A 2CIPA 3LNMA 1W5OA 2W92A 3W38A 2C15A 2QQ6A 1NP2A 3NURA 1E0XA 1IWPA 4LAOA 5H8PA 1IXOA 2ZUVA 2PDWA 3O6YX 3RPDA 3LHUA 3KW3A 1O60A 2Y2WA 2I7GA 3EB4A 4RE2A 1GVRA 4HQVA 3PN8A 4FF7A 1MXDA 4OZOA 4DJDC 3OHMB 1F4AA 1LDCA 3AXHA 4QR6A 1ZENA 3FKKA 4GUFA 3IV3A 4JQ2A 2V5CA 1W2PA 2HPIA 4XBSA 3SY5A 1AZ1A 3W83A 1F07A 2FPYA 4K38A 4YNGA 4CNSA 5DELA 4HBKA 3LLDA 3VMNA 3BCFA 2G4JA 2Y89A 2PDKA 2DU2A 3LCGA 5HNUA 1OG6A 4AX7A 4IG2A 4KWOA 1E43A 1VRDA 4PUUA 4CU6A 5I06A 1ADOA 3AIQA 1ZFJA 1KO0A 1O94A 1O1ZA 2A21A 1S1RA 3WEMA 3H2NA 1OFDA 4X2PA 1FCVA 4DB7A 1OF8A 1XYLA 4XAFA 1TMQA 3H4XA 1ONXA 2CLKA 1LL7A 4HZ7A 2E9MA 1LM1A 2XHYA 4D6GA 3F2BA 1JPDX 1EFZA 1I45A 1DWJM 4WQ6A 2NV9A 3W7QA 4QCEA 2HPMA 4A3HA 2YA0A 1OF6A 1KFEA 3B97A 1H7PA 3TWAA 1S5TA 3BG9A 4FMVA 4I9AA 1WAWA 4XISA 2VRJA 2I1OA 3REQB 3ID7A 4RNIA 4OJYA 1QPKA 3GU9A 1UH3A 5ABGA 1UD5A 3FHAA 4E3VA 2PZNA 3E96A 3T0BA 4ZOAA 1MQRA 3OLGA 2UBPC 4AIBA 4RV3A 4QGCA 1RP9A 3PFMA 3J7HA 2FZ9A 3GSMA 3LV6A 3PC0A 4FNRA 4W85A 5G1MA 2P8CA 3WUFA 5FL0A 4M51A 1V0LA 2WAGA 1U22A 4MPQA 5GJMA 2AAAA 2BXYA 1YHTA 1X7IA 2E5BA 1UG6A 1YPFA 2WJDA 1EJVC 4L7ZA 4DI8A 1JD9A 3CBWA 3B8DA 1YTDA 2XU2A 3I7QA 1TELA 4GVIA 1C9DA 3UWWA 1ADSA 1JF5A 4DRSA 1NTHA 3E2VA 5EMUA 1F61A 3I6EA 3WBXA 1XUZA 4AVFA 3OZOA 1P7TB 4A8IA 3LM3A 4O4VA 3CZJA 3HQ1A 2H8ZA 4W5UA 1V51A 4C6MA 1UH4A 3MDUA 3S1WA 3STPA 3NSMA 3HJEA 4JIHA 3EX1A 2PODA 4K8GA 3JUGA 2NUWA 1G4TA 4CQ9A 4FNQA 3CAVA 4HJFA 5K9DA 2DJLA 3CV6A 3W23A 1XR2A 3OJGA 2HDJA 4O8AA 2HE5A 2OYLA 1QWKA 4S3DA 5T91A 4JNMA 4XBKA 3WEZA 4L1XA 5E0CA 3UJFA 3UVAA 4AFYA 3T09A 3KOYA 2C1IA 1JZ5A 4YCOA 2DV0A 2C79A 5LSMA 3NXFA 3CHVA 1XYCA 4H9YA 2I9EA 1KGUA 3THQA 1AD4A 4RR4A 1VBGA 2OOGA 2QVNA 2OQYA 3FJNA 3S4TA 2A2IA 2E5DA 2ZWZA 1Q6LA 2BY0A 3DX5A 3TOPA 1N8IA 3PHAA 1BD0A 2C7FA 2G0WA 1S2TA 4H19A 4RNHA 1SFJA 3O0FA 3IGSA 5D05A 2FLIA 3N19B 1G6CA 1W54A 2H3DA 1VEMA 4CEXC 4F48A 4IUGA 3THDA 1EX5A 1Q63A 2UY2A 2O55A 3CIWA 2ZVIA 1KRBC 2V63A 2P10A 2J88A 2OGYA 1RLDA 1LWHA 1JUBA 4M1BA 2PDBA 4JTCA 2WHLA 4IIBA 1GJWA 1P0DA 3AS0A 4ZA0A 2I16A 2VEMA 3TUUA 2C19A 1BWKA 3LCWA 2WOQA 3GDRA 3LM7A 4GZIA 2NVDA 3P62A 3CH0A 2A6NA 3LV5A 4C1NB 4DLMA 4BKNA 1KB3A 1S3HA 1TCDA 4BQ4A 1K03A 4H8NA 1M65A 1QNVA 3C2FA 5D9OA 1HGWA 4C6LA 1TX2A 2VT0A 1YE6A 2YZ5A 5LIYX 1YXYA 2GK1B 4GINA 4AC1X 4TUFA 1MXSA 5GPRA 3A4XA 3ENLA 1BF2A 1JPIA 2ISFA 3S2NA 4HU3A 4I9MA 2O92A 3RR1A 4JEJA 1D9EA 2VDHA 1UPPA 4F9DA 1DHPA 1HKJA 2QVHA 1TWWA 2BG5A 1E15A 3CEUA 4LWWA 1MNZA 4PR4A 1REQB 3M0XA 5AZ0A 5HPOA 2QF7A 3OGSA 5H8UA 1Q7QA 4F2UA 3M0YA 3SQLA 4GACA 5AB3A 4KGJA 1OWQA 1TPWA 4IPLA 1TJRA 4C5ZA 5A6AA 3OVGA 1XSJA 4UQAA 3R8RA 5HINA 1G0CA 1L2UA 5JUVA 4KCWA 3MV11 1JUKA 4H7CA 5KMYA 1KKOA 5EMYA 1HNYA 3WIJA 4Z0JA 2GGHA 3BPWA 3O9NA 1U5VA 2CCRA 2E3ZA 5I23A 3IJ6A 4GY7A 1QHZA 1WP6A 3ZVHA 4CQBA 4KFNA 4AF0B 5TD4A 4BWLA 2VX6A 1L6FA 2GUBA 4HMNA 4H9XA 4XTDA 1DWIM 4ZQPA 4M24A 5IOBA 1V4YA 4HCDA 3T6CA 2V68A 4WK9A 1P6WA 2POTA 2OT0A 1V6XA 4K8HA 1B4KA 3TSDA 2DW7A 1JGMA 4GY1A 1LL6A 3G0XA 1E73M 1JDCA 2PLJA 2X1SA 5C6MA 2D23A 1VFOA 1RLCL 4NG3A 4IIDA 2FVMA 1Y5WA 3OODA 2Y88A 1PZ3A 4C1LA 4QAIA 4NZJA 3P8JA 5HULA 1NP0A 1MXGA 3VNLA 4JTSA 3F4WA 1VBUA 3N14A 2DZSA 2J47A 2QCNA 2Y5SA 4S3CA 1UWRA 3W7MA 1BYDA 4HKPA 3ZT5A 3WLRA 2V69A 3GW0A 5CC7A 4J1OA 3SCVA 1PL9A 2D1ZA 5LYRA 1F6YA 3KL3A 2WMGA 1OIFA 3O8AA 5GVJA 3UESA 1PIGA 3ARVA 2X42A 4Z1BA 1TZ7A 3SGUA 4W87A 2DZPA 3N34A 3AALA 3WJXA 3AC0A 1OC7A 3UXAA 2VGFA 3JRKA 1MRAA 4IISA 1T99A 4HP5A 2HBVA 2Y63A 4Q8WA 1LG1A 4ES4A 5CZ0A 1R85A 3CV1A 5BXRA 1QTWA 4X3ZA 2YXXA 4Z42C 3T8LA 1V3MA 3KL5A 3T2PA 3JZUA 3WLHA 3EX2A 2WNWA 4M6PA 4UUIA 2YCLA 4HOWA 4AZGA 2C3ZA 3QMTA 4JTEA 1QCWA 1GHSA 3OA3A 5G2HA 1WQ5A 1TRDA 2VX7A 4QDWA 3QFWA 5D2WA 4XQ6A 3UA4A 1CLKA 4PCPA 1NM9A 1CXKA 4DWSA 1K9TA 5KZEA 1ME7A 2GGJA 1IGSA 3N2XA 5HR6A 3HPSA 3C8NA 2QUNA 3SI9A 2VNCA 3TMQA 5C9RA 1A4LA 3EDDA 4FF5A 4EF8A 3W7GA 1BGGA 3WF0A 4E8GA 4C6IA 4B90A 2PTDA 4WLCA 1JZ6A 3GM8A 1DJZA 2IPGA 3ABOA 3W07A 4DWSB 3LPOA 2Y1HA 1QNQA 1QI3A 3WUGA 2PD9A 1BAGA 1TVPA 3M0JA 1DBTA 1V6VA 3URAA 4JYFA 2RJHA 4MJ4A 1TPEA 3NDZA 4FR6A 1XIEA 4D6DA 4DJEA 3RM4A 2OG9A 4TVDA 1P0KA 2QIWA 4QJ4B 2Z2AA 3DFHA 1J8VA 3RX3A 5BRQA 2ZVRA 1J0JA 3C5QA 1TQXA 2ZIDA 4GQBA 3CPUA 1QNRA 4A3RA 5DT7A 2PI6A 2OX1A 2TSYA 1VCGA 1E4IA 3P14A 4JHOA 5D8WA 4AZ5A 3BAXA 1GZJA 5D2TA 1JFHA 3CK5A 3V7PA 2V6AA 4NILA 3CAQA 3DERA 4HVXA 3K1DA 4W7WA 4KETA 5T8GA 3ARZA 3ZJ7A 1L0PA 1JYVA 1E0UA 2A1YA 1IEQA 2WMIA 4UTWC 4X60A 1QFEA 2VFHA 3BZJA 3VD7A 3WYZA 1KR1A 3S5OA 3UXLA 4WHBA 2YPIA 2CKRA 1XF0A 3HZ3A 1OSEA 1P5BA 1VFTA 1N7KA 3TAKA 4AY7A 3TC3A 5J5DA 1H7RA 1HG3A 1KR0A 2Z29A 3WD0A 2WZEA 4YMZA 1QI5A 1BVZA 4DO7A 3IANA 4IPIA 2VFGA 3WDPP 4R27A 4RCXA 1VP5A 3FLUA 3LENA 1NOFA 3UR8A 2Z1SA 1ZSXA 1W3LA 3VUSA 4GYPC 3O1NA 3LQLA 3STCA 3GHUA 5J8LA 1TPDA 3L0NA 5M2FX 2OMAA 1V8EA 2JQXA 3GFZA 1SO5A 2WC4A 4NJIA 3W7OA 2BDQA 1K77A 3SQSA 3WKZA 4IGNA 1I0DA 3TYAA 2R14A 5I0DA 1E1EA 3GIYA 1US0A 1SFSA 3ZLFA 3GG0A 4TVUA 2E6DA 4EE9A 1HW6A 3NL5A 4C6BA 4JIIX 4M29A 3NQFA 4O28A 3QTPA 2PP3A 2YXOA 4GI8A 3K8LA 4Q7BA 3WBYA 3QV6A 4XZMX 4AEOA 4ZXOA 1QNPA 1A0CA 4ICCX 1XISA 1VBHA 4FR1A 3VVGA 2OZ0A 1OZQA 3N15A 1EWEA 2PDFA 1JL8A 1NQ6A 3WD2A 3CYJA 3MJYA 3AO0A 3S6DA 3P74A 4Y6GA 1UJQA 3VZXA 1TWIA 4KS0A 4WD0A 3V0TA 4GUGA 2Q3OA 1UD8A 3VGFA 3LERA 4FB7A 3CB3A 4MZYA 2YCEA 2BWGA 1KBLA 2CBIA 3KOFA 1RALA 3WDQA 1O66A 2J78A 3B0XA 4JKKA 4P8VA 2V67A 4AVOA 1QPQA 4BF5A 5CXPA 3CO8A 4XG1A 3AJ7A 4RZ6A 2FVLA 3WQOA 1TZ9A 1DJWA 4WJ8A 1UW9A 5A8NA 5JBFA 4IM4A 3P84A 4E2VA 4UR9A 4PYSA 3MVIA 2OYKA 2P88A 4YVVA 4US5D 2V5LA 4K36A 4ATDA 3VZZA 2W9MA 5FA5A 5IRPA 4S3AA 3E0FA 3DOPA 5MF5A 2E1DA 1JCLA 3VOHA 3G1YA 3I65A 4IQLA 3W01A 1FWSA 4KRZA 4A3UA 5D2YA 1UMLA 4DEFA 2WXDM 1JPKA 3VAVA 4W7VA 3ITLA 4N02A 1M5WA 4XSLA 4JIQA 4N7QA 5CPLA 4UFKA 1B3OA 1OCQA 1WDDA 1RJQA 4S3EA 2QCHA 3HU7A 4XKYA 1OCJA 3CQ0A 1UP3A 3WF2A 2WWDA 4IUOA 1HF6A 3IJIA 3HF3A 1UKQA 4CQ8A 1ECEA 1F8MA 3WLMA 6TAAA 1QR7A 1XBVA 3SUTA 4BI7A 4ASTA 3C0SA 3KWSA 3FJ4A 1F74A 2PCEA 1S2AA 3SO7A 5LNWA 1UQZA 4QROA 2OSWA 3APYA 3EOEA 3GNDA 4YPJA 1IWAA 3B4UA 1BFNA 2QV4A 2R82A 1TR9A 4ZQRA 1VRXA 9RUBA 4CCEA 1U5JA 4O4WA 4OECA 1H51A 4YTSA 1J12A 3CWOX 4D9PA 1IXQA 1RY8A 3GTXA 4NU7A 4D6CA 1TV4A 4HA1A 2NQHA 4ML9A 2A7NA 1S2VA 3K1GA 4RX0A 3VD3A 3NYDA 3L65A 1Y8BA 3N1AA 4LSBA 2SFPA 4YL2A 1AMKA 3LTSA 2XVPA 5I3FA 1V3JA 2FYMA 4GX9A 3HG5A 1XLFA 3NQCA 3M5XA 3EX3A 3AIEA 2VM8A 1SZGA 3C56A 1IYXA 1YPIA 2GQ9A 2CWNA 3NGJA 1I1WA 4BCEA 1GOIA 3M7WA 3WX7A 3N2BA 1UASA 4NSBA 4JCMA 1LYXA 5KZDA 3TE9A 2NT1A 3BLFA 3KP0A 1SM9A 2D20A 3OG3A 3BW2A 2WQPA 4RZ4A 3UFYA 4WGXA 1HO1A 3WH6A 4REQA 1H5YA 2CLEA 1ML1A 1JCMP 4TO8A 2GWNA 4NZ5A 3BSHA 1PKNA 3W74A 1VC4A 3WNMA 3VPLA 2FJKA 4HPNA 3T8QA 5CAKA 4MSSA 3M0KA 1GCYA 1Q5MA 1E9YB 5M1TA 4EPBC 2EF9A 3TQKA 4DN1A 3WK3A 3LXAA 4AD5A 4ZO8A 2R1PA 4LF2A 4LANA 3NM3A 4WDWA 3EBVA 4UZSA 4AHQA 1C8YA 4RZ5A 3QYQA 5T26A 4TX9A 3XIMA 1SQ7A 1XLAA 4QNWA 5I3DA 2JEQA 2I57A 5HQMA 2ZZ5A 1E4NA 3OBKA 5CKSA 3CQJA 4MZ8A 3M1ZA 2E0PA 1MDRA 4D1IA 3E49A 3W87A 1R38A 1Q2SA 3OZPA 1J96A 1Z48A 3PUGA 2IKJA 1B57A 5HK4A 4P5UA 3MI6A 3AWNA 1GOXA 1B0IA 3BW4A 3N18A 4LYKA 1E6XM 1AL8A 3ZWSA 2ISVA 3SGZA 3QC0A 3TSBA 1XIGA 4PGLA 1DWHM 2ZXAA 4XO6A 1XIHA 2TRSA 2BVTA 3MBDA 4LYRA 1GQNA 4AW7A 5CJNA 4PUMA 3IJ7A 4AZ6A 2NQJA 3WFLA 1XLGA 3VNIA 1ODUA 1PSCA 3XISA 2H6RA 4GI6A 5HAOA 2PA6A 1J6PA 3PG9A 3GAYA 1WBJA 3KVMA 2FPVA 3EOOA 3QTGA 2DW6A 2VOMA 1E3XA 4GYKA 1JULA 3P6LA 1JCXA 3PPCA 3HGJA 1V7YA 2L5HA 1LUCA 3AIBA 4ZQCA 1C29A 4RW5A 1G94A 4I9TA 2VRQA 1PCWA 4YYFA 1GKPA 4HHHA 1BQGA 4XSMA 3O6AA 2O4MA 1BVWA 3E0IA 3COTA 3NSXA 4V28A 3SCWA 4TOQA 4GUIA 1LRNA 4OWGA 3L4WA 4PTDA 4GX8A 4LRSA 5F2MA 2B4GA 1WXJA 4ZB5A 3FYPA 5JBDA 3CXOA 4ERGA 1TPB1 1GYLA 1NAL1 3D0CA 4C6QA 1KQYA 3L4TA 5CC5A 2V8ZA 1JUEA 4PCFA 3ZWTA 4ZO6A 1MZHA 2DORA 2H9AB 3B0PA 3PZGA 3IJQA 4FLOA 1UIPA 1IXNA 3TA6A 5BOEA 2ZDRA 4PUWA 3L7RA 1IQ8A 3VI2A 2PWVA 5BCAA 4GYJA 4GVFA 9XIAA 1ZPTA 2ESCA 2J7CA 4NAFA 2ZRYA 3UG3A 5TBOA 1DJHA 3R8HA 4IZGA 1XYZA 4R34A 5D38A 2XIMA 1GJPA 3SZ8A 4F8XA 4B4FA 1TE1A 1DEDA 2PPGA 5CC3A 3C4UA 1YEYA 4WY0F 3NEHA 4N42A 1UPMB 3V35A 2P0IA 3QPYA 1XSIA 1BTMA 1QO5A 1AH3A 2O9RA 3B0UX 3BXWA 3VIGA 4IIFA 2X2YA 3P8IA 4IQEA 3N3MA 3CTLA 5IXEA 1FCQA 2Q01A 3TR9A 1TA3A 4ENLA 3RLVA 1H7XA 5FD0A 1XH0A 4ECLA 1VFSA 3H54A 3K13A 1ADDA 1BYBA 3CT2A 4QQUA 3WQDA 2ZRWA 4HZ8A 1B3VA 3BLLA 4AMCA 4NASA 3NWRA 5DFAA 3T4WA 2Q3RA 1HXJA 5K9CA 4S3JA 1WPCA 2ACSA 1ITQA 4ZQOA 5M03A 4JTTA 3HMCA 4JIEA 3HN3A 3QGKC 5I3KA 3UPWA 4D6FA 1QBAA 1I2RA 1D3CA 4PRWA 3W82A 2JGQA 1RBAA 4CNUA 3CUHA 1OFAA 2WHKA 1U1HA 1US3A 3TC7A 3SFKA 5G4HC 2IQ0A 5JQ9A 1YLVA 1M03A 1HKIA 2XISA 3SRFA 1WOBA 3LRMA 2PDPA 1BTCA 3H22A 3R25A 1MFVA 2ZC1A 1F76A 1DTUA 1GOQA 4O16A 5BWFA 4YWIA 2EJAA 4C6PA 2QF8A 3HFYA 3Q2DA 1CGXA 1XLIA 1S38A 3P93A 1EX1A 4RUBA 1MW3A 2OR2A 4OOUA 3GC2A 4XAYA 4XVEA 3QVQA 3OPSA 1FUYA 3LUTA 4JICA 3W00A 5A3HA 5EL1A 4WXYA 2OEJA 1Q2RA 3A24A 2C6QA 3VIPA 5CJ5A 1NF7A 5I09A 4TQTA 2W27A 4GI4A 3AYVA 4HTBA 4CD8A 3KX6A 3OIHA 2WB5A 2WHMA 3ZVIA 1TE6A 3C86A 5FF4A 3SJNA 4BY3A 1VIWA 3KCOA 3EMCA 3L12A 4DYKA 4KERA 1D7FA 1TO3A 5F2LA 1TVLA 3BGAA 4DWSD 4HN8A 3M0VA 1AUSL 3L9CA 1AL7A 3KOZA 3VGDA 3EOLA 2GQ3A 3MYOA 3W71A 3W85A 3L0KA 4RDZA 3IVSA 4O52A 3GWQA 5AZ1A 2B7OA 1GVSA 3VINA 3FVDA 5CZTA 1W5NA 5FF0A 3QM3A 1YKWA 1UBPC 3G6MA 4WCJA 3GTHA 1LROA 1S5WA 3RUBL 2WV8A 1UR0A 3LX9A 4QIUA 3N2OA 2GJLA 4E0CA 1MEWA 3WFAA 1XSKA 4DBEA 2YSWA 2PWFA 3EA2A 3ABSA 4D6HA 1DIKA 3UJSA 2XSXA 3UCDA 2Y70A 1Y5XA 3P80A 3FSUA 3S5ZA 4WOQA 3TFXA 3EEGA 2G41A 4GGHA 3ZVHB 1W2VA 2OSXA 3OYXA 1X96A 1MYRA 4Q3MA 4AD0A 5HUOA 3EWCA 1EBGA 3GBDA 4XD4A 1XCXA 1H5VA 2V0TA 2VCBA 3MSGA 1E6PA 2BX7A 3AYSA 4IMFA 3TTOA 3QR0A 5A6LA 3F2CA 4H6RA 1CPUA 2YIHA 3VNYA 1O68A 4PEKA 1EKOA 5M17A 3KRBA 5G4EA 4FP1A 3LN3A 3W1MA 4UQ9A 3V5CA 4Q32A 3WNNA 4DJDA 2FIQA 3N2MA 4MB5A 3W02A 4JFVA 3PSVA 1A5MC 5XINA 4GVGA 1GPFA 1PEZA 4P8UA 5CPQA 5C9UA 5DCEA 2WO5A 4J5NA 1TWSA 2ZZ2A 1DJGA 2GDVA 1XWYA 2YBUA 1CT5A 3PFRA 1NFBA 4A2SA 4GXPA 1I9CB 3THCA 1WKYA 3MUZ1 3OZYA 1KQZA 1OVDA 4B15A 2GLKA 3D3AA 4U3AA 1UP0A 2NWSA 3C0QA 1D3GA 3QW4B 1JXKA 1EOMA 1Y65A 4BR1A 5F4SA 4F9JA 1FWJC 1MVYA 4X22A 1NVMA 2TODA 5DCBA 3EWWA 2VQUA 3ARPA 4MY9A 3MP3A 1FWDC 4UTUA 1SZEA 4HNOA 1AFSA 1H7NA 1SJAA 1NQKA 1QHOA 3AROA 5E5CA 3T2OA 3UZYA 3PAJA 5EU9A 3EWUA 2WM1A 1BYCA 3G1DA 1EEPA 3NOYA 1UD2A 2AL2B 4IL0A 3IGXA 4E2OA 5DN1A 1PCKA 1QOPA 5AVHA 4G2DA 5C5YA 1XGZA 4C6CA 4NAEA 3WD3A 4H9UA 4JD4A 3AXXA 4DBSA 4AMAA 1ZLPA 5E9XA 4KH2A 5C2XA 2EO7A 4NJKA 4O8RA 1RBOB 1XBXA 2IMRA 4V33A 1Q6EA 1CEOA 2XVKA 2PP1A 5FAJA 3VZYA 3TXVA 3OP2A 4G9PA 2WVSA 2FB3A 1EZWA 4HA0A 3W2KA 3MI3A 3UZZA 3FVMA 1RCOB 1S5MA 4R3UA 2PDLA 4UTTA 2E6YA 3DHDA 5JXQA 1XJBA 4QE4A 4I5XA 3VA8A 3HQPA 1PKMA 2CPUA 3VIKA 1IIGA 3M16A 2YOCA 3CZ8A 1VYSX 3U0HA 4F0LA 3V4BA 1BKHA 2TAAA 4FLRA 1TX0A 3TYZA 2I14A 3QSTA 1LBLA 3EMQA 5F1UA 4D8AA 1K7XA 2QT3A 3G8EA 4RDYA 1FWNA 4BK9A 1L6WA 3UR7A 2ZWYA 1WA3A 3LBOA 2R91A 2QYGA 2QJNA 3MC5A 3BMWA 4J9JA 4ICNA 4FA3A 2E67A 3DFNA 5ECUA 3W25A 4MG4A 3W6MA 3UP8A 3UETA 5BRPA 4KFPA 4A22A 4Q8NA 1MO0A 3GC4A 3S1UA 1CLVA 4HMEA 2V81A 3MV01 1B3WA 4GJIA 3BLKA 5HQEA 2Y8VA 3QV8A 1HJXA 2IS7A 2A3AA 3LNPA 3TN5A 1SW7A 3BLPX 3V1HA 4NVTA 3O06A 5I24A 2VFIA 3DENA 1RD5A 1ZHAA 1JDDA 3SM0A 1A47A 4FPSA 4LU0A 4BEQA 2GOKA 4XAZA 2YLLA 3PZMA 2XFFA 4EPEC 3S2MA 3DYOA 3UF9A 2VMFA 1SO4A 4EIVA 2XUCA 4XAPA 3H2FA 2WK2A 4XO7A 4NZ4A 1AQ0A 4GJ1A 2P1FA 4DZHA 1LJYA 2WHJA 3ONCA 4MWAA 2NQZA 2BGSA 1C8VA 3EWZA 3UJ2A 4YWSA 3GG8A 3HG3A 3THUA 3CJPA 1GYMA 3W28A 3VDGA 2V2HA 1IWBA 2C1HA 2GJXA 1XBYA 3FKRA 4GI9A 3D46A 4QDPA 1VFFA 1XRVA 2GGEA 4NT0A 4ADTA 3DFSA 4JTRA 3AQUA 2ZDSA 1PTGA 3DIPA 4RNJA 2INZA 1UP2A 5DXYA 3N4FA 3EYPA 3HO8A 4F0SA 4CNPA 1JRBA 1E4MM 1BXNA 1DJYA 5IBXC 3SB0A 2XWDA 2OO6A 4HNTA 1OB0A 1XS2A 3BUVA 3NQDA 1CB2A 4IPJA 3E0VA 3AIRA 1OX6A 1JI1A 1C91A 2W62A 5CH9A 2W91A 2BY2A 3PWAA 2ZADA 3MUXA 4ZQNA 4L64A 3GUWA 4DM2A 3VGEA 3OEXA 1P1MA 1QOQA 1QUMA 4I7WA 2DP3A 2DQWA 2DZBA 3REQA 1Z89A 1K8CA 1TMLA 4TX8A 2GK1A 3P7YA 4L65A 4ZTYA 1KV8A 3GR8A 2V5BA 1ZBWA 3GVQA 2YL8A 1JCNA 2AKMA 3NTYA 2OXNA 3W70A 5HQLA 2WC7A 3VUPA 2X41A 4C1NA 3NDOA 1X1NA 4O53A 3BQ5A 5AYBA 3WQGA 2Z00A 4XWUA 4AAJA 3WH8A 2CLPA 3CNYA 1WYIA 4GZ7A 5D09A 1CECA 3RHGA 4Y2WA 6XIAA 3KFTA 2VR5A 4KEUA 4K39A 5I6SA 1ZZMA 1AK5A 1BG9A 3F5JA 3L5MA 2PDYA 5H8MA 1WKFA 3EZ4A 4N9DA 1I1XA 4W8LA 1W8GA 4HNCA 4HMDA 5RUBA 4B92A 3MKVA 4BI6A 4UBPC 3HJZA 3TKFA 2Y62A 1EJXC 1R7OA 2AKZA 4JQ1A 4ZQMA 3VMOA 2P3ZA 4LPCA 4AXNA 3T08A 5DY3A 1K9EA 2X7VA 1UR8A 1DJXA 3F4VA 2G3NA 4MFEA 2VI0A 3U48A 2GSEA 4UWMA 2ZQ0A 3IJ9A 3F5LA 1YIXA 5PTDA 4RW3A 4Z1CA 4MNMA 1X7FA 3MSRA 1IEIA 1WOAA 4GO9A 3CL8A 1XLKA 1V6WA 2E6FA 3ARXA 2WNZA 3O0KA 1SVDA 1OABA 1XG4A 2XVGA 3HG4A 3F03K 3PJXA 4AC7C 1IGWA 3ZXWA 5DQPA 4M1RA 3U4FA 1NARA 1WZMA 4E2BA 1PXGA 5ABEA 1XIBA 3TJIA 3UZWA 3WN6A 2XIQA 1J93A 3DFPA 1HJUA 4UMAA 4JAWA 3HBLA 4ZMGA 3FXYA 2W61A 3G1RA 4QJ3B 1LL4A 3SSZA 3W1NA 1PIFA 4UOQA 2Z26A 3BDKA 2ON3A 3WJSA 1EQCA 1ZGDA 2KZHA 5AVNA 2ISDA 3G1XA 4HD5A 5BZAA 1XV8A 1F3WA 3BAYA 3I3DA 4V2XA 3GB6A 2OWWA 1LCOA 3RPTA 1DVJA 2P53A 4MKVA 3WD1A 4PCSA 2YJQA 3KTSA 2WKJA 3LYEA 3LZ3A 4JFUA 1D2KA 1EC8A 3KEHA 4JQ4A 3M46A 1XPGA 2QDDA 3U7BA 4LGXA 2KAUC 3MB9A 1I2QA 3RMJA 4RDWA 4W8BA 1LBFA 4FOJA 1AZ2A 3PZQA 3M41A 3EB2A 3M43A 3BZGA 4E5TA 1OBAA 6PTDA 1JDEA 4N0RA 1TIWA 2HE8A 4RE3A 3RF9A 1ZBVA 4DO4A 2XVLA 1VYRA 2DH3A 1PVNA 1ZS2A 3FS2A 3MI2A 3AMLA 1CWYA 1GGOA 1B54A 2W3ZA 9CGTA 2YDAA 1OQFA 3ITTA 1Z32X 4H01A 5I3JA 3DU0A 4EP8C 4ORIA 4D72A 4HSNA 2E77A 2GQ8A 4DELA 3TSMA 1ZBKA 3PBUA 1B9BA 2XIJA 1AJ2A 3U4AA 1E70M 4FNPA 3GXTA 3UPBA 2VC6A 1MZRA 3PULA 2JEPA 1AQHA 1ZTVA 3GNRA 4REQB 3M64A 2G4FA 1U1JA 3WLPA 4S2BA 3LGEA 4M6VA 5TAOA 1FWFC 1NJJA 1U33A 1CGWA 1A5SA 1IT7A 4BWLC 2YB4A 4F79A 3JZEA 3CLMA 2VEFA 1AD1A 4AEFA 3HA1A 3VOIA 4NXKA 1EA0A 1ZQ5A 4GH1A 3CAWA 1UWTA 1ELSA 4I6VA 1UWIA 1IHIA 1UROA 1UUMA 4C6DA 4J3SA 1FCUA 4ZZ9A 1EXBA 4LUJA 4H7VA 6ALDA 1R3TA 3MP4A 3KTCA 1EBHA 1HL8A 3WF3A 4WDUA 3P60A 5D02A 2BVWA 1NEYA 2VX5A 1J0IA 4PTVA 3RG6A 2YYUA 5G2WA 1GPWA 1LOSA 4OQVA 3AJXA 2CBUA 4CLMA 1JPMA 4GJJA 2I5IA 3H7VA 3D6NA 1I6NA 1VGAA 2DJXA 2JIWA 4YHEA 3UG4A 1V08A 2YR1A 3T4CA 1R5YA 1TZZA 2YCIX 3WQ5A 2GJNA 4MKSA 3G22A 4ATWA 2CZVA 1KFKA 2DSWA 4QXIA 3CUFA 3TMLA 1RCXB 1RH9A 5DANA 2NLIA 3CZLA 2ZTKA 1EYEA 2PBGA 4LUTA 1FKXA 3EPNA 3FGCA 2J6VA 2PRLA 4QRNA 4M82A 2EPMX 4J3WA 3TA9A 4JX6A 3RAOA 5C70A 3LD5A 4XKYB 1RQHA 1MW2A 3GG7A 1E0TA 4JX4A 2FHFA 2XTKA 4ZBCA 3OQ8A 2PWGA 3OO2A 1Z44A 4HYWA 4JDBA 5A6TC 1UH2A 5G4WA 2NV2A 5F1VA 1ISVA 4RE4A 4WIWA 3QQWA 4J7RA 1HJQA 4PMXA 3CPRA 3B0YA 4R9XA 3NPUA 4FX8A 1PDZA 1OYAA 1S5NA 4Z17A 2HTMA 3R6IA 4AIUA 3UGVA 4NYYA 2VKZG 1ME8A 3P2VA 2A0NA 4HA3A 3AAMA 4Y9OA 5FOOA 4LF1A 3GNOA 4P7OA 3OGVA 2R8WA 4C6FA 4WY0B 2MANA 4US6A 1ISWA 2ISWA 1M01A 2GUUA 1M04A 3WJYA 1FHDA 4KWWA 1GTHA 1OK4A 3AS1A 3UVIA 3C61A 3W7HA 3CTTA 5I2UA 3TV8A 1GQKA 3KVJA 1HIZA 2YCLB 3E12A 3QEZA 4MADA 4NL1A 4WSJA 2NVAA 1JR1A 2RJGA 1W5QA 2AL1A 2PDNA 2F2HA 1UR2A 2O0TA 3AISA 4AWTA 3UT0A 3NQ8A 1XD1A 3MKCA 4J27A 4EF9A 1SSDA 2ZA3A 3CQHA 5EBAA 2BV9A 3IV8A 1YDYA 4AD1A 4GRSA 3SUWA 1OZMA 4L9ZA 3PAOA 3S1GA 3EGJA 1CZ1A 3RMEA 3VTRA 4UTIA 5J5RA 4QS5A 1GOMA 4XUYA 1U5HA 3GHSA 1VD6A 4ZE4A 2B81A 3QLLA 2OSYA 1V3LA 2QGHA 1NELA 4G7EB 3NUKA 3B8UA 3UWQA 1W1B1 1MW1A 5SWUA 3S2CA 1TV7A 2QCDB 2H90A 3MS8A 4B5UA 2X09A 2Z2UA 3R0DA 2C0AA 1I4NA 1HO4A 4NZ3A 1UA3A 3PUOA 3KBSA 3V18A 2VFFA 1FXPA 1G7UA 3FXGA 1A5NC 2Z1KA 1HKKA 3W37A 3V0UA 2G3FA 5HWJA 2I17A 1LG2A 1OCBA 1H2JA 4D8ZA 4J28A 4JYEA 1FY6A 4PUJA 3T1GA 3IACA 4LCRA 1ICQA 1UR3M 4L80A 2YDQA 3CM4A 5G1TA 4R7WA 3RO8A 1JYNA 2Y5JA 1JGIA 3MCMA 4Q4SA 3CC1A 1T6MA 3IARA 5ABFA 2WVVA 3IRDA 3VOFA 1JCYA 4OUEA 2NUXA 3HV8A 1OGBA 4NZ1A 4AG0A 2DPEA 3C8FA 1UKOA 1MEHA 1ESWA 2YA2A 4ML4A 4XAGA 5JVLA 3QR3A 1QPRA 3TOYA 3MCNA 5CCZA 4UQDA 2G5WA 3TW9A 4C6NA 1R3RA 4A05A 2EEXA 1TTPA 1DIEA 3SUSA 4WKAA 2D2OA 4UFMA 4ACYA 4BHYA 4H9MA 1K4HA 2CERA 4UCFA 3C0LA 2VZUA 3MANA 4KIRA 5LNUA 2YXGA 2FVKA 2PWHA 4DVOA 1JFXA 4IQJA 1OD0A 3UR5A 3AXMA 1GKRA 1L6SA 1RQBA 4J3UA 4NRSA 1TSIA 3TYUA 1C8XA 2QZRA 3WFZA 1QW9A 2NW0A 4XZWA 2PTWA 2DIEA 4BEUA 2XN1A 3ITCA 3MUAA 2F2KA 1R3VA 1S2CA 1A80A 3R0KA 5DMMA 2DIKA 3C0JA 4F0KA 4MY8A 4JTLA 1WAUA 3W7DA 4HU0A 4QJ5B 3DBNA 1OM0A 1EF3A 1Q6RA 4LBUA 3LLFA 5LGZA 4JTDA 1CXHA 5JH2A 1FWBC 3R13A 1G69A 1TWZA 3DYPA 4GPNA 3U57A 4IX0A 1E4LA 1E6RA 3FA3A 3TYEA 8XIAA 1CENA 3U5UA 2Y8UA 3B04A 4LUSA 3HQNA 5G1YA 1DORA 4YTRA 2E1WA 4LAMA 1ZJHA 4CN4A 4G56A 1SZRA 3HPFA 3R4IA 4I5UA 5LHEA 3T07A 1ONWA 1F6PA 4TMCA 3F4NA 2FFCA 2V3GA 4PTWA 4DY1A 3O6CA 2OCZA 1KBBA 1X6LA 3VIIA 3E1F1 4IMDA 4Z1DA 3B9DA 4O1AA 4O12A 3S47A 4IT1A 4LCQA 2PAJA 3BICA 3QOKA 1EUNA 3I4KA 3OHIA 2RHGA 3LCFA 4HOZA 4NZCA 3DESA 4X9SA 4QITA 4CQCA 1J0HA 3AMDA 3FGCB 1LQ0A 4Q7NA 1AG1O 4LYQA 5EMJA 3L4UA 1XH1A 5AHEA 4PN2A 1K4GA 3N6QA 3UWZA 5CG0A 5LIKX 4B5TA 2CWXA 3S5SA 4IH3A 1NWRA 3Q45A 1JD7A 2YB1A 3WLLA 1ALDA 4S1FA 5CPSA 2Q02A 4EVZA 1E56A 3VKJA 4J3VA 3W1XA 4S3KA 4L1GA 4NIRA 2ZX5A 1A53A 2V3FA 1FH7A 2D0HA 3FSTA 3EKGA 4MDPA 3TN3A 1FWGC 1W1ZA 4K37A 3TLQA 4EXBA 1QASA 1JNDA 1W3KA 3VM7A 5CEWA 3STGA 2WKGA 3OW1A 1CIUA 3KOXA 4Z1AA 2G8ZA 1FHVA 3TNOA 3ARSA 5EPDA 3A4JA 5G2IA 3B06A 3U2ZA 4B2DD 4P7LA 4DJFD 1UIOA 3L67A 1PB0A 3NVTA 4JKMA 2EPHA 3IIXA 3ZYZA 2NSOA 1V6YA 1LQAA 3TTSA 1I0BA 4Y9MA 2D24A 4DZIA 2DUXA 2PB1A 3CS2A 3GZAA 1ZJAA 1XI3A 3W7KA 2YBTA 3QZEA 2CXGA 4M7TA 3C2RA 2FGZA 1PYFA 2FTPA 1OCNA 5T9BG 3N9KA 4Z2IA 5LZLA 3MHUA 4IMAA 1EJWC 5DMNA 4N6EA 2OEKA 4LYPA 4XZHA 4INFA 4B3LA 3PPFA 3EWXA 1E9IA 2P76A 3V0SA 2QUUA 1CGUA 1E6NA 4UQCA 4JDYA 1TPVA 2GQAA 2PF8A 2RDUA 4CN6A 4JXCA 3NNTA 3DECA 3RCYA 2OX4A 1JDFA 2FQIA 4LAKA 3MY9A 2ABAA 3DC0A 4LVFA 4RK8A 3WLQA 2E9LA 5DX7A 3RCNA 4N9CA 5HDRA 1REQA 3W3OA 5BXPA 2O9PA 3H2AA 1GZ1A 4PBGA 3KZSA 4Z2LA 4GQRA 5ABHA 1QI2A 1OGSA 3CEPA 3HIJA 5MHBA 3UJRA 3CMGA 1LZOA 3QY6A 3NYZA 1CXEA 1R47A 5GNZA 4MWAE 4G8TA 4CNTA 2CBJA 2GSHA 3I68A 4M3PA 3VCRA 1VHCA 1KCXA 2ZX6A 2D2HA 5EMMA 3GXDA 5BWAA 3CHCA 4O1FA 3GBEA 3EXRA 2VC9A 2PGWA 4F0MA 1TQJA 2OLAA 2ZA1A 4PRRA 2I9UA 1B5TA 3SIZA 3RRXA 1T7LA 2AGKA 1P6CA 1QPNA 3R7MA 1WZKA 3BOFA 3GFXA 5XIAA 1THFD 3VKAA 1GVYA 4JY8A 2BNJA 1OADA 2XIOA 2ZC8A 3O2LA 4NRRA 2A7RA 4GE8A 3T0DA 5E6YA 1XDLA 1QNOA 3VNKA 4PBFA 3TYDA 5KSWA 3K8KA 1YDNA 2RH9A 1EO7A 1UBSA 1YXCA 3EA3A 2CHOA 1YDVA 4QM1A 3OU8A 3SCOA 3DFTA 5C54A 4WEVX 3PM6A 3PZUA 3JU2A 4UOJA 4ZO9A 3K30A 1HKWA 4UXDA 4Z2JA 4YYCA 2PWDA 1P0BA 2QJIA 4O50A 2DUZA 3UBPC 4F2TA 4BFAA 1X6NA 5EBUA 1NOWA 4DJEC 3RIKA 3SCQA 1EZ2A 3U6WA 2HXTA 4Q6JA 1UZDA 2XPKA 4JR5A 3PNUA 2E6AA 2Y61A 4Z0SA 3QJAA 1OHLA 3NSNA 1UUQA 1LRQA 5ECVA 4PUDA 3G24A 2HNEA 3WDHA 5CLTA 4LVBA 4AH7A 5JBEA 3KOWA 1K02A 1NIUA 1B90A 4H2HA 4JN7A 2DZUA 1EHNA 1XGEA 1A0DA 2FFIA 4NKCA 2X1UA 4RPQA 1P6BA 1LLWA 4PMRA 2Q71A 3TCSA 3KRSA 2A3HA 1PE1A 3VABA 4UTFA 4PFMA 3BLOA 3WQ4A 3TIMA 2QW5A 1V3KA 1HP4A 4AZ7A 5FJRA 1X1ZA 5E09A 4C6OA 3U3HA 1HZYA 4UR7A 4PUNA 4DBUA 5CPOA 4B2DA 2RUSA 3T44A 1YDOA 4HA4A 1LWIA 3FEMA 1XL9A 4OBSA 1US2A 1PYMA 1NDWA 3KDNA 4Q4RA 2Y6ZA 5DXXA 2EXOA 3N6JA 3WH9A 3HTWA 1T8XA 1J11A 1WDRA 2WZIA 1OINA 1QVBA 3NL2A 3PBGA 2PDJA 4M6UA 5C0QA 2W4XA 1F3XA 2DZWA 3GVVA 3W7LA 3R10A 4FEZA 4ACZA 3CGTA 4JTIA 3BCJA 3CPGA 4GISA 2RGLA 1W37A 3IJ8A 4P8XA 2WC3A 2NX1A 4IMGA 1X6UA 4KWVA 1J5TA 1CX9A 3AIVA 3G1HA 4WSKA 3OIXA 1XRSA 1V3IA 4O0KA 3ZJ8A 3MP5A 3DI0A 2J9XA 3CUJA 3GZ3A 1TIMA 3F5KA 1UUOA 4J2MA 2PBOA 1MEIA 4E4PA 1G7VA 1POJA 3LGDA 2WWCA 1QK0A 3CHFA 2OYMA 3GH4A 3ZR4A 3BSGA 1OK6A 4NXSA 4QX4A 5FKYA 4LOCA 1IE7C 3GNNA 4QJ1A 2BVDA 4H7ZA 3PWGA 2V9DA 4LS1A 1G1YA 3ZLHA 3MW7A 1L9WA 2Z6JA 3ZIZA 1FQ0A 3P5ZA 1WXYA 3N11A 3FA5A 3KS5A 5LKYA 3TDFA 2GVYA 3N12A 1KM0A 3EPMA 3DZ1A 3W22A 3W7JA 4FXFA 4DJED 3ABZA 2REQB 4PE8A 1PHWA 2J7FA 4O1BA 2BOFX 3WMLA 4LS0A 4TTGA 6TIMA 3O05A 5GJNA 3U7VA 4IMCA 3ALGA 3I7SA 2P8BA 4Y8FA 5K4ZA 3RYSA 2UY4A 1BXCA 7XIMA 1EIXA 2VHLA 3AHTA 3GDBA 4Q4KA 3HQOA 4GFSA 2UY5A 3N25A 2CLIA 1MNSA 1YYAA 1EPXA 2WLZA 1E72M 1TV8A 3A12A 3BH4A 1SSGA 1TVNA 1WDSA 2J27A 3UCQA 3ZJKA 2W79A 2O9OA 3VOJA 4QG6A 4E2DA 1KBJA 3VGGA 4QLJA 3QQ0A 3SSJA 1GONA 5BU9A 3KVKA 4MZ1A 1AJ0A 3CZEA 4D71A 1UA7A 2P50A 1DOSA 4PMDA 2GVEA 3L23A 1PZ0A 3PBYA 2DT1A 5D30A 1F3TA 4W8AA 3STFA 1ZP3A 3TC6A 1EA9C 1VKFA 4FIQA 3CMFA 1G9HA 1Q8JA 3T2QA 3MMUA 1XIIA 3DCPA 2QCDA 3LGGA 4G1NA 5JMUA 2ZOXA 1KD0A 1OYCA 1FFQA 3LS9A 2QCGA 2RDWA 3I6TA 1NDVA 2QGYA 2Z1BA 4XB3A 5LIXX 1BPLB 2QR6A 3ATZA 2ALRA 4XZ9A 3PZOA 4QISA 3A6OA 5E9AA 1CDGA 4FXRA 2X8RA 3JVAA 5HMDA 1L8NA 2NQLA 4L4MA 3S6TA 1OX4A 5BW6A 4Q8TA 4DJFC 4GC3A 4KPLA 4S3FA 4KF1A 3DHUA 4CD6A 1DP0A 4FX7A 2XDFA 4NQ1A 4US5A 1HKVA 2NWRA 1ZY9A 4H9TA 3UG5A 3EMZA 4P61A 4OFCA 2DT3A 4QNEA 2WPGA 3W1AA 4JX5A 3AZTA 1R46A 1YTKA 4I6KA 5FESA 3OQEA 4Z2KA 2WKLA 2IXUA 3M5VA 2XM1A 3EWYA 4C5YA 1DXIA 3N13A 1PWMA 3MSDA 3KE0A 2FZNA 3N3TA 1ZJBA 5HA7A 2ZICA 2XH0A 3T42A 3NEVA 1SJBA 4MJMA 1W56A 4FLSA 1HT6A 2YFOA 2AAMA 2XGBA 2A3LA 3W88A 2WMFA 3O15A 1VBJA 3SR7A 4QE5A 4WY0A 2VVSA 2DT2A 3N4EA 4YCPA 3DKJA 2HS8A 4W89A 4LW7A 3KLLA 3LQGA 3NQEA 3BL3A 5H6HA 5HATA 4E8DA 4E4UA 3ALFA 4PEEA 4MF4A 1O5QA 5D2XA 1K8ZA 2EHHA 1S3TC 1JQVA 3TP4A 1XC6A 3M4HA 4UZUA 1Z42A 1H7WA 2Q8XA 3SJ3A 4YIWA 2Z1VA 3KHJA 2PLMA 4C90A 1E9LA 4MB1A 4MAZA 4NX5A 3W24A 2EGZA 4J40A 4S3GA 2PGRA 2EPNA 3W7NA 1DXFA 3AMKA 4RXGA 4W5ZA 3A4WA 4UNIA 3B8TA 3LB0A 3PZIA 3HURA 3A47A 7PTDA 2XH2A 3CB8A 4IQDA 3PPGA 2VFEA 2WJFA 2XZ7A 3UNDA 2NSXA 1FVPA 2W0UA 1TREA 3DI1A 2V3EA 2R1KA 4R9OA 1QT1A 3PZTA 1GYNA 4DXKA 1B3XA 2VTFA 3C52A 1JI2A 3W53A 1FWTA 4A29A 1KW1A 4BJHA 2OKOA 4YLWA 4C6JA 1RCQA 4JFTA 1UD4A 2FMOA 4IPPA 4L4OA 4Q8QA 4ONVA 3OBAA 5CLWA 1EQPA 2PS2A 4TX6A 5F2IA 1N8FA 5KETA 3B03A 3ZR6A 4NP7A 3M0LA 1DYSA 1R3SA 3WL0A 4AUBA 5FEXA 2G97A 4LV4A 5JIPA 1EGZA 4N2YA 1R2TA 1Q6FA 3C2YA 1T8QA 2VWTA 1CGYA 3FAWA 2CZFA 4IXHA 4TV5A 1SO3A 1VJZA 1GT8A 1JCJA 5A2BA 2NXHA 5A6MA 4P8WA 4NI8A 3B8IA 2PTZA 3ARRA 4UTMA 4OBRA 3M6DA 3E0LA 2A85A 1W3NA 5A2CA 3HPAA 2ZRXA 4NJGA 4LVDA 2VXNA 4GMEA 1CXLA 2VX4A 4K68A 3W1PA 1Q65A 4Q7IA 3M9YA 3AZSA 3W4RA 2HCVA 1GVQA 4MHBA 2BODX 1RZMA 3EKZA 4EX4A 3AWOA 1XRFA 1H11A 3HGRA 2IKHA 3EDEA 3GKFA 4IP5A 4OGZA 2G37A 4W86A 4MWAC 1UR1A 1W0MA 1PPIA 3TVAA 2V30A 3SCTA 2FH6A 1ITUA 5EMKA 2Z28A 2BHUA 2EG8A 2O4QA 4GWEA 3IK2A 1ZCCA 1TUFA 2JKPA 2XGIA 2YDSA 3TWBA 4GYPA 3DG3A 1S1PA 1DWFM 4GKLA 2FHCA 3QY8A 3WO8A 4OU1A 5FEPA 4E6MA 3MWCA 1MUWA 2YW4A 4JTUA 5KINA 4IFRA 3KHDA 4DPPA 5A6BA 3W0KA 2CZ5A 4KRTA 3E0WA 2E7FA 3BAIA 2HJPA 1KC7A 1XPYA 3G1SA 2J9ZA 2NLYA 3ABXA 3KTXA 3FDGA 1Z9AA 3U2OA 3P82A 4WR3A 3TZFA 4A8LA 3XINA 4GBDA 3VD4A 1AH4A 2B7NA 3GXMA 1R6WA 1CI1A 2INEA 3R11A 5I3IA 4FK9A 3FIGA 2QIIA 5CPNA 4L1WA 3GK0A 1W9DM 3B8SA 3G1AA 4BQ3A 3CUXA 1A4MA 2BB0A 3ITXA 4MKNA 5H2ZA 2OB3A 7ENLA 3GYCA 3VIJA 3PG8A 4H41A 4L6DA 3T7VA 1M7PA 2CNCA 4L56A 4AHOA 3C2OA 1MMFA 5IBXA 2P5NA 5AHLA 1AODA 4ZTXA 4ALDA 1YTEA 4NHVA 1YBQB 1RK6A 4LEQA 5CPTA 2PF0A 4ZFMA 4MAVA 1ONRA 3RILA 2QS8A 4JY9A 4EKJA 1RA0A 1LOLA 3A13A 5A1AA 4PMUA 1J10A 3QKZA 4MY1A 4PUEA 5FSEC 3QSRA 1UZ1A 2R1LA 4FS9A 1XLJA 3DAQA 3JW7A 2EKGA 2F38A 3NZGA 1U83A 3NPVA 4C60A 1EP2A 3N2TA 2VEIA 3M0IA 2R94A 4NAFB 2YBVA 2INFA 4CCDA 3RPMA 1F7BA 2Q09A 5FF3A 2PLKA 1UWSA 3BLEA 1E55A 4I8DA 4O57A 4XD5A 1X38A 5AOUA 2DSUA 1TPUA 2J74A 4W7UA 3GU2A 2H9AA 1UCWA 2VR2A 3ZLGA 4IFKA 3NZPA 4O1CA 1O5XA 4U2ZA 4AY8A 1A50A 3CUIA 4Q8PA 4QE1A 2R6OA 2WVTA 3AXKA 2EG6A 3GO2A 3ELFA 3O07A 2IPFA 3VNJA 2E9BA 3VKBA 1XKJA 3POHA 4MLRA 4RNFA 1W5MA 2IPWA 1KTNA 4U5IA 2ADAA 1ZJIA 1XLHA 3WK0A 1XLMA 2R9RA 4U3CA 4KQNA 3FN9A 5BXSA 3R1ZA 4NZFA 5H1WA 3GQYA 4NF7A 3NOEA 1XCFA 3UW6A 2JALA 1VAHA 3POCA 5FJUA 2HBXA 3WLTA 4K1WA 1H0IA 2WZHA 2ACRA 1QPOA 3OYZA 2ACQA 1ENUA 4RXFA 4AB4A 3BG5A 3IGHX 3KRZA 1U30A 2HVOA 2CW6A 4CQAA 4FIRA 1XIFA 3S9ZA 3ITVA 2WBKA 3FEQA 4JQ3A 4DBWA 4O54A 2JBMA 3R8GA 4K8EA 3IVTA 4AWEA 2AL2A 3W7IA 1C3FA 3DFYA 4FO4A 1GZGA 2FDSA 1U2YA 2RDTA 3K4DA 2GL5A 3FHQA 1UMYA 3GUGA 3S1XA 5I03A 2EG7A 3LPGA 2EKCA 4AZIA 5KTLA 2CETA 4RKAA 2PD5A 3SECA 4UMBA 2C1GA 3EDKA 3ANUA 4Y7EA 3CUZA 1WZLA 4Y96A 3NJ3A 4WVXA 4MB4A 1GQLA 1N82A 1UYQA 1GOKA 1ME9A 5J04A 1C9WA 3SY1A 3MU7A 4M7SA 3PBWA 3LCHA 4PL1A 5LIUX 4JTFA 3TR2A 4KKXA 4EANA 2PEVA 3T0AA 4LC6A 3RX4A 3GDMA 3RXZA 3BO9A 4PMZA 1VR6A 1K1DA 2R24A 1MUMA 1YNYA 2J24A 1GQJA 4LRTA 3BV7A 1UWAA 1VHNA 3WDRA 1H41A 1C90A 3ES8A 3VIOA 3UXIA 3T78A 2WSKA 4A8NA 4ZSUA 1MUCA 4OE7A 4EAMA 4D8LA 1WX0A 4CCZA 3FNDA 1PDYA 4HZMA 6REQB 1RAKA 2NT0A 1ITXA 3AHYA 3TQVA 3F7JA 4HCHA 1KM2A 3B8VA 1EDGA 2HEJA 3ZZ1A 2WBGA 1O5KA 5AHIA 2MUCA 4LUIA 3GX9A 2G3JA 5XIMA 6A3HA 9XIMA 1VIZA 4TV6A 2AQWA 3UY7A 3ECQA 1KFBA 1KXVA 1Q6CA 3WK2A 1FKWA 2E68A 5BNKA 1GVFA 2H3BA 3MHFA 3UZ5A 5ABFB 3WENA 1H1ZA 3R58A 5L9FA 3H53A 5AYIA 3USZA 5DF0A 2ZZ1A 5IDZA 1W17A 1RVGA 3M5ZA 4UTWA 3ZSSA 3LXBA 3NO1A 1O12A 1XBZA 1P0EA 1DWGM 1VEPA 4U5KA 1ZAHA 2FJUB 3VMPA 3ZT7A 3WNLA 4D6JA 5A5WA 1JJKA 3RM9A 3DUGA 1W1A1 1IT0A 3ZT6A 1Q3NA 2A6LA 2FGBA 3GW3A 5I5RA 2X7WA 3DHFA 1KTCA 1W32A 3VFCA 3V3WA 3ARTA 5REQA 1DQXA 3BV4A 5B80A 1V93A 4ZL1A 2CKSA 2J25A 3A21A 3IJDA 3UWVA 2PWUA 2JGYA 3FV9A 1QAPA 1VFUA 3WF1A 3ZFHA 2WMIB 4PFHA 1SFLA 5GQBA 1R3WA 3LHTA 4POCA 5M5DA 4KCUA 2VELA 2XH4A 1XICA 4WJXA 3GAKA 1VPXA 1XFBA 3KS6A 3H70A 3AHXA 3WH7A 2HROA 4I7UA 2GYIA 1A5LC 1WE5A 5I79A 1KM5A 4DO5A 1ISYA 1QHPA 1WCGA 4G6CA 4E3TA 3EX4A 2ZZ4A 4XZBA 3MMWA 2QCCA 5TNVA 4LBSA 4QCFA 1FP8A 3LLXA 3VDBA 1GORA 1PV8A 2VR4A 3APTA 3SADA 3LBMA 4LB4A 2E8YA 3CAKA 2TPSA 1KRMA 2B0MA 3ARUA 4ZOEA 3GDLA 1EH9A 3OVQA 4LNCA 1L6GA 7REQA 1WO2A 3CU2A 1J79A 3EA1A 1NH6A 1PO9A 1Q4NX 4O0QA 5HNTA 3NQ7A 1S2WA 1TJ1A 1UR4A 1IZJA 3IWPA 1QMLA 2J8FA 3ISIX 1SFTA 4LV9A 2ZA2A 2E4TA 1PX3A 3OLDA 4MTVA 2OWCA 1H09A 1DV7A 1R86A 1E6ZA 1EL3A 2D3LA 2YLAA 1RBLA 2BBFA 4F0RA 3I10A 1CGVA 1Q66A 4ACZB 3KRUA 3H24A 3WSUA 3RU6A 1AW1A 2JF6A 4L9YA 2ZXQA 3W26A 2XGZA 2WZTA 1RD6A 4LFYA 2CITA 2WQDA 1JCTA 2CLFA 4K3ZA 2ANUA 4AZCA 3LK6A 1E0VA 1S46A 1R9ZA 4X9YA 4LAZA 2IPJA 3UGRA 4CN1A 1EO5A 4MNLA 4XD3A 3GVWA 4JTKA 1TYGA 5FJOA 1E6QM 4G5DA 2R1NA 1XDJA 5FF7A 4CEUC 1E6SM 2WCAA 4FZIA 3H2EA 4GZJA 2GFTA 4KEMA 1H1YA 2QLYA 2WNNA 4PH6A 4UFHA 2QEZA 2ZYFA 3FFSA 4Q4PA 3E38A 3H7RA 5D33A 4HZ6A 1UC4A 4ADSA 4UB9A 3L68A 2J8TA