5AHIA

Crystal structure of salmonalla enterica hisa mutant d7n with profar
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
244
structure length
232
Chain Sequence
MIIPALNLIDGTVVRLRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIGSTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGWQENSGVSLEQLVETYLPVGLKHVLCTDIRDGAGSVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQCWQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Mechanism of Hisa from Salmonella Enterica
rcsb
source organism Salmonella enterica
molecule tags Isomerase
molecule keywords 1-(5-PHOSPHORIBOSYL)-5-[(5-PHOSPHORIBOSYLAMINO) METHYLIDENE
total genus 74
structure length 232
sequence length 244
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5ahiA00
3T40A 3SW6A 3G1FA 3W7PA 5AYYA 1THFD 3FJ6A 3M5YA 2QCCA 3W7DA 4BF9A 2ISSA 3SJ3A 3RU6A 5KITA 1K7XA 2CLMA 1BEUA 2ZRWA 4KFNA 4S1FA 4WY0B 3LRKA 4MZ8A 4HNUA 3PBYA 3N2XA 4UR7A 4PC8A 2NXHA 1F74A 3B05A 2QUVA 5HR7A 1W5QA 3FYOA 3W1QA 3FIGA 2FQIA 4JTHA 4FEZA 5G1TA 1RQBA 2BX7A 3W2UA 3M16A 4HT3A 5LNUA 2FTPA 1OX6A 3HQ1A 4O18A 2V5BA 5EYWA 5C2XA 3S0CA 1F05A 5G4EA 3N2MA 3PUDA 2A5HA 3KAOA 3WJYA 4BR1A 5LZLA 1VHNA 1DOSA 1JQVA 3ABQA 4Z0JA 5L9FA 4GUFA 3LHVA 5G1YA 3OVQA 2HS6A 4I9AA 1OG0A 3UZJA 3QSTA 1HL2A 1H51A 3GAYA 2QEZA 4MOZA 3S42A 4O54A 4B5NA 5FF0A 3O15A 2RDUA 3L5MA 1GEQA 1WA3A 3GYEA 3IIVA 4XTIA 3LTSA 5CGQA 5C54A 3P82A 1PCWA 3PBUA 3O1NA 1DORA 4A29A 4DPQA 3DKJA 1M5WA 2NV1A 1JQXA 2WO5A 4DO5A 3P81A 3TQVA 1KTNA 1GG1A 4FXRA 3EWZA 3PSVA 1KM0A 5HUOA 2Z1BA 4YXGA 5D2TA 3G1XA 1H60A 2OT0A 1OYBA 4E2DA 1C9DA 3ABOA 2CLFA 3SZ8A 3W07A 2DJXA 2CLOA 3NQ7A 2YR1A 3FLUA 1SPQA 3NQ8A 3L5AA 3PG9A 4FX7A 4O14A 2Y7DA 1NVMA 1W5NA 1OFEA 3LTYA 4AF0B 2YX0A 3BW4A 5AC7A 3BO9A 3QMRA 4BWLA 4N6FA 2BLEA 1FUYA 5F4SA 1EB3A 1QPOA 3C0JA 3NPWA 3RNDA 4AWSA 3D0CA 1H1ZA 3UWWA 3O07A 1F2JA 3LTPA 3RLVA 4CCEA 5ABTA 1XUZA 3MP5A 3L0NA 1Z44A 1XKYA 2AAMA 3S1UA 5KINA 1IGSA 3LLFA 1TYGA 2CZFA 5CPNA 1J2WA 1JRBA 2YSWA 5LNSA 1OVDA 3GK0A 1EP2A 2GJLA 2Y63A 3EX6A 3ELFA 3TSMA 5LKYA 5DCEA 1ML1A 2QCDB 4JS3A 1S3HA 3BK0A 3HGSA 4N9DA 4K7YA 3B4UA 5K2ZA 3MHUA 4O4VA 2VXNA 2V2CA 2X1SA 1KM5A 1TO3A 1GOXA 4BI5A 2NWSA 2Y7GA 2WJZA 3A24A 1ME7A 3NQFA 3DHDA 2C16A 2RDTA 3TXZA 4RZ5A 2A7NA 4HNNA 1DQXA 3O05A 3IEBA 4CCCA 2YZRA 1O60A 2RHGA 2DORA 3GIYA 1P4CA 6ALDA 3HGJA 2R8WA 2CZDA 4IQLA 1MEHA 1TPB1 3NPXA 2NLIA 5LGZA 3GKFA 3W83A 3W85A 3VKJA 2RKXA 2XN2A 4M7SA 2QCFA 3GR7A 2PC4A 5F4WA 2A7PA 3O6YX 5HWJA 3DFPA 4OGZA 3P60A 4ONVA 2D73A 3F4WA 4CNOA 4XUGA 4ORIA 2V2HA 1KTCA 3W7OA 2E6YA 4IXXA 2QUUA 2ISWA 3M7WA 3ZWSA 3C6CA 3Q2DA 3W75A 3NDOA 2ZZ7A 1VHCA 4LU0A 4NJHA 1FQ0A 1U5JA 3JR2A 3DAQA 4S2CA 2WOQA 1QOQA 2H90A 5K4XA 3NL5A 3I68A 3LXCA 2NUWA 3WFAA 4ZQOA 3PR2A 1R2RA 4O19A 1GYLA 4JIPA 1M7PA 3NA8A 1FXPA 3S5YA 2QJHA 3L9CA 4GUIA 3C56A 3W9ZA 3LHUA 2YPIA 3ABSA 1L6SA 4FIRA 3UD6A 3WK3A 3CTLA 1DHPA 2E5DA 4QQ3A 1XL9A 4JN6A 4DF1A 3MBDA 3W70A 2A2IA 4N6EA 3A5VA 3EX1A 1ZAJA 4O1DA 2VENA 3W6YA 2CW6A 2Q3RA 3KVLA 4KKXA 4MFDA 4MY9A 1AW2A 3N9SA 3R13A 3PWAA 3N3MA 5CZSA 5CZTA 4Y8FA 2ZZ6A 4WZHA 4UTTA 1SFLA 3DKLA 3T44A 4M19A 2J9YA 4IMEA 3V1PA 4DF0A 3LBCA 1TPWA 3TMLA 1LBFA 3NQDA 1PV8A 4QM1A 4JXCA 4GUGA 3NL3A 3DXIA 2C14A 3BW2A 4UUIA 2TRSA 2ZFAA 1I2PA 5H2ZA 3TAKA 4XKYA 3C2OA 1S5WA 3CEUA 1W5MA 4X3ZA 1SR9A 2HMCA 3LHZA 3NQGA 3W7RA 4HNTA 1F73A 4Z1CA 4MIMA 3NZRA 3TSBA 4JX6A 2QAFA 4EIVA 2QAPA 3QPZA 4PODA 3KVJA 4IMFA 2Z2UA 1H61A 2B4GA 5D2YA 2WSRA 3IIPA 3B0UX 4MY8A 1GZGA 4RXGA 3MYPA 1KFCA 4DXVA 5DY3A 3TE9A 4AAJA 3UWZA 3LHWA 1C8VA 1I2NA 5D02A 5G5IA 5CZJA 2NV2A 3S8HA 3PSWA 3DH7A 1YPIA 3UWQA 2I14A 2XN1A 5D37A 3NQVA 3LBMA 1R30A 1XBVA 5KZEA 3PUEA 4HSOA 1VLIA 1IXQA 2VEPA 2EKCA 4RLIA 4IX0A 5HINA 4NNAA 5BMXA 3UNDA 3R12A 4FIQA 4Y6GA 1R2TA 1VYPX 2OX1A 4ZQMA 3KXQA 2CZ5A 2G97A 2ZRUA 1KV8A 1XI3A 1I45A 1EA0A 2ATSA 5K9DA 3R2GA 4PH6A 3GB6A 5I3KA 2DZWA 4HHPA 4L4LA 4O8RA 2Y70A 6TIMA 4HN4A 3NPVA 3GDTA 3TAOA 4YL2A 2PRMA 1XUUA 5C55A 4X22A 1DJQA 2IQTA 2J88A 3FYPA 1IF2A 3GZ3A 4Y96A 4O15A 4QIUA 4NU7A 1AL8A 2JGQA 1QCWA 5FEWA 1TV7A 3KRZA 4O57A 1YDNA 4C1LA 2NXIA 3W1AA 3I7SA 1QPNA 4BWLC 3W2LA 4OQVA 3L0GA 4IPIA 1OX4B 3DFQA 2QCNA 2A1YA 4LT9A 2JKAA 5IBXA 1CW2A 2E68A 3G1YA 3B0VC 2QKFA 4LW7A 4JEQA 4DPPA 2B7PA 3EWWA 4EWND 5AYZA 3LM7A 3OG3A 4KWWA 5BW6A 3G0XA 5DBTA 3G22A 4OV4A 3FFSA 2A85A 3TQ0A 1ZCOA 3W1LA 5K9XA 2GVGA 1YTEA 4Y9AA 3CLMA 4GUJA 3W1XA 1SSDA 3HMJG 1EWEA 5J5RA 5CKSA 1OF8A 4WD0A 5D33A 4LVFA 3NOEA 3WJZA 4JICA 3S9YA 4PFMA 5J5DA 2ZZ3A 1VYRA 3DHFA 1TSIA 3TFXA 1TQJA 2FIQA 4KWVA 1OFOA 4LRTA 4TR9A 4MPQA 5K9CA 1K8YA 1SW3A 3PC0A 2A4AA 4O52A 3UY8A 3E12A 3I7RA 2QDHA 5A5WA 4Y90A 2QCGA 3W1PA 1K3UA 3R89A 2QF7A 3QYQA 2Y7EA 3QC3A 4PA8A 1UUMA 4TMBA 3HF3A 2WV8A 4BI7A 4UTMA 2OZ0A 4MYAA 3H55A 3MYOA 5CPMA 3VCRA 1A5BA 3VE7A 3A9IA 3HPSA 3CIXA 1ZNNA 3DZ1A 3TIMA 4DQWA 1W3IA 4UFMA 3B03A 4NJIA 3TJXA 1ICSA 3NL2A 1KFEA 3W74A 5AC6A 2J27A 1H7PA 2ZTJA 3L0KA 3QMSA 1JCJA 3MMTA 1AW1A 5I3GA 2VEKA 4WXZA 3LCWA 3ANYA 1KM1A 1YYAA 1T96A 1EP3A 3QM3A 2Q3OA 5G2WA 5D2WA 1LRTA 1MEIA 3HBLA 3BARA 1W54A 4LV4A 2FB3A 4RZ4A 2BSLA 1Q45A 2Z6JA 4O53A 3BGJA 1CX9A 1TREA 3DU0A 3S5ZA 4N4QA 3LHTA 1LDCA 4FX8A 1QOPA 4AWTA 4WOQA 3GX9A 1W31A 4UNLA 3T7VA 3M5ZA 1RPXA 1FDYA 4LUIA 3O06A 3W23A 3GXNA 3W7HA 1A5AA 3VFLA 3DFNA 5FEZA 2BWGA 2ISVA 1YPFA 3GDRA 4UFJA 2CU0A 4K37A 2Y89A 2QCHA 4UTUA 4GBUA 3IVUA 5U7SA 5DELA 1S5TA 4UTTC 2X2GA 3H53A 3W71A 4DBEA 3WJSA 4LUJA 4I7VA 4I7UA 5AFDA 1LOSA 3NL6A 1KFLA 1TCDA 1UUOA 3IGSA 4QNWA 3ZFHA 1B4EA 3ZR4A 4K8EA 1UB3A 1TRDA 4RJEA 2CLKA 3AO0A 1QAPA 3DBPA 1GVOA 1LM1A 1HO1A 4JTTA 1FWNA 3QW3A 1PIIA 2C18A 1LBLA 1G4SA 2ZCGA 3UZ5A 3TUUA 1VLWA 2ZZ4A 2XFWA 3PBVA 4UFIA 4O4WA 1UJPA 1FWSA 3QZEA 3P61A 1GWJA 5C5YA 3ATZA 3HO8A 4XBKA 3LCFA 3IGXA 2RDWA 1H63A 1SSGA 1QO2A 1W3NA 2X1UA 3LCGA 4CQAA 1TQXA 3IIXA 2ZRYA 3LXBA 1YXDA 5DBUA 2VKZG 3RF9A 1S5VA 3NM3A 5F2LA 4QNEA 3UPBA 1WOBA 4GUHA 1ME8A 4A3UA 5BMWA 3OA3A 1OFPA 1KBJA 4NQ1A 1D3GA 3UQNA 1WV2A 3P5ZA 4UTJA 1T99A 2CLLA 3HG5A 1Q6QA 3RLUA 5CSSA 3M9YA 4P2VA 3C2VA 3G1HA 4K38A 3TNOA 3MI2A 3SFKA 3VI2A 3S1WA 2WSYA 4K8HA 4WX2A 2EGZA 2ZRVA 4ALDA 4JTUA 3W88A 1SW7A 3TC7A 3W72A 5AHFA 3T78A 4NX0A 1OK6A 3NAVA 2QR6A 3LI0A 1ALDA 2NWRA 4MY1A 3A22A 4RKAA 4TX9A 5DLCA 3YPIA 3OVRA 5AHMA 2H8XA 1V7YA 4U4MA 5HUPA 3HG2A 4GNJA 1JCLA 2ALDA 5LSMA 2B7OA 2PE4A 4OE7A 5AHEA 3INPA 3UWYA 3MI3A 3LCHA 3T55A 3G1AA 3SGUA 3MHFA 3LHYA 4E2BA 1B57A 4R34A 3LDVA 3T4CA 3TR2A 4A2SA 3E0IA 3TK7A 1TJRA 4CCDA 1I2OA 3EWBX 3TROA 4POCA 3DI1A 1X1OA 1XBXA 4RV8A 3TA6A 4E0CA 2DZPA 2CLEA 3EKLA 3GNNA 4UC5A 1DQWA 1SO6A 4YWIA 5EY5A 1TPDA 1MZHA 1ONRA 1WX0A 3O6DA 3PG8A 2J24A 1OX5A 1ZAIA 4KFOA 1F5ZA 3IV3A 1K7FA 1FCBA 3GKAA 3SSJA 1XXXA 4K39A 2ZZ2A 1DVJA 4R53A 2PRLA 1GG0A 1FXQA 2B7QA 4Z1DA 4H6KA 1W56A 5SWUA 2KZHA 1UBSA 3QFEA 1B4KA 3NGJA 4AH7A 1FCVA 3L68A 3W7MA 3FA5A 1OABA 3MI6A 1I4NA 2QJIA 5CPOA 2CWNA 4JTLA 2PURA 4NT0A 4E38A 2B0MA 3BG5A 3A23A 5FEPA 1P0NA 5CZ0A 4Q33A 1KM3A 2FJKA 3TFCA 1IXOA 5FF3A 3M5VA 3GDMA 5I3FA 3U2OA 2YFNA 1QDSA 3F03K 1YDVA 1A50A 1SZGA 3GDKA 3PF3A 5G4WA 3RMJA 2DZSA 1B3OA 2ATMA 1P1XA 1TV5A 4EF8A 4UTWC 2FPYA 3DFOA 1TMHA 2VFHA 1OFAA 1FCUA 1T8XA 3G0UA 4NZFA 3M0ZA 4NX5A 3KHJA 4ICNA 1VCFA 2W79A 1TB3A 1EIXA 3EXTA 3G8RA 4K36A 1NSJA 2V81A 4NXKA 1QMLA 3TDFA 4TO8A 1NAL1 2OT1A 4AXKA 1GYNA 1L6YA 5BRBA 2YGYA 3QJAA 3E49A 3CM4A 4GC4A 3P67A 3TH6A 2ABAA 4K6AA 5TQLA 3SY5A 1F6PA 4O13A 5D05A 4XBSA 2X16A 3UWUA 3NQ2A 1VS1A 3SECA 4A21A 3G3MA 2C19A 4JTIA 4UFHA 3W1MA 4O50A 5DN1A 1JUEA 4MLRA 1GTEA 4YCOA 4AB4A 1SQ7A 1DJNA 4WQ6A 5DY2A 3W76A 2DZXA 5AC8A 1BTMA 3FS2A 3C2FA 4EOUA 3P62A 2ZZ1A 3P84A 5FF7A 4FNUA 4TU1A 4MZYA 3BLFA 2XN0A 4HKPA 4KFPA 1L9WA 4ZMGA 3NYZA 2O7QA 1LP6A 1KM6A 4JTJA 1WBJA 3KRUA 3QMTA 4AHQA 4AF0A 2TPSA 3BW3A 3LV5A 3E02A 2VFIA 1LRNA 3NG3A 4NJKA 2E77A 2GVLA 4R33A 2VFDA 4NJGA 3EKZA 5DXYA 3LRMA 4JTFA 5E93A 2ZTKA 4JD4A 4WUIA 4JIQA 2VC6A 2FFCA 3C4UA 3C52A 4O11A 3MP3A 3TQKA 1K8XA 4DO4A 4N2YA 1LZOA 4LNYA 4AHPA 3CIWA 1UASA 3LCIA 1XCFA 2V2DA 3W2MA 2J6XA 1XBZA 4MJZA 3VE9A 1HTIA 2EAWA 1SO4A 1O94A 1W1ZA 1LORA 2ZA2A 3NPUA 2JKEA 3HG3A 1HFBA 3H54A 1GTHA 4O0ZA 3M44A 3W87A 1KM2A 5CPLA 1QPQA 4HPXA 4JTSA 4LY8A 4RCXA 1JUKA 4JTGA 2VEIA 3N9RA 4UFKA 2CFFA 5CSRA 4ZQRA 3LGEA 4O16A 5KTLA 3FEMA 3S5NA 2DZVA 1LLZA 1W3TA 3B8DA 3F4NA 3GNDA 1I2QA 3HGRA 3NQAA 1VCVA 2A7RA 3F1QA 2A21A 4A22A 4UMCA 5I3HA 1U83A 3W3OA 1TV8A 3O63A 5G2HA 2HSAA 2A0NA 2VELA 4ZVJA 2H3DA 2NZLA 2LLEA 3CHVA 3W7NA 3LX9A 1V5XA 4XWUA 3B04A 2VEMA 3OVPA 1TPH1 1ZJIA 2Q8ZA 3QRHA 1TTIA 1ZY9A 3C2EA 1H7NA 1JCXA 3THAA 3OHIA 5IBXC 3PB2A 3FKKA 3W7KA 5F1VA 3P80A 3CC1A 1PS9A 1OYAA 1JUBA 2O7SA 2E5BA 1FX6A 3MP4A 5KMYA 2GPTA 2E6FA 2W6RA 3PBWA 3DGRA 1AL7A 1YTKA 4CQ9A 4L4MA 2C1HA 3VNDA 1GJPA 1JCNA 5EA9A 1EX5A 1ZENA 1D3HA 2E1DA 4NZJA 4XZ9A 5U4NA 1MSSA 1T0OA 1OFBA 3KRSA 1PVNA 1IIHA 4TIMA 1GT8A 3WK0A 1KW1A 5EBUA 4O1AA 5C6MA 3UXDA 4AVFA 4XTDA 5LHFA 4PCFA 3FKRA 3STCA 1VZWA 3WJWA 4ADSA 4GFSA 5HR6A 3MHGA 5EKYA 2BTMA 3GLCA 3W7GA 4IX2A 3MBFA 1PE1A 4Z1AA 5LHEA 3L21A 5HMSA 3W7IA 4JR5A 1L2UA 2FDSA 3W7JA 1H62A 3NQMA 3S5OA 2V30A 1WOAA 2X1RA 3U8GA 5GVJA 4XKYB 4QSHA 2V8ZA 4O1BA 4WXYA 5DCDA 3NXFA 2EF9A 1IIGA 3GDLA 3BV4A 4PL1A 2JKPA 5LNRA 3STEA 3PAJA 3UYCA 1TPVA 2NUXA 5AHLA 5E0KA 5LNVA 2DZUA 4O12A 5AB3A 1K02A 3QW4B 2E09A 3EWXA 1OHLA 1NFBA 3GR8A 3ZS4A 2TYSA 4FNRA 3O16A 5BNKA 1AK5A 3RFAA 4WY0A 2WQPA 3CEPA 3NM1A 4BFAA 4LC8A 3PULA 3G18A 4NXSA 3W1NA 3W1UA 3G1DA 3G3DA 4GXMA 1ICPA 5EL1A 1Q6RA 3LCLA 5AHIA 4LVGA 3Q58A 4JGDA 4LRSA 1I2RA 5F1UA 3Q94A 3SGZA 4UXDA 1O5KA 2I1OA 4GE8A 3ATYA 2CLHA 2QUTA 2QCDA 4ML9A 2TSYA 1PHQA 2GOUA 1BWLA 4EVZA 5EPDA 3CB8A 1PL9A 4LVBA 1WDWA 5HQEA 1L6WA 3QEZA 1KV5A 4JX5A 5HJLA 5E1QA 1JCMP 3MWAA 1EUNA 2BZNA 3QSRA 2J9ZA 3IIOA 4UTIA 4MVAA 4HIBA 5BOOA 3L66A 2WNQA 1HUVA 1TPEA 5A8GA 3EX2A 4HPJA 5FF4A 4UMAA 1JRCA 1NF0A 3QF0A 3EEGA 1G67A 1VYSX 4RR4A 4JTKA 1YADA 1EWDA 3OEXA 1OK4A 3I7QA 4OT7A 4IMGA 4TMCA 2TMDA 4CNNA 4O10A 5I3JA 3HPZA 1RV8A 4DF2A 3RK8A 4UMBA 1MO0A 1D9EA 3S6DA 3M6YA 2PRHA 3HOJA 1A53A 2AGKA 2ZZ5A 3E96A 5EMUA 1TPFA 3CWNA 3LB0A 2NUYA 4HNVA 4D2JA 4LWWA 4JDBA 1KFKA 4X9SA 2G96A 4FB7A 2I9EA 3G8EA 1LROA 3TV8A 1DV7A 1QR7A 4IMCA 5TBOA 4RXFA 1KBIA 2DJLA 1TTPA 2Y88A 3L67A 5FF2A 4ADUA 2VFGA 4JDYA 4QJ1A 2Y7FA 4JYDA 3W1RA 1SO5A 2YXGA 1KM4A 4ZQPA 4AMAA 2P0OA 3IGUA 3MJYA 3W73A 4JYFA 5D2VA 3BG9A 4OBTA 2Y85A 2YW3A 2PCQA 4FO4A 4JYEA 2DU2A 1A5CA 4GJ1A 1ZAHA 3M1ZA 3EWUA 3TMQA 1VR6A 2WNNA 2ZQ0A 2Z6IA 4Q4KA 1WXJA 4MZ1A 2P10A 4UTLA 4JNMA 4IOTA 1CI1A 1E51A 1GVRA 5D30A 3TX9A 4N4PA 1FCQA 4LS1A 4OWGA 1XDMA 2V0TA 4O17A 1G7UA 4WJEA 3N73A 3G1VA 2ZA1A 3SIZA 4P61A 1TJPA 2X30A 4PTNA 5D03A 3NZ1A 4CNPA 1W37A 5FEXA 4R7JA 2G95A 4M5PA 2C15A 5HWNA 3QPYA 1LYXA 3S1VA 4GRSA 3W2JA 1M7OA 2FLIA 3W7EA 1XBYA 2P1FA 7TIMA 2FPVA 4FF7A 1BKSA 1AW5A 1X6UA 1VJIA 3TCEA 4H3DA 3L65A 3B06A 3O6CA 2R91A 1QWGA 3PM6A 1O5XA 3C2RA 4N9CA 3PB0A 4UCGA 1LCOA 2FPTA 1W0MA 3QH2A 1N7KA 3E9AA 4NNBA 4I7WA 3EX4A 5TIMA 2RH9A 1YDOA 1FWWA 1JJKA 1SZNA 1H50A 2GJNA 3KFTA 1NEYA 3M41A 4NVTA 5FESA 1G4PA 4H4IA 1Z42A 1G69A 1VRDA 4MLJA 2RFGA 1SFJA 3LXAA 1KLZA 5AOUA 2NX9A 3W22A 3CQ0A 3G0SA 2G5WA 4LS0A 3LERA 3CT7A 2VFFA 1TPC1 3AJXA 1LBMA 1A5SA 2WNZA 3TKFA 3EX3A 2AQWA 3L2IA 1OF6A 2YW4A 1JVNA 2GUUA 3UWVA 3GXPA 2Y61A 4FXSA 3G24A 1ZALA 4ADTA 3TSDA 3I6RA 1WQ5A 1WBHA 3U6WA 2C6QA 2R14A 4FNPA 4Z1BA 2ABBA 3LV6A 3EXRA 3L5LA 4X2RA 1O4UA 4IMDA 3HB9A 1H7XA 1H5YA 3LI1A 3LCXA 4FX6M 4OV9A 1FWTA 5HWMA 1N8FA 3QQ0A 2Q8LA 1W5PA 1HG3A 3LRLA 3CU2A 3R8RA 2QDGA 1XC4A 2FB2A 3N19B 1VGAA 4ZL1A 3DFTA 4UTWA 2NXGA 4W9TA 4EF9A 1O95A 4MJMA 4O0KA 5D04C 1RQEA 4LVAA 1AG1O 2OCZA 3MO7A 4A2RA 4QAIA 4M6PA 5F2IA 2CZEA 1ZFJA 4OHQA 2A6LA 1EP1A 4DELA 1GVSA 3V75A 1RZMA 1K8ZA 2UV8G 1RD5A 3A5FA 1Z48A 1FDJA 4U28A 1ZHAA 4BK9A 4HSNA 2GQ8A 4IPJA 4UTHA 1JR1A 3P74A 3NVTA 4MKNA 1ME9A 4JX4A 2J9XA 2QCMA 4O28A 1K03A 3TU9A 4LV9A 1Y0EA 5CG7A 4RX0A 5L6UA 3W7QA 2C13A 1KFBA 3IVTA 4UIOA 1C29A 3HPXA 3BLEA 3W7CA 4FNTA 1FY6A 3K30A 2Z0IA 1RVGA 3Q37A 4IGHA 5HULA 1R2SA 4IWWA 3CWOX 4M6QA 1OJXA 2ZRXA 3FOKA 4O1CA 5IM51 4Q32A 4QITA 1G4EA 1Q3NA 1SZFA 3EXSA 1I8JA 3EB2A 3PVFA 2OJPA 3M5XA 4LC6A 4Z0SA 3BVJA 3W86A 2V5LA 4LTSA 4XQ6A 4UNKA 1F7BA 4LS2A 3P8JA 5DCBA 3JS3A 3TJLA 2JBMA 1H1YA 3PUOA 4JTEA 3GXTA 3NR0A 1J5TA 3GVGA 1GVQA 3M47A 3MW7A 1RR2A 1XM3A 1JULA 1GPWA 3NQ6A 3R5EA 4DEFA 3WK2A 2ZBTA 3HJZA 3NNTA 3LOTA 5KSWA 2W0UA 1SU5A 1YTDA 1X8FA 3THQA 2YFOA 1VC4A 1TPUA 2F7FA 1GVFA 1OYCA 1IXPA 3STFA 3MUXA 3N34A 1IXNA 2QCEA 3NQEA 5T26A 1EEPA 1YXCA 3W1TA 1Q6LA 3IRDA 5KZDA 3O8AA 5AHNA 1Q6OA 1PHWA 3WK1A 1KFJA 4IJBA 3WJXA 3W7LA 2H3BA 3USBA 1OX4A 2DZTA 3PS7A 5F2GA 4PEKA 1DKWA 4FNSA 2GQ9A 1OFQA 1F76A 5LNWA 3IVSA 1AMKA 4WOZA 4C1KA 4YCPA 5D09A 2V9DA 1LOQA 2B7NA 3EWYA 5D32A 4UFLA 2JGYA 1LOLA 3B0PA 2R94A 4YMZA 1X1ZA 2E6AA 1WYIA 3N14A 3W84A 3HG4A 1G7VA 1R46A 3ZWTA 1SUXA 2H6RA 4UR8A 4M6VA 5K3VA 5KZMA 2ZDRA 1R47A 4RZ6A 1UCWA 4DBDA 1JCYA 2WKJA 2VOMA 3NO5A 1P5BA 5MHBA 2HTMA 3P5YA 5HNRA 2ZYFA 4MFEA 1H7OA 5G2IA 1MXSA 2C0AA 1QNVA 4MUZA 1OFRA 3KX6A 1WAUA 3ABRA 1YLVA 4K7VA 1W8SA 8TIMA 1XDLA 3KOFA 2YDAA 3A21A 1TTJA 5D38A 4NNCA 2BXVA 1KLYA 4FHAA 1VH7A 1SZEA 2NX3A 3W2KA 1MEWA 4LOCA 3JRKA 2QJGA 1FDZA 1KTBA 3UPWA 2VFEA 3GAKA 1TRIA 4PL2A 5K4ZA 4CLMA 3BGGA 2Y6ZA 3QQ1A 1X7FA 1EPXA 1KA9F 4Z08A 1M6JA 3KVKA 2GVJA 1QPRA 1NF7A 2V82A 3LLDA 2C3ZA 4ZQNA 3KVMA 1F6KA 1LTDA 1EUAA 4UTKA 1GQNA 2YYTA 3M43A 4G1KA 2A6NA 3OIXA 4BI6A 1Z41A 3FJLA 3W2NA 1YXYA 2YCEA 4NUWA 3HGOA 5I3IA 3BPWA 4IUOA 4N9EA 5F4XA 1B9BA 1SW0A 2OMAA 3C8FA 1LLWA 4NJJA 2QCLA 4YLWA 1OFDA 2HS8A 3NQCA 3CPRA 1SO3A 2ZRZA 4N9BA 2Y62A 1VPXA 4M7TA 2H8ZA 1FBAA 2DP3A 5LGXA 2E6DA 4RK8A 4S2BA 2ZA3A 1TIMA 3C3NA 1FWRA 1QO5A 3SI9A 3DENA 1ICQA 3UXAA 3TXVA 1N55A 2F84A 4QISA 5K7JA 1BWKA 1ADOA 1H7WA 4WY0F 3TW6A 3TC6A 4ZQCA 4AEOA 2GQAA 4J9JA 3DI0A 1HO4A 5H91A 1LRQA 4LVDA 3NEVA 4CQ8A 4IXHA 1DL3A 1VQTA 4N02A 5FI8A 1XFBA 3PY2A 3IIZA 2JK2A 2E5CA 4FNQA 3I65A 1G4TA 1H7RA 1W5OA 4GWEA 4JY9A 4OU1A 1TTQA 4AHOA 4DO6A 1PCKA 4MYXA 4JY8A 3BG3A 4ORMA 1G6CA 2WPBA 2YYUA 2NX1A 1K7EA 1P0KA 2WSQA 1RQHA 2X1TA 3C61A 1DBTA 1VCGA 1QFEA 5D2XA 3P8IA 2CLIA 3P7YA 3SR7A 3DFSA 2EHHA 3HIJA 5AN7A 3STGA 3UY7A 3OBKA 5AYXA 3BLIA 5DXXA 3G1SA 4ZZ9A 4AWUA 3TW7A 1J4EA 2EPHA 3S1XA 5F2MA
chains in the Genus database with same CATH superfamily
3BJFA 4IIFA 2DT0A 4GI8A 2XJ7A 3SRFA 1J5SA 5HPOA 3W7DA 1GW9A 5JH2A 2QIIA 1B5TA 3LSCA 2CBUA 4CN6A 3HU7A 1UKOA 4WF7A 3KUMA 1W1TA 2YBVA 4HOWA 4KFNA 1ISWA 4S1FA 1OQFA 3PBYA 3N2XA 2NXHA 1F74A 3W37A 4I6KA 4I6VA 3FYOA 4JTHA 4C60A 3WMBA 1RQBA 4ZOBA 3M16A 2CXGA 1A5OC 4GXWA 4AU0A 3S0CA 3N2MA 4KEMA 3T0DA 4RDVA 2P3ZA 3HTWA 4C6EA 4GUFA 1C90A 2GUBA 1XWYA 4REQB 2FVMA 3QHMA 3QLDA 4I9AA 3QSTA 4XVDA 4C7GA 5A8QA 3W25A 1XYAA 3VFCA 4OOZA 4B5NA 3O15A 4FMVA 1BYCA 1U1JA 1WA3A 2ZXAA 3OTRA 2XVKA 4HMCA 4IPLA 3IRSA 4UOZA 4AD2A 4XTIA 1GVEA 5CGQA 5C54A 4DPQA 1QBAA 3FX4A 5IFTA 3GVQA 4DO5A 4PUDA 3T42A 1GG1A 1KXHA 2J25A 1R3SA 1AD4A 1KM0A 2Z1BA 3AUOA 4JIRA 2OT0A 2C1GA 3TW9A 4E2DA 3ABOA 2QYGA 4TTGA 3W07A 4V2XA 3KW3A 1SPQA 1GOMA 1XV8A 3VX1A 4IFKA 2CYGA 5HNNA 4J3XA 2WXDM 4W89A 4FX7A 4I5RA 3SCSA 3BW4A 4AF0B 2ZVIA 3BO9A 4R7WA 2X05A 1QPOA 4AY7A 3NPWA 4PMQA 3UWWA 3O07A 4KERA 1F2JA 2Y0FA 3RLVA 4GC3A 4FPSA 4GQ0A 4W8BA 4KBXA 1K4GA 1UR3M 4RE2A 3LLFA 5CGTA 1W2PA 4LYQA 1B3WA 5LNSA 2GJLA 4A3RA 3EX6A 2D22A 3TSMA 5LKYA 5DCEA 2I5GA 4JS3A 1S3HA 3BK0A 4K7YA 4D8LA 3C5QA 2OQLA 4BI5A 1UR2A 1E6SM 5CSYA 5BXSA 4JFWA 2HXUA 1MRQA 4D8AA 5IRPA 3UG4A 1V3JA 1PSCA 4IM4A 3IEBA 3H7VA 1E4NA 4WJ8A 1O60A 4CCCA 2RHGA 3VC5A 3N12A 1OG6A 1TPB1 4Q8UA 3NPXA 5LGZA 3GKFA 4Q7NA 3GRIA 4RNJA 4K1WA 4B3KA 2RKXA 2QCFA 1WCGA 3GR7A 2A7PA 1DXEA 2WC7A 2PD9A 4IMAA 3H21A 5FJUA 3GHRA 3LK6A 3LA4A 1G0CA 3HQOA 4ORIA 4DRSA 3W7OA 1P0BA 4KWUA 1OC7A 3BLOA 4NJHA 4LU0A 1FQ0A 1C8XA 3CZEA 1QOQA 3NL5A 2NUWA 1UYQA 3PR2A 3RRAA 3MSYA 4ZOAA 4PSRA 1GYLA 3GXIA 3VPLA 3L4TA 4JIPA 4PB3A 1M7PA 4C6OA 4PYSA 4GUIA 4F2TA 3C56A 1CGXA 3LHUA 3GC4A 1XL9A 4FXFA 3MU7A 1XLJA 4JN6A 4DF1A 1QI3A 1Y5VA 4OUEA 3ZR6A 2Z1XA 4I5XA 3VD3A 1XX1A 3W6YA 3KVLA 1WUFA 4MFDA 3N3MA 1EYEA 2CCRA 1K6AA 3E0FA 4B9YA 2GDVA 1AH3A 4WZHA 3P93A 1JZ8A 4JIEA 3TYAA 1TPWA 4UZUA 4ENLA 1VFMA 3N2CA 4JXCA 1TR1A 1C9WA 3DXIA 1ZSXA 1DE5A 2GFTA 2TRSA 4XKYA 2DH2A 3OYZA 2HMCA 3NQGA 2VEGA 1BVNP 3V1HA 3TSBA 5FAJA 2YXXA 3QPZA 3KVJA 1HVQA 4H9MA 2HRWA 3SQMA 3B0UX 3FY1A 1EGVA 4A8IA 3GQYA 4DXVA 5ECVA 1MFUA 2VX4A 4AAJA 3UWZA 3LHWA 1C8VA 1BSIA 4KWSA 1UKSA 2NV2A 2WJEA 2G8ZA 1ZJAA 3UR8A 4GIRA 3S8HA 3UWQA 3WQ4A 1X98A 1H3GA 5FJPA 4HSHA 3ISIX 4GCXA 2QNEA 5CAHA 4IQJA 4HSOA 4TX8A 4F2BA 4XO7A 3LPGA 3VUSA 4RLIA 1OM0A 2YJQA 1XRTA 3AWNA 3UNDA 3EDFA 2Y8KA 2F9RA 2PGWA 1R2TA 3VZXA 2OX1A 1Q66A 4H6RA 2DSZA 3VOHA 1RBAA 2ATSA 1HGWA 2WZHA 1NTHA 4PH6A 3GB6A 2V3FA 3EOUA 3ARQA 4HHPA 2BGNE 6TIMA 2ZC8A 4YL2A 4OECA 1PB0A 3FYPA 3CL8A 3CYVA 1FTXA 1US0A 2D3LA 2QS8A 1TV7A 3VMPA 3I7SA 2ZE0A 3UNTA 3W2LA 4JHZA 5IBXA 1CLKA 4WLCA 3K13A 1JPIA 4QS5A 1LWIA 1A3WA 4JEQA 5FJTA 3VOCA 2OGJA 3LM7A 3OG3A 2XH4A 4PB5A 3G22A 3FFSA 3CT2A 1J9YA 2ACRA 1HKKA 3W26A 2XSAA 5K9XA 1OC6A 3HV8A 4NYUA 1YTEA 3W24A 4Y9AA 4GUJA 1SSDA 1CBGA 1EZ2A 4RNHA 1P43A 1OF8A 3TN3A 4TTUA 5D33A 4FALA 1UP2A 3PBMA 2ZZ3A 4B5WA 1VYRA 3ARTA 3DHFA 3V36A 5C8BB 3E2SA 3TFXA 1EKOA 4US5D 4RUBA 1TQJA 1UHVA 5LXXA 4LRTA 1S2UA 4TR9A 1QK2A 1LUCA 1GYMA 3E12A 1Z32X 2QCGA 5H8MA 1KD0A 2QF7A 3QYQA 1JL8A 5PTDA 3AHZA 3ITYA 4JHMA 1UKPA 3U2ZA 2O9OA 2VX7A 3HF3A 2NW0A 4EP8C 3H2AA 3VCRA 1A5BA 3BAXA 3RG6A 1G94A 4JKKA 4AW7A 5EU9A 1CZ1A 2A3EA 3PZ9A 3RCNA 5LIYX 1ICSA 4B90A 1KFEA 2B31A 3W74A 5AC6A 4U2ZA 2ZTJA 1JCJA 1AW1A 1B0IA 2WZTA 1KM1A 1T96A 1EP3A 2O4QA 1DWHM 2Q3OA 2EEXA 2BY3A 3GC5A 3BARA 5M17A 2FB3A 3SADA 2Z6JA 4O53A 3S5ZA 3BAYA 1KQYA 4NZ5A 4MGGA 4AWTA 3RJYA 4A05A 1RPXA 4LUIA 2BY0A 3GXNA 4DJFD 3QVQA 3HM7A 5FEZA 1MUMA 5HNUA 5I06A 2GK1A 2QCHA 1Q5MA 2PU1A 2XVLA 3AMKA 4XAYA 4H2CA 4UTTC 3VGDA 4DBEA 4DNMA 1Y8BA 5H8PA 2Z1KA 4I7UA 5AFDA 1PDYA 2QGHA 1B3VA 4YHEA 3ITOA 3ZR4A 1QPKA 3F5JA 4K8EA 1UB3A 3UXIA 1TRDA 4RJEA 4DN1A 2CLKA 1TELA 1BKHA 4HU4A 1K4HA 1LM1A 2G4FA 3QW3A 3MUZ1 3ZJKA 3RITA 3E5PA 3ZMRA 3AZRA 3UZ5A 3WBYA 1DIDA 1BSLA 4HNLA 3PNZA 1I9CB 2XFWA 4O4WA 2EPOA 4DYJA 5JMUA 3LCFA 3IGXA 1W3NA 2X1UA 4ZB5A 1TQXA 2J6VA 3IIXA 3L23A 5BWFA 5DBUA 2F6UA 3K8MA 3UPBA 4DAIA 2XPKA 4A3UA 5AKQA 1OFPA 5AY7A 2WMGA 4LB4A 1D3GA 1E0XA 1V7AA 3P5ZA 2VDIA 4QG8A 1JFHA 4IH3A 3KBMA 3RLUA 2HK0A 4RE4A 3M9YA 4P7NA 4PMOA 1XYBA 3WIJA 3MI2A 5D8ZA 3WUBA 2EGZA 4FZIA 2UZ9A 2IKGA 3SCTA 3TC7A 5KZ6A 4LSBA 3T78A 2IKJA 2NQHA 2QR6A 3NAVA 4ZO6A 2XU2A 1ALDA 4MY1A 3A22A 4K8GA 4TX9A 5DLCA 1BYBA 4XD3A 1JDAA 3B9NA 2ZUSA 3EDJA 3LGDA 3LS9A 2PBGA 4GNJA 4NRRA 1UQZA 2B7OA 4OE7A 5AHEA 3E2RA 3MI3A 1T40A 3LPPA 1WXZA 3G1AA 4Z42C 4HOXA 3LHYA 1W1PA 3MUCA 4CD7A 5DF0A 3WSUA 1B57A 3E0IA 4LAOA 3G2GA 1OCNA 1I2OA 3EWBX 3TROA 3DI1A 3WN6A 2DZPA 2CLEA 1RSCA 4JEJA 1SO6A 1OGBA 4UQBA 1MZHA 3EZ4A 1WX0A 1OX5A 3E38A 4KFOA 3RIKA 4PTWA 3WLOA 1GVYA 1J0ZA 1EZWA 2NT1A 3SSJA 3QY8A 1IEQA 4C6PA 2ZUMA 2PRLA 3ARXA 3O7UA 2CHRA 1CEOA 5C71A 2Y1HA 5AC4A 1W56A 3OHMB 3PZIA 1IGWA 1N8IA 3JZUA 2C71A 4UQEA 2YL6A 1OABA 2QJIA 3CBWA 3ZM8A 3MT1A 5HATA 2PURA 4NT0A 4F48A 3H12A 5M5DA 1UP3A 2NQLA 5CZ0A 1XG4A 5EMYA 1E9LA 1KM3A 1IXOA 1PYMA 1VBJA 3U2OA 4J7RA 5GPRA 1BXNA 3H6OA 3IV8A 4BEQA 2HE8A 4R5EA 1TV5A 2WANA 4UTWC 5JIWA 4NZFA 5D9OA 4ZGYA 4ICNA 1VCFA 3IJ8A 3URQA 3U57A 1TB3A 2QV4A 2R9RA 3EB4A 1U5VA 2J74A 1NSJA 1Q8JA 3TDFA 2DVUA 3TTOA 3CM4A 2UWFA 4FK9A 5A8OA 2O55A 2VJXA 2PAJA 1EO5A 3G3MA 3OO2A 5DN1A 3G6LA 4EPKA 1FWBC 1XH2A 4V15A 1V0NA 5A6MA 2DZXA 3C2FA 4G56A 4EOUA 1JPMA 3P62A 4AD0A 3P84A 2FDMA 5FF7A 3FXGA 4FNUA 3CJPA 3WQFA 3M7SA 4WR3A 1G01A 1LJYA 3CHFA 1K9FA 2RDXA 1E73M 1P1MA 2WBKA 3H8AA 2IKIA 4X0VA 3E02A 1TWIA 4U33A 2VWTA 4R9OA 3NG3A 2E77A 2XTKA 4RNIA 2DZBA 3RILA 4R33A 2FMNA 4DZ5A 3LRMA 5E93A 4LANA 4JD4A 3H4XA 4M0XA 1UP0A 4HP5A 8XIAA 1XLDA 3WF1A 2XINA 3GYCA 4DO4A 2YBUA 3MCMA 5I03A 3CIWA 2SFPA 9RUBA 3WNPA 3WDHA 1JNEA 1Q6GA 2J6XA 1XBZA 3VE9A 1SO4A 1O94A 4DWSB 2ZA2A 3NPUA 4U3CA 4B5SA 3RM4A 1SGJA 4O0ZA 5HQLA 1E55A 2W61A 2OXNA 3P14A 4S3GA 5EMLA 2QVHA 1QPQA 2QJJA 5FOOA 4PUWA 4F3HA 3EAUA 2DT1A 1YBQB 4J2MA 2AL2A 1E1EA 4MNKA 3S5NA 1KGWA 5EMJA 3WLSA 4ICMA 2X0HA 2OEJA 1D7FA 2A7RA 3IUHA 1CWYA 5I3HA 2ZDSA 1GNXA 1U83A 4FP1A 2HSAA 1GQIA 1AQFA 4ML4A 2EG8A 2LLEA 2CKSA 2X8RA 3NIYA 4XWUA 4BA0A 4E3VA 2CBVA 2VR4A 4G6CA 1OWQA 1TUFA 3THAA 4H7CA 5BWAA 5IBXC 2GVEA 3H4WA 3P80A 2P50A 3MSDA 4Z1YA 5CC3A 1Q13A 2GPTA 3PJTA 3WLJA 5FL0A 4TQTA 3FN9A 1Q85A 4CQ9A 4L4MA 5CLTA 2AQVA 1S2VA 2C1HA 3VNDA 4GHRA 3TYUA 4CQDA 1GJPA 1DWGM 5EA9A 1EX5A 3LZ5A 1ZENA 1MDRA 4DNHA 1AFSA 1E4IA 4JTAA 1UJQA 3SJNA 3WK0A 1KW1A 5EBUA 2IQ0A 4O1AA 5C6MA 3ITCA 1JYXA 3T8LA 4XTDA 1W9PA 2VVSA 4PCFA 3FKRA 1YIXA 2XIQA 1EC9A 4LF1A 1D8WA 3W7GA 4MAVA 3PANA 3MBFA 3A9BA 1ITUA 2E8ZA 3KBWA 3W7IA 5HA7A 3OBEA 2J77A 4PUNA 4GZJA 1XLLA 4WXYA 5DCDA 3NXFA 2EF9A 3BV4A 3STEA 4UBPC 1AQHA 3CV7A 1JDDA 4PTDA 2DZUA 1K02A 3B4YA 1W32A 4Q3MA 4J4KA 3V18A 2TYSA 4NAEB 3MKCA 1ESWA 3O16A 1AK5A 2C7FA 3C3UA 3CEPA 3NM1A 3GNOA 4LC8A 3PULA 4QCFA 1DJYA 4HA1A 4HGXA 3W1UA 1ZL1A 3G1DA 3GO2A 5GQBA 3ZVHB 3GW3A 4JGDA 5LA2A 4LRSA 1I2RA 3RU8X 2PMQA 3ATYA 2JE8A 5BXTA 4Q7BA 2GOUA 4EVZA 1PL9A 2GSJA 1ZP4A 4F9JA 3BH4A 3QEZA 1R85A 5HJLA 1QU4A 1OD0A 4YU1A 4AC1X 1A0EA 5HPCA 3QSRA 2NVAA 3QC0A 5CZKA 3L66A 1QATA 3EX2A 4LUSB 3FJ4A 3NXLA 1I0DA 4FLOA 5C7HA 4WDUA 3T9PA 1EWDA 1R86A 4IFOA 1J0YA 2X0YA 4D6EA 5BZAA 2PDKA 1W1A1 3UXLA 4CNNA 4AZ5A 4YTTA 3V35A 3RK8A 3ZLFA 2WM1A 1D9EA 1JGMA 5BXRA 5GNZA 1E71M 2AGKA 3VU2A 3QPEA 3E96A 1TPFA 2OYLA 1J0KA 3CWNA 2W9MA 2WLYA 2CC0A 4D71A 3EMCA 4D2JA 8A3HA 1V6XA 1G5AA 4LWWA 4JDBA 2G96A 2HNEA 1XINA 3OA5A 4JFTA 3TWBA 2QV5A 4G8TA 4DI9A 4DWSC 3UJ2A 2IPWA 4ICCX 1IYXA 2J66A 4IMCA 2A3LA 1R8LA 3ZXWA 3BZGA 5FF2A 4C6LA 4ADUA 4JDYA 4JYDA 1SO5A 1EQCA 2P0OA 3KL5A 3IGUA 5I3DA 3WDQA 2X0SA 3RGTA 4AIUA 5D2VA 4OBTA 4FO4A 3WQ8A 4JYEA 1PJ9A 3UA4A 4ROPA 3WDIA 2DU2A 4Y7EA 3MSRA 3M1ZA 3U4FA 4ILSA 1VR6A 5CCZA 2ZX5A 2PDGA 1WXJA 4MZ1A 2P10A 2X1IA 4UTLA 2VYOA 2GGJA 4CNSA 3ITTA 2HK1A 4E3TA 4GIEA 1XDMA 1G7UA 4P61A 4OJYA 2J4GA 3NZ1A 3RX3A 2C15A 5BU6A 5LIUX 4DYKA 4GRSA 2P8BA 3BOXA 2P1FA 2PTYA 1CGYA 5DEZA 3UF9A 1X6UA 4I8YA 3L65A 3NCOA 4M1RA 2BGSA 4DJFC 3PPHA 4N9CA 4MDPA 2WJDA 3RM8A 1TZZA 4NNBA 3OYXA 2RH9A 1KRCC 1FWWA 1JJKA 4AYGA 3KHDA 2NQJA 3OZMA 1J18A 4L61A 1W91A 1BFNA 2RFGA 1SFJA 3W22A 1KLZA 3POCA 2G5WA 2CXEA 2OZ8A 4D1IA 2QHAA 1KBKA 2WWDA 4GIYA 1A5SA 2ISDA 4BF5A 1CYGA 2YW4A 3AMCA 1JVNA 2XG9A 1V0MA 2YDQA 3BTNA 4L1XA 3ECQA 1WKEA 3TSDA 2WMIA 1UR4A 1WBHA 3U6WA 1WDQA 2R14A 4W7VA 4Z1BA 1GKPA 3FV9A 3LV6A 3L5LA 1XLIA 1JZ3A 5H6HA 5HWMA 2QIWA 2Q8LA 4C6DA 3GU2A 4QE5A 2D3NA 1PAMA 3GW0A 3N19B 1BD0A 2NXGA 1O95A 1R3VA 5D04C 1YHTA 1RQEA 4A2RA 1NARA 4H83A 4OHQA 3GFYA 1GVSA 3KE0A 1AA1B 2ZXDA 5JH1A 1X8CA 2O9RA 1P48A 1A0CA 4MNLA 2ESCA 4L6DA 5DRCA 5I79A 1UD5A 1N2VA 5DX7A 2ISFA 1JR1A 1IT8A 3P74A 5C7VA 3CQHA 1ME9A 2J9XA 2QCMA 3QOKA 4O28A 1Y0EA 3W7QA 4QTGA 3EMQA 3IVTA 1JPHA 2ACSA 4D9PA 3BLEA 4KRUA 2PDUA 5IDIA 1WDDA 3VDCA 3W7CA 3B9OA 2PWVA 2Z0IA 2VOTA 1R2SA 4IWWA 2VC7A 3P3BA 2ZRXA 1UOZA 4O1CA 4Q32A 1Q6FA 4IP7A 1G4EA 1Q3NA 1SZFA 4US6A 2NVDA 1I8JA 4WCJA 2HVOA 4MM1A 1PX8A 3WQDA 1XLHA 1V93A 3P8JA 2PFHA 5KETA 3AIUA 1V02A 3GVGA 4DUWA 4ZA0A 3D3FA 1XM3A 2HV5A 5A2AA 2PWEA 1XYZA 4CQBA 3HJZA 3APTA 2W0UA 3B40A 4DBWA 2BHYA 1ADDA 3THQA 2YFOA 4HB7A 3MUXA 1WP6A 1V51A 1OZQA 3GG8A 2G3JA 4D6FA 2VZVA 3WNLA 1EEPA 1E1CB 4I90A 3CAKA 3W1TA 3IRDA 4HCDA 5C9UA 4H41A 2E9BA 3EWCA 4INFA 1PHWA 1RXOB 2YOCA 4M8UA 4QSFA 2DFAA 3USBA 1OX4A 2DZTA 1LT7A 2GQ9A 4W5ZA 4WOZA 3SY8A 2V9DA 1X7IA 3EWYA 5D32A 3CHCA 3B0PA 5ECUA 1ELSA 2R94A 4YMZA 3VDAA 3HG4A 1G7VA 4MHBA 2Y8VA 3EA2A 3WBEA 5KZMA 5K3VA 2EXOA 4DBDA 3WBWA 1Y5WA 1RUSA 1P5BA 1H7OA 5FIPA 2DQWA 4H2HA 1KXQA 2ICSA 2VUNA 1QNVA 4B16A 4MUZA 1EH9A 3LUTA 3ABRA 4K7VA 3KOFA 5G1MA 2YDAA 4GFIA 2H9AA 5D38A 2PLMA 1VH7A 1SZEA 1PUDA 2NX3A 5HOSA 3JRKA 2QJGA 1KTBA 2VFEA 1TRIA 2DVXA 4P7LA 4XZNX 1SVDA 5K4ZA 4L4OA 4CLMA 4XX6A 4EPEC 4ZSTA 1A80A 3BGGA 4Z08A 1HKWA 2E28A 3KVKA 1QPRA 1RLCL 1NF7A 2V5JA 3LLDA 4LPCA 4ZQNA 3KVMA 3WD0A 1XGEA 3KOWA 1KWGA 4WIWA 2IPJA 4G1KA 4PGLA 4YVPA 4LNCA 3KCOA 1R3WA 3W6LA 2MUCA 1VRXA 4B91A 4IUOA 1QW8A 2G37A 1IWPA 3R11A 2VDHA 3C8FA 4J3TA 4NJJA 3EOOA 3NWRA 3CPRA 1SO3A 1XIMA 1O6IA 2Y62A 2PWHA 4S2BA 2E6DA 4PBGA 1B54A 4HD5A 3SB0A 4V1YA 2BB0A 3QZ6A 1N55A 3EDKA 3WENA 3DYPA 2PP0A 1BWKA 2D0GA 2VC5A 1H7WA 4IL0A 4J9JA 3DI0A 1HO4A 1Q6DA 2BHUA 1LRQA 2VWSA 4H9ZA 4LVDA 3R6IA 1J93A 1XFBA 3E74A 4S3BA 2R6OA 4R3UA 1H7RA 4OU1A 2R1KA 3B9AA 3DFHA 5M03A 4C6QA 1S1RA 2WPBA 4Q8OA 1K7EA 1P0KA 2WSQA 1W1VA 3RX2A 5HBFA 4AZ6A 4AY8A 4C7DA 2CLIA 3CXOA 4HPGA 3BLIA 3VIKA 4AWUA 1PKYA 3ENLA 3TW7A 4DHGA 2EPHA 3UU0A 2Z4GA 3SN4A 3S1XA 1UQYA 3Q65A 4ATWA 4F79A 3G1FA 3W7PA 5AYYA 1THFD 4S3FA 4DJDC 2PDQA 2QCCA 4KETA 2DIKA 1KXTA 2VURA 4FR6A 4U5KA 2ISSA 2OOGA 3VNZA 4J27A 3OW1A 3RU6A 1TWSA 3FYYA 1FWAC 2CLMA 1XLAA 3H2CA 4EPBC 1IEVA 3QHOA 1J8VA 3TTQA 2QUVA 4GQQA 3PJXA 3SRDA 2VTFA 1XLMA 3FGCB 2CEQA 3FDKA 2XH2A 3NO1A 3FHQA 3TN6A 1GVIA 4UOQA 4B3LA 3W2UA 5LNUA 3D46A 3NSXA 1Q2SA 1OX6A 3HQ1A 4O18A 1NM9A 2UY3A 1E0VA 4QDPA 1HJUA 2A5HA 1QNSA 3WJYA 2R1NA 3WMLA 5LZLA 1RA0A 3ABQA 1HXJA 3UZYA 4G7EA 4Z0JA 3VKCA 5L9FA 1JYNA 1JZ6A 1L0PA 5G1YA 3V7PA 2HS6A 3UZJA 1YRRA 5A6BD 1H51A 1IZJA 3RDKA 4PCTA 5C70A 4O54A 3L5MA 1V6VA 4MWAC 3GYEA 3SCVA 4ECLA 3LTSA 3PBUA 3O1NA 1DORA 4A29A 1M5WA 3R7MA 1ZJBA 4JTRA 2WO5A 3SUSA 2V69A 5D9NA 3MB9A 1DJGA 5HUOA 4HYVA 5D2TA 1OYBA 2PLKA 1C9DA 2OWXA 3DG7A 2CLFA 4HK5A 2DJXA 2CLOA 1C91A 2YR1A 1VFOA 2P53A 2BP1A 2OU4A 3VINA 3F4DA 4HK6A 1XLGA 3LTYA 3A4JA 3QMRA 3KDOA 1V6TA 1V3IA 1HNYA 2PWGA 1SJDA 4GIAA 3C0JA 1T41A 3ZJ6A 4CCEA 2BOEX 5HDRA 1XUZA 3EEZA 1Z44A 1XKYA 1SJAA 1EA9C 2AAMA 1IGSA 4J3UA 1JRBA 4QRNA 1GEHA 2ASHA 1GHRA 1TFVA 1OVDA 1XCXA 1EP2A 2PGEA 1H0GA 2Y63A 2DQXA 3WF0A 1J96A 1ML1A 2QCDB 1XSJA 3CUXA 2PODA 4O4VA 2WWCA 2Z00A 4MB1A 3VKKA 4BQ2A 1ODZA 1TO3A 1GOXA 2Y7GA 4XIMA 2WJZA 3A24A 3EPMA 3WL0A 3DHDA 4L9YA 3DG6A 2WC3A 2A7NA 3OLGA 4XSMA 2BMBA 1WDSA 1DQXA 2PDBA 3CYJA 2DORA 4CQCA 2WMKA 2R8WA 1XYCA 1US2A 4ZO8A 5I23A 1Z9AA 3VKJA 1EJ7L 4XZMX 2PC4A 5HWJA 3A4XA 3P60A 3D3AA 2D73A 4GY0A 4DJED 3EA1A 4CNOA 1WXYA 3XINA 4M82A 2V2HA 5IFPA 4DM1A 3R94A 2E6YA 4IXXA 4D6HA 1U5HA 3ANVA 3M7WA 3ZWSA 3C6CA 3W75A 3NDOA 2J7EA 1VHCA 1KBLA 4QHRA 3DAQA 3WKZA 3QR0A 2H90A 1XIBA 3I68A 3WFAA 2QMJA 1EJWC 3LM3A 3GD6A 3NA8A 2D24A 2QJHA 2PP1A 1RBOB 1JZ2A 3L9CA 3W9ZA 1PWLA 4NHVA 1V0LA 1VD6A 4FIRA 3WK3A 3CAQA 3M4HA 2J7BA 3IPWA 3CMJA 1DHPA 4QQ3A 3GE7A 4DUVA 4LYRA 4D6GA 3EX1A 3AC0A 3LMYA 2CW6A 5JBDA 2Q3RA 1CLVA 4PMNA 3WD3A 3R13A 3VMNA 3LGGA 4WHBA 4UNIA 3WQPA 5CZTA 2XIJA 5HAOA 3CZKA 2ZZ6A 5FACA 4HHLA 4GQGA 5EMKA 3SEPA 2J9YA 4DF0A 3TMLA 3NQDA 3IAPA 3KTCA 1NOWA 4CN1A 2WZEA 5H8UA 1Q4NX 2I5QA 1Q6CA 3WNOA 1TMQA 4LUTB 1OCJA 1W5MA 1TV2A 4X3ZA 3W7RA 3R0KA 4HNTA 1XH0A 3I4EA 3ITVA 1F73A 1E70M 4JX6A 2GGEA 1HJWA 3E5BA 4IMFA 4O0QA 2Z2UA 4PMVA 1H61A 1RVKA 5D2YA 1XIHA 2HJPA 1RA5A 2WSRA 1NQKA 3ITXA 3IIPA 3M0VA 4NAEA 3VMOA 3PTQA 2EO7A 2AQOA 1GHSA 2ZUNA 1FA2A 1ZUAX 5CC6A 4GKTA 3VIJA 4M56A 3U0HA 3DH7A 2I14A 4C65A 5D37A 3NQVA 1XBVA 3PUEA 1VLIA 4Q4RA 1I75A 2EKCA 3SCUA 3W53A 4IX0A 1P0DA 3KP1A 3LEPA 4GH1A 5BU9A 3BC9A 5BMXA 4Y6GA 2PA6A 1VYPX 2FZBA 3LNMA 3V5FA 1KV8A 1SJBA 5CG0A 3GUWA 4QJ5B 1MI3A 2BVTA 5K9DA 3R2GA 3LENA 3N29A 2IPGA 2DZWA 2WKLA 4O8RA 1GKRA 2WC4A 3NPVA 5CXPA 1GOOA 1Y65A 5JVLA 1DJQA 1MXDA 1QI4A 3TONA 2J88A 2VM8A 3GZ3A 1QBBA 4QIUA 2XGIA 3NSNA 4MSSA 1AL8A 3N6QA 3KDNA 1E1CA 4EAYA 2GVYA 4O57A 1YDNA 2NXIA 3W1AA 1E4MM 1VBGA 3GH5A 1QPNA 4NI8A 1FRBA 1DJXA 4OQVA 2EPLX 1OT1A 1OX4B 4AD4A 2A1YA 3LYEA 1CW2A 4DXKA 3NQBA 3G1YA 3BCDA 3B0VC 2B7PA 3POHA 4S3KA 3WLHA 5AYZA 1V79A 5H1WA 3VXGA 3BAIA 5BW6A 2VUYA 3G0XA 1PO9A 1ZP3A 2Q02A 3TQ0A 3TN4A 2HBVA 4E5TA 4DWSD 1EWEA 3B8VA 2J8FA 3GTNA 4WD0A 3NOEA 3UFYA 4JICA 4Z2LA 4QJ4B 1NP0A 4H9XA 5CJNA 2FIQA 4KWVA 2J7HA 1OFOA 3AYTA 5K9CA 1L8PA 2G3IA 5BYWA 1DIEA 1HJQA 3WD4A 1BLIA 1K3UA 3VILA 2VO5A 2BV9A 2J7DA 2P5NA 4I3GA 2JQXA 1AODA 3BICA 1AZ1A 1RY0A 3QC3A 3EBVA 4TMBA 4BI7A 4UTMA 2OZ0A 4HPHA 1UKTA 1K9TA 3VE7A 5T8GA 3HPSA 1DWFM 3NZPA 1XGDA 3DZ1A 3K4AA 4DQWA 3R79A 3N18A 2D1ZA 3B03A 3DECA 1XH1A 4EWJA 1YNPA 1TE1A 1S46A 1H7PA 2G41A 3L0KA 3MMTA 4UQDA 2VEKA 3LCWA 3QM3A 3I6EA 5G2WA 4TVDA 3FHAA 4F9DA 4HYRA 1CGWA 4RZ4A 3VNMA 1C7SA 3UCCA 3QXBA 1CX9A 1UWAA 3N2TA 1XS2A 3DU0A 4N4QA 3LHTA 4K2SA 1RALA 3BMWA 1QOPA 1XIIA 4JZ5A 4UNLA 3M5ZA 2VQTA 3O06A 1QNRA 1XCWA 4BKNA 1A5AA 3SRHA 4C6JA 2UBPC 2NQZA 3FVMA 2CU0A 2DW7A 2PZNA 2PTZA 2YLAA 4UTUA 3IVUA 5D4YA 1UMLA 4CCZA 3GIQA 3KOXA 4JAWA 1LOSA 4Y2WA 1B90A 1QNOA 1KFLA 1UWTA 3L12A 1LL4A 4I5UA 4QNWA 3UPMA 7PTDA 4YVVA 2BOGX 3CZGA 4J40A 3TOYA 3DBPA 4JTTA 4Q4QA 2EPMX 1PIIA 2C91A 5JU6A 1W9VA 3CNYA 1EQPA 4Z2GA 1LBLA 2ZCGA 3TUUA 3UGRA 2FYMA 1K9EA 1VLWA 3AS2A 3VCNA 4UFIA 3V0UA 5MKGB 4NL1A 2FTYA 3P61A 1EJUC 1GWJA 1ZRQA 4QQUA 2RDWA 1H63A 3LCGA 2YA1A 1EBGA 4R7OA 2ZRYA 2OOFA 1HVXA 3ZT6A 3RF9A 4GI9A 3WELA 3NM3A 5F2LA 1WOBA 1O7AA 1XLCA 3BLDA 1DQUA 1KBJA 1VFTA 3UQNA 2V63A 4UTJA 4NYYA 2CLLA 1QASA 5CSSA 3G1HA 4FA3A 4F0LA 5J8LA 2WSYA 3URAA 4KIEA 5GNXA 3W88A 2VL4A 4L65A 1OK6A 2NWRA 1WKDA 2V3EA 4RDYA 1YMYA 2PGRA 2ZWZA 3T0CA 3PZNA 3MA8A 3LZ3A 3RCYA 1X1NA 1V7YA 4U4MA 4W84A 4EPDC 2ALDA 3I10A 3INPA 3UWYA 2PB1A 2HQAA 2ON3A 3NZQA 4CD8A 4E2BA 4R34A 3LDVA 3T4CA 1ZZMA 2XDFA 4JHOA 1CGTA 3WLKX 4CCDA 1H0IA 3SN0A 3SCWA 1XC6A 4RV8A 3TA6A 5AZ0A 1MNSA 3F5KA 5XIAA 5I02A 3GZAA 3GNNA 4MKSA 4UC5A 5A2BA 1EJXC 2J24A 4J3VA 1V4YA 1K7FA 4H1ZA 1FCBA 5I78A 4KESA 3GKAA 4AD1A 4K39A 2ZZ2A 1DVJA 1ECQA 3VIIA 4PCNA 1GG0A 3BAKA 3QV8A 3QYSA 2B7QA 4IGNA 4Z1DA 2OKTA 4H6KA 4JBRA 2Y5EA 2KZHA 3GTHA 3L68A 4GINA 4N42A 4Q4SA 3BLPX 3B9EA 1XW8A 5CPOA 1B2YA 6REQA 3U7BA 2VNCA 2CESA 2B0MA 2Z1VA 3A23A 5FEPA 1P0NA 4Q33A 2VX5A 2FJKA 1BVZA 3M5VA 1QDSA 3F03K 1YDVA 4F66A 4ZOEA 1V02E 4GQBA 1R0MA 3QHNA 2YA2A 2DZSA 3TLLA 1ZGDA 2ATMA 5FD0A 2YBTA 3T8QA 3TNBA 2XIIA 2PUZA 5EFFA 4CN4A 1T8XA 4O1EA 2W79A 1JPDX 1OB0A 1DIKA 3G8RA 3KBSA 2B81A 2HE5A 2V81A 4TO8A 4A35A 2GDQA 2OT1A 4GYPC 4S3DA 2XVGA 1L6YA 4GYKA 4KRTA 4DZHA 3TH6A 4K6AA 4EXQA 3OLEA 4MPKA 4GCAA 1S3TC 3SY5A 1P6WA 1GQKA 3VNJA 3VNKA 2AMGA 2X16A 3FXYA 1XYMA 1UD8A 3EPNA 3EYPA 3PFMA 3MY9A 2C19A 3W1MA 4UFHA 4WSHA 2Y5SA 4AZCA 1V03A 2HROA 2V3GA 5C9XA 4L4PA 2E0PA 3BZJA 3Q45A 3PZGA 4GYJA 2ZXBA 1E6NA 2BXZA 3HFYA 2OELA 1JG9A 2Z2AA 4TU1A 4XZWA 4MMWA 4A8LA 1L9WA 4ZMGA 5T91A 3RUBL 3ES8A 3FK4A 3R0UA 5D9MA 3QMTA 2OTDA 3BW3A 1PZ2A 1WPCA 3LV5A 2A3CA 2VFIA 3L4XA 3PP7A 2W92A 2XSBA 4Q8PA 3FW6A 4GA8A 2XSXA 2NVCA 5DXYA 1OINA 1RCOB 4JIQA 2VC6A 4DWSA 3WDRA 2QUNA 3QTGA 4CGTA 4AVNA 1M41A 4A8NA 4GO9A 3CPGA 3SN1A 1IEXA 3AXIA 1GOKA 3RR1A 4AHPA 2IMRA 3ZR5A 4NZ1A 3MJMA 3BJTA 3CQKA 4MJZA 2EAWA 1LORA 2WAGA 3HG3A 3S2CA 1HFBA 3H54A 4PSPA 1GTHA 1UZDA 4GNVA 2WB5A 3OG2A 3R4IA 1IR2A 3FVDA 1KM2A 3ARZA 1E9YB 4JTSA 1YW1A 1JUKA 3KTXA 3WF4A 2XISA 2VEIA 4KCUA 3QV7A 4UFKA 3F2DA 5CSRA 4DAFA 3PK7A 4E4FA 3QR3A 3FEMA 3B8DA 1W3TA 2E3ZA 2WZMA 1V0KA 4W4QA 2A21A 1IEIA 1IE7C 3OPSA 1TV8A 1MW1A 3O63A 4CD6A 3WH6A 3CO4A 1LL6A 5HJXA 3BOFA 1F3WA 4C7FA 1C8QA 2WHMA 3LX9A 3B04A 1E4LA 4U2YA 1ZJIA 3AWOA 4DJFA 3M07A 4NIRA 3CUIA 3KOZA 5FJOA 4QAWA 5REQA 1H7NA 4ZB0A 3FKKA 4LAZA 5F1VA 3VNIA 4EK7A 7ENLA 3CC1A 3F2BA 1PS9A 3IANA 2O7SA 3SUUA 5KMYA 1PYFA 4UQAA 3VIGA 3TWAA 2PDHA 1S39A 3W0KA 2W62A 1E9IA 3IS4A 2L5HA 1UD4A 4MWAB 2QGYA 3DHUA 1D3HA 2ANUA 2E1DA 3BURA 4TVCA 4XZ9A 5U4NA 1MSSA 1T0OA 4TIMA 1W9BM 1UIPA 4GGBA 2UY4A 1IZKA 2Z26A 3UXDA 3I3EA 4AVFA 3SUWA 2OSXA 5LHFA 4C1NA 4LAMA 3TYCA 4ADSA 1HKJA 3MHGA 1JNDA 2O56A 2BTMA 3GLCA 4HTYA 4JTDA 2FH6A 1HKMA 3T0AA 1XDJA 2XVPA 4DXXA 3NQMA 3S5OA 3CH9A 2VR2A 3GNPA 4XKYB 4QSHA 3ANUA 1IIGA 3UYCA 1OC5A 2EQDA 3AS3A 5A6JA 5LNVA 5D9PA 1OIFA 4US5A 1KXVA 2E7FA 3EWXA 3F5LA 3ZS4A 3ZVHA 4DUXA 1TV3A 4AUBA 5BNKA 4PR4A 4OBRA 4WY0A 2DIJA 1KCXA 4NXSA 3W1NA 3DCPA 4IICA 3G3DA 2YL8A 1S1PA 2EKGA 4YTQA 4HMEA 5AHIA 2XIMA 4LVGA 5F1UA 3SGZA 2MANA 4UXDA 1KKRA 4GABA 3CO8A 4FR1A 1CT5A 3CQIA 4GE8A 3BWWA 5I5RA 3OJGA 4OUIA 1C7TA 1ZBVA 3CB8A 4FLSA 2VMFA 3S1GA 2OG9A 1KV5A 4MNMA 5E09A 2PTXA 1OSEA 3OOQA 3GM8A 4HIBA 4D8ZA 2WNQA 5I09A 3KEHA 5A8GA 1JZ4A 5HANA 3VOGA 4DJDA 3DN5A 1G67A 4Y9PA 3IAQA 4KF1A 4QJ3B 3OEXA 1X96A 3SGGA 3CASA 1OBAA 1SZRA 1RAKA 4M6UA 1PPIA 1RV8A 4DF2A 1MO0A 1KC7A 3GWQA 4IT1A 3HPFA 2ZZ5A 3TTYA 4CVUA 3KRBA 2Z25A 5G4HC 1H5VA 3SIMA 1KFKA 5IOBA 5AVNA 3G8EA 1LROA 4IISA 1KRAC 3PZMA 2DZAA 3TYEA 2KX9A 5TBOA 4RXFA 4PTXA 3AUJA 3L67A 2V5DA 4QJ1A 5AYBA 2PI6A 3W1RA 4IP4A 1RPKA 3CUGA 4ZQPA 1HL9A 3PN8A 5ABEA 4Z2IA 4JYFA 3WQ5A 2O92A 2YW3A 3ARRA 3L4WA 1A5CA 4GJ1A 3S2MA 4MTVA 3TMQA 2ZQ0A 2Z6IA 1VJSA 4QCEA 4IOTA 1CI1A 1FWEC 1XICA 1FCQA 4HQVA 2J79A 2ZIDA 1OCBA 4O17A 2XZ9A 3N73A 3G1VA 3QGVA 2X30A 5D03A 1KCKA 3A6OA 1UPPA 3ITLA 3RPTA 1ZLPA 3WQOA 5FEXA 2QJNA 3QPYA 4XZBA 1IHIA 1DE6A 3VZZA 3W2JA 3ARPA 2QLYA 4B2DD 1XBYA 2FZNA 3TZNA 2CWXA 2GGHA 4FF7A 3BE7A 4HK7A 3RJXA 1BKSA 3WEOA 3HQPA 1BWVA 1HP4A 1MVYA 4Q6JA 3WNKA 3MMDA 3TCEA 4H3DA 3MPGA 3B8TA 3RLHA 1O5XA 3PB0A 3LD5A 4UCGA 4KMQA 2FPTA 1W0MA 1XIEA 2Z7KA 3N13A 4I7WA 1MQPA 1UR1A 3AXHA 3NJ3A 4H8VA 4A4AA 2Z1SA 2GJNA 3R10A 5FESA 3G1RA 1G4PA 3BQ5A 3EOSA 1P7TA 2WHKA 4JIIX 4PUKA 5E5CA 3G0SA 2FH8A 3LERA 1TPC1 3N15A 4JQ4A 4LUYA 1JYWA 1LBMA 4HMNA 4P8UA 4OFCA 3H7UA 1U33A 2W67A 4NRSA 2GUUA 2QJMA 3GXPA 2Y61A 2DPEA 3ZQ9A 3V4BA 1ZALA 1P6BA 4CD4A 3ZSSA 4ADTA 1ZS2A 2GK1B 1UD6A 2C6QA 2F6XA 1Q7QA 1MUCA 4GX9A 4FNPA 1KB3A 3RO6A 1N8WA 2ABBA 6TAAA 3ALGA 1VPQA 4MWAE 4X2RA 1O4UA 4IMDA 1D2KA 1H7XA 4FX6M 3WH9A 4OV9A 3VCCA 3DOPA 4L9ZA 3CU2A 1BQCA 3EB3A 1XC4A 1JD9A 2W27A 3DDMA 5FJRA 2DDXA 4LVAA 1JAKA 1A3XA 4M6PA 2CZEA 2BVYA 4YWSA 5LXEA 1K8ZA 4E8DA 2UV8G 3TZFA 3A5FA 4IQDA 1R3QA 1Z48A 3UXKA 5XINA 1EDQA 3A3HA 4JFSA 1E1FA 5T9CE 5A6AA 4Y9NA 2GJPA 4HZ6A 4Y8EA 3WYZA 4BK9A 4UTHA 1J79A 4MKNA 1FHUA 3NGFA 4JX4A 2OVLA 1B30A 2AMXA 1K03A 4LV9A 5CG7A 1PBGA 4RX0A 1F3TA 4NAFA 2DSUA 2C13A 5J04A 1RH9A 3HPXA 1U1HA 3L4VA 3PWGA 3Q37A 3UZXA 3CWOX 5HK4A 1BXCA 3FOKA 1J2BA 2CPUA 3CUJA 4N0RA 4K68A 4QITA 1POKA 5CSUA 4WGHA 3EXSA 3EB2A 3FAWA 2OJPA 3I3BA 1UW9A 3BVJA 3IWPA 2V5LA 4XQ6A 5DCBA 1FH9A 1EJSC 3ARYA 7A3HA 1BTCA 3TJLA 1XLBA 3MMWA 1BF6A 1QNPA 3VKAA 2Z27A 3PUOA 1NOUA 1J5TA 1GVQA 3M47A 5GJPA 3DX5A 3GFZA 4C6CA 5HMEA 1GPWA 3NQ6A 2BXYA 4XBJA 3WK2A 3NNTA 2POTA 1ECEA 3CHDA 4NASA 1OYCA 1TV4A 2YCJA 2FVLA 1BGGA 2QCEA 2RGLA 4U5IA 4U10A 3GU1A 1Q6LA 4F0RA 3U7VA 5AHNA 1Q6OA 2E40A 5I00A 2ZXQA 1KFJA 3BSHA 3TA9A 3GBEA 1GK8A 5LA0A 1DWJM 4RE3A 4QROA 1EEXA 3AJ7A 2DV0A 3KOYA 3IVSA 1AMKA 5D09A 1LOQA 1UG6A 1O66A 2DSKA 1F8MA 5FSEC 2WCSA 4MDOA 1X1ZA 1MW2A 3VDHA 4XB3A 4HHMA 3JUGA 4M6VA 1R47A 4RZ6A 2H9AB 5IDZA 1JCYA 2WKJA 2VOMA 3GNXA 3AS0A 2OZTA 5MHBA 1VKFA 5HNRA 3DBNA 3TYBA 3CB3A 1FKXA 3CZLA 2G3MA 3FDGA 5JUVA 1YLVA 5FA5A 1W8SA 8TIMA 3D6NA 1XDLA 3MUIA 3OLIA 5CH9A 1TTJA 4CEXC 3EA3A 1WO2A 4JKLA 5TD4A 3REQB 4K3ZA 4LOCA 3AMLA 3VM5A 3GY1A 4BQ5A 4AXNA 3TJ4A 3UPWA 4ZTXA 5CBJA 1J10A 2ZX6A 4B4HA 3LN3A 4W8AA 3GTIA 4MJ2A 2CETA 1S5NA 2WZIA 4PN2A 3RLGA 2XFFA 1KA9F 3H2NA 1M6JA 1PKMA 4B92A 4UR9A 2C3ZA 1F6KA 1YE4A 3M43A 2A6NA 3OIXA 1J0JA 4B9ZA 4BHYA 1F4HA 3FJLA 2RAGA 4NUWA 1FH8A 3HGOA 3BPWA 3UG8A 3LMZA 4ATDA 3P6LA 1JFXA 1PX4A 3BL3A 2OMAA 1MMFA 1LLWA 1V3KA 5JXQA 2GUYA 1CECA 1OFDA 5A2CA 1VPXA 5LGXA 1LWJA 3C3NA 3MUY1 3SI9A 3U2EA 1TZ9A 2Z28A 4FLQA 1PZ1A 4QISA 1ZPTA 4LQ1A 4FF5A 2PGFA 4WY0F 4AEOA 2GQAA 5H91A 1AVAA 2OEMA 2BBFA 2BNJA 1VQTA 2WVVA 5FI8A 3CZ8A 3IIZA 3IJLA 1HJVA 4GWEA 4JY9A 4MB5A 2CHNA 4MYXA 3NTYA 4BEUA 1KGUA 4HMDA 3GSMA 1G6CA 3GVVA 2YYUA 3FSUA 3C61A 3WQEA 2HVMA 1AH4A 1DBTA 1QFEA 2FJUB 3SR7A 3DYMA 4QXIA 1LLOA 5AYXA 4DUOA 1DJWA 1M1BA 4ZZ9A 1QHOA 1JCTA 3BLKA 4BQ4A 1T6MA 4V28A 5F2MA 3TP4A 3T40A 3AFBA 1DWAM 1V77A 2FVKA 1BYDA 4BF9A 1UC5A 1F07A 2E8YA 4IF2A 3GVRA 4KW2A 4C6IA 4S3CA 4NZ3A 5KITA 3TC3A 6XIAA 3SBFA 2YDSA 2ZRWA 4WY0B 4HNUA 1WKYA 4MWAD 3CLWA 2R1LA 4OVXA 1A4MA 5HR7A 1UWUA 1U22A 1ZBCA 3U9IA 1EC8A 1S2AA 3PPGA 3W1QA 4B5UA 2FQIA 2D20A 4FEZA 2DIEA 5G1TA 2YL9A 2EJAA 4PRTA 2FHBA 4I8DA 3AALA 2FTPA 4GO8A 2RJGA 5EYWA 2WBGA 3AMGA 5C2XA 4HU8A 1F05A 3PUDA 4FS9A 1TR9A 3KAOA 4BR1A 1DOSA 3OIHA 1UIOA 3FGCA 1W3LA 3ABXA 3SM0A 4S3JA 2Z24A 3O2LA 4GVHA 1OG0A 1HKVA 3UVIA 2QEZA 2WVSA 1HJXA 2RDUA 4LX4A 4X60A 1EGMA 3QQWA 3APYA 1GEQA 5BROA 3RHGA 3IIVA 4XZIA 3P82A 1PCWA 3DKJA 3T07A 1NQ6A 4W8LA 1XYFA 5CC5A 2PDXA 3CH0A 1EXPA 4H9UA 3TQVA 1DTNA 1KTNA 3ITGA 4FXRA 3O0FA 1IEWA 3R1ZA 2XGBA 3SDOA 3PJWA 4PMYA 3SSZA 4YXGA 4IJRA 4J1OA 3G1XA 1O5QA 1H60A 4MG4A 4NILA 3I6TA 2EJ1A 4FOUA 4JFUA 4WSJA 1XP3A 3NQ7A 4H8NA 3VD5A 3ONBA 2Y7DA 1NVMA 2YX0A 2C1IA 5AC7A 1C93A 4UQCA 4B5TA 1VEMA 1DHKA 3IUDA 2BLEA 1FUYA 3WQGA 5F4SA 1X38A 3RNDA 4AWSA 3UESA 3WH7A 4W5UA 1H4PA 4NZ4A 4C6FA 3OLDA 3S1UA 7ODCA 1UWQA 5KINA 1TYGA 5CPNA 2YSWA 3MVTA 3UCQA 2OLSA 4ZE4A 3G6MA 2HZGA 2V3DA 3HGSA 4N9DA 3K5XA 3B4UA 5K2ZA 3MHUA 2VXNA 2GL5A 2NWSA 3OGRA 1ME7A 1M7JA 3NQFA 2C16A 3CL7A 4RZ5A 3T2QA 4HNNA 2CLPA 3T6CA 4JFVA 4QDMA 3GIYA 2JIEA 3HGJA 2PDJA 3WDPP 2CZDA 1REQA 1MEHA 1JF5A 1Z8AA 1UD3A 2NLIA 4AEEA 3W85A 2XUCA 1Q63A 2J7FA 4YHGA 1FWGC 2XN2A 4M7SA 3A4WA 5F4WA 5GNYA 1CDGA 3DFPA 4OGZA 4ONVA 2EPKX 4LCRA 3F4WA 1RD6A 1UZ1A 4XUGA 3MV11 5CAKA 3CUZA 1KTCA 2QUUA 1QHPA 1NIUA 3Q2DA 1MQQA 4L6OA 1QW9A 2ZZ7A 2WSPA 3QY7A 4LBUA 3JR2A 5FAGA 3CK5A 1NWTA 2WOQA 3WZ0E 5K4XA 3T4WA 4Q6XA 4ZQOA 1H49A 3BANA 5REQB 3HV9A 2YIHA 5HJYA 2DSVA 3KWSA 1OIMA 4UOJA 4JN7A 3S5YA 4AZBA 3PZUA 4JTCA 1R87A 2YPIA 1L6SA 3VGGA 4LAUA 3CTLA 1YQ2A 4EE9A 5TNVA 3MBDA 4N6EA 3A5VA 1V3MA 1ZAJA 4O1DA 4MY9A 3S4TA 1Q4WA 3N17A 1BGAA 1TA3A 3ZJ7A 1TWZA 4GY7A 5CPSA 3F4CA 4LUTA 3QKZA 4UTTA 3DKLA 3ARWA 3MKVA 3AI0A 3T44A 3WQ6A 2DH3A 3V1PA 3LBCA 1LBFA 4NF7A 1PV8A 1X6LA 4GACA 3AYVA 3NL3A 2X09A 3BW2A 4UUIA 3KBNA 4GJJA 1I2PA 1E6RA 3TAKA 3XISA 3B3DA 3LHZA 6CGTA 2OX4A 3GH7A 3OBAA 6XIMA 4Z1CA 4MIMA 3NZRA 1XIDA 4LAKA 4EIVA 4IIEA 2QAPA 3AS1A 4PODA 2R1MA 2B4GA 1NY1A 4LB3A 4RXGA 3MYPA 5MKGA 1WB0A 4AZHA 3NDZA 3VYLA 3TE9A 1WAWA 4BS0A 1B31A 1NFGA 4OKDA 2FHCA 5G5IA 4HPNA 4Q4MA 5CZJA 4PMJA 1TJ2A 4AIOA 1YPIA 2XN1A 2AOSA 3N2BA 1AD1A 1M3UA 3EOLA 4JQ3A 3VVGA 3LBMA 1E6PA 1R30A 1WKFA 1XISA 5KZEA 1LT8A 4XAPA 4N7QA 1IXQA 1ISVA 8XIMA 2VEPA 5HINA 3O0KA 3VD9A 1M65A 4FIQA 4GY1A 2CZ5A 3H2FA 1I45A 1VFFA 2FFIA 1F8IA 3A13A 1E72M 1NWSA 3KS5A 3EDEA 4YYFA 3C0SA 4L4LA 1OADA 2Y70A 1R3YA 3WUEA 4HN4A 3TAOA 4KIRA 5C55A 4X22A 4QE4A 5A8PA 1IF2A 2QULA 3USZA 1HN1A 4ZENA 2IXVA 2CERA 4Z2KA 5LA1A 2JGQA 3W6MA 2A3BA 3VC6A 4BWLC 1XF0A 3L0GA 4IPIA 4C91A 4LT9A 2JKAA 2YXOA 3CIVA 4AIEA 4M81A 3BDKA 4DPPA 2VT0A 4F40A 4KWWA 5I77A 1DPMA 3F7JA 3AHYA 4OV4A 3W1LA 3MMUA 3QFWA 4AFYA 2R24A 2XHYA 3MWCA 2GVGA 2WJFA 2FZ9A 2C0HA 3GG7A 4NP7A 2REQA 3WQWA 3OGSA 4W7WA 5J5RA 3B8UA 1NU5A 4Q8VA 2I17A 3PZVA 4XIAA 2XH0A 2PEVA 2VZSA 4F0HA 4PFMA 1TSIA 4WRHA 2PLJA 2QPSA 1RBLA 1X6NA 4GPNA 1C8YA 4EXBA 3D47A 4MPQA 1SW3A 3PC0A 2A4AA 4O52A 3UY8A 3I7RA 4IIHA 5A5WA 5RUBA 1D7KA 4Y90A 1CLXA 3W1PA 3R89A 5CJ5A 4HN8A 4PA8A 1G1YA 1NDVA 4QS6A 3GHSA 5FL1A 3MYOA 4XK2A 1XFCA 1GQLA 3AIVA 5I2UA 4C6MA 4CU6A 5M2FX 2JF7A 3TIMA 1W3IA 1L6GA 4UFMA 4NJIA 3TJXA 1SFTA 1M68A 3NL2A 3OZPA 1PDZA 3AIBA 3QMSA 3AZTA 3ANYA 1YYAA 1RP8A 4AEFA 4B5VA 4R9XA 1MEIA 3HBLA 2ZUTA 4AZCB 4HZ7A 2Y8UA 1Q45A 3GU9A 3BGJA 1K8CA 3MZ2A 1LDCA 2Q8XA 4WOQA 3E2VA 3GX9A 3T7VA 3BSGA 1FDYA 4BQ3A 3W23A 2XFRA 1O5RA 4MAZA 3DFNA 1AJZA 4LBRA 5TF0A 1FWCC 4UFJA 3OZOA 2Y89A 2WLZA 5U7SA 4S39A 5DELA 5F7UA 3PNUA 3W02A 3W71A 3L2LA 1XIJA 4I7VA 4BZYA 3QTPA 3RM9A 1FWHC 3NL6A 1TCDA 2PPGA 2HPIA 1WZMA 4ROQA 1ITCA 1PXGA 4PUMA 4Y9OA 3L4YA 1V3HA 4YJ5A 3AO0A 4IG2A 4AX7A 1HO1A 1FWNA 1R7AA 1EYWA 2GZXA 2C18A 4TV6A 2VDGA 1G4SA 2YDRA 3DIPA 2QMKA 1FFRA 1XSIA 3PBVA 1UJPA 1FWSA 4RZBA 3QZEA 2FMOA 3VOJA 2WKGA 3HO8A 5C5YA 1P0EA 4LF2A 1F61A 1SSGA 1QO2A 1XQLA 5A3HA 1FKWA 4V33A 4U31A 2VKZG 4DM2A 4QNEA 3VD7A 5BMWA 3NVDA 4DLFA 1WV2A 1UC4A 3GH4A 1A5MC 3UR2A 3C2VA 3S6OA 4K38A 3SFKA 3S1WA 4K8HA 5AZ1A 2W66A 2ZRVA 3HJEA 4JTUA 5GJMA 3CTTA 5AHFA 2D2HA 3LI0A 4XZLX 4U3AA 4IIDA 2WHJA 3YPIA 3WO8A 2Q6ZA 5AHMA 1TVNA 2PTDA 2H8XA 4PTVA 4Q8TA 1TE6A 1OY0A 1A5KC 5MF5A 4REQA 3W28A 1CGUA 4LCSA 3LCHA 3T55A 3UVAA 2J7CA 4QP0A 3II1A 1OD8A 2XWDA 3TR2A 1GQJA 3TK7A 2XZ7A 1TJRA 6A3HA 3VAVA 4J3WA 1XBXA 1UA7A 3WG6A 3EKLA 5HMFA 3GXMA 5EY5A 1ONRA 3O6DA 3PG8A 1ZAIA 1F5ZA 3RRXA 9XIMA 1PZ0A 3KTSA 2DW6A 3UWEA 1PKLA 2I5IA 4IIBA 4C1NB 1HQTA 3MZNA 3AHVA 3JU2A 3VKDA 3WLPA 1FXQA 3T08A 1R9ZA 1UBSA 3QFEA 1B4KA 1FCVA 1EO7A 3ARVA 2QXWA 4AQLA 3MI6A 3UP8A 3C0LA 3WLMA 1UWSA 3AIEA 2VZOA 2CWNA 3GR4A 4UWMA 1XRFA 2WSKA 3BMVA 3S3GA 3BG5A 3I3DA 1HZYA 2DY3A 3AU2A 4PULA 1I0BA 2YFNA 1NDZA 4Z17A 2JALA 1Z7AA 2HCVA 3GDKA 4Q8NA 3PF3A 2X41A 2Q71A 1O68A 1K77A 3M0HA 1JI2A 1ZQ5A 3DFOA 1TMHA 3G0UA 4L5ZA 4Y9MA 2VD9A 3KHJA 3UA3A 1B3YA 4YPJA 4L1WA 1EIXA 3EXTA 2OLAA 1LF1A 4F0MA 3TCSA 1QMLA 4HVXA 3SO7A 3V0SA 4XSLA 1KQZA 5BRBA 1EBHA 4DX3A 2HPMA 1UWRA 3P67A 2ABAA 2P88A 1CIUA 2G3FA 1JXKA 3E2QA 4O13A 5D05A 4XBSA 2D69A 4CVWA 1OCQA 1VF8A 3UWUA 1VS1A 3SECA 1TMLA 4JTIA 5DT5A 1JUEA 3BGAA 4JL2A 5BXPA 4WGXA 2IS7A 4YCOA