5AHEA

Crystal structure of salmonella enterica hisa
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
244
structure length
230
Chain Sequence
MIIPALDLIDGTVVRLQRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIGSTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGWQENSGVSLEQLVETYLPVGLKHVLCTDISGSNVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQWQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATE ION
publication title Two-Step Ligand Binding in a Beta/Alpha8 Barrel Enzyme -Substrate-Bound Structures Shed New Light on the Catalytic Cycle of Hisa
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Isomerase
total genus 78
structure length 230
sequence length 244
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2015-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5aheA00
1IXQA 4EVZA 4UFJA 3CIWA 5D02A 3TH6A 3C2VA 3DFPA 1ZNNA 1L9WA 3L65A 1KM3A 2C3ZA 4LU0A 2Q8ZA 1R2RA 4UTIA 4UTUA 3NQMA 5EMUA 2J24A 4H4IA 3KRZA 4UTKA 1OFBA 3DKJA 3NQVA 2RDWA 3ATYA 1OX5A 3UQNA 3LCXA 4Z1BA 2QCDA 3G1FA 4PL1A 1L6SA 3V1PA 1NVMA 3CQ0A 4GUJA 1J4EA 4MKNA 1Q6RA 4ONVA 2ZCGA 2X30A 3DFTA 3IIVA 4A21A 2YFNA 1OYBA 4LWWA 5BRBA 4LNYA 3L5MA 3BARA 4CNPA 2TSYA 1ZFJA 5K3VA 3Q2DA 3TK7A 5HULA 1FCBA 3G1DA 1JUKA 2JGQA 3P67A 5LNWA 4IUOA 3F03K 3ABRA 3C2RA 4O1CA 4O14A 3W71A 3TC7A 4N6EA 4XKYA 3PBVA 1SO4A 3UWUA 2V30A 4ICNA 4NJJA 1TV8A 1LLWA 1W5PA 1MO0A 1FY6A 2UV8G 1H1YA 3LI1A 1VH7A 2FPYA 1XM3A 3WK1A 4YXGA 2CLKA 1FCVA 4Y90A 4Z08A 3E96A 1X1OA 1Q3NA 3KX6A 5EY5A 3WJSA 3O6CA 4RV8A 1I2QA 3M5VA 4KKXA 3GDLA 4O8RA 4M6VA 4FEZA 1VZWA 1EWEA 4UNKA 4QIUA 2VELA 5G1YA 5D38A 2DZSA 2Q3RA 1DL3A 1L2UA 3VE9A 1L6YA 1OX6A 4JTTA 4H3DA 4TR9A 1ME8A 2A5HA 1DVJA 1EWDA 4FF7A 4O53A 4S2CA 1SW3A 4HKPA 1TPH1 3B06A 1O94A 2TRSA 1OK4A 1FCUA 3P60A 1R30A 4XTIA 1GZGA 3NPXA 4AHQA 2X1RA 4G1KA 1BTMA 2QJHA 3GAKA 3O63A 3W7DA 5LGXA 3I7SA 1UUMA 3KVMA 4FHAA 1X8FA 1XKYA 1JVNA 2QJGA 3NQGA 3ABOA 3L67A 2ZRYA 3QMRA 3P8IA 1W3IA 2RH9A 3S1UA 1RR2A 1K02A 1W1ZA 1WA3A 1T0OA 1F74A 2B4GA 7TIMA 3VI2A 1P4CA 2VEKA 3L21A 2WSRA 3QM3A 3B0VC 5D2XA 5HR7A 1JCLA 1LORA 2Z6JA 5FF7A 4IJBA 5AHNA 2Z0IA 3UYCA 4ZQNA 2C0AA 1DOSA 4JTFA 1RQHA 3LCFA 8TIMA 1WX0A 3RNDA 2R8WA 2ZA3A 3RF9A 2CZFA 4JIPA 3P84A 2GPTA 3IGUA 3W84A 5DELA 3S5OA 5KINA 4E38A 3ZFHA 3RK8A 2ZRZA 4NXKA 1H7PA 1JCMP 3VKJA 3M44A 1GYLA 2B7PA 4KFOA 1QPRA 3BK0A 5L6UA 1V5XA 3L0GA 3GKFA 1LOLA 2ZZ7A 1XBZA 5FF3A 3F1QA 1X1ZA 2V9DA 2ZZ6A 4X2RA 3FJLA 1SO3A 1EUNA 1GVSA 5BW6A 1S5WA 4XWUA 2QCMA 3MWAA 5HR6A 3TFCA 1YDOA 3G1XA 3BGJA 3TMLA 1BEUA 2V8ZA 4QNWA 4Y9AA 3R89A 3I7QA 2VEMA 1AL7A 4A29A 5I3JA 1TPWA 3HG5A 2CWNA 3LHVA 1EP3A 1IIHA 4WD0A 3KRSA 2WSYA 1Z41A 2C14A 4LRTA 1H7RA 4N02A 3DENA 3USBA 4JDYA 2YYUA 1MEIA 3KOFA 3O16A 3EX4A 3LTSA 2GQAA 1VYPX 4ZZ9A 4OV4A 2GJNA 4DF0A 3LM7A 5G2IA 2W79A 3RFAA 1ZCOA 4O15A 3YPIA 2C19A 5D2VA 3EX2A 5HINA 4JX5A 2X1UA 5EBUA 2AGKA 3SW6A 3SY5A 5A5WA 1SZNA 2CLLA 1OX4A 4EWND 5J5DA 4NZFA 4UUIA 3CEPA 2EAWA 2QF7A 3LHWA 2VXNA 4HN4A 5K7JA 3CHVA 4JIQA 1TPUA 3TX9A 3W1UA 1TTIA 4BI7A 4I9AA 3IV3A 1SW7A 4FNUA 4XUGA 4NQ1A 5G2WA 3G0SA 2OJPA 3U6WA 4LVGA 2RDTA 3RLVA 3TAOA 1UCWA 2WJZA 2NX9A 2NX1A 3W2MA 4O12A 2B7OA 4EIVA 3HOJA 5KZMA 5LNSA 2P0OA 3TKFA 4X3ZA 1EA0A 4LOCA 3N19B 1LRTA 3W76A 1C29A 1EPXA 3ANYA 5AC8A 1VRDA 3GAYA 3FKRA 1SPQA 4DPQA 1JJKA 1S5VA 1YXCA 4UXDA 1FBAA 3NVTA 2PRLA 2GJLA 1NSJA 4OQVA 1VPXA 1JRCA 4S2BA 1I4NA 4LUIA 3G8EA 3W1AA 2ZZ3A 5CPNA 4MY8A 3UD6A 4JTLA 2ZZ1A 4DPPA 4UMAA 2PC4A 3BV4A 3GXTA 4JDBA 2WSQA 3S1WA 2BZNA 1OFEA 1WXJA 3L2IA 1DKWA 2XFWA 4DBDA 5CSSA 4M6PA 3HF3A 4GC4A 1XDLA 3NQ7A 4JN6A 5DY2A 4Z1DA 3VNDA 3QSTA 4LW7A 1SZGA 1SUXA 2QDGA 5FEWA 4GE8A 2YCEA 2BWGA 3WFAA 2F7FA 4K8HA 1K8YA 1DJQA 4JTSA 2V81A 1HTIA 1GTEA 3DHDA 3NPVA 3PWAA 2QCNA 4FNPA 1F05A 4X22A 1H60A 4LC8A 3LRLA 4O16A 4FXSA 1JCJA 2FB2A 2ZFAA 3BO9A 1EX5A 2NLIA 3G0UA 1IXNA 3LHYA 3G3DA 4NJIA 4LS0A 3NL3A 4JTIA 4HPXA 3M0ZA 1QO5A 1K7FA 2X2GA 4IPIA 4N9EA 4WX2A 4IMFA 1DHPA 5AC6A 3NM3A 2V2HA 3EXRA 1TYGA 1JQXA 4NVTA 2Y88A 4JX4A 3PULA 3LHTA 1W3TA 3TXZA 5AYXA 1VS1A 2ZTJA 4UR7A 1TO3A 3DI1A 1DQWA 4OBTA 3E0IA 4WY0F 1KBJA 1W31A 4JTGA 4A2SA 1U5JA 1OJXA 2AQWA 1T8XA 1XBYA 3C2EA 3I6RA 3UNDA 3S5NA 3I68A 3MUXA 3WK3A 2PE4A 3W7KA 3CT7A 3PVFA 3NZ1A 5HJLA 3SI9A 2I14A 1GYNA 5HQEA 3INPA 4R53A 4KFNA 3QF0A 3NEVA 4QISA 3W23A 1TTJA 3DBPA 4NNAA 4UNLA 2YXGA 1H7XA 3EWYA 3NAVA 5CPOA 2X1TA 1GVQA 4HNUA 1I2OA 3CC1A 4WUIA 3BLEA 1QNVA 3M7WA 2QUTA 3PS7A 3WJXA 5CZTA 5G5IA 3LXCA 3NQ6A 4ZL1A 3TMQA 1O5KA 1DV7A 5LGZA 4Z1AA 3UPWA 4WXZA 1XUUA 1VLIA 1CX9A 1RD5A 3MO7A 2E77A 2HS6A 1D3HA 3VE7A 1SO6A 1K7EA 1TCDA 3GR8A 1RV8A 5F2IA 1GWJA 3LI0A 3S5YA 4OT7A 4JTKA 1Z42A 1OFPA 1OABA 3W7GA 3EWWA 4XTDA 3THAA 1VYSX 1F73A 3E02A 4JGDA 1O4UA 3HG2A 3QEZA 1LCOA 2C1HA 3E49A 3LCHA 1R46A 3TSDA 2B0MA 4UR8A 1QFEA 1TRDA 1H61A 5D05A 3W74A 1KV8A 2RKXA 3O07A 2QCLA 4JD4A 4P61A 5FF2A 3LOTA 4GUGA 3JRKA 5DXXA 1YADA 4UTWC 5CKSA 5AHIA 3LCLA 2X16A 4Q32A 4MUZA 2A6NA 2J6XA 4CLMA 1WV2A 3QW3A 5I3KA 3S5ZA 2QR6A 5F1UA 3W2UA 3W7MA 5U7SA 5BNKA 1M7PA 1KM4A 3STGA 3L0KA 3PM6A 5LZLA 2NZLA 3DXIA 4YCPA 3PB2A 2ZA2A 3IIPA 4GBUA 2QDHA 4UTJA 3DAQA 3IIXA 5K9DA 2FPTA 4Q33A 1NEYA 1OHLA 2DJXA 3NYZA 4TMCA 3S1XA 3PBUA 1KM0A 1TREA 3O15A 4UCGA 2CLIA 3EXTA 3WK2A 1GJPA 3EWBX 4AHOA 5K4XA 2A7RA 2QCEA 3PY2A 3KFTA 3NZRA 2QKFA 1QMLA 4LUJA 3QQ1A 1GG0A 2NWRA 3STCA 2ATSA 2J9YA 1J5TA 3SZ8A 1EP1A 2QAPA 3HPSA 4U4MA 3EXSA 3Q94A 3TNOA 2WQPA 2H8XA 2C15A 4UTWA 2VFFA 4RZ5A 4UTHA 5CZ0A 1VC4A 1H5YA 3NQ2A 3IEBA 5BMXA 1PCWA 2CFFA 1EP2A 3A5VA 1C9DA 2Q3OA 3FKKA 1AW5A 4UTMA 1Q6OA 4UTTA 4FX7A 1W5NA 2E1DA 2Y62A 3T7VA 3W7EA 1ZAHA 5G4WA 4FNRA 3TCEA 4FNSA 3FA5A 3NA8A 4M6QA 1N8FA 3A23A 4GWEA 1LM1A 4U28A 1NF7A 2ZRWA 4L4LA 5TQLA 3W07A 2GQ8A 3TXVA 1TQXA 4Q4KA 4BWLC 4PFMA 3PBWA 4N4QA 4O52A 1TPVA 4OE7A 3W1QA 3LHUA 4TMBA 3W7HA 3C61A 2Z2UA 3MBFA 3NL6A 4JEQA 1FDYA 3HBLA 3UXDA 5KZDA 3NQFA 3QJAA 4KWVA 2AAMA 2VFIA 2V5LA 3UWWA 2QAFA 3C8FA 4FIQA 4PCFA 4MY1A 3FFSA 1BWLA 2R14A 1TJPA 3LB0A 3CIXA 3O8AA 1TPFA 1GOXA 5A8GA 1OFDA 3HGSA 3PC0A 1FQ0A 3TR2A 1WOBA 3TE9A 3NPUA 1YXYA 3BG5A 5C55A 2BSLA 3T55A 3P80A 5G2HA 2FJKA 2G97A 4NZJA 3DFSA 2EKCA 4UMCA 3IGSA 3E12A 4WXYA 2Y6ZA 3TROA 1FWSA 4UFLA 2RDUA 1HFBA 4X9SA 4BWLA 3W2NA 1TPB1 2P1FA 3LLDA 2VOMA 3L9CA 3GNNA 3LBMA 4AHPA 4OV9A 4JYDA 1Q45A 1A5SA 2NWSA 3OIXA 4JNMA 4M7SA 2EHHA 2CLOA 3W1XA 3LGEA 1LTDA 3DI0A 3M5ZA 1KFLA 3QYQA 4ML9A 2X1SA 1WBHA 4O11A 2GOUA 2YW4A 3KVLA 1FWRA 1F6PA 4FIRA 3R8RA 4K7YA 3G18A 3W83A 4O50A 3N3MA 1XXXA 1ME7A 1TV7A 1UUOA 3W86A 4DXVA 1A5BA 1W8SA 4N4PA 1HO1A 3DU0A 3IIOA 2Y7EA 3LLFA 2H6RA 3BW2A 4O18A 2GUUA 3W1RA 4IMEA 1I8JA 2DZUA 5AOUA 4GNJA 2ABAA 2YX0A 3U2OA 1H50A 3QC3A 2E68A 1VQTA 1U83A 4KWWA 3EX3A 1WYIA 2QCDB 4JXCA 2JGYA 1SW0A 5SWUA 3UPBA 3W22A 2EGZA 1GPWA 3I65A 2RHGA 3PF3A 1XUZA 3HGOA 1ZALA 5CG7A 1TMHA 4HIBA 3MJYA 5GVJA 3ZS4A 2A21A 3DGRA 3RLUA 3IVTA 3PUDA 4K38A 2H3DA 3A9IA 3M43A 5LHFA 2RFGA 5E1QA 2V82A 2CZDA 4AWUA 2CLEA 4XKYB 5BOOA 4R7JA 5IBXC 4CCEA 4MJMA 2DU2A 3NQ8A 3HPZA 1Y0EA 4ORIA 3QPZA 2VKZG 4ORMA 2A4AA 2Y7DA 2Y85A 4MLRA 5F4XA 1FX6A 4ZMGA 3UZJA 3DHFA 1ICQA 5C6MA 4LVDA 2HTMA 1DBTA 1GVRA 3MHFA 3PSWA 4DELA 1OFOA 3H54A 4AEOA 4AXKA 3LV5A 4O19A 3H53A 2B7QA 5DY3A 3SECA 4Y8FA 1WAUA 3NXFA 1S3HA 1PIIA 3G22A 4BK9A 5LNUA 1OG0A 4YMZA 3G24A 2HMCA 3O1NA 4O4VA 2TYSA 3W7JA 3HG3A 5KITA 1M5WA 4ZQOA 1S5TA 3O06A 4HNVA 3SJ3A 5D04C 3ABQA 3C52A 4AWTA 2VFDA 3KHJA 4MFDA 5AHEA 2QUVA 2C13A 4LTSA 4JS3A 3CTLA 3PBYA 1TQJA 5J5RA 3U8GA 1KTNA 1OF8A 1YTKA 3SGZA 4YWIA 3EWUA 1SFJA 1YDNA 4LVBA 3B05A 3HG4A 2BXVA 4JYEA 2BTMA 3W7QA 3OHIA 3AO0A 5EYWA 3GNDA 2PCQA 3NO5A 1EIXA 2CW6A 4ZQRA 4K8EA 1G6CA 3M16A 5DCEA 3W1TA 1G4SA 2QCHA 4ADUA 4AF0A 4DO5A 4MY9A 3THQA 3NG3A 2A6LA 3PAJA 4WY0A 4AVFA 4GUIA 1QOQA 3BLIA 1W5OA 3LRKA 2FQIA 3BGGA 1TPC1 1AL8A 4CCCA 3EX6A 1KM6A 3FJ6A 1CI1A 2C6QA 3K30A 1XCFA 1GQNA 1Q6QA 1YTDA 3LERA 4Y6GA 5AN7A 5K2ZA 2NUXA 4DO6A 2A7NA 3GKAA 1QR7A 3C2OA 3W2KA 2Y63A 4N6FA 4OU1A 1KA9F 4QNEA 4LY8A 3S6DA 3RU6A 2Z1BA 2D73A 2NV1A 2GVJA 2Y7FA 4K39A 4UFHA 2C18A 2G5WA 3TC6A 3IGXA 3G8RA 4LS2A 5HWJA 1ZAIA 1IXPA 3G1VA 3OVPA 4MPQA 5FF4A 3SIZA 1JCYA 1OVDA 4BI6A 3M5YA 3ZWTA 4XZ9A 5FESA 4LRSA 2OT0A 3W2JA 1G4EA 4IOTA 4UTLA 5E93A 3HPXA 3L0NA 1PHWA 2CLHA 2B7NA 1PVNA 3LDVA 4E2BA 1SR9A 4AWSA 3PB0A 5KZEA 4C1KA 1R2SA 2FB3A 1F6KA 1A5CA 2WPBA 4NJHA 4M5PA 4C1LA 3TDFA 3B4UA 1FWWA 4LVFA 3MYPA 5D30A 2ZRUA 2HS8A 3KAOA 1PE1A 4HSNA 3MI6A 5G1TA 3F4NA 4RK8A 3C0JA 2WOQA 4NJKA 4CQ8A 1JRBA 1RQEA 1NFBA 2ZRVA 2I9EA 4IX0A 4K7VA 2O7QA 3BPWA 3UWVA 4PL2A 5DCDA 1GTHA 2F84A 1TPDA 2ISVA 2IQTA 4DQWA 3HJZA 5C5YA 2YDAA 3M6YA 5I3FA 3UWYA 1QPOA 3CLMA 3ABSA 3R2GA 1LROA 3T44A 5K9CA 2G96A 2Y70A 1MZHA 2YZRA 1KTBA 4RR4A 3RMJA 1F7BA 3W2LA 1OX4B 3M9YA 1I2NA 3OG3A 4P2VA 1EB3A 1KFEA 3M1ZA 5LNVA 1IIGA 4FX6M 5U4NA 3WJYA 4TX9A 3WJWA 1WDWA 1LZOA 1ADOA 1VLWA 1XDMA 5AC7A 5CZJA 1QWGA 3GK0A 2G95A 3LBCA 2FPVA 4OHQA 2V0TA 3W7OA 3W7CA 3ZWSA 2A85A 4LC6A 3G0XA 5D2WA 4UFMA 4NX5A 4WOZA 2NUYA 4NUWA 4RX0A 2XN0A 5EPDA 1PCKA 4JICA 4O28A 2ISSA 3BG3A 3GDRA 3C2FA 3B03A 2CU0A 4XQ6A 1Q6LA 3VFLA 2YW3A 2O7SA 4IX2A 3GDMA 4O0KA 3MW7A 1LYXA 4LS1A 2LLEA 2QCFA 3MBDA 1TTQA 3FIGA 1WBJA 4OGZA 4WJEA 3W1LA 3SR7A 1VGAA 1RQBA 5HUPA 1K7XA 4BFAA 1SO5A 3DFQA 3PG8A 5AHLA 5CZSA 3W7IA 1YDVA 3B0PA 2E6FA 4ZVJA 2VEPA 1VR6A 3W70A 3SGUA 3T40A 1OK6A 3OA3A 3M5XA 4QAIA 3W1PA 4IMDA 2ZQ0A 3GXNA 1KW1A 1E51A 3QPYA 3NQEA 5F4SA 3NPWA 1TV5A 4DBEA 5DBTA 1WQ5A 4FB7A 1B57A 4WOQA 5CGQA 5EA9A 1Z48A 3M47A 2E6AA 2WV8A 3DFOA 2A2IA 3NNTA 1OFQA 4FNTA 4RLIA 1LOSA 4MZ8A 2ZA1A 4RZ4A 2CZ5A 4I7WA 1W3NA 3P8JA 1G7UA 4ZQPA 1RZMA 1M7OA 2QEZA 1KM1A 1KTCA 2GVGA 4R33A 3QH2A 3KVKA 1ZENA 1ML1A 1VCVA 3G1AA 3B04A 3W7NA 1YLVA 3B8DA 1GVFA 2QUUA 2FTPA 1JULA 2OMAA 1H62A 4S1FA 4JTEA 1BKSA 1ME9A 3G1YA 4XBSA 1PV8A 2FLIA 4MOZA 1M6JA 2WNNA 1H7OA 2NUWA 2VFGA 1KFJA 3SSJA 1JCXA 3LCGA 5I3HA 2DZTA 4MIMA 1D9EA 2R91A 1ZHAA 1R2TA 2W0UA 1QPQA 3E9AA 2VC6A 3TAKA 3NL5A 1RVGA 4DF2A 2E6YA 3C3NA 3STEA 1G7VA 1H51A 2Y61A 5C54A 4QJ1A 5DCBA 3GDKA 5HUOA 1AG1O 2R94A 4UC5A 3TW6A 5HWMA 1HG3A 1QCWA 1LBFA 2YFOA 3W3OA 4FNQA 1A5AA 1J2WA 3EX1A 3UZ5A 2YYTA 4ZQMA 1YPIA 2E5DA 1ONRA 3L5LA 1SSGA 3C56A 1LLZA 1N7KA 5C2XA 4JYFA 3N14A 1P0KA 1PHQA 2CZEA 3TFXA 3BW4A 3S0CA 1JCNA 1DORA 4LT9A 4RXGA 3A24A 2Q8LA 5FEPA 4Z0JA 5K9XA 4E0CA 4CNNA 5CPLA 3FS2A 4MVAA 3CWNA 1G4PA 2ISWA 3NQAA 5AHMA 3UWQA 1FXPA 5DN1A 3S9YA 1O5XA 4TO8A 3TA6A 4IQLA 1F2JA 3HB9A 1WOAA 2VFEA 3KRUA 3NDOA 3C6CA 3WJZA 3IRDA 1T99A 3L66A 3EKZA 4FO4A 4LV4A 4WZHA 3EWXA 2H90A 4HSOA 4A2RA 3P7YA 3MI3A 4MZ1A 1KLYA 1G67A 1TSIA 3B0UX 3MYOA 5CPMA 5FEZA 4B5NA 4I7UA 1OYCA 2ABBA 5HMSA 1EUAA 5F1VA 1K8XA 1KFCA 2V2CA 3LTPA 1XC4A 4N9DA 5H2ZA 4TU1A 3PUEA 2DZXA 3I7RA 2ZYFA 3MP3A 3CWOX 4PEKA 2CLFA 1KM5A 4Z1CA 5LNRA 4UFIA 1SZFA 4FX8A 5I3IA 3P62A 1BWKA 1W5QA 3LCIA 1ICSA 1O95A 1X7FA 1W5MA 2DORA 4O1AA 2QCGA 4FXRA 4PODA 2PURA 4H6KA 3W7PA 1CW2A 3STFA 3HIJA 2PRMA 5HWNA 3H55A 1MXSA 3TJLA 3MI2A 5F2GA 3UY7A 4MZYA 3P74A 3MHUA 3ZR4A 1I45A 3FYPA 5DLCA 2QJIA 6TIMA 5AHFA 1AW2A 3T4CA 2V2DA 3S1VA 3HQ1A 3CB8A 1FUYA 2ZZ5A 3M41A 1LP6A 2J9XA 3TV8A 3GDTA 4K6AA 1ZY9A 4O4WA 1P0NA 1I2RA 2OT1A 3NM1A 4JY9A 1KLZA 3TJXA 4YL2A 4DF1A 1JR1A 1QOPA 2TMDA 4QM1A 1V7YA 3GXPA 4HT3A 1GG1A 4WQ6A 1VHCA 5D33A 1KFBA 3A5FA 1G4TA 3W7RA 3Q37A 5EKYA 2V5BA 1K8ZA 2W6RA 3N9SA 3V75A 3NOEA 1JQVA 2H3BA 4O0ZA 2A1YA 3JR2A 1NF0A 3QMTA 2EPHA 2Y89A 1F5ZA 3TSMA 5HNRA 5D37A 1TJRA 5F2MA 1JUBA 3AJXA 3CPRA 5AFDA 5D2TA 1A53A 5KTLA 2NXIA 2ALDA 5FEXA 4M19A 2I1OA 4IMCA 3W9ZA 1FWNA 2YGYA 2NXGA 3LTYA 5AYYA 3QQ0A 4O13A 4CQ9A 2NXHA 1W37A 3TSBA 2KZHA 3LXBA 3P82A 4D2JA 5TBOA 4QSHA 3N9RA 4HPJA 4N2YA 4MYXA 1SSDA 2J27A 1UASA 3S8HA 2JBMA 1UB3A 3SFKA 3QZEA 4J9JA 1K03A 4N9BA 3QMSA 2VFHA 4Y96A 2CLMA 1OF6A 2PRHA 2GQ9A 3C4UA 1FXQA 1XFBA 1VYRA 2TPSA 3W7LA 4JX6A 3GZ3A 2FFCA 3DH7A 3A21A 3R13A 4QITA 1UBSA 5D09A 3PSVA 1LOQA 1FDZA 4RXFA 2E5CA 1W56A 4HNTA 5D2YA 3P81A 5IBXA 1SFLA 3D0CA 1SZEA 4O10A 4AAJA 1KFKA 4POCA 4MJZA 2VEIA 3FLUA 3GVGA 4K36A 4GJ1A 4BF9A 1W54A 1AK5A 1OFRA 4PA8A 4XBKA 3FEMA 3CU2A 3TQVA 4EOUA 1TIMA 2FDSA 4CQAA 3F4WA 4GUHA 1GVOA 5F2LA 1L6WA 2OCZA 1G69A 2JK2A 4A3UA 1OYAA 4ZQCA 5TIMA 1PS9A 1FWTA 3O6DA 5I3GA 2JKEA 3PR2A 4UMBA 1B9BA 4IWWA 4DEFA 2C16A 1TTPA 3GIYA 3UY8A 4CCDA 3LRMA 1C8VA 3N34A 3FOKA 4EF9A 3DFNA 2XN2A 3CM4A 5AYZA 4E2DA 3W75A 1RPXA 3W85A 5D03A 3O6YX 4IGHA 3TUUA 1AW1A 3QW4B 4IXXA 1H1ZA 1TRIA 3N2XA 4PC8A 3LXAA 1K3UA 1B3OA 3UWZA 2DZVA 4MFEA 1B4KA 1HUVA 3QFEA 4NT0A 4NJGA 4LV9A 1QO2A 4ALDA 3MP4A 2WNQA 2ZDRA 1X6UA 4JR5A 3W87A 2YSWA 4AB4A 1UJPA 3EEGA 3P5YA 4GFSA 4GXMA 4EF8A 2WNZA 3ATZA 1LRNA 3O05A 3TU9A 2BX7A 3HMJG 5T26A 4UIOA 3OEXA 2HSAA 1AMKA 1ZAJA 2FIQA 5K4ZA 1VCFA 5KSWA 1IGSA 1VHNA 3L5AA 5EL1A 3MMTA 3R5EA 5DBUA 3OVRA 2E6DA 5D32A 3IVSA 3W72A 5MHBA 3NR0A 4K37A 4M7TA 3NQDA 2DZWA 2P10A 3GB6A 3P61A 4NNCA 3N2MA 3N73A 4O1DA 5ABTA 1ICPA 1N55A 2A7PA 4O57A 3G3MA 3Q58A 4HHPA 4CNOA 1FDJA 4JTJA 1I2PA 1XI3A 4NXSA 3DZ1A 4IMGA 3ELFA 3NGJA 3R12A 3FYOA 3T78A 3EWZA 4BR1A 1QPNA 2BLEA 3PG9A 3UXAA 1P5BA 5BMWA 2E09A 2VENA 2OZ0A 1IXOA 3G1HA 3BG9A 6ALDA 2H8ZA 3LCWA 4YCOA 4A22A 4RCXA 2ZZ2A 3BLFA 4OWGA 1VJIA 4O1BA 2NV2A 3LHZA 1PL9A 1OFAA 3W73A 5FF0A 1H63A 4DO4A 4AF0B 3W88A 4RJEA 3HGJA 3IIZA 2WKJA 3JS3A 4RKAA 4O54A 4WY0B 3NL2A 4Z0SA 2XN1A 5KMYA 4UFKA 1JUEA 4KFPA 4JTUA 1H7NA 1YXDA 5AB3A 1YTEA 5G4EA 4NNBA 4O17A 5LHEA 1VCGA 3P5ZA 3CEUA 1THFD 3PUOA 4IPJA 3L68A 4W9TA 1DJNA 2JKPA 4MYAA 3MP5A 3VCRA 1F76A 1P1XA 1XL9A 2ZTKA 3LV6A 1GT8A 2ATMA 2WO5A 4L4MA 1YPFA 3KXQA 4I7VA 4ADSA 3KVJA 1NAL1 2EF9A 1LRQA 1KBIA 4PTNA 4R34A 1SU5A 4ADTA 1HO4A 1R47A 3A22A 3EB2A 1MEWA 5H91A 3W6YA 1KV5A 1HL2A 4N9CA 3TQKA 4AMAA 1YYAA 2YR1A 4JTHA 3WK0A 1TPEA 3HO8A 5E0KA 1MSSA 2DP3A 1H7WA 3GX9A 3W1MA 1TB3A 5IM51 2QCCA 1GEQA 5FI8A 4YLWA 3TIMA 3DKLA 1QDSA 3W1NA 1W0MA 4TIMA 2ZZ4A 1LDCA 2J88A 2ZBTA 1O60A 2JKAA 5L9FA 1EEPA 1ZJIA 2A0NA 4BI5A 1FCQA 1ALDA 1XBVA 2NX3A 4HNNA 2Y7GA 3QSRA 1LBMA 4RZ6A 2GVLA 4MLJA 1B4EA 4NU7A 1SQ7A 1LBLA 3BW3A 4NX0A 1Z44A 2ZRXA 3NQCA 3EKLA 3QRHA 3OBKA 3TQ0A 3IVUA 5CSRA 1A50A 5DXYA 1IF2A 3TW7A 1DQXA 4PH6A 4UTTC 2Z6IA 1XBXA 3OVQA 5LSMA 3GYEA 2DZPA 5LKYA 1QAPA 3LX9A 3GR7A 1MEHA 3BVJA 4JY8A 1T96A 3S42A 2E5BA 3MHGA 4LVAA 3HGRA 1D3GA 3GLCA 4AH7A 4QQ3A 2J9ZA 2YPIA 4IXHA 2OX1A 1KM2A 4GRSA 4GUFA 3G1SA 5F4WA 2DJLA
chains in the Genus database with same CATH superfamily
1IXQA 4EVZA 2VRJA 2F8QA 3TH6A 1UG6A 3AS1A 2WJDA 2J78A 2E25A 3L65A 2B31A 1R2RA 3NQMA 5EMUA 3ARWA 3QVQA 1HNYA 3CV2A 2Z1XA 1NH6A 5JBEA 2RDWA 3ATYA 3MV11 4EKJA 3UQNA 3G1FA 4TQTA 1NVMA 1J4EA 4MKNA 1Q6RA 1J0HA 2ZCGA 2X30A 3RO6A 3N12A 2YFNA 4QX4A 3L5MA 3Q2DA 4Q8WA 1ZJAA 2VZSA 1SJBA 3TK7A 5HULA 3WLNA 3CHFA 3CZEA 2VZVA 4O1CA 3C2RA 1HGWA 3WQVA 1Q4WA 4JL2A 4P7RA 3PBVA 1J12A 1TV8A 3L12A 4OKDA 1W5PA 5A94A 2VGGA 4DJEC 2UZ9A 4PUNA 4WLCA 1GHRA 3WK1A 4YXGA 1FCVA 2OLHA 1E6XM 3E96A 3KX6A 5EY5A 2WBGA 3O6CA 1XH0A 4RV8A 2Z2AA 3GM8A 3M5VA 1I9CB 3KP1A 3ITYA 1IT7A 4O8RA 2YBTA 1VZWA 1O7AA 3CV7A 5FD0A 1GJWA 2VELA 5D38A 2Q3RA 1DL3A 3OA5A 1ZPTA 1RH9A 4JTTA 3HQNA 5FSEC 1GQIA 4O53A 3K2GA 4IIEA 3TYDA 1KRAC 2WANA 4AEEA 1O94A 3P0XA 3P3BA 4ACZA 2X42A 1CNVA 1C9WA 1FCUA 5A6KA 4HSHA 1XR2A 3CUZA 3MO4A 1R3RA 3W7DA 2RGLA 1UUMA 3CO4A 3BMVA 4QCEA 4UQAA 3NQGA 3ABOA 2ZDSA 1JPIA 1RR2A 4D6JA 5HQMA 1J6OA 1W1ZA 3WLOA 3H2NA 2VEKA 3L21A 2RJGA 1NWUA 1JCLA 1PPIA 3SUSA 4ZCWA 4TVCA 4ZQNA 2DIEA 3WFLA 3CIVA 4JEJA 4JTFA 4L9ZA 1M01A 3MA8A 1WX0A 4MDOA 1YPXA 4ZEPA 3AYVA 2R8WA 4U5KA 3RF9A 3P84A 1R3TA 2GPTA 2D69A 3ISIX 3W84A 1M68A 5DELA 1T7LA 3MKCA 1JDAA 4XIAA 3M44A 4I90A 4C6KA 3SSZA 3BK0A 3O0FA 1W8GA 3GSMA 3UZWA 3F1QA 2V9DA 2ZZ6A 1TZ7A 4GFIA 1EUNA 4YS1A 4RNFA 1OADA 1WKEA 1RBOB 3BGJA 4C6MA 4NY2A 4NAFA 4XSLA 3WQ4A 5I3JA 3LHVA 4WD0A 3G6LA 3M7SA 3HPAA 2PB1A 4LB4A 3EWDA 4FZIA 5EGRA 2AL2A 1Z41A 2C14A 4PRWA 4IFKB 4GYFA 4JDYA 3GR4A 1U5VA 3KOFA 1DWJM 3LTSA 4ZZ9A 4AG0A 1ITXA 4DF0A 3IV8A 3GNPA 4FF5A 3RFAA 4O15A 4IGNA 5D2VA 4DI8A 3H21A 3EYPA 2DT1A 1ECQA 3O2LA 3DC0A 4IJRA 1LQ2A 3BSGA 1OX4A 4PUUA 4NZFA 4CQCA 4JIQA 2YA2A 4BI7A 4D1IA 1K9TA 4KESA 1SW7A 1MRAA 2FTWA 5HNUA 3H6OA 2Y0FA 2PWUA 3RLVA 1UCWA 2WJZA 3E0WA 2NX1A 4O12A 4JTDA 3GHUA 5HA7A 1JCTA 5KZMA 4OJYA 3TKFA 1LRTA 2EXOA 1HJQA 2VVNA 1C8QA 3ANYA 3GAYA 3AJ7A 3PPGA 3AIUA 4H41A 1J0KA 1SPQA 1EH9A 2HROA 1M65A 1JJKA 1LT8A 2PEVA 1YXCA 2GWGA 1FBAA 2OWWA 2GJLA 1I4NA 4LUIA 2HXUA 2PP3A 3A3WA 5CPNA 1QRQA 1Y7VA 1BAGA 2WC4A 4JTLA 3GNOA 5DMYA 2ZZ1A 1PYMA 2G3JA 3LZ3A 3O6AA 4PEEA 1WXJA 4BQ5A 1K70A 4E8GA 2XFWA 4DBDA 1XDLA 5DY2A 3ALFA 1SZGA 4EPDC 5EMLA 1PIGA 2RGMA 4GZ7A 1R87A 4JTSA 1GTEA 3UR8A 3VX1A 2EPLX 1HX0A 2QCNA 3ARPA 4FNPA 4B4HA 3U2ZA 1H60A 5E9AA 3LRLA 1JCJA 1MZRA 1JDDA 4AD4A 2VX5A 2VEGA 1EX5A 1M04A 2NLIA 1GOIA 4YYFA 1V77A 1NWTA 3G3DA 1KXQA 3QOKA 2V3FA 1VBHA 3W38A 4HPXA 3M0ZA 1GQKA 1QO5A 4A3RA 2X2GA 2IMRA 1NM9A 1J18A 3T0DA 4KIEA 4LAUA 4ZOCA 1VS1A 4RZBA 3HM7A 4UR7A 4H9VA 3DI1A 3A3HA 4WY0F 2WJEA 4Q6XA 5PTDA 3VGGA 1FWAC 2AL1A 3UNDA 2XG9A 3S5NA 4C1NB 4JBRA 3MUXA 3A4XA 2PE4A 3PVFA 1QJWA 4GY0A 3R1ZA 3VDGA 2A79A 4DNHA 3LQGA 3INPA 3NEVA 1GZJA 3QR3A 3W23A 4V1XA 3DBPA 4D6CA 4PUEA 1JZ3A 1XICA 4OZOA 1OC7A 2PDCA 3R6IA 4Q8TA 4WUIA 3BLEA 1MW1A 1XX1A 2QUTA 3WJXA 1ISXA 3N2BA 1O5KA 1DV7A 3WF0A 4Z1AA 3UPWA 2BG5A 3AHYA 4WXZA 4HZ6A 3WELA 2E77A 1UW9A 1D3HA 1K7EA 1GWJA 6TAAA 3S5YA 3H2FA 2AQVA 3VGDA 4OT7A 4HCLA 3CXOA 4TVUA 3LNPA 4XTDA 2CLPA 3D3FA 1VYSX 2BOFX 3CMGA 1UR3M 4JGDA 3QEZA 5CJMA 1R46A 4PMNA 3TSDA 4UR8A 2F6KA 1XV8A 2QF8A 1H61A 3UPMA 5D05A 2YL9A 3LOTA 4UTWC 5FACA 1JAKA 3FAXA 5AHIA 3OGRA 2X16A 4QLLA 1TWIA 1WV2A 3EOSA 2QR6A 1FP9A 3W2UA 3W7MA 3PM6A 1D7FA 1Q66A 2IQ0A 4GBUA 1FRBA 3ES8A 1QW7A 2DJXA 1UKSA 2GYIA 3FGCB 1EDQA 4DX3A 5LIYX 1W1VA 3EWBX 3KTSA 1TV2A 1C7TA 2A7RA 3PY2A 3KFTA 3NZRA 4AMCA 1GG0A 3MTWA 5GJMA 4TXEA 1XH2A 2OQLA 3BJSA 4R7WA 3VNJA 3TNOA 1IR1A 2VRKA 3ZT6A 2VFFA 3P14A 4UTHA 3H26A 3A47A 1VC4A 1H5YA 1RPKA 3IEBA 1F8MA 4OTKA 1PCWA 3BSHA 1EP2A 1C9DA 1K6AA 4IJCA 3WL0A 2X1IA 4UTTA 3VNLA 3UZXA 3CTTA 3GXIA 2Y62A 3CQHA 1TMLA 3ITTA 3TCEA 1VD6A 1DIOA 4FNSA 3EBVA 4M6QA 1N8FA 4PUWA 4HZ8A 1LM1A 4U28A 4L4LA 4JOMA 3W07A 1TELA 3EA3A 4OE7A 2O55A 3FA4A 3BANA 3W7HA 2QLYA 2Z27A 1CLXA 1OCQA 2NT0A 1JI1A 2J4GA 3BAJA 2D1ZA 5A2AA 1BQGA 3QJAA 4QCFA 2VFIA 1OIMA 4Z2KA 3B8VA 1TJPA 2QPUA 3O8AA 4LANA 1TPFA 1RCXB 1OFDA 3HV8A 4PTWA 3CQKA 4TOQA 1WOBA 3QY7A 2IXVA 1XSKA 3T55A 2BASA 4AIUA 1S2VA 3CH0A 3V5FA 5AECA 3E12A 4WXYA 3K4WA 3TROA 4DB7A 2J7EA 2R24A 4UFLA 2A3HA 2ZWYA 4X9SA 1CEOA 1JYNA 2P1FA 4MB5A 3L9CA 4KCVA 3LBMA 4Q6JA 4AHPA 1Q45A 1A5SA 2NWSA 4JNMA 1HGYA 1MRQA 1VIZA 2R1PA 2CLOA 5EMJA 2VI0A 3W1XA 1XIGA 4F40A 3LGEA 1XD0A 3L7RA 4C6QA 2EO7A 3ZO9A 1JF6A 3QYQA 2CHOA 1FH8A 2G41A 4ML9A 1ZU8A 4X60A 1JL8A 2YW4A 2ZE0A 1FWRA 3G18A 2PD9A 1XC6A 3TR9A 1TV7A 1UUOA 1HQTA 1DP0A 1J10A 4MF4A 1HO1A 1KWGA 2H6RA 2NVDA 2WJFA 3FV9A 3UJFA 4B92A 4IMEA 1TR9A 3U2OA 3K1DA 1XGDA 2E68A 1RXOB 1TMQA 3LPOA 1WYIA 3TZNA 1SW0A 4HA3A 3W22A 4NAEB 3I65A 3PF3A 1XUZA 2QDEA 3BZGA 4XAYA 3L4UA 1IWPA 4H8NA 2HE5A 1BXCA 1JXJA 3MJYA 5GVJA 3ZS4A 5M03A 4YWSA 4EAYA 3UNTA 3AXIA 4K38A 3M43A 1XCWA 1CGWA 1F3WA 2V3EA 4J3WA 1EOMA 4NZ3A 5IBXC 2DU2A 3EA1A 4ORMA 4W8BA 3GNXA 2A4AA 2Y85A 1Z3NA 4MLRA 1FX6A 4ZMGA 2OX4A 2W4XA 3DHFA 2HXTA 1ZZMA 2HTMA 4WKAA 1GVRA 1HJVA 1R9XA 4I6KA 3WD3A 4UQEA 1VEOA 1OSEA 2G3MA 3DG3A 4AXKA 2XSAA 3H53A 4D6GA 3R25A 5BU9A 7REQB 5DY3A 3R58A 4S3DA 3JW7A 5AKQA 1BFNA 3LLXA 3ZQ9A 4BK9A 4JIEA 5C7VA 3O1NA 2PZNA 4O4VA 3GHTA 4BS0A 4MSSA 4HNVA 3ABQA 3TYUA 2BVDA 1C8YA 3KHJA 3I6TA 5AHEA 3U7BA 2BHZA 4GCXA 4JS3A 4Z17A 4DO7A 3C2YA 1UD5A 2ZVRA 1O1ZA 1JF5A 1KGWA 1BRLB 5HMDA 2Y4SA 4LVBA 3B05A 2BXVA 4JYEA 3RU8X 3WBEA 3ZIZA 2Z26A 4YTRA 3GNDA 3TJ4A 3NO5A 2PCQA 3EDJA 4K8EA 1YQ2A 1G6CA 3FW6A 5DCEA 3PWIA 2QCHA 4MY9A 3WBWA 4L6DA 4WY0A 5I09A 4AVFA 4EPBC 4EXBA 4GUIA 3BLIA 2XTKA 1GOQA 4OOZA 1VEMA 3BGGA 1KM6A 3VDBA 2GDQA 3W81A 2C6QA 1C92A 1PX3A 1Q6QA 3CV1A 1QR7A 4PB4A 3C2OA 5A6BD 4XAFA 4N6FA 3NQBA 4QNEA 4LY8A 3W27A 1ADSA 4V1YA 3RU6A 2Z1BA 3BOFA 3AMDA 3TC6A 1E43A 1W6TA 4WJXA 1HL9A 4LS2A 5HWJA 3ZVHB 3OVPA 3SIZA 3VIIA 3BTNA 3WN6A 3NSXA 3QR1A 2VOTA 4QJ5B 4MGGA 2DW7A 4MHBA 4UTLA 1FHLA 2XIBA 3P0WA 4H04A 2FYMA 1MW3A 1PVNA 1E9YB 2WSPA 4PMRA 1LUCB 5JMUA 1UR2A 4QLKA 1PE1A 3BUVA 5G1TA 3C0JA 1MDLA 2WOQA 1M03A 1NFBA 1XIMA 2PODA 3H2AA 4REQB 4K7VA 2O7QA 4ML4A 4A4AA 5DCDA 4HK6A 2VCBA 2HVNA 4KEZA 4DQWA 2IXUA 1B5TA 2ACUA 4IGMA 3M6YA 5GJPA 3OO2A 3ABSA 3L4TA 1CXIA 5K9CA 2Y70A 5LYRA 2QUNA 3WZ0E 4W93A 1RD6A 1TWDA 1F7BA 4DYKA 1WZLA 2WMIA 5JUVA 2V5JA 4G7EB 4I5UA 3GIPA 5CPQA 5LNVA 3KTCA 1Q2SA 1Q5MA 5U4NA 4ZODA 4TX9A 1LZOA 1VLWA 5AC7A 3SCPA 3GH4A 3W26A 2XSBA 2TAAA 2G95A 3OLIA 4OHQA 2XVNA 2PWVA 3ZWSA 2IPGA 2A85A 3WH9A 2AGTA 1PJ9A 4GQBA 5EPDA 1V4YA 8A3HA 1ZTVA 2ISSA 2XIIA 2CU0A 1E4LA 2DUXA 3SCNA 2O7SA 4IX2A 3MW7A 4E8CA 3N2OA 4OUEA 1J0YA 2YZ5A 3MDUA 1TTQA 1WBJA 3W1LA 4ATWA 3DX5A 1BXBA 2YOCA 1PUDA 4AD3A 2DSVA 4JTRA 4C5YA 5D9MA 4BFAA 3GVRA 4V15A 5CZSA 1VFSA 4LCQA 2E6FA 5T8GA 1VR6A 3SGUA 3OA3A 3M5XA 2ONEA 1A0CA 3ZOAA 1OEPA 3GXNA 4EX4A 1KW1A 5F4SA 1TV5A 3DYMA 2OGYA 5DBTA 1B57A 5EA9A 3IJ6A 3VMPA 2E6AA 2WV8A 3DGBA 2BB0A 3LZ5A 1OFQA 2ZUWA 2REQB 1P6WA 1LOSA 2V63A 1XIHA 2ZA1A 4RZ4A 3VKKA 2CZ5A 1XRSA 2D2JA 4I7WA 3P8JA 3VUSA 3QZAA 3P2VA 4ZQPA 1RZMA 1B54A 2GVGA 3DHUA 3FDGA 1VCVA 2VX4A 3B04A 3FCPA 4GI4A 2HVOA 2OLAA 4KWSA 2OMAA 4S1FA 4URIA 4PUMA 4MOZA 1H7OA 1KFJA 2CPUA 1E4MM 1LQ0A 5EBAA 1K6WA 1D9EA 4L4OA 3IWPA 1XLFA 3VDCA 2X8RA 4LNCA 2WHJA 4IH3A 3TAKA 4ZOAA 1XS2A 2AMXA 1A5UA 1G7VA 5C54A 5CLTA 4ZSTA 3UU0A 3OW1A 2FHCA 1AG1O 2P0IA 4LBUA 2R94A 3IARA 4UTFA 2W9MA 4UC5A 3TW6A 2BHYA 1HG3A 1QCWA 3W3OA 1WUFA 4FNQA 2XU2A 2X09A 3VZYA 3HFTA 4JZ5A 1DIDA 2YYTA 4ZQMA 4RDVA 2Z25A 5AZ0A 5A1AA 1RALA 1QNRA 1A5LC 2PU0A 1WDDA 4JQAA 3S0CA 4RXGA 3AC0A 3A24A 3ZZ1A 4GX8A 3UXIA 2CBVA 1P6CA 4E0CA 1Q13A 3CWNA 4IL0A 8RUCA 3S9YA 1FXPA 5LXXA 3MUZ1 1EGZA 2FH8A 3TA6A 1F2JA 2YCLB 4RW3A 4E6MA 1WOAA 3A12A 2P76A 1EF3A 2PDYA 4GI8A 1T99A 4AZGA 3T1GA 3QKZA 3EKZA 2F6UA 4R27A 3Q65A 4WZHA 4MDPA 4U10A 3IPWA 4HSOA 3CB3A 1KLYA 3TTYA 1ZL1A 4B16A 1QTWA 1TSIA 1Z6KA 3FNDA 1JPDX 2ABBA 3NFUA 3THUA 2EKGA 4HNLA 4LYQA 2V2CA 1EJ7L 1TFVA 3RCNA 5H2ZA 1N2VA 3I6EA 3I7RA 1BGGA 2D2HA 3N17A 1YE6A 2CLFA 3M0IA 3E1F1 3RO8A 1SZFA 5I3IA 4F0KA 2NV9A 5CXPA 1GYMA 3LCIA 2GWNA 4J4KA 1GPFA 3VDAA 4BA0A 4GVIA 4PODA 2PURA 4H6KA 3W7PA 4IP5A 3HIJA 4LUYA 4PMOA 2C8NA 3H55A 4IPNB 3HQPA 3WLMA 2BGSA 2PDXA 4IMAA 3CH9A 5DLCA 2QJIA 6TIMA 3RX4A 4C7FA 2V2DA 2XGZA 3HQ1A 1V6XA 3CB8A 5A8QA 1CB2A 3RRAA 1KQYA 1DQUA 1XPGA 2J25A 1OGBA 3ZSTA 3QTPA 1V3HA 3GDTA 4K6AA 1P0NA 1I2RA 4EANA 3NM1A 1V02E 1YBQA 4YL2A 1JR1A 4V33A 2TMDA 3VIGA 4L7ZA 3T9PA 1A0EA 4HT3A 1GG1A 3TWAA 3VKBA 3W7RA 3RJXA 2W6RA 1L8PA 3JR2A 5FJOA 2EPHA 2Y89A 3CQIA 1F5ZA 3TSMA 5D37A 5A2CA 3DN5A 3LD5A 2D0HA 5A6BA 2JF7A 3I3EA 3TN6A 3T0BA 1A53A 5KTLA 4Q4MA 2PLCA 3M0JA 2OEMA 3V4BA 5FEXA 3EOEA 4H2HA 4QRNA 1FWNA 4HBKA 3B8IA 3W28A 1BYCA 3QHOA 5AYYA 1D8CA 1Z32X 3NJ3A 3OHMB 1QBAA 2NXHA 2KZHA 3P82A 3UCQA 4QSHA 4HPJA 4N2YA 2BGQA 3XIMA 3QZEA 4AWEA 7ENLA 1M7JA 1XQLA 3RILA 3MWCA 4GIAA 1ZRQA 2CLMA 3S5SA 2PRHA 3BOXA 4PCTA 4JTQA 4W4QA 3R13A 1HJWA 3TYEA 1Y5XA 1FDZA 5FL1A 4ILSA 3WQFA 5JIWA 1KR0A 4GINA 1CECA 3T8LA 4K2SA 1SZEA 4PUJA 4M24A 4MJ2A 3MUAA 2VEIA 1DJXA 2BFGA 2XH4A 3SB0A 3KZPA 3GC5A 4GJ1A 3B3DA 1W54A 1AK5A 2XGBA 3WKZA 4Q8MA 4RL3A 3TQVA 5C9RA 1TIMA 4R88A 1WPCA 1KWKA 1JZ4A 1GKQA 5F2LA 5HOSA 1HF6A 2JK2A 1EBGA 4JN8A 5TIMA 2WWDA 3S6TA 2PTWA 1FWTA 3O6DA 2JKEA 3PR2A 4UMBA 3DG7A 1B9BA 1OB0A 2CIPA 7PTDA 3GHRA 2C16A 3GIYA 1S39A 4CNTA 4XIMA 3UY8A 2PF8A 3F5LA 3N34A 2QVNA 1WDSA 3FOKA 3KRBA 3DFNA 3CM4A 3ARTA 5CJ5A 1YW1A 3CQJA 4Q22A 1RPXA 4W8AA 5D03A 4IGHA 3UR5A 1AW1A 2FZBA 3SUVA 3M0KA 2OYMA 4YU1A 4XSMA 5FIPA 1B3OA 2DZVA 4B5UA 5GQBA 1B4KA 3AUOA 5M1TA 3CJPA 1UP2A 1QO2A 3QQWA 3MP4A 2ZDRA 5I6SA 4AB4A 3LGDA 3GU9A 4GFSA 4EF8A 4MWAB 4UOZA 4Q4OA 3LN3A 3AMCA 4PMZA 3HMJG 5T26A 5C9UA 3OEXA 3WH5A 2HSAA 1ZAJA 5K4ZA 1VCFA 4FOUA 3E2SA 2WVVA 2FZ8A 1OZQA 3R5EA 3UWEA 5DBUA 2WB5A 1LL7A 1BPLB 1EO7A 3IVSA 4OBRA 5MHBA 3NR0A 4K37A 3TN3A 1B2YA 4M7TA 4NNCA 2J8TA 2JEPA 4O57A 2DT2A 4N7QA 3Q58A 4HHPA 3GH7A 5B80A 1I2PA 3REQA 1XI3A 3JU2A 4IMGA 4BF7A 4QG6A 3NGJA 3QOMA 1NTHA 1E1CA 4DHGA 2PLJA 1E0UA 4C6IA 2BLEA 3UXAA 4AZBA 4MMWA 5C0QA 5CBIA 2WVUA 3T81A 3XISA 1QI4A 1BQCA 2ZZ2A 3BLFA 3DESA 1MVYA 2PA6A 4DO4A 4V2XA 3W88A 3IIZA 1HVXA 2XN1A 4H6EA 4KFPA 4PMJA 4CN6A 4BEUA 5G4EA 3VOHA 3U5YA 3P5ZA 3CEUA 1E4IA 1RP9A 1R3SA 3URBA 3MP5A 1VRXA 3KE0A 3KZSA 4KMQA 2ZTKA 2WO5A 1JGIA 3RHGA 4L4MA 3AHZA 5ECUA 1YPFA 3KXQA 4I7VA 2ICSA 1AODA 3KP0A 2QT3A 4UR9A 3F4VA 1GHSA 3U9IA 2WZHA 4H9MA 1OD0A 1QI2A 2WMKA 3W6YA 2ZICA 3ZJ8A 2VR5A 5HNTA 3DDMA 3WK0A 4B15A 6REQB 3HO8A 1Z9AA 2GJRA 1FTXA 4KETA 3W1MA 4KS0A 2GL5A 1TB3A 4WR3A 5E5CA 3M0YA 1EC8A 2BXZA 1CYGA 4DJFD 1EEPA 2A0NA 4I8DA 3H4GA 1MFVA 2OQYA 4BI5A 4B2DA 2FMOA 1US0A 1UWUA 1BG9A 3LENA 1I0DA 3URNA 3L4YA 3UERA 4NU7A 1J01A 1SQ7A 2G50A 1Z44A 3NQCA 3V5OA 5LA1A 3EKLA 2XSXA 3QRHA 3TQ0A 3U3HA 4C91A 5CSRA 3T2PA 3LBOA 1UMLA 4IIGA 5DXYA 2E8YA 4PH6A 4UTTC 3OODA 3WUFA 4YTSA 3HFYA 1GOMA 1QAPA 2NSOA 5LA0A 2GGHA 3HGRA 5DF0A 4E4PA 3GLCA 1VFTA 4AH7A 4H9YA 1YKWA 4ATDA 2XYLA 4GUFA 5DMLA 5F4WA 3BQ6A 3VX0A 1CWYA 1QUMA 2DPEA 3U0HA 4JQ3A 4MPKA 4IGSA 1XYBA 2PDUA 4DI9A 4D1JA 3PJWA 4UTIA 1V6VA 2J24A 2QHAA 3R0UA 3KRZA 4UTKA 2UY5A 3RMEA 1OFBA 3WMSA 3DKJA 3PN8A 3WX7A 4HA1A 1TJ0A 1OX5A 2DH2A 2QCDA 4LUSA 2NQ5A 4GUJA 4YTUA 5GNXA 5C9ZA 4CN4A 5A95A 3GE7A 3DFTA 4A21A 4GACA 4G7FA 4GGHA 2ZUVA 1PWLA 4CNPA 5K3VA 1W3KA 3ENLA 3G1DA 5I3DA 1UR4A 3N15A 4JFTA 7TAAA 3ABRA 1F4HA 3W71A 3TC7A 1SO4A 4KH2A 4ICNA 4IG2B 2YDRA 3B40A 4QEEA 1MO0A 3WEMA 2PWFA 4NRSA 1HJXA 5IFPA 1UOKA 2FPYA 4J7RA 5CC5A 4Y90A 2PDBA 3K4DA 3G2GA 1I2QA 3KBWA 2HISA 4H6QA 3DFHA 4JTAA 3GDLA 4ZFCA 4IFKA 4RDZA 3VPLA 4M6VA 3V0UA 2CKRA 1EWEA 1FH9A 4NZ4A 4UNKA 1T6MA 4QIUA 1CBGA 1V0MA 3VE9A 2QQ6A 1EC9A 4HKPA 1PBGA 3B06A 4PTDA 2TRSA 4DZAA 1E4NA 5DQPA 1OIFA 4XTIA 1GZGA 2VRQA 3NPXA 3PZ9A 3GU1A 1BTMA 4DJEA 3O63A 3GAKA 1X8FA 1Q63A 3U2CA 5CG0A 1JVNA 4DAIA 1W3IA 3UZZA 3CS2A 4LH8A 1J96A 1MW2A 1AH4A 4KRTA 3VI2A 3UYIA 1Z89A 1N82A 2WSRA 1VFUA 5HR7A 1LORA 1TG7A 3BJTA 4IJBA 4BJHA 4GX9A 1ONXA 2DUAA 3UYCA 4GA8A 3E2VA 4X0NA 2ZX5A 1DOSA 3TN5A 3ZR6A 4E3VA 3RNDA 3V35A 4J35A 3L2LA 3BICA 3R0DA 5XIMA 4H9UA 4DWSC 3WLRA 2UBPC 3S5OA 1MUWA 1IQ8A 1XYAA 3VYLA 2ZRZA 4NXKA 1ZJBA 4ERAA 1JCMP 3W24A 1QPRA 1V5XA 4PCSA 1HXJA 3GKFA 1W2VA 1LOLA 4I3GA 2ZZ7A 1REQB 4GKLA 4PB3A 1ENUA 2OOGA 1QI3A 2GDVA 2NT1A 3B9DA 1IEQA 1S5WA 5BW6A 2PUZA 4XAPA 1GNXA 3RM4A 2QCMA 3MWAA 5HR6A 1YDOA 3G1XA 1VBUA 1X39A 3FVMA 1BEUA 3EDKA 1EZWA 5CPSA 1E6PA 5I7GA 3N6QA 1R0MA 3I7QA 2VEMA 2OEJA 4ERGA 5BOEA 3UF9A 4S3GA 1TPWA 2CWNA 1EP3A 2QGYA 2GK1A 2XPKA 1W3HA 3TYCA 2BGNE 1IWBA 3WQCA 4U3CA 3GW3A 1GVEA 3A4AA 2HBXA 1VIWA 4NSBA 2YBVA 3E2QA 3GRIA 3O16A 3F5JA 3RRXA 1F07A 2GQAA 2GJNA 4RW5A 5IDZA 4QFUA 4AZCA 3QPEA 4AZ5A 5HINA 4JX5A 2X1UA 4QHRA 2E4TA 2YDSA 3ARSA 3SY5A 5TD4A 4C6CA 4UUIA 2WCGA 2VXNA 1DJGA 1ISZA 5K7JA 3AHVA 3DBNA 2FVMA 1TTIA 1XLMA 1B3ZA 5HJYA 1QASA 4I9AA 3IV3A 2CCRA 2DIKA 3APYA 5G2WA 4LSBA 1E70M 1EJTC 4LVGA 3ZLFA 2QIIA 3H2EA 1J79A 1V3IA 4KF1A 5LNSA 1S5NA 2P0OA 3A6OA 4X3ZA 4L56A 1EA0A 1CLVA 4PE8A 2OWCA 1EPXA 5AC8A 3POCA 4NL1A 3PJTA 1O68A 4DPQA 5DT7A 4UXDA 1ELSA 2ANUA 4OQVA 1IZKA 1JRCA 2W62A 3KOZA 4MY8A 3EDDA 2VQTA 7XIMA 4UMAA 3LM3A 2G3NA 4JDBA 2HJPA 2WSQA 4B4FA 3S1WA 2BZNA 1JNDA 2YL8A 3IJ9A 2BV9A 1X7IA 5CSSA 1UWSA 3VNDA 4JN6A 4Z1DA 4LW7A 1SUXA 3VMOA 2QDGA 2BWGA 3WNOA 2X7VA 2F7FA 3GVWA 1K8YA 2C1GA 4J2MA 1HTIA 4X61A 4IICA 3L2MA 1WDPA 2DT3A 1F05A 4X22A 4A3QA 4O16A 2FB2A 5I24A 2D0GA 3G0UA 3O3RA 2WZTA 2Y1HA 4YHEA 2I5GA 3BCJA 3NL3A 3NYDA 3MSRA 2BOGX 4D8LA 3T8QA 4IMFA 1DHPA 3BZJA 3CYVA 3EXRA 1TYGA 4JNYA 2Q01A 4JX4A 2D3LA 4PBFA 2BOEX 2CHRA 2HNHA 3V18A 1W31A 3E38A 3SQLA 3USZA 5HK4A 1U5JA 1OJXA 1OZMA 1TE6A 3MZNA 1C93A 3NZ1A 1V51A 5AYIA 3SI9A 2I14A 4G5DA 1K4HA 4LBSA 4R53A 3ITCA 1OINA 3QF0A 3WNKA 2XWDA 5T9CE 5RUBA 3PFMA 4UNLA 2YXGA 1H7XA 2QIWA 1OCNA 4HNUA 3HZ3A 3WD1A 2GQ3A 3VD7A 2D23A 3M7WA 2ZC1A 3H4WA 4ZSUA 5G5IA 4AC1X 7CGTA 1J0JA 4FR1A 2A3LA 3OTRA 5LGZA 1RBLA 1XUUA 5D8WA 4ZE5A 3QV7A 4OECA 4S38A 2WWCA 2HS6A 4F0SA 3VE7A 2EG8A 2PU1A 4M0XA 3ABZA 4GBDA 1TCDA 1NU5A 1CXKA 2V68A 4J27A 3WL1A 2GZXA 1OFPA 5EU9A 1OABA 7ODCA 3THAA 1Q7MA 1F73A 1ISWA 3E02A 3N04A 3RDKA 1O4UA 3HG2A 1LCOA 2C1HA 3LCHA 3BGAA 4F0RA 4AISA 4D6HA 3ECQA 1SMDA 1QFEA 4PMUA 4EXQA 3W74A 1QVBA 3O07A 2QCLA 5FF2A 4P61A 5DXXA 1UKQA 1GQLA 3LCLA 4R7OA 5JU6A 3GG0A 3U7VA 4MUZA 4UQCA 2J6XA 3SCTA 4CLMA 4A8LA 1A5OC 2I16A 3QW3A 4KBXA 4XZBA 1MMFA 5U7SA 1M7PA 3STGA 4HNCA 5LZLA 4YCPA 3UGRA 3EZ4A 3IIPA 2FPTA 1NEYA 1A5MC 3S1XA 5EFFA 3UJEA 2D24A 3EXTA 5K4XA 5H1WA 4J28A 4J3TA 3FJ4A 4EAMA 6XIMA 1QMLA 4DWDA 4JQ1A 5FCZA 4LF2A 2ATSA 3LEPA 2J9YA 2PC8A 2QAPA 2PDFA 4US5A 3G1RA 3BQ5A 4UTWA 1PKNA 4RZ5A 3MKKA 3NQ2A 3CUIA 4GO8A 1M3UA 1MYRA 5CJNA 4FX7A 3T07A 2WHKA 1W5NA 3WH7A 2E1DA 4HB7A 1JZ5A 5JH1A 4EXAA 1RHCA 3UESA 4LBRA 3M0HA 2OLSA 3A13A 5I0DA 3NXLA 2OZTA 3FA5A 3NA8A 2P8BA 4GWEA 5TQLA 1NF7A 2ZRWA 3VINA 5BCAA 2J62A 2YDQA 3WNNA 1PKYA 2PPGA 1G94A 2Z00A 1R3VA 4U2ZA 4XAZA 3W1QA 2YCIX 2IW0A 3C61A 4NRRA 3WLPA 4JEQA 1NDZA 3OOQA 4WKHA 4YTQA 4L1XA 1E9ZB 1XYMA 2PLKA 4KWVA 2V5LA 4CD4A 3NWRA 4FIQA 2C7FA 4MY1A 1MUCA 1BWLA 2OR2A 1GOXA 1NARA 3BMWA 2J7CA 3PC0A 1Q7QA 3SQSA 4KRZA 5CLWA 4I9TA 3QN3A 3BG5A 1A4MA 4LF1A 5C55A 2BSLA 1IT0A 3KDNA 3K4AA 4UMCA 2NW0A 1UR9A 1JPHA 1E40A 1FWSA 1QHZA 3GO2A 1QATA 1FWCC 2VCAA 2DY3A 3WCZA 5FJJA 4XZWA 2WHLA 4M7SA 1CGXA 1RP8A 4KWUA 2EHHA 4UZSA 1A3HA 1NQ6A 1KFLA 2J6VA 2VHLA 3CLWA 4JHOA 5A6LA 4DBSA 4HU8A 4ZA0A 2GOUA 3KVLA 3LPGA 4FIRA 4S23A 3QV9A 4O50A 1EGVA 3APGA 4A8IA 3W86A 4IL2A 4WDXA 2Y5EA 3R43A 3DU0A 4WEVX 3TVAA 5BU6A 2QGHA 3T0CA 2J8GA 2GUUA 5TAOA 4W5UA 1HVQA 4GNJA 2ABAA 2YX0A 3V1HA 1HKIA 4L6OA 3UJSA 1AH0A 1VQTA 4KWWA 1E9IA 1K9DA 4HNOA 4JXCA 2GVYA 1W17A 3UPBA 1N8IA 3VK5A 3C3UA 4W86A 1TMHA 2PWGA 3K1GA 4ZB0A 1RSCA 1US3A 1VAHA 2I9UA 2PDWA 3IVTA 3PUDA 1UBPC 3K8KA 2RFGA 3B8UA 5E1QA 2V82A 4KGLA 3O7UA 4AWUA 2O0TA 4MB1A 4H7ZA 1V0KA 2OKTA 3QKEA 1LUCA 1Y0EA 4GG9A 3A4JA 1MI3A 3VKDA 2Y7DA 4PMQA 5C6MA 1W91A 4B91A 3EOLA 5H8MA 1DBTA 1V02A 3CHEA 1OFOA 4R9OA 3UVAA 3H54A 4ATLA 4W89A 4AEOA 1V3LA 3LV5A 4O19A 2B7QA 2E9LA 2GOKA 4ZOBA 2VVSA 2XUCA 1OCBA 4Y8FA 3UA3A 1WAUA 3ZJ7A 3SCRA 1PIIA 1JZ7A 4M8UA 5LNUA 1OG0A 3MMWA 1VJZA 2Y5SA 2Z2BA 1D2KA 4S3JA 4ZQOA 1S5TA 4RDYA 1RK6A 3C52A 2JE8A 3SDOA 4ACZB 2HK1A 3AU2A 1ECEA 5HMEA 3VCCA 1EYWA 3H24A 1TWZA 3SGZA 4YWIA 1CIUA 1SFJA 3VIOA 1ZSXA 1YDNA 3HG4A 4K1GA 3KBNA 3WQ8A 3OHIA 3AO0A 3I3DA 1TE1A 2VDHA 1EIXA 2CW6A 4ZQRA 3M16A 4AF0A 4DO5A 2YL5A 2MNRA 4L5ZA 2A6LA 1CZ1A 1W5OA 3LRKA 2WC3A 3WH8A 1QWKA 1TPC1 3MU7A 1AL8A 4GI6A 1FKWA 1G5AA 1CI1A 2CC0A 1EGMA 2WCSA 3LERA 4Y6GA 5K2ZA 4WDTA 2A7NA 2BBFA 1HP4A 5D9NA 3RPMA 3W2KA 3ZLHA 3VIKA 4C6JA 1NDWA 3M07A 3ANUA 4HOXA 3CASA 3VAVA 4S39A 4UFHA 3W0KA 2DGAA 3AS0A 4MWAD 5FF4A 4BI6A 3M5YA 4D72A 4XZ9A 3MSGA 2OT0A 3CO8A 1G4EA 4LAOA 5E93A 5A6AA 2G4JA 4AWSA 3PB0A 4M3PA 4C1KA 2ZKMX 1CENA 1ZP4A 3AALA 2OG9A 1KC7A 4UNIA 2XISA 3W02A 1MQPA 3KAOA 5MF5A 3MI6A 4FOKA 1BTCA 2WVSA 3KHDA 2A3EA 4RK8A 2YLLA 1L6FA 2AL2B 3QGKC 1PKMA 4CQ8A 1ISVA 1U30A 1JRBA 1C3FA 4UOQA 4B3ZA 4QR6A 3A3XA 2VURA 4C90A 1GTHA 2PDQA 5IFTA 1UD4A 2ISVA 2IQTA 5BWAA 3HJZA 2YDAA 5I3FA 3CLMA 4G6CA 2NLYA 3FX4A 2OSWA 3QFWA 4AD2A 1MZHA 4GHRA 1MQQA 1KTBA 3CWHA 1OX4B 3FEQA 1VPQA 1VP5A 5G4HC 3M9YA 3KOYA 1T8QA 4YVVA 1KFEA 3M1ZA 1ONEA 2ADAA 4BQ4A 4WSKA 1TUFA 3WJWA 1ADOA 2W5FA 3IGHX 1QWGA 3CYJA 2ALRA 4WSJA 3RLHA 4W87A 3S83A 1ZGDA 2V0TA 5CQ1A 5H8UA 3KEHA 4C6BA 4LC6A 5D2WA 4NX5A 4WOZA 2NUYA 4RX0A 4WF7A 3TYAA 1RLDA 4WGXA 3GDRA 3B03A 3NZGA 2CWXA 3WUEA 4XQ6A 1Q6LA 2CERA 1TX0A 4LS1A 3MBDA 5HDRA 2V3DA 1L6GA 2FVLA 3SR7A 1VGAA 1FVPA 1BF2A 3GU2A 1SVDA 3I4KA 3NGFA 3PG8A 3W7IA 3RUBL 1YDVA 3PZVA 3KCJA 1KKRA 1E73M 2VM8A 5FSDC 3RCMA 3NQEA 3NPWA 1AQHA 4DBEA 1QNOA 3DYOA 4XZIA 4WOQA 4IP7A 4ZE4A 1HKVA 4RLIA 3QGVA 4HGXA 4B90A 3P6LA 1SYTA 4L1WA 2PD5A 3LK6A 1M7OA 3W29A 3KDOA 5CEWA 3QH2A 4OOUA 3KVKA 4HA4A 4AD1A 4MNKA 1YLVA 3B8DA 1Q2RA 4L6HA 3LPFA 1U5HA 4XBSA 2PWHA 4U3AA 4WVXA 1VPYA 3SSJA 3L4XA 3FN9A 4UCFA 5I3HA 4AX7A 5LIWX 2DZTA 1FWDC 1S46A 2Q09A 2R91A 3BAIA 5AC5A 1R2TA 2W0UA 1QPQA 4GABA 5GJNA 2XVPA 4F9JA 1VJSA 3VKCA 3RX2A 3F2CA 3NL5A 1RVGA 1ZBKA 3MSDA 3PPHA 3OIHA 3UR2A 6ENLA 2VC7A 1DXFA 1JPKA 2WW5A 3KCOA 1AQ0A 3D46A 3CMFA 3VGFA 1JZ8A 5HUOA 3FJNA 3AROA 4GQRA 3WLQA 2AMGA 3H7VA 4AIEA 1A5AA 1J2WA 2HK0A 2EQDA 3AHTA 4M82A 3UZ5A 3GUGA 1UKPA 1MUMA 3A4WA 1A5KC 1BYDA 5C2XA 4JYFA 1P0KA 3VO0A 3AIVA 4QQUA 2IKIA 1DORA 5REQA 2Q8LA 1OC6A 5K9XA 3ICJA 1PSCA 2X7WA 5CPLA 3AMKA 3BH4A 3DYPA 3QY6A 3QYSA 5GNYA 1G4PA 2ISWA 3NQAA 5DN1A 3UWQA 1O5XA 1ADDA 3C6CA 3IRDA 3IJDA 4FSAA 3NZPA 3VD4A 4XAGA 2FGZA 4FO4A 5BXRA 4GC3A 1F3EA 2J75A 4A2RA 3P7YA 4P8UA 2QMKA 1V0LA 1G67A 1J2BA 3VIHA 3B0UX 1W3LA 4XD4A 5IRPA 2R1KA 1OM0A 5HBFA 1FH7A 4I7UA 1PZ2A 4Z42C 3N1AA 4J2PA 1K8XA 1VFOA 3EOOA 1KFCA 4QG9A 3CAWA 4HU0A 3S4TA 1J9YA 1D8WA 1UWTA 4R5EA 5LNRA 3WD4A 4HCDA 1OQFA 4Y9NA 3TTOA 1X7FA 4Q4PA 2DORA 2ON3A 4RPQA 3VIJA 3S3GA 3B8TA 4FXRA 1VF8A 1XIBA 1MXSA 1HP5A 2W27A 3MI2A 4MZYA 3P74A 3MHUA 3ZR4A 1I45A 4H00A 3PFRA 4Q4RA 1O6IA 3T4CA 4PBEA 4QAWA 3JVAA 8XIMA 2OGJA 2C91A 4TTUA 3A9BA 5DFAA 3TV8A 5TNVA 3WUGA 4X63A 4O4WA 4JY9A 1XIIA 1KLZA 3NIYA 4CD6A 4DF1A 1QOPA 4LAMA 3WH6A 2Y24A 2VDIA 4QM1A 1V7YA 3GXPA 4WQ6A 1BXNA 1HL8A 1GKPA 1KFBA 3A5FA 1E1EA 1DJHA 3Q37A 3VOIA 3V75A 4HD5A 2H3BA 4O0ZA 3VABA 4ES4A 3TOYA 5HNRA 3AISA 2XFYA 5F2MA 1W1IE 1KCXA 3PZIA 4H8VA 4L65A 4TUFA 2WKGA 1B3XA 5FJPA 4M19A 5CBJA 1RAKA 3B8WA 2ZVIA 1CXHA 3FDKA 5A8PA 4TTGA 4MKVA 4MWAA 4HU4A 4XZHA 4AQLA 4IIDA 2F61A 2F2KA 3WY1A 4A8NA 4CQ9A 1W37A 4W7UA 4D2JA 5TBOA 2J7FA 1XISA 4JCLA 4L61A 5CPTA 1Q6FA 5HATA 4GPNA 2J27A 1UASA 2YA1A 3SY8A 1QNPA 1UB3A 3FK4A 1TWSA 4ZFMA 5D9OA 2GLKA 3QMSA 2VFHA 3C86A 2BXYA 1OF6A 3E5BA 4R3UA 4JX6A 3GZ3A 3DH7A 4XX6A 3A21A 3CZGA 3GFXA 3PSVA 4C60A 1E55A 4DYEA 4E5TA 5DX7A 5D2YA 3P81A 3D0CA 4AAJA 1KFKA 4MJZA 3GTXA 3GVGA 2XH7A 3ARXA 2D22A 5J04A 2IKHA 5AVNA 4CQDA 1JEZA 4XBKA 4H01A 4LYRA 3FEMA 4FLRA 3CU2A 3FXGA 2FDSA 5DO8A 1C8XA 1FWBC 2IPFA 2CXGA 1X96A 2Q6ZA 4IQJA 1OYAA 4IT1A 4IQEA 5HMFA 5XIAA 8CGTA 1HZYA 3OP2A 1V08A 2ZADA 3MANA 4NF7A 1TTPA 4H7CA 3L4VA 5DMMA 4Q4SA 1V8EA 3MB9A 3T2QA 5C7HA 2VX7A 2QS8A 3TUUA 2DT0A 1N8WA 3QW4B 4FALA 9RUBA 1TRIA 4DJFC 3UWZA 1EJVC 4LV9A 4ALDA 4CN1A 4QTGA 2PAJA 3NTYA 3C5QA 3P5YA 2WNZA 3ATZA 1GVYA 2OEKA 3TU9A 2IKJA 2QJJA 4JFWA 4HMDA 3GBDA 2FJUB 5KSWA 1IGSA 3MJMA 1KBBA 2XHYA 3L5AA 5I77A 3MMTA 1X97A 4GXPA 5BRPA 4NYYA 4DWSD 3W72A 3TC3A 4HA0A 3LQLA 2WM1A 1DPMA 2AAAA 4NP7A 2V5KA 3N2MA 4MKSA 3N73A 2V69A 1FDJA 2OZ3A 5LA2A 3DZ1A 2E3ZA 3ELFA 4JFSA 3OQ8A 3FYOA 4J5NA 3AZTA 2P5NA 1XLKA 2OVLA 2PWDA 5BMWA 3WENA 2X0HA 2VENA 4Q8PA 3C0SA 3MVIA 1R3WA 4YCOA 4RCXA 4KWOA 4OWGA 1S1PA 3WLJA 2NV2A 3LHZA 3LNMA 5FF0A 3B9NA 2IPWA 3HGJA 4RKAA 4WY0B 3H22A 2WNWA 5KZ6A 3SUWA 2PDMA 4UFKA 1M1BA 1H7NA 1YXDA 5AB3A 3AWNA 4RNJA 4O17A 4ZO8A 1EJSC 3U4AA 3CAVA 3PBGA 1A47A 4IPJA 1DWFM 1V3KA 1F76A 4UB9A 3KBMA 1ZBWA 3VGEA 4RE0A 1GVIA 3QLDA 2DV0A 1UH4A 1NAL1 4U2YA 4LEFA 1QXLA 1HO4A 1XCXA 4YPJA 3PZOA 2GGEA 3IUHA 1S1RA 1Q8JA 3KLLA 2YR1A 4D6DA 5I06A 1TPEA 1XG3A 1UUQA 1MSSA 3KLKA 3GX9A 3CUJA 4AY1A 1K77A 1EXBA 3SFWA 1GEQA 4CNSA 3TIMA 3DKLA 3W1NA 2ZZ4A 6PTDA 5B7ZA 2JKAA 4C65A 4PCPA 1FFQA 1XYFA 4XK2A 3VDHA 5GPRA 5ABEA 4KPLA 1S2WA 1BLIA 1HKJA 2J79A 4CCZA 4RZ6A 1LBMA 3SUTA 2GVLA 2R9RA 5DT5A 4MLJA 3ITGA 1B4EA 4LCSA 4MB4A 4TV6A 2XZ7A 1LBLA 4NX0A 3R8HA 1EPVA 3W25A 1RUSA 3UEQA 1FKXA 2YXXA 1P48A 1DQXA 1KO0A 1NOFA 3OVQA 2DSUA 3GYEA 2WZEA 3LX9A 1MEHA 3GR7A 2VZUA 3S42A 3BSMA 2ODOA 2D2OA 1WDRA 5D8ZA 4QQ3A 4ZBCA 2YPIA 5ECVA 1W1PA 2XDFA 4MNMA 2DJLA 3T4WA 1I1XA 1VKFA 1Q65A 1EC7A 1JIBA 4UFJA 4AYGA 2I5IA 2XM2A 2QUMA 1KM3A 2C3ZA 2QNEA 4LU0A 1EYEA 2Q8ZA 4UTUA 4W88A 1A80A 3WQPA 4H4IA 2VC5A 3NQVA 3AYRA 4J3UA 1WDQA 3MPGA 4Z1BA 1FWJC 4DM2A 1L6SA 3DC8A 1OYBA 2VX6A 1E72M 5BRBA 3S1GA 1ZFJA 4P8VA 4HTYA 1K9FA 4HMNA 3KL0A 4H1ZA 5CCZA 3P67A 1V3MA 2E28A 3F03K 3MC5A 4O14A 3TONA 4N6EA 4XKYA 3UWUA 1XF0A 1PKLA 4CU8A 1LLWA 5A8OA 4FMVA 2UV8G 4HN8A 3N4EA 1GJUA 5A8NA 1UJQA 4MB3A 3CZKA 3RR1A 1EDTA 1UPMB 4FXJA 1NDYA 1V03A 1PWMA 3WJSA 4GCAA 1NOUA 2RUSA 2PDKA 2EBNA 1XQKA 1WUEA 4F0MA 5B7YA 3WDRA 3NUKA 1UIOA 3WO8A 4H3DA 2FZNA 2A5HA 4DAFA 1TJ2A 3WBXA 4FF7A 1SW3A 1TPH1 1UC4A 2DVUA 4MNJA 1KCLA 1AJ0A 1R30A 1XYZA 2L5HA 4Y9MA 4WGHA 3PWGA 5DANA 4S3CA 4JKLA 4CD5A 5LGXA 5LIUX 3I7SA 3ZT5A 4QDWA 3AZSA 1GONA 1WZMA 1HKMA 3E0VA 1XKYA 1UOZA 1K4GA 5EMKA 4YIWA 1CGYA 2QJGA 3L67A 2ZRYA 3QMRA 1TV4A 2RH9A 1IEXA 2GJXA 3S1UA 1E56A 2ZUSA 1JZ2A 1F74A 2B4GA 3O0KA 1P4CA 2D0FA 2AOSA 3OLDA 3QM3A 4GVGA 1DYSA 1MQRA 1MFUA 5D2XA 2OOFA 3H8AA 2Z6JA 3SEPA 5AHNA 2F9RA 1J0ZA 1D7KA 2PF0A 2VDGA 1RQHA 3LCFA 3R4IA 8TIMA 5CSUA 1LWIA 2ZA3A 3EKGA 3N13A 1RK5A 2CZFA 3MUIA 1WAWA 1CT5A 3BC9A 1JDEA 3AHXA 5KINA 2VQUA 1CDGA 3ZFHA 4DJDD 3RK8A 4DN1A 7A3HA 3ZR5A 1GYLA 1OY0A 2H9AA 4KFOA 3ZLGA 5L6UA 3PTDA 5I78A 5FF3A 1D3CA 1DIEA 1WZAA 3WQWA 3NDYA 3TFCA 5CAKA 4PB5A 1VFHA 3FHAA 2V8ZA 4HVXA 9CGTA 3PPFA 4QNWA 4Y9AA 1QT1A 3R89A 1AL7A 3HG5A 1LG1A 5FA5A 4GD0A 3OPSA 3KRSA 1EXPA 2WSYA 4A35A 1H7RA 1U1HA 2ESCA 2J7HA 4N02A 4U31A 1F61A 3DENA 1UPPA 1KRBC 1RJRA 4WK9A 3RPTA 2ZWZA 1VYPX 3RITA 4OV4A 4RE3A 3LM7A 4DWSA 4K1WA 3N3TA 1QNSA 3QY8A 3C0LA 1ZCOA 3F5KA 4D6FA 2C19A 5FOOA 1AJ2A 2AGKA 3U48A 4B5XA 2JQXA 4W8LA 2CLLA 4EWND 5J5DA 3CEPA 4HN4A 3LHWA 1LL4A 3CHVA 3W4RA 1TPUA 3W1UA 2UY4A 4DNMA 4FNUA 1DJIA 4MG4A 3G0SA 1NJJA 5ABFA 3T08A 4M81A 1F9CA 3TAOA 3W53A 1YBQB 1W32A 2NX9A 3FVDA 3MKVA 3W2MA 1TR1A 2B7OA 3AIQA 3N11A 4EIVA 2PTZA 4CUCA 1GOKA 2QV4A 3MZ2A 3GTNA 2BDQA 2HCVA 4LOCA 2E67A 3KM8A 2O9OA 5KETA 1VRDA 3BLDA 2HBVA 1KBLA 3FKRA 2YL6A 1P7TB 3GD6A 3RX3A 1S5VA 3H70A 2E1WA 2PRLA 1VPXA 1YX1A 4ZO9A 3LPPA 2ZZ3A 4PFHA 3PK7A 2XIJA 3UD6A 1XPYA 4I6VA 3EMCA 2PC4A 1OT1A 1HN1A 4HYRA 3GXTA 4C6PA 1E0VA 3VNMA 3GDBA 1OFEA 3V0SA 5I02A 2Z1KA 3PTKA 1TVLA 4M6PA 1WE5A 4CD8A 2A3AA 4GC4A 3NQ7A 3QSTA 4BY3A 4DUXA 2ZX6A 1RA5A 4GE8A 2CXEA 3VOCA 2YCEA 4DUOA 3IUIA 4PYSA 1DJQA 3DFYA 2V81A 1YNQA 4H9TA 3DHDA 3NPVA 1NIUA 3PWAA 5AZ1A 3KBJA 4LC8A 1Q6DA 4FXSA 2W67A 3CAQA 2VGIA 3SO7A 2XFRA 4W85A 3BO9A 4WJ8A 4H2CA 1IXNA 5HXMA 2WQDA 4F8XA 1B3YA 3LHYA 4DM1A 4UOJA 3ZJKA 4LS0A 1G1YA 4QLJA 4JTIA 1K7FA 4IPIA 5FKYA 5I2UA 3WDPP 3WQ5A 3WDJA 3AAMA 5M5DA 2Q8XA 2O9PA 1SFTA 4QGCA 1O5RA 4NVTA 2Y88A 3PULA 1W3TA 3ZT7A 3TXZA 1TO3A 4OBTA 2OQHA 1KBJA 3MUY1 1MXDA 2FZDA 4A2SA 2X0YA 3C2EA 1T8XA 1XBYA 4OFCA 4KEUA 3WK3A 3E6EA 1R7AA 5HJLA 5FJTA 1GORA 1O1HA 1XGEA 5HQEA 4KFNA 3ALGA 1TTJA 4NNAA 3RM9A 3TW9A 1XLIA 3EWYA 5CPOA 5E6YA 6CGTA 2X1TA 2W92A 3N9KA 1GVQA 1I2OA 3CC1A 3BCDA 3IS4A 5A69A 1W1B1 3PS7A 4PMYA 3D47A 4YHGA 1X6LA 3TMQA 1G01A 1PIFA 3FAWA 4PULA 3UXLA 2POZA 1SJDA 2CHNA 1RD5A 3CZJA 4ACYA 2VZOA 3MO7A 3K5XA 1YNPA 2CBUA 3PHAA 1SO6A 1PEZA 1RV8A 1PDYA 3LI0A 4CKQA 1H4PA 4MAVA 1RJQA 4JTKA 5IHSA 3UG3A 1DJYA 3W7GA 1V7AA 3EWWA 3RIKA 2QPSA 2PDIA 2WVVB 3S2JA 1E71M 4AXNA 1KCZA 2RDXA 3COTA 3K13A 2WVTA 3WF4A 3SCSA 3TZFA 2J7GA 3GNRA 2C1IA 2RKXA 4JD4A 4GUGA 3R7MA 2Y2WA 3JRKA 1YADA 1JZ6A 4BEQA 5CKSA 3LSBA 3ZVIA 4JQ2A 4QS6A 3REQB 1EKOA 3ONCA 5I3KA 5F1UA 5BNKA 3MQTA 1GUVA 3HV9A 1KM4A 1R38A 3N4FA 3IAPA 3L0KA 2NZLA 4LUTA 2ZA2A 1R9ZA 1LWHA 2QDHA 3DAQA 3IIXA 5K9DA 2Z7GA 4Q33A 3NYZA 1TREA 3T05A 4UCGA 1EEXA 4E2VA 1X1NA 2YIHA 2CLIA 1GJPA 4AHOA 1XG4A 2VD8A 4DZIA 3CNYA 4JIRA 4Z2JA 3STCA 3CT2A 1XD1A 1Q4NX 4C7DA 2QYGA 3TTQA 1C91A 4R85A 3EB4A 4LGXA 2XJ7A 4O0QA 3EXSA 4DRSA 4UQBA 2ZXQA 3Q94A 2H8XA 1HJSA 3AI0A 5CZ0A 3VVGA 4XO7A 3VOGA 5BMXA 3T09A 1VFLA 1CGUA 4UBPC 1FWEC 1AW5A 2NQ9A 2BMBA 1Q6OA 1TZ9A 3ITLA 1TA3A 3W7EA 1ZAHA 1BSIA 3GUWA 5G4WA 2I7GA 2EG6A 4AU0A 2PS2A 1CLKA 1V0NA 2GQ8A 1TQXA 4Q4KA 3TXVA 4BWLC 4PFMA 1Q85A 2PP0A 4O52A 3WDIA 1ONWA 2D20A 1XIDA 3LHUA 4TMBA 4PMXA 5CAHA 3MBFA 3VU2A 1FDYA 3UXDA 5IHRA 4DJDA 3NQFA 1LG2A 4QJ4B 4DZHA 1V6TA 4ZXLA 2KX9A 4PCFA 2CNCA 3FFSA 3DEQA 1EZ2A 3LB0A 4PUDA 4Z1YA 3W37A 5BRQA 4LPCA 4F48A 1A0DA 3R8GA 4QXIA 1U1UA 2FJKA 3TEVA 2G97A 3DFSA 2EKCA 1DWIM 2Y6ZA 1YE4A 4Q8OA 2PGFA 1OG6A 1ZCCA 2ZXBA 1HFBA 2WKLA 4HK7A 1TPB1 1XIJA 3LLDA 2VOMA 4KEVA 1UA7A 2BY0A 3C0QA 2Z4GA 5C9XA 4OV9A 3OIXA 4GQ0A 1E15A 4Y7EA 3VIPA 5BROA 1XKJA 5A6JA 3EAUA 1ZQ5A 2XIQA 1ODUA 3M5ZA 3VIFA 3O9NA 4QDMA 4HZ7A 1JD9A 2X1SA 2A3CA 1WBHA 2HV5A 2GGGA 1F6PA 3IK2A 3R8RA 3G6MA 2QXWA 3W83A 1RCOB 1XXXA 3WD0A 1ME7A 2AKMA 4FLOA 1A5BA 1WZKA 4XUYA 1WP6A 3GC4A 3IIOA 2BODX 3OBEA 4MWAC 4IPLA 3LLFA 1US2A 4O18A 5MKGA 2DZUA 4H19A 1NWSA 5C2GA 4J40A 3ARVA 3SRHA 1H50A 3QC3A 4FXFA 2GUYA 3B0YA 1WCGA 3R11A 3WUBA 2XIOA 2QCDB 4LUSB 1EBHA 2EGZA 1GPWA 1IEWA 1KXVA 2GGIA 3QR0A 4HYWA 1JDFA 1U22A 2MUCA 1MXGA 3AUJA 1IZJA 1ZALA 4ZTYA 3QGAC 3SRFA 3DGRA 3RLUA 5BOFA 1W2PA 2DQWA 1MNSA 4MJ4A 2NQJA 3SCWA 3F7JA 3A9IA 3UGVA 5ABHA 5LHFA 4Q7IA 1EL3A 2W63A 3L4WA 5FAJA 4WCJA 2CLEA 2NQZA 3JZUA 4R7JA 4MJMA 2DVXA 3QPZA 3N18A 1J5SA 1H1NA 4A3YA 4Q8NA 2J7BA 3UZJA 1ICQA 1WKFA 1A3XA 2VR4A 4GXWA 3POHA 3WLTA 3GHSA 2HVMA 4JHZA 1EQCA 4PBGA 1EJWC 1OGGA 3SECA 3U57A 3PTQA 4Z2IA 5JQ9A