5AHIA

Crystal structure of salmonalla enterica hisa mutant d7n with profar
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
244
structure length
232
Chain Sequence
MIIPALNLIDGTVVRLRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIGSTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGWQENSGVSLEQLVETYLPVGLKHVLCTDIRDGAGSVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQCWQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Mechanism of Hisa from Salmonella Enterica
rcsb
source organism Salmonella enterica
molecule tags Isomerase
molecule keywords 1-(5-PHOSPHORIBOSYL)-5-[(5-PHOSPHORIBOSYLAMINO) METHYLIDENE
total genus 74
structure length 232
sequence length 244
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5ahiA00
2ZFAA 3O07A 3EWBX 2Y88A 5K9DA 2PRLA 3M5ZA 3CT7A 1C8VA 2J9YA 3G0SA 1Q6QA 4FHAA 3CU2A 3S5NA 4O11A 3DFSA 3MO7A 4RZ4A 2B7QA 4IMDA 3UY7A 2R94A 3EWZA 4LVAA 3EX6A 3W7IA 2I14A 1W5OA 3W88A 5TQLA 2HTMA 3PSWA 4U4MA 1JCMP 3BGGA 4MZ1A 4JX6A 4UTLA 1SPQA 1NSJA 1WDWA 2NX3A 2YCEA 4OBTA 5F2IA 4UTTC 6ALDA 1KLYA 1F6PA 3HGRA 3M1ZA 3DBPA 4EVZA 2ISVA 2QEZA 5HULA 5LHEA 3TXVA 3TCEA 4CQ9A 4M7SA 5G1TA 2OJPA 1W1ZA 5EL1A 4NX0A 5E93A 1WXJA 4MFDA 1OJXA 2I9EA 3HGJA 3G1XA 2OCZA 5HR6A 3PULA 1I2QA 5KZMA 1A5BA 1OF8A 3MI2A 3NAVA 4Z1AA 3MW7A 3RMJA 5K4ZA 1O4UA 1YLVA 4GUJA 3WK0A 4TMCA 1YPIA 3ZWTA 2VFIA 3VNDA 2ZZ2A 1F05A 2C19A 1QPOA 1VR6A 4UTTA 4EF8A 1K8ZA 6TIMA 3W2KA 4E2DA 1EX5A 1VHCA 4B5NA 3CIWA 3QJAA 4DELA 3SGUA 2H90A 1ICSA 1JUKA 2E6FA 4DF0A 5D38A 3W76A 3M6YA 2H3BA 3KVLA 3GDMA 3LLDA 4CCDA 5H2ZA 1ZJIA 4YMZA 1TPWA 5BNKA 3W86A 4MVAA 1W5PA 3KVKA 1KBIA 3PWAA 4JXCA 1QCWA 1LP6A 5LGZA 4MY1A 1ME9A 3BARA 2E6DA 3IRDA 2FPTA 3E12A 2Y70A 3B0PA 4AHQA 3GX9A 3QSTA 1NVMA 5I3KA 1GVOA 5G1YA 2ZTJA 1TPUA 3LXAA 1I2NA 4Y9AA 1D3HA 1KM1A 2JK2A 3MHUA 1JVNA 1ZFJA 5LNUA 4AAJA 4MJZA 1TV8A 1KM3A 4HNTA 1SZFA 5L9FA 1EP3A 3Q94A 1M7OA 2R8WA 5E0KA 4FB7A 3E02A 2TMDA 3W7CA 3B05A 5FF0A 3MMTA 3QFEA 3OVQA 1QO2A 1ME8A 3IVTA 4GE8A 3KVMA 3EXTA 5LNWA 1DJQA 3DENA 1TPVA 3L0KA 4BI6A 3M5XA 3LI0A 3Q37A 2ZZ1A 1ZALA 2ZRVA 3PB0A 4LU0A 3TQVA 4MZYA 4LVFA 2P10A 5F4XA 1B4KA 5KSWA 2NX9A 1Z42A 4XKYA 2P0OA 3N9SA 1SUXA 4JYEA 2X1SA 3BGJA 3TSMA 2WSYA 1DJNA 2FB3A 1F5ZA 1TPH1 5IBXA 3EX3A 4HNNA 5U7SA 3W1TA 1TTPA 2V2CA 3IIVA 3GB6A 1IIHA 3TNOA 2ABAA 3LLFA 4IWWA 3NQGA 2E68A 5F2LA 1UASA 2VC6A 2CFFA 2YSWA 4LT9A 3M7WA 3SECA 3HMJG 4UMCA 3IIXA 3A23A 1GG1A 4NU7A 3FLUA 1OX4A 3QPYA 3UWQA 1BTMA 3G1FA 1GVSA 1XC4A 2G5WA 2HS6A 3BW2A 1XBVA 2QCEA 2ZA1A 2ISWA 3S1UA 1JR1A 2RDUA 1LBLA 4JX4A 1IXQA 3OIXA 3NPWA 3QF0A 1TO3A 2TSYA 4HSOA 4ONVA 3WJXA 3QQ1A 3W71A 1TYGA 5CPMA 3S1WA 3DFNA 4WUIA 4RX0A 2YPIA 4E0CA 2IQTA 3QM3A 1FX6A 4POCA 3LHWA 1TB3A 2V8ZA 3IIPA 4K8EA 2QJGA 5EA9A 1GJPA 2GQ8A 5KITA 5EKYA 3MUXA 2XN0A 1FWSA 3ZS4A 3UPWA 3SGZA 1LRNA 1EEPA 5DY2A 1JUBA 3GXPA 4O1BA 3M43A 2GJLA 1GVFA 3W7OA 3ATYA 3QYQA 5KMYA 2ZZ4A 3LERA 3NQMA 2NWSA 4CCEA 2A7NA 3I6RA 2O7SA 5C6MA 4O1DA 1L6YA 3IGSA 4Z1CA 2YX0A 1TPB1 5BRBA 1PE1A 1XCFA 3KRZA 3GDTA 4AHPA 2V2HA 3HGSA 3FA5A 2ZYFA 2KZHA 3SIZA 1N7KA 3EX1A 1XDLA 3CWNA 1L6WA 1VJIA 4CLMA 3CIXA 3STGA 4DF2A 1H7OA 2Y7FA 4NJIA 4PL1A 5TBOA 5F4WA 1EWEA 4K36A 2VOMA 1G4TA 3GAKA 4I7VA 5C2XA 4QM1A 4A21A 2AAMA 3OHIA 4RZ6A 1VLWA 4DO5A 1TTQA 2CLMA 3BG5A 1PHWA 3QSRA 2WJZA 1L6SA 1OYBA 3C2OA 4N9CA 1P4CA 2QCFA 1H60A 1XM3A 4TR9A 5L6UA 1O5XA 3L5LA 2WNNA 2EHHA 3HPSA 5D03A 2YZRA 4AWSA 1XBZA 1YXYA 3HPXA 4QNWA 1FWRA 3ZFHA 1SFLA 3G22A 4BF9A 3ABSA 4H4IA 2H8XA 2QCMA 3EXSA 3W1RA 3G1HA 2QUVA 5AYZA 1YDNA 1THFD 3PC0A 1HTIA 1MEIA 2RKXA 3IVUA 2GUUA 4O4WA 2ZDRA 2CLHA 2V5LA 4HNUA 1GYNA 3MP5A 3GDRA 4S2BA 3QC3A 3WK2A 3SZ8A 1F76A 2WOQA 4BI7A 1CI1A 4OT7A 5D05A 2QCLA 3F1QA 4LVBA 1JCJA 3BLFA 3PF3A 1PS9A 5LNVA 4PFMA 1TTIA 3EX2A 4Z0JA 3L68A 4CQAA 3LHTA 3B06A 4AF0B 1WOBA 1MZHA 2FB2A 4IMEA 3B0UX 4NXKA 2W79A 1H51A 1QWGA 2ZBTA 3W1QA 3W7PA 4A22A 5CZTA 4LV9A 2ZRXA 3O06A 2XN2A 3LB0A 4RXGA 1DVJA 2QUTA 3L0GA 1GT8A 1SU5A 1H7RA 2I1OA 3LRLA 5CPLA 1KW1A 4ZZ9A 1W3TA 3CB8A 3JRKA 1K7XA 3F4WA 3H53A 4O0KA 3W85A 3BLEA 1C29A 4K37A 1OFQA 5C54A 1YPFA 1YTKA 1K02A 2GVLA 4JTSA 1VPXA 1AG1O 1VHNA 1LYXA 2YGYA 3BV4A 1W31A 3CC1A 4AWUA 2P1FA 1WA3A 1XUZA 3W74A 2EF9A 4X22A 3S1VA 4N4PA 3H55A 1L2UA 3W70A 3HPZA 1JQXA 3NQ8A 1LLWA 4NXSA 3KHJA 1D3GA 1FCUA 4MUZA 5AHNA 4O16A 3TJXA 4MY8A 3OBKA 4WJEA 1UB3A 1G4PA 1VYRA 2WNZA 3VE7A 1TQJA 4UTWA 4RXFA 3SFKA 3C52A 3FS2A 3G0UA 4FNQA 1S5WA 4U28A 4HKPA 4DO6A 1H63A 1LRQA 1O95A 4IJBA 1PIIA 4Z0SA 1Y0EA 2NUWA 3TC6A 1LOSA 2CLFA 3LHYA 4Q33A 1TMHA 4UTMA 4O53A 4FF7A 1FCVA 1SO5A 1CX9A 4NJKA 4LS1A 3SW6A 4KFOA 5BOOA 1OF6A 3RLUA 2C13A 3PVFA 3U8GA 3VFLA 3B04A 4RZ5A 1EIXA 2WSRA 3HG3A 3BPWA 2C3ZA 1ZCOA 1GVQA 4NNBA 3EKZA 4DO4A 2AQWA 2Q8LA 1K7EA 3W7EA 3P61A 1GOXA 2CLLA 4WZHA 5BW6A 2VFGA 3UWUA 5KZEA 2NLIA 1TIMA 5FF4A 4KWWA 3O15A 3KRUA 1HO4A 1QPNA 3EWWA 1N55A 1KLZA 5C55A 4L4LA 4ORMA 3L2IA 3TA6A 1YADA 3TDFA 1Q45A 2DZSA 2EGZA 2Y89A 3G8EA 3NQFA 4YLWA 3W72A 2BZNA 2QDHA 2W6RA 4O8RA 3ABQA 3P84A 4NT0A 1P0NA 3MYPA 5LHFA 4UFMA 2R91A 2ZZ3A 4MJMA 1M6JA 3ABOA 4YL2A 5LKYA 5AOUA 2ZTKA 1KTCA 3DAQA 1ZENA 5EBUA 3M9YA 1TPDA 2O7QA 2NXGA 1AW5A 2OT1A 3TUUA 4UFJA 3NO5A 5FEZA 2AGKA 2E1DA 2WNQA 1SZNA 3HG5A 3PM6A 3TQKA 3F4NA 3IVSA 3W6YA 2DORA 4I7WA 3S6DA 3ABRA 3RNDA 2B7PA 3LHZA 5K2ZA 2Y7GA 3W7HA 3LBMA 1W0MA 3P5ZA 1G6CA 2ZRZA 4LOCA 3VKJA 1SQ7A 1LBFA 4JTIA 3RF9A 4Y96A 3LTPA 5AB3A 4HSNA 4MPQA 2QUUA 5FF2A 3TW6A 3A9IA 4O14A 1ALDA 4LY8A 3W22A 1LDCA 4R53A 5HWJA 2ABBA 4N9EA 3DU0A 3KFTA 3NQCA 2Q3RA 3SJ3A 3IEBA 2A5HA 1KFLA 3PG8A 4WX2A 3CWOX 2FPVA 1DORA 2CLOA 3S5YA 1DOSA 5I3GA 5AFDA 2B0MA 3L5MA 3EKLA 5D2TA 5FI8A 1A50A 4JTEA 1J4EA 4FO4A 2WV8A 4A3UA 4TMBA 5HR7A 3GK0A 3GIYA 3LCIA 3QMRA 3W87A 2FDSA 3LHUA 4OV9A 5I3IA 1SSGA 2J9ZA 3OEXA 5F1UA 3LCHA 3FKRA 2CLKA 4NJGA 1ZAJA 5LGXA 1WQ5A 1NEYA 2CLIA 4JY9A 1QAPA 4DBEA 5KINA 2ZA2A 1UBSA 2PE4A 3NGJA 1MO0A 1OYAA 2BTMA 4FXRA 5CZ0A 4RK8A 4UMAA 1KFCA 1SR9A 4JD4A 3DI0A 2RDWA 4ML9A 4K7VA 3G1SA 2Y7EA 3RFAA 3LTYA 1DHPA 3W7DA 4A29A 1BEUA 1QO5A 4K8HA 1RD5A 3MYOA 3N9RA 1KA9F 1TRIA 5D02A 5J5DA 3PUEA 2NX1A 5DCEA 4BI5A 4ZQPA 2Y7DA 4O17A 3WFAA 3I7RA 1SZGA 3TSDA 2VKZG 4O1CA 4PH6A 1OFPA 1VH7A 4CNNA 3C2EA 1WX0A 2FJKA 1ZAIA 1E51A 2CZFA 1RQEA 2UV8G 2NV1A 2A6LA 5G4WA 4ADTA 4PODA 1EUNA 1SO4A 3M44A 3NL6A 5FESA 2Z0IA 1BWLA 3G8RA 3GXTA 4LW7A 2HMCA 5HMSA 5HJLA 1YTDA 5DBUA 3NZRA 2QCHA 2VFHA 4AH7A 1H1ZA 3G1AA 1HUVA 2WQPA 1PHQA 3IGUA 4DBDA 1X1ZA 1I2OA 1IF2A 3QW3A 3GKFA 3HG2A 4R33A 3SR7A 4O0ZA 3NNTA 4OU1A 3HF3A 1HL2A 2A1YA 3DXIA 4C1LA 4ADUA 1IIGA 2JGQA 1LM1A 4OQVA 2PCQA 1W54A 3A5VA 4UMBA 4UTJA 4O4VA 4NZFA 1D9EA 5AHIA 2OT0A 3STFA 2VEIA 1OK4A 1PCKA 3UZ5A 1G4SA 1VYSX 3NA8A 4M19A 5K9XA 2Z6JA 3EEGA 3IV3A 2QAPA 1LTDA 1GZGA 4JGDA 2DZXA 4JY8A 3N2XA 3UXDA 1KV5A 3G3DA 4Y8FA 1T0OA 4LWWA 3R5EA 2Q8ZA 1X7FA 3EWXA 2VFEA 3NZ1A 3LCXA 3M47A 1SSDA 1F7BA 3AO0A 4QJ1A 3MHGA 3C8FA 3TKFA 3WK1A 3QW4B 3KRSA 3H54A 1KM6A 1GYLA 2EPHA 4K7YA 3HBLA 2Y63A 3GAYA 3L0NA 3LHVA 3O16A 5KTLA 3W7MA 5FEWA 4Z1DA 4JS3A 1O94A 2VEKA 3ELFA 1W56A 4UR8A 1FWNA 1OFEA 4EIVA 1J2WA 1ZY9A 5LNSA 1LCOA 1L9WA 1PVNA 3UXAA 2X1TA 4RV8A 4QSHA 5DLCA 4JTHA 2ZZ5A 1TJRA 3W7NA 5CG7A 1AL8A 3T55A 2HSAA 5K4XA 3W2LA 4J9JA 3TE9A 2CWNA 1MXSA 3B03A 4X3ZA 3G3MA 3VI2A 4M5PA 2VFFA 3LCWA 3W1LA 3SI9A 2FPYA 5I3FA 5MHBA 3UWVA 1RQBA 4I7UA 1VS1A 4G1KA 2XFWA 3HO8A 2NUXA 5DCDA 1F73A 3B0VC 5G4EA 2C18A 3TW7A 2NXIA 1P1XA 4UIOA 4ZQNA 3FJLA 4MOZA 3DGRA 4FNTA 4RLIA 2A7RA 5D2XA 5K7JA 1EWDA 1R2RA 3NR0A 1QNVA 2GVGA 3S8HA 2RH9A 3IGXA 1KFBA 1UUOA 1IXNA 3NM1A 5AHMA 1DBTA 2ATSA 3W73A 4ALDA 1K3UA 3TMQA 2X1UA 5LNRA 4WOZA 4LS0A 5EY5A 4Y6GA 2VEPA 3GLCA 4O1AA 2QR6A 4XTIA 2VENA 1DV7A 1NF7A 2Y61A 3NYZA 1B9BA 4IX2A 2Y62A 1RZMA 2QCNA 1KM5A 1V5XA 1TSIA 3F03K 3UWYA 1JQVA 2DU2A 3C0JA 1GPWA 2Z1BA 2PRMA 4UUIA 1JCXA 1YXCA 1QMLA 4UFLA 1B4EA 3N2MA 3PBYA 3NL2A 3I7SA 2DZTA 2D73A 3O6CA 1X1OA 3W75A 1LZOA 1G7VA 3N14A 4M6VA 4TO8A 3W7LA 3G24A 1AW1A 3E96A 5CSRA 4TU1A 5LZLA 3TAOA 1I2RA 3C3NA 4R34A 4AF0A 4TIMA 1OFRA 4O54A 3RK8A 1HG3A 3LDVA 1MSSA 4UTWC 3PY2A 4O18A 1OABA 4LVGA 1V7YA 2ZZ6A 1TREA 4YXGA 1KM2A 3R89A 1OX6A 1LOLA 1ZAHA 4JICA 4PEKA 3BG3A 1OX5A 4UNKA 2CZ5A 1GTHA 5I3HA 3DKJA 3EB2A 1Q6OA 1DQWA 3NM3A 1K03A 5ABTA 2JKEA 3C6CA 3KX6A 3Q2DA 3IIZA 1FXQA 4CNPA 3NEVA 1XFBA 2EAWA 5LSMA 4FIQA 1VGAA 3HQ1A 3CHVA 2V2DA 3TV8A 3NQDA 5D2WA 1IXPA 3C2FA 3O6DA 2GJNA 4UTKA 2QCGA 1I8JA 3A21A 4DXVA 3GDKA 5DCBA 1SO3A 4N9BA 3LRKA 1VCFA 3C2RA 3R12A 1UUMA 3BO9A 1KTNA 1H62A 3G1DA 1R2TA 4NZJA 3CM4A 3A5FA 2YW3A 3SSJA 1TQXA 4KFNA 1TCDA 1VCGA 4IMGA 3NVTA 3UY8A 2X2GA 1A53A 3IIOA 3NG3A 1UCWA 4ICNA 2ISSA 4M7TA 3TIMA 5HINA 3O05A 3BVJA 1VZWA 3C56A 3GVGA 2C1HA 2BXVA 1GG0A 1ADOA 3PBWA 4HPXA 4EF9A 3HJZA 4MKNA 3TAKA 1XL9A 3O63A 2HS8A 2FTPA 4MIMA 3N73A 4N2YA 2R14A 4GNJA 4GUHA 1FBAA 1MEHA 4JTJA 3LM7A 3O6YX 5IM51 2J9XA 4JDBA 1XKYA 3LCFA 4FNSA 1FXPA 3LOTA 2A21A 5FEPA 1XI3A 3SY5A 5A8GA 1XBXA 1NAL1 2DJXA 3GKAA 1K8YA 2DZVA 3NQ7A 1FQ0A 1OYCA 3C2VA 3PSVA 4FEZA 3W2NA 3W2UA 4R7JA 2VELA 3DZ1A 1RPXA 3T7VA 4NJJA 3UQNA 4ZL1A 1SO6A 1H7XA 3MHFA 3PUOA 1ZHAA 4FNPA 2C14A 4ZQCA 3P74A 2YXGA 5AHFA 1A5AA 1M7PA 1VQTA 3PBUA 4ZQMA 5CKSA 3ZR4A 3HOJA 2TPSA 3WJYA 3ANYA 4WXYA 4JX5A 1O5KA 1EUAA 4LC8A 3PUDA 3W84A 1T99A 3P81A 3TMLA 3GR7A 4P61A 2NZLA 5GVJA 1SFJA 1ICPA 1DQXA 2X16A 4UTUA 1JCNA 3WJZA 1I4NA 1OHLA 3INPA 3QEZA 3C61A 3R13A 4PTNA 4I9AA 4IMCA 1OX4B 3DH7A 1TV7A 2ZA3A 3P60A 3TU9A 3T44A 4IOTA 1R47A 4IUOA 4ORIA 5D33A 5EMUA 5K9CA 3L65A 3G0XA 4CCCA 4PCFA 4UFKA 4NX5A 2V0TA 2C0AA 4O50A 3JS3A 3E49A 4JTTA 1SW7A 1EP1A 3A24A 3U6WA 1A5SA 1SW3A 4MLJA 4MYXA 4O28A 4OE7A 1A5CA 3S0CA 2F84A 3CPRA 4ADSA 1I45A 3UZJA 4YCOA 4UFHA 2VXNA 4GUGA 2EKCA 1YYAA 3HG4A 1Q3NA 3EWUA 4DF1A 3S5OA 3QMTA 1WAUA 1FY6A 3FEMA 4K38A 5DELA 3NQAA 1Z48A 2CLEA 5DXYA 3QMSA 1AK5A 2ZCGA 1FWWA 3NQ2A 2A4AA 3V75A 1PL9A 2GOUA 1F6KA 1QDSA 3M16A 5T26A 3THAA 4NNCA 4BWLA 4Q32A 4JEQA 3WJWA 2JBMA 4S1FA 5AHEA 3Q58A 4LUIA 3MP4A 1VC4A 2VFDA 4GWEA 3DFQA 3DHDA 4IXXA 3W1PA 4IX0A 2G97A 3GR8A 3MBFA 4WY0A 2ZRYA 4WXZA 1HFBA 3UPBA 3L5AA 2E6AA 5CSSA 2NWRA 4LC6A 3MI6A 4N4QA 1KFJA 3RU6A 3M41A 2PURA 4W9TA 4IXHA 4N9DA 2X1RA 3I7QA 4NUWA 3W2MA 4MZ8A 1AMKA 4QNEA 1R46A 4OHQA 2OZ0A 4IMFA 4AB4A 5D2VA 3TR2A 1FCBA 3T78A 2V82A 3GNNA 3V1PA 1W3IA 5HQEA 2FIQA 5HUOA 3P5YA 3PS7A 5G5IA 4GUFA 3R8RA 4JDYA 2QKFA 4LRTA 3VE9A 4EOUA 4XBSA 2E5CA 2PRHA 5CZSA 1C9DA 4CNOA 2OX1A 5DBTA 1BKSA 4PC8A 4XKYB 1H7NA 3NL3A 3W1UA 1H7WA 2GVJA 5AYXA 3W1NA 4WY0F 1IXOA 4A2SA 4XZ9A 4GUIA 2GQ9A 4MY9A 4WQ6A 5BMXA 4IPIA 4DEFA 1FDZA 3BLIA 4MLRA 3OVPA 5D04C 3KAOA 3STCA 2DZUA 1YXDA 3TX9A 4HT3A 2H8ZA 1ONRA 1G67A 3TROA 3W2JA 1JCYA 4O10A 3KXQA 3QZEA 3FYOA 1Q6RA 3LRMA 3P62A 1AW2A 1LRTA 2BX7A 3P80A 4JTFA 5AC6A 3TJLA 1H61A 2J88A 4AEOA 2A7PA 1H5YA 2B4GA 2NUYA 1WV2A 1W3NA 5HUPA 2QCCA 2ZRUA 3CTLA 3TQ0A 1JRCA 1KM0A 3LI1A 2YFOA 3EXRA 1VYPX 1I2PA 3W23A 3TSBA 3L21A 4M6QA 3PR2A 3VCRA 3DI1A 3GXNA 1X6UA 4P2VA 3D0CA 3LCLA 3MP3A 1EPXA 2A0NA 3NQEA 2QJIA 2C15A 1S5TA 4JYDA 4LS2A 3HIJA 1XBYA 5CPOA 1M5WA 1K7FA 2V5BA 4H6KA 4XWUA 5FEXA 3S9YA 4O12A 4DQWA 1BWKA 1PCWA 1FUYA 5D30A 3S42A 5D09A 1WYIA 5HWNA 1QOQA 1WBJA 1G7UA 4DPPA 1NFBA 1GEQA 1OFAA 4K39A 4OGZA 4HHPA 4NVTA 4IQLA 3E9AA 3PG9A 4QQ3A 5G2IA 3FJ6A 4AHOA 1GWJA 4JTGA 4LV4A 5DXXA 4BR1A 4S2CA 2J6XA 3KVJA 4FX6M 3B8DA 2V30A 1OFDA 3TK7A 1TPC1 1KTBA 5IBXC 3W9ZA 5HWMA 1S5VA 5BMWA 3A22A 3NPUA 5EYWA 4Z08A 1WBHA 1FWTA 3MI3A 4TX9A 3OA3A 4GRSA 1P0KA 2RHGA 4YCPA 3GNDA 2E5BA 4D2JA 1FDJA 1EP2A 2GPTA 2CW6A 1ML1A 3NOEA 5J5RA 4N02A 4OWGA 3G1YA 2WO5A 1U5JA 1VCVA 1YDOA 4ZQRA 1CW2A 1LROA 4Z1BA 3GDLA 1B57A 4RKAA 2H3DA 4O52A 3W3OA 1LOQA 3T4CA 2C16A 3UYCA 3PAJA 3LV6A 1KBJA 1OK6A 3TFXA 1SW0A 3DFTA 1N8FA 4NNAA 4KFPA 1S3HA 2BLEA 4H3DA 5A5WA 4QIUA 5AYYA 3S1XA 1OFOA 1F74A 1RQHA 2A85A 2B7NA 2E09A 3NQVA 4NJHA 5CPNA 4N6EA 4RCXA 3LBCA 2CZEA 1FDYA 3LV5A 1EA0A 3C4UA 4UNLA 4UFIA 1JUEA 4UTIA 3W1MA 1GTEA 2QCDB 4MFEA 2ZRWA 3BW4A 4FX8A 2ZQ0A 3WK3A 3W7KA 1H1YA 2QAFA 2FQIA 1OFBA 1J5TA 4O57A 2E77A 3W1XA 1TPFA 4PL2A 2A2IA 4GFSA 3UD6A 4ZMGA 2J27A 4O15A 4XBKA 3E0IA 2JKAA 1RV8A 3TXZA 2DZWA 4E38A 1W5NA 3FFSA 1TTJA 3LGEA 2QDGA 5TIMA 4UR7A 3W7GA 1HO1A 4JR5A 3W7JA 4JNMA 1QOPA 1F2JA 4IGHA 5D32A 2YW4A 3TC7A 4XUGA 4Y90A 3O1NA 1KFEA 2RFGA 1T8XA 3QRHA 5F2MA 5HNRA 2DZPA 8TIMA 3ZWSA 5K3VA 7TIMA 2CU0A 3O8AA 1H7PA 3CEPA 4JIQA 3RLVA 1AL7A 2Y85A 2F7FA 4UC5A 3G1VA 1JJKA 4Q4KA 4CQ8A 1W37A 5D37A 3MWAA 2JKPA 3JR2A 2LLEA 4HPJA 3BK0A 1ME7A 2W0UA 4JTUA 1XDMA 4GBUA 5E1QA 5CZJA 1KFKA 1B3OA 5FF7A 5KZDA 4JIPA 2WKJA 2Z2UA 3U2OA 3NPXA 3W83A 1LBMA 2H6RA 3OG3A 2C6QA 4LUJA 3DFPA 3M5VA 3BG9A 5FF3A 4JYFA 5AHLA 3NQ6A 4M6PA 3TH6A 3FOKA 4GC4A 3WJSA 4O13A 3EX4A 3NL5A 3N34A 4C1KA 4HIBA 4MYAA 3UNDA 1OG0A 3W7QA 3P7YA 2GQAA 2V9DA 5F4SA 4K6AA 1VRDA 1QPRA 2QCDA 2ATMA 3PBVA 3KOFA 1T96A 2WSQA 5G2WA 4ZVJA 4UCGA 1Z41A 2ALDA 3YPIA 5F2GA 3UWWA 4KWVA 1U83A 2A6NA 3QH2A 1PV8A 1O60A 4LRSA 4HN4A 3UWZA 1W5MA 1DL3A 4OV4A 5SWUA 2RDTA 4E2BA 1TV5A 2FLIA 4BFAA 4XTDA 1XXXA 1G69A 1DKWA 4LNYA 1X8FA 3LX9A 3G18A 4WD0A 4QISA 5I3JA 4X2RA 4EWND 4JTKA 1ZNNA 4GJ1A 4IPJA 5C5YA 3NXFA 2XN1A 4WOQA 3TFCA 3AJXA 3L66A 2WPBA 3DHFA 1QFEA 3DFOA 1QPQA 2J24A 1Z44A 3P8JA 3CQ0A 3N19B 4O19A 3QQ0A 3B4UA 4FXSA 2TRSA 1KV8A 1XUUA 1W5QA 3PB2A 1ICQA 1H50A 4HNVA 4AMAA 1K8XA 2CZDA 1KM4A 1JRBA 4LVDA 1YTEA 4NQ1A 3L9CA 3M0ZA 3BW3A 2E5DA 1P5BA 4ZQOA 2Y6ZA 1RR2A 2G95A 1VLIA 2ZZ7A 2BWGA 4FIRA 4AWTA 2FFCA 4N6FA 5H91A 3T40A 3P8IA 4GXMA 2DJLA 4KKXA 1TPEA 1SZEA 1RVGA 1Q6LA 1R30A 3L67A 1WOAA 1YDVA 1R2SA 4FNUA 3R2GA 3LXBA 2TYSA 3P82A 3STEA 3N3MA 5CGQA 3FYPA 1TJPA 4DPQA 4PA8A 2BSLA 4FNRA 2NV2A 1IGSA 3EWYA 4LTSA 3LTSA 3S5ZA 2E6YA 4QITA 3USBA 3W7RA 3DKLA 4UXDA 2QF7A 3LCGA 5AN7A 3I68A 4X9SA 5DN1A 2QJHA 2V81A 3MBDA 5D2YA 3MJYA 2YYTA 5F1VA 3THQA 2JGYA 3ATZA 1LLZA 4UTHA 3FIGA 5AC8A 4RJEA 2DP3A 3M5YA 1OVDA 1JCLA 2G96A 4XQ6A 1FCQA 2VEMA 1W8SA 4AXKA 4WY0B 5AC7A 3HB9A 3HGOA 4AVFA 1TRDA 4FX7A 4QAIA 4JN6A 4YWIA 1EB3A 2B7OA 3GZ3A 1GVRA 2YDAA 2OMAA 3NDOA 4BK9A 2YR1A 3NPVA 5DY3A 1G4EA 3K30A 4L4MA 4RR4A 5U4NA 5G2HA 4BWLC 3W07A 3FKKA 1JULA 3CEUA 5EPDA 2NXHA 3CLMA 2Q3OA 1MEWA 1LORA 3QPZA 2Z6IA 3GYEA 1GQNA 1NF0A 3LXCA 4A2RA 2YYUA 4JTLA 3P67A 2X30A 1UJPA 2PC4A 2YFNA 3OVRA 1QR7A 3I65A 3W1AA
chains in the Genus database with same CATH superfamily
1E1CB 3LS9A 3UXIA 2ZFAA 4DLMA 1RK6A 3AS3A 4B5VA 4H1ZA 4LYRA 1OCJA 2VYOA 3OHMB 1E70M 3M5ZA 2P3EA 3E6EA 2RJGA 1I9CB 2PDHA 4LBSA 3S5NA 1MFUA 3DYMA 4RZ4A 3UR7A 1FHVA 1K8CA 4HVXA 4LVAA 4J35A 4HCDA 2I14A 4AY8A 3W88A 5TQLA 4HGXA 5CG0A 3OYXA 3PSWA 3VGHA 4AZGA 4C60A 1BVWA 3RX3A 4JX6A 1MFVA 2NX3A 4KWOA 1RA0A 1ECQA 5F2IA 1TWZA 6ALDA 1E0TA 1PAMA 4RE2A 5FAGA 3HGRA 3FK4A 3M1ZA 4AISA 2QEZA 1PEZA 3TXVA 3TCEA 5M3WA 3WLPA 3O6AA 3WQWA 3M07A 1WXJA 4MFDA 1XGEA 3P0WA 1K9DA 1EDGA 1ISVA 1QRQA 2QS8A 3T2QA 4A35A 1UD8A 3N6QA 3NAVA 3MI2A 1M04A 3TTOA 5K4ZA 4NL1A 2HISA 1YLVA 4AZHA 1HGWA 2YOCA 1XJBA 3GXMA 2C19A 1QPOA 2DDXA 2NQZA 1OC5A 4MNJA 4JBRA 3SADA 3W2KA 4B5NA 3CIWA 1CGXA 4AQLA 4OFCA 4HN8A 2H90A 1JUKA 4L9XA 4DNMA 1Q66A 2O56A 3KVLA 1E4LA 2PCEA 2DVUA 3OGVA 3CAQA 4GH3A 3BOFA 2VGFA 3RPMA 4H8HA 1KBIA 4HOXA 2Y1HA 3THUA 4Y8EA 1QCWA 4JTQA 1LP6A 1VKFA 2GJXA 5LGZA 4XD5A 3BARA 4H6EA 1W6TA 3IRDA 2FPTA 3E12A 2Y70A 2WKGA 3ARRA 2BB0A 3EPOA 1JZ8A 3QSTA 4A8NA 5MF5A 4GD0A 4V15A 2ICSA 3GU1A 4CD4A 1EXBA 4LCQA 1X98A 4DVOA 2HQAA 1EF3A 3TWAA 1EL3A 4Y9AA 1KM1A 3MHUA 9RUBA 1HZYA 2DIEA 3P6LA 1TV8A 7ODCA 4PUDA 1X96A 2YLLA 2J75A 4HNTA 4XAYA 3Q94A 1M7OA 2JF7A 3NVDA 5E0KA 3LYEA 5FOOA 4WDXA 3URAA 3IVTA 3F2CA 4LUSA 3KVMA 1MZRA 1RCOB 3EXTA 3WQVA 3DENA 5LNWA 2NVAA 4BI6A 1BVNP 1EGZA 3LI0A 1BHGA 1JFHA 1MMFA 2HE8A 2PBOA 1B4KA 2FZNA 1Z42A 1CPUA 1J0ZA 1I1XA 1J96A 1M7JA 3GNOA 2HNEA 1SJBA 1EJTC 4EXBA 4A3QA 3W1TA 4M51A 2YLAA 3NFUA 3N25A 2XH7A 2E68A 4PMZA 2ZUTA 3PHAA 2D2GA 3JU2A 2CFFA 3WQ5A 3SECA 5EMLA 4I9JA 1O68A 1GG1A 3W0KA 3S2NA 5JBEA 4LANA 3RYSA 3LPOA 3BW2A 1XBVA 3VOIA 4XUYA 2ZA1A 2ISWA 1RBOB 1LBLA 1IXQA 1UD2A 3OIXA 3NPWA 4DZAA 5HMFA 2XVPA 2QMJA 1TYGA 1UA3A 5CPMA 4XVDA 4YVPA 3WQCA 3WD4A 4W7VA 3QM3A 5PTDA 5MKGB 4XV0A 2J7GA 4Y9MA 3VGEA 2AGTA 3MUXA 1D8CA 4JHMA 3N12A 1EEPA 4PMVA 3M43A 1GVFA 3W7OA 4Q4SA 3QYQA 3LERA 5C6MA 4KGJA 3WLRA 5C7HA 1UH4A 3WENA 4GZIA 2VM8A 1OY0A 1TPB1 3U4FA 2XVNA 1G01A 2QDEA 1FWFC 3LN3A 4GMEA 1XV8A 1GPFA 2VEGA 4GKTA 3EX1A 3CWNA 4DF2A 3ARYA 2WVSA 3MCNA 3WKZA 1H7OA 1E71M 3UZZA 4WDTA 1G4TA 1V6UA 3KOYA 5DRIA 1LL7A 2WW5A 2CLMA 2PZ0A 1PHWA 2W5FA 3QSRA 3ZVHB 4WKHA 1P4CA 2QCFA 4D1JA 3TR9A 4PMOA 2EHHA 3HPSA 4HPHA 3UW6A 1RVKA 3A64A 3HPXA 2DW7A 3ZFHA 1SFLA 3G22A 4H7VA 4BF9A 2XIBA 3VIIA 5M17A 4A8IA 4OECA 1XGZA 5CGTA 2VZSA 3W1RA 5CPQA 2WHMA 5AYZA 5TD4A 2GUUA 3MB9A 2CLHA 2V5LA 4D8LA 4GIRA 3OO2A 3MP5A 4S2BA 4XZNX 3MZ2A 3U48A 3U9IA 4HCLA 4ZOAA 4QJ3B 2IPJA 1VFOA 3B8UA 4OT7A 5D05A 2QCLA 3MUAA 3F1QA 4LVBA 1PS9A 1UWRA 5LNVA 1TTIA 3EX2A 1J0IA 4DWDA 1JPDX 1QUMA 3WEMA 2X40A 3KW3A 3B0UX 1VBRA 1OCNA 3I6TA 2ZBTA 1WZAA 3N6HA 1I60A 2MUCA 1GOOA 4RXGA 1H7RA 2PDLA 1K7XA 3HJEA 3H53A 1AJ2A 1JAEA 4HU0A 4B3KA 1YTKA 1VPXA 6CGTA 3IUHA 4QDMA 1LYXA 5DMYA 3T0BA 1W9UA 4AXNA 2Z28A 4O8AA 2EPMX 3S1VA 1JDCA 3GTFA 1A49A 1Q4WA 1JQXA 3NQ8A 1D3GA 1NFGA 1HJVA 4MY8A 2HJPA 4WJEA 1UB3A 3VE7A 1GCYA 3D6NA 4D6FA 4Z2HA 4JNZA 2GWGA 1KB3A 4MDOA 3C0QA 1DHKA 1TV4A 1S5WA 4HKPA 3P3BA 1UKTA 3QV8A 3WX7A 4Z0SA 3LHYA 4Q33A 3B9EA 1TMHA 4UTMA 3EPMA 4LB3A 4FF7A 1FCVA 1SO5A 4NJKA 3SW6A 4KFOA 4DLFA 3WLNA 5BOOA 4K1GA 1E55A 3RLUA 3VFLA 1EIXA 3BMVA 1ZCOA 2WC3A 7ENLA 4B5XA 4DNHA 4NNBA 3EKZA 4DO4A 2AQWA 1S2TA 3W7EA 3P61A 2EQDA 3RRXA 2IQDA 3MMDA 2VD9A 3EWWA 1KLZA 3NO3A 4L4LA 3VPLA 3TDFA 3CL8A 4EAYA 1DTNA 1FFRA 2VTFA 1OC7A 3A4XA 3LLXA 3NQFA 1X8CA 3ARUA 1EHAA 4L1XA 4YLWA 1R87A 5DMMA 3P84A 1HX0A 3DC0A 4S3CA 3MYPA 2OLHA 1ZJAA 4MJ4A 2ZC8A 3MTWA 2ZZ3A 4Q4MA 3GM8A 2DT3A 2GGHA 3ABOA 5AOUA 1E9YB 2VRJA 4XZLX 5XIMA 3MJMA 7PTDA 2Z24A 1R3QA 2FTWA 1W2PA 1ZGDA 2BVDA 1IHIA 3M9YA 5CAKA 2NXGA 4HPNA 3EZ4A 3NO5A 4WHBA 1QPKA 5FEZA 4Z2GA 2AGKA 5FJRA 2WWCA 3HG5A 3TQKA 2CZVA 3W6YA 4YTRA 1EH9A 3LHZA 2G37A 2CETA 4GYPA 2X7WA 5K2ZA 3L4XA 4HTYA 4C90A 1W0MA 2PGWA 2VD8A 3NZPA 2ZRZA 4LOCA 4PMJA 3VKJA 4TOQA 1LBFA 2V67A 4GQQA 4P8UA 3LTPA 4MPQA 1IGWA 1M41A 2XZ7A 1LDCA 2ABBA 4N9EA 2Q3RA 1E0UA 2A5HA 1XYLA 4LF1A 3CWOX 3QZAA 1DORA 1J01A 3QY6A 1DOSA 2B0MA 5D2TA 1A50A 4I6KA 2A3EA 2IPFA 2VX7A 4TMBA 5T9BG 4MNMA 5HR7A 4KRTA 3GK0A 4L9YA 3F4VA 1SJAA 3LHUA 4OV9A 1NM9A 1M53A 1MRQA 1XIMA 4F40A 5FSEC 3BLPX 4JY9A 3CO8A 4R7WA 1QAPA 4WF7A 5KINA 4H9ZA 2BGNE 1UBSA 1QVBA 4A05A 1JGIA 1EJRC 2BTMA 1JZ6A 4IJCA 4NZ4A 4UMAA 4RK8A 4XVEA 1Q2RA 5A2AA 2X2YA 3AHVA 1HKJA 2Y7EA 1NH6A 2ZUMA 4HYVA 1DHPA 3RFAA 3CMFA 3W7DA 5A8MA 1XICA 4K8HA 3SJNA 1S2AA 4BI5A 3F2DA 3GTHA 1K6AA 3TSDA 2VKZG 4QS6A 4PH6A 3IACA 4R9XA 3PZQA 1OGSA 2QQ6A 3M0IA 2XGIA 2FJKA 4V33A 1E51A 4GVGA 1RQEA 4H19A 5CPTA 1RCXB 1EDQA 4LCSA 3GFXA 1NWTA 3DHUA 4G9PA 1EUNA 4PODA 1SO4A 1A4LA 1WAWA 3PTKA 1BWLA 1LWHA 3G8RA 3L4TA 2HMCA 1YTDA 2BVYA 3SRFA 3NZRA 2QCHA 3RG6A 4U5IA 1FWIC 3G1AA 1HUVA 1M3UA 3IGUA 1JYVA 3H70A 1RPKA 1IF2A 3QW3A 4ASTA 2DT0A 3SR7A 2C91A 4ZO6A 5I02A 4OU1A 1QW7A 4Q8WA 1O12A 1YW1A 1R85A 1R9YA 2W62A 1JPIA 2PCQA 4KIRA 1DYSA 4O4VA 2OU4A 1HGYA 3STFA 3KM8A 2ADAA 1KXTA 4HA0A 2Z6JA 4Y8FA 3VKDA 1AFSA 3R5EA 5DF0A 2PDMA 3AI0A 1X7FA 3AO0A 1SSDA 3NZ1A 3CPUA 1XYZA 3LZ3A 1MUCA 3KRSA 1DEDA 3LNPA 4NAEB 3GS6A 3CWHA 3EAUA 4NZ3A 2EPHA 2CYGA 3HBLA 1UBPC 2Y8KA 3L0NA 3USZA 3VZXA 3O16A 4KCVA 4Z1DA 2VEKA 3GQYA 3UXLA 5A2CA 1QI2A 1XH1A 1FWNA 4EIVA 2O0TA 4V1YA 5FJJA 1LCOA 2PDKA 1PVNA 3UXAA 1XH0A 1W9DM 4JTHA 1XH2A 4WSKA 1TJRA 1AL8A 1F6YA 2HSAA 1IEIA 3RCNA 4WDWA 1HP4A 5K4XA 3CUJA 2CWNA 3WBYA 1IV8A 1UQYA 2ZUNA 3B03A 2VRKA 2F9RA 5D4YA 2PDNA 1XLCA 2E1WA 2FPYA 4F2TA 3H8AA 5D9PA 1E73M 2WM0A 3B9NA 4S3BA 4C6KA 3B0VC 3RUBL 3UJFA 1W1A1 1P1XA 2EJ1A 1JPKA 3DGRA 3WF3A 5LXEA 4W8BA 5K7JA 3N4FA 1XLDA 1EWDA 3NR0A 3KBWA 3S8HA 1HKIA 2QW5A 3BSGA 3S2LA 1UKQA 5AHMA 4CEXC 5BROA 5A69A 4D1IA 1Q6EA 3FDGA 2YXXA 5LNRA 3HV8A 4LS0A 5EY5A 2OSXA 2A3BA 2FH6A 2QR6A 3B3DA 3PP7A 5D9NA 4XTIA 2J8FA 3VCNA 4H9UA 2Z1WA 4H6QA 2OKOA 3W6LA 1RZMA 1KM5A 1AD4A 1TSIA 3F03K 4DAIA 4JFUA 1EPVA 3L4YA 3VC6A 3C0JA 1GPWA 1GONA 3TJ4A 3ZLFA 4TXEA 3M46A 3I7SA 2WMIB 5BXTA 4D6HA 2D73A 3TLQA 5A6BA 1X1OA 4TO8A 2C79A 1AW1A 4HB7A 1UJQA 3MO4A 1E0VA 2YCJA 4TU1A 4DI8A 1I2RA 4K8GA 4EPKA 3LDVA 1DIKA 3OZOA 3OIHA 3OZMA 3WNOA 4QJ4B 4HK6A 3NJ3A 4YWSA 3ZSSA 3EA2A 1LOLA 1ZAHA 1GUVA 3BG3A 4PCTA 4PZVA 4JHOA 4UNKA 1GTHA 1L6GA 3T05A 2EPNA 4WR3A 1DQWA 1P6CA 1K03A 5ABTA 4Y7EA 3KX6A 3EB3A 4PSPA 1VFLA 4CNPA 1ONXA 1XFBA 1W2VA 5I00A 1IWBA 2GUBA 3I4EA 8XIAA 3TV8A 4AY7A 1ZBCA 4CD6A 5D2WA 2VWSA 4MADA 2GGGA 2QCGA 4B2DD 4DXVA 4UQDA 5REQB 4N9BA 3LUTA 3HN3A 3OU8A 2ZDSA 4QHRA 1OGBA 1UUMA 1QNOA 5CC6A 1QHZA 3B4YA 3A5FA 1X6NA 1VCGA 2XVLA 3UY8A 8XIMA 4CVUA 5LIWX 5C9ZA 1UCWA 4ICNA 4M7TA 4XISA 4W5ZA 3U57A 3VD5A 3C56A 1FP8A 3GSMA 1MW2A 4WEVX 1SFSA 2V68A 4HPXA 2X42A 3FX4A 2OO6A 1V93A 2HS8A 3N73A 4GNJA 4HA4A 4GUHA 2EPKX 3LM7A 4DB7A 2RUSA 3URNA 3GRIA 3LCFA 4DM1A 5FEPA 1OCBA 2OQHA 3GKAA 1VFTA 3NQ7A 4GQBA 1FQ0A 2WANA 1RLCL 3GUGA 3RJYA 3W2UA 4W88A 3WLJA 3VGGA 2GFTA 1TELA 1H7XA 3MHFA 2GWNA 1WO2A 2BOGX 2PGRA 3PUOA 4FNPA 1A5AA 1ZL1A 1XIJA 1M7PA 4ZQMA 2QVNA 5LYRA 2TPSA 3WQ6A 1SVDA 4NZCA 2BHZA 1W3LA 4LC8A 1ODZA 1T99A 3WMBA 4ZXLA 3QKZA 4P61A 1ZP4A 4IFOA 1ICPA 3VKKA 1KGUA 1DIOA 1ISYA 2ACSA 2P53A 3AJ7A 2XWEA 3ZO9A 1FVPA 4PTNA 3H4GA 3G6LA 2FGZA 1M1BA 1OX4B 4C7GA 4MWAB 3TU9A 1UWTA 1LUCB 2FVKA 5D33A 1BGAA 3AXMA 1S2CA 3L65A 3AAMA 3WZ0E 3GC5A 4PCFA 3ARZA 4S3AA 4NX5A 3O7UA 5GJPA 4D6GA 1SW7A 4F0MA 3P14A 1SW3A 2VR4A 1XKJA 3OOQA 3CPRA 3M0JA 2INZA 4YCOA 3HQNA 5AVNA 2VXNA 2PP0A 1YYAA 2RGLA 3VIKA 1S5MA 2ODOA 1OZMA 4Z2KA 3AIVA 3H2OA 2G3FA 1FY6A 5DELA 3NQAA 2XWDA 1ZZMA 1N8WA 2HK1A 1UROA 5H8UA 3SUTA 2YIHA 1R6WA 3W4RA 4MAVA 4B9YA 3LEPA 3JW7A 3WUGA 1QTWA 4TVDA 2Q6ZA 4YHGA 1GK8A 4WY0A 2QGHA 2ZRYA 5DT7A 2D2HA 4PBFA 4LC6A 3WBEA 4UQBA 3PPFA 2AL1A 2ZE3A 3RU6A 2OFJA 4QBXA 2VJXA 2W91A 2WM1A 4LUTB 4IXHA 1JXKA 1CGTA 3W2MA 4F0LA 1AMKA 1R46A 3QLLA 4OHQA 4PCNA 3AROA 2EPLX 4IMFA 3ITTA 4TX8A 4AB4A 3TR2A 1FCBA 3T78A 3GNNA 3V1PA 5HQEA 3ARSA 3PS7A 5G5IA 3VE9A 4AC1X 5I24A 4M8UA 3K8KA 5CZSA 1GQKA 1CLKA 4PC8A 3QGAC 3V0TA 3W1UA 1A5MC 4W7WA 4GYFA 1H7WA 4WY0F 3U5YA 2WB5A 2Z4GA 3GNXA 2GQ9A 3W82A 3B9DA 4F4RA 4WQ6A 5IHRA 4J3SA 3ARVA 4KQNA 4MLRA 3OVPA 2E40A 3HURA 3WDIA 2W61A 5E9XA 3TX9A 4HT3A 4RDVA 3PZVA 1SMDA 3KXQA 2PDGA 3QZEA 3WDRA 1UIOA 3MV01 2BX7A 3BLLA 3CH9A 1H5YA 2B4GA 2NUYA 3E2RA 1TX2A 2V63A 3SCQA 4F0RA 3PNZA 2QCCA 4BF5A 5FL1A 4NAEA 3TQ0A 3ABZA 1LQ2A 4RW3A 3VZYA 3MANA 4M6QA 4Z1YA 3GXNA 4P2VA 3D0CA 4A8LA 4FLOA 4EPDC 4JYDA 4LS2A 5CPOA 4OUIA 2V5BA 3FEQA 4DQWA 4WKFA 4BF7A 2OLSA 5D09A 1NFBA 1GEQA 2ASHA 2WZTA 4K39A 2G0WA 3U0HA 1K9EA 5G2IA 3AZSA 5DXXA 2J6XA 4L5ZA 3UEQA 4R27A 4WGXA 3OTRA 4CN6A 2H9AA 5IBXC 1O7AA 2XUCA 3GH7A 5HWMA 4I5XA 2OEMA 5BMWA 3A22A 3NPUA 4TUFA 4BQ2A 2EXOA 2O4MA 1P0DA 1DWIM 2IXUA 3CK5A 3UJEA 4TX9A 1XHGA 1WDSA 1PZ0A 3OA3A 4UTFA 4GRSA 1TUFA 4JIRA 5JUVA 3ZM8A 3GNDA 2PDJA 3WQPA 3WYZA 4N02A 4OWGA 5M1TA 1G1YA 1GQJA 1D7KA 1XLBA 5A8OA 3GDLA 4O52A 3XISA 3UYCA 1E6NA 3TFXA 1N8FA 2E9LA 2WK2A 5AYYA 4TVUA 5I23A 1RQHA 3NQVA 1W9PA 2CZEA 4UNLA 3FAXA 4UTIA 3W1MA 4XIAA 1JZ3A 2ZRWA 1M7XA 4FX8A 2ZQ0A 5DMNA 3W7KA 1V6YA 3U4AA 1J5TA 4HQVA 1R8LA 4PL2A 1E1FA 4ZMGA 1DJIA 4C6EA 2JIWA 1GOIA 3SCUA 1RV8A 3WF0A 3CJPA 3JVAA 1ITCA 2AKZA 2ZXBA 2DQXA 3VKBA 2ALRA 5D32A 2YW4A 3TC7A 4XUGA 2FHBA 1KFEA 4GY1A 3UR5A 4W8AA 3TZFA 3VOCA 3ZWSA 2CU0A 1AD1A 5BWFA 1H7PA 4DUVA 2Y85A 4D8ZA 4UC5A 1KBKA 1L6FA 3W81A 3ZLHA 6A3HA 5D37A 3ARQA 3BK0A 2XFYA 1XYMA 3FGCA 4IL2A 4Q3MA 4F0SA 5KZDA 3S1GA 4GJJA 4OOUA 3NPXA 3W83A 1LBMA 3ID7A 4LUJA 1BYCA 2YL6A 5FF3A 1T6MA 3WD2A 4GFIA 4M6PA 3PNUA 3UVAA 3WJSA 1QNQA 4HIBA 1DIEA 3UNDA 1OG0A 3BMXA 1PXGA 4GKLA 1MWOA 4K6AA 1VRDA 3PTMA 3T07A 4H00A 4W7UA 5FJIA 4GYKA 1T96A 1WZMA 3KBSA 3REQA 4ZVJA 2CHOA 1CXFA 1BRLB 2XVKA 4NIRA 3F5LA 3VD9A 4IL0A 3UWWA 4KWVA 1EHNA 1UKSA 4WSHA 4HN4A 3UWZA 2UY3A 2ONEA 4OV4A 4DJFD 4F9DA 2RDTA 3I10A 3UZYA 2C71A 2FLIA 4KESA 1HL9A 1V6XA 2ZIDA 1DKWA 1ONWA 3LX9A 2F6XA 4IPJA 3N17A 3OB8A 3FAWA 2HCVA 1GGOA 4U2YA 2WPBA 3DHFA 3DFOA 1QPQA 4XAZA 3N19B 4O19A 3MQTA 1W5QA 4QDWA 3PTDA 4HNVA 4Z17A 1JRBA 4C6QA 4WRHA 2PZNA 3GZAA 1YTEA 1CENA 3OZYA 2J7CA 4J3ZA 3L9CA 3M0ZA 1P5BA 4MWAD 2G95A 1CXKA 3FJNA 2ZZ7A 4FIRA 4AWTA 4RPQA 2ACUA 2QUMA 1TPEA 1RVGA 3C2YA 2NV9A 1TE1A 1XLEA 5GNYA 1F9CA 3DGBA 2TYSA 4MKSA 3STEA 4NI8A 5CGQA 1Q2SA 1B0IA 1TJPA 3BV7A 4U2ZA 4FNRA 1IGSA 3EWYA 4LTSA 3LTSA 3S5ZA 4QITA 3USBA 3GIPA 4C91A 1EYWA 3DKLA 4M1RA 1BGGA 2QF7A 4UXDA 4C6JA 2PA6A 1XG4A 5HJYA 3TN3A 5D2YA 3MJYA 4US6A 1RY0A 2YYTA 5F1VA 4UTHA 2JGYA 4M6UA 3ATZA 1LLZA 1HKMA 1UHVA 1RCQA 1UA7A 4JIHA 1QI5A 4ZE5A 3ZZ1A 1V77A 2HE5A 1W8SA 4AXKA 2W66A 4WY0B 5AC7A 1TRDA 1W1YA 4QAIA 5AVHA 3KCJA 1E6SM 1GQIA 2ZWYA 3GZ3A 3ZT5A 1MNSA 2WC7A 4AW7A 2YR1A 3VUPA 4I90A 3FSUA 3Q45A 2PDXA 4L4MA 3N9KA 1VBUA 3GU2A 2NXHA 3CLMA 1XISA 1MEWA 2Q3OA 3QPZA 2VMFA 3LXCA 2J6VA 1UJPA 4AD0A 2GSHA 3W1AA 4H9MA 4G2DA 1V8EA 2FFIA 2Z2BA 3GVVA 1PPIA 1VBHA 4V1XA 2Y88A 5D8WA 4QRNA 1C8VA 1RK5A 4I6VA 3MO7A 3UY7A 2B7QA 1J0HA 4IMDA 3AU2A 3WH7A 2EO7A 1P48A 1VPQA 1PBGA 1UWAA 3EWZA 3THCA 4R9OA 1NJJA 1VBGA 2WPGA 3BCDA 1HVQA 3W7IA 1W5OA 2Q71A 5CC5A 4GHRA 2FVMA 3BGGA 3OG2A 4B5WA 1SPQA 1EJXC 3MMUA 1WDWA 1FHUA 1KO0A 4OBTA 1VFMA 1KBLA 4E6MA 4UTTC 4IQJA 1F6PA 2W27A 5HULA 3CXOA 1IEWA 4CQ9A 4M7SA 5G1TA 3IJ7A 3M0XA 2OJPA 1OJXA 4NG3A 3HGJA 4H9VA 3G1XA 2HPMA 1CWYA 9CGTA 5HR6A 3PULA 1I2QA 5KZMA 4LUYA 1A5BA 2IKIA 1OF8A 4Z1AA 4JFWA 4OOZA 1O4UA 1V02A 3EA1A 3NXLA 1IEVA 4GUJA 1YPIA 3ZWTA 2A3AA 4ROPA 1EBGA 3FXGA 3VNDA 2VX6A 4ZB5A 4CQBA 3PFRA 2PU0A 6TIMA 2CITA 2PDUA 1VHCA 3NWRA 4EE9A 2FGBA 3RDKA 2DQWA 1MNZA 2FZ9A 3WELA 2VC5A 1EFZA 3W76A 3M6YA 2H3BA 3GDMA 5H2ZA 1ZJIA 3MKVA 4MVAA 3G2GA 3H26A 4WJ8A 3KVKA 3PWAA 2YBUA 4KEVA 1R7OA 4Q8MA 2ANUA 3WQGA 4K68A 2XHYA 2E6DA 4HYWA 2OGJA 3NUKA 1E4IA 1GOWA 3BGAA 4AHQA 1UPPA 1BF6A 3GX9A 4F3HA 5C0QA 2WLYA 3H7UA 1YNPA 1TPUA 3EOEA 3G77A 1D3HA 2V69A 1CEOA 1JPHA 2JK2A 4QTGA 5LNUA 4AAJA 1JZ2A 1U1UA 1KRBC 3WQ4A 1XC6A 3WLTA 1IT0A 1KM3A 4B16A 1GZ1A 3DIPA 1SZFA 5L9FA 4FB7A 3E02A 4QCFA 3WLQA 3HQOA 4PUMA 2I5IA 1V7AA 3MMTA 4I5RA 4N0RA 3QFEA 3DERA 3OVQA 3TZNA 1ME8A 9XIMA 4HK5A 5LA2A 4B5SA 4PB5A 1TPVA 3L0KA 2VDHA 3M5XA 3WLLA 3VOHA 2OSYA 4XD4A 1H41A 1ZALA 3UF9A 4LU0A 2AQVA 5FKYA 5F4XA 2P10A 4C6NA 1AQFA 1PX8A 2O92A 1EKOA 2NX9A 4XKYA 1LG1A 1UQZA 3TSMA 2IS7A 3V5FA 3EEZA 1XSIA 1CGYA 1WCGA 3TA9A 1EEXA 3EOSA 3IIVA 2V2CA 3GB6A 1IIHA 3GUWA 2P50A 3NQGA 2V3FA 2GSJA 1WDPA 1YE6A 4H2CA 4YTUA 1CCWB 1BTMA 3G1FA 4IJRA 2J25A 1NIUA 2HS6A 1BPLB 1V4YA 2V5JA 3L23A 1VB9A 1PZ2A 3S1UA 2HK0A 4JX4A 3UG5A 2YB1A 1PWMA 3QF0A 1TO3A 5EFFA 2TSYA 4HSOA 2BY0A 3QQ1A 3GWQA 3BZJA 5AZ1A 3UR2A 2CIPA 1S1PA 2IQTA 2XVGA 1FX6A 4S39A 3TTSA 1TB3A 3PANA 3WBAA 4C6MA 3WBWA 1GJPA 2GQ8A 2GVEA 3RX2A 5DY2A 3GXPA 3ATYA 1BYAA 1RSCA 4GX8A 2ZX5A 2VO5A 4JKMA 3NQMA 3SRHA 3T0AA 2CLPA 3T1GA 1VIWA 2CBVA 1XIHA 3VNMA 4O1DA 4FLQA 2D2JA 3CHEA 6XIMA 4DWSA 3CZKA 4TTGA 2YX0A 5REQA 3KRZA 2V2HA 1KWKA 2R24A 3FA5A 2ZYFA 2I56A 4CLMA 5JH2A 4E2VA 1LQAA 1YHTA 1BQCA 1O1HA 5DT5A 5IRPA 5F4WA 1W1PA 2VOMA 1AH4A 2QUNA 2FVLA 4QM1A 3OHIA 4RZ6A 1VLWA 1TTQA 3V35A 3K4AA 1L6SA 3VX0A 7A3HA 3UU0A 1YQ2A 3C2OA 3HFTA 4N9CA 4AEFA 1F8MA 1XM3A 4TR9A 1O66A 3W02A 1TWWA 1OD8A 3L5LA 3EBVA 1UMYA 2WNNA 3VC5A 1XBZA 3VZZA 4QNWA 5LXXA 4AUBA 4HSHA 2DW6A 1B3VA 4X2PA 1IT7A 1I6NA 2RDXA 3SCPA 4ZO7A 2F2KA 3G1HA 3PPCA 3BOLA 1O5QA 2OKTA 1YDNA 3PC0A 1MEIA 1WPCA 3UXKA 1H0IA 3N6JA 3GDRA 3QC3A 5T9CE 3WK2A 3T2OA 1F76A 4PUNA 4BI7A 5JVLA 1UZ1A 3XINA 4KRUA 1CI1A 3V7PA 1NDWA 1Q4NX 3ARWA 3WL1A 1WUFA 2A3LA 2QV4A 3E5PA 4FXFA 1OD0A 4Z0JA 5JBDA 1J2BA 4P7QA 4H41A 1C9WA 1MZHA 1HW6A 2FB2A 1MI3A 2WJFA 5EB8A 1ITUA 3W1QA 4D6JA 5CXPA 2ZRXA 3O06A 3LB0A 4LBRA 2D3NA 2Z25A 5CPLA 3S6OA 5B7ZA 4ZZ9A 1VPYA 3ZT6A 1H09A 4O0KA 4C7DA 2OYLA 3BLEA 4K37A 3GYCA 5C54A 4IPLA 2GVLA 1VHNA 2FDMA 3BV4A 1W31A 3CC1A 2WLZA 1A3XA 2BHUA 2J13A 4QG6A 2P1FA 1ZQ5A 2OELA 5JH1A 1V6VA 4GA8A 1XUZA 3MUIA 1S2VA 2Y8UA 2MANA 3QY8A 3ITXA 4J5NA 2HBVA 3HPZA 1VEPA 3EOUA 3KHJA 1FCUA 4MUZA 3OBKA 4MG4A 2P8BA 2FYMA 4AEEA 3D3FA 3QV9A 3F5JA 1V02E 3QZ6A 3UJ2A 3BC9A 3S5SA 3RIKA 1LRQA 1O95A 5FA5A 4GABA 2VNCA 3VOFA 1BSIA 2DH2A 1LOSA 3WLMA 5ECUA 5CSYA 4O53A 4B90A 5T8GA 4GY0A 2I16A 2JF6A 4LS1A 1L8NA 2PDCA 2V5CA 3PVFA 3QYSA 1Y5WA 3B04A 4RZ5A 1IWPA 2YCKX 3HG3A 3BPWA 2R9RA 3VKCA 2VQTA 2DSVA 5H1WA 3AHXA 1K7EA 3TOYA 3KRUA 1HO4A 1QPNA 5IDIA 4RNHA 5C55A 3BZGA 4LEQA 2FZBA 2CKRA 5CC3A 2OVLA 2DZSA 2PTXA 3G8EA 4MB3A 3W72A 4B91A 2W6RA 5CLWA 3KCOA 2XISA 2IKJA 4LY4A 2AAAA 5IXEA 4S23A 3EPNA 3CZEA 4ERAA 3RO6A 4MJMA 1M6JA 2VRQA 4AD5A 1W9XA 5LKYA 4NILA 4AX7A 3Q67A 1KTCA 6PTDA 5HJXA 4QE1A 3PK7A 4FR6A 4AY1A 2I9UA 2PTZA 5FJUA 2OT1A 1M68A 2BY3A 4GOAA 1SZNA 2X0YA 1GNXA 3F4NA 3IVSA 1HXJA 2VL4A 4I7WA 2B7PA 3IJ9A 2Y7GA 3W7HA 3P5ZA 3WIJA 1G6CA 4QEEA 4DIAA 4TX6A 4Y96A 4QSFA 3SB0A 1VAHA 1U5VA 2QUUA 4FSAA 3TW6A 1U5HA 4GQRA 4LY8A 5HWJA 3NQCA 4HOWA 3VOGA 4IQEA 1KFLA 3PG8A 2NSOA 4WX2A 5XIAA 1UR1A 5FJPA 1Q5MA 2CLOA 1GW1A 5AFDA 4EWJA 3L5MA 1IEXA 4DRSA 4Y9NA 1TIWA 4JTEA 4ICCX 1E6QM 3B0XA 2WV8A 4L1WA 3CUGA 2PP1A 2QJMA 3LCIA 5TAOA 1B31A 4XBJA 3W87A 1W3KA 1C3FA 1UC4A 1SSGA 3OEXA 2CLKA 4NJGA 1ZAJA 1RJQA 1RA5A 2D1ZA 2NVDA 2I57A 3O9NA 2POZA 3CV6A 3MKCA 1XS2A 2ZA2A 3ZLGA 1NDZA 1E3ZA 1IZCA 4F2BA 5C8BB 3R11A 5HBFA 4MB1A 6ENLA 1KCXA 1DJYA 3LTYA 3VGBA 2QGYA 5HATA 2BS9A 1RD5A 1KQYA 3MYOA 1MUMA 4M1BA 3F5KA 3KZPA 2PSNA 5D02A 2NX1A 3P2VA 5A6BD 4O17A 1SZGA 4JFVA 1XD0A 4O1CA 4CNNA 1YE4A 4IP5A 4KMQA 2XGZA 3EGJA 2UV8G 2L5HA 4ADTA 4CQDA 5HQMA 1ZBWA 1UMLA 4F48A 3V1HA 4HZ7A 3VIFA 4LW7A 4GISA 4LFYA 4QJ5B 4KBXA 4REQB 1PHQA 3AXIA 1X1ZA 2HVOA 1I2OA 2R1KA 3HG2A 4KS0A 5EMJA 1KKOA 3E3HA 1YNYA 4GZEA 1CGVA 3NNTA 1ADSA 1BAGA 2A1YA 3DXIA 4ADUA 1IIGA 1CB7B 2JGQA 1LM1A 2SFPA 1W54A 3K5XA 2H9AB 4UTJA 5AHIA 4FP1A 4NY2A 4K2SA 2XIMA 2VEIA 1OK4A 2WVVB 4US5D 2WXDM 2QAPA 1UW9A 1X1NA 2W4XA 4JGDA 3N2XA 1XSJA 5AZ0A 2QJJA 2DSKA 3WLHA 3H6OA 1B5TA 1E72M 1PTGA 1S3TC 2OEJA 1OM0A 4JQ3A 3VO0A 3R94A 4J27A 4QJ1A 5T91A 1V0NA 2XIOA 1XIBA 5HANA 4B9ZA 4QFUA 2F38A 3C8FA 3RPTA 3WK1A 4ZENA 4UR9A 4N7QA 4X0VA 3B9AA 3UCDA 4CU6A 5HXMA 2VCBA 4NRSA 5AYIA 3UA3A 1QOXA 4K7YA 2BY2A 4A8RA 2OTDA 3VUSA 2ZWZA 4FI4A 3QLDA 3CUXA 5BXPA 5FEWA 3CYJA 2X0SA 1RXOB 3ELFA 2CC0A 4B5UA 1BXCA 1UWIA 1W56A 1VD6A 5E09A 2BOFX 1Q13A 5LNSA 2AMGA 4S3EA 3N15A 5DLCA 2ZZ5A 4DJDA 3W7NA 2XFFA 2Y0FA 3NSXA 3CBWA 3N2TA 4HD5A 1J0JA 1WKYA 1C7SA 1XPYA 3ITLA 4J9JA 2O9RA 3V0UA 4DWSB 3CL6A 2OPJA 4M5PA 3R1ZA 4UOQA 3TYCA 3GHRA 5I3FA 5MHBA 1RQBA 2GLKA 4I7UA 5A8NA 1VS1A 2QMKA 4NP7A 4IMAA 2XFWA 3HO8A 2PD5A 1WZLA 4TVCA 4YIWA 3TN4A 2C18A 3FJLA 4IG2A 4FNTA 4RLIA 3DCPA 5DFAA 3AUOA 3WNNA 3N04A 1R7AA 2CWXA 4FA3A 3PWGA 4KERA 2GVGA 1GOKA 3NM1A 2FTYA 1X6LA 4JZ5A 5HPOA 3FGCB 3TOPA 2X1UA 3LQLA 2G3NA 2VEPA 4OBRA 4JHZA 3UVIA 3WUEA 2RAGA 1DV7A 1NF7A 4MB5A 2WMHA 4EP8C 1B9BA 1XG3A 3CQKA 4IX2A 4LAOA 3FN9A 3NO1A 2DU2A 1FRBA 1JI2A 1JCXA 1AZ1A 4XD3A 3VDGA 1QMLA 2JQXA 4Y2WA 3PBYA 2VCAA 3NL2A 5IFPA 1DE5A 1N8IA 4GI4A 4B3LA 1F61A 3REQB 2WZIA 3N14A 1G7VA 4M6VA 3HA1A 3G24A 4GXPA 3OA5A 3E96A 3VMNA 2Z7KA 4GIYA 1E1CA 3VNYA 5LZLA 3TAOA 3CV2A 3HV9A 3C3NA 3URBA 1T40A 2WJEA 4O54A 1R86A 1U22A 1VFFA 4UCFA 1UZ4A 1MXGA 3PY2A 3KS6A 4LVGA 3R89A 1OX6A 2DSWA 4PEKA 4JICA 4Q4OA 1WKFA 3W53A 3EB2A 1Q6OA 5EMMA 4G7FA 2PTWA 1NOUA 2GVYA 2J62A 1FXQA 2GJPA 1EZWA 5LSMA 1VGAA 3G1RA 1KC7A 4MAZA 3HQ1A 2XH2A 2V2DA 3GTNA 4A4AA 2GGIA 4BA0A 1US0A 3C2FA 5EMYA 3TONA 1REQA 4DJED 3F4DA 4Q8QA 4Q4PA 4CCZA 1HKVA 4BZYA 2DIJA 1VCFA 3C2RA 1IR1A 1R2TA 4NZJA 2OYKA 1MQQA 2DVTA 4U5KA 1PZ3A 2CKSA 2XJ7A 3N2OA 4DJDD 2DUZA 3B8IA 3E74A 2V6AA 2X2GA 3UA4A 4LAUA 1JF5A 3TIMA 3BVJA 1VZWA 3WQOA 4AIUA 3GVGA 3DFYA 3VNKA 2OQYA 3O0FA 3CZGA 3HJZA 3N11A 1XL9A 4Z2LA 4GACA 3O63A 3H7RA 5HNUA 1UZDA 4MIMA 1TG7A 1ENUA 1JG9A 4IF2A 3PPGA 1FBAA 2R1LA 1MEHA 4JTJA 3A4JA 5HQLA 1B9ZA 5TF0A 2J9XA 4FNSA 4QAWA 3LOTA 4RL3A 1E9IA 2I7GA 4KCWA 3SY5A 5A8GA 1NAL1 1J5SA 4H01A 4ENLA 2E9MA 3BL3A 5HNTA 3PSVA 1TJ0A 4FEZA 2WMGA 2NQ9A 1M65A 3DZ1A 1RPXA 5EBAA 2YDQA 3GW3A 4J4KA 4ZL1A 1SO6A 3FNDA 2PEVA 3P74A 3PZMA 5AHFA 1BXBA 1D2KA 3PBUA 4XSLA 1FHLA 5CKSA 1JZ4A 4UZSA 3ZR4A 1UH3A 4JTDA 4KEMA 3SQMA 3VIJA 1O5KA 5IDZA 4CNUA 2OEKA 3I3DA 3SQLA 3P81A 3TMLA 2NZLA 3AS2A 3SCVA 4IGNA 3QTPA 5GVJA 5CQ1A 1XD1A 4WVXA 4OUEA 4IIFA 3LMZA 1JCNA 1I4NA 3INPA 1R3SA 4DI9A 1DP0A 2DGAA 3TYEA 3R13A 4BQ5A 3FW6A 3BLKA 1UH2A 3GG0A 4HBKA 1TV7A 4GX9A 3AHZA 4IOTA 1R47A 2AMXA 5EMUA 5K9CA 4LX4A 4CCCA 3ANUA 4UFKA 1PIGA 3PTQA 1DJHA 2YL8A 4O50A 3AWNA 4JTTA 4DO7A 3A24A 3U6WA 1GORA 4MYXA 5JMUA 4O28A 4OE7A 1AJZA 4GO9A 4HMCA 4REQA 2WMKA 4HU8A 4C5ZA 4UFHA 3DYPA 2CNCA 2EKCA 3WQ8A 4PBEA 4QP0A 1Z48A 4Y9OA 4UQEA 3SY1A 1AK5A 2WMIA 3NQ2A 2GOUA 1ZBVA 2I5GA 3KHDA 3HPFA 5LIKX 5T26A 3ITVA 4W86A 4NNCA 1EC9A 4M80A 3ZR5A 1GYMA 2BASA 2JBMA 3KDNA 4S1FA 5AHEA 1GQLA 4LUIA 2UBPC 1ITXA 4PCPA 1EXPA 4GWEA 3BOXA 3DFQA 1I1WA 2G97A 3UPBA 1HFBA 3L5AA 2E6AA 5CSSA 3VD7A 1XR2A 1ITQA 3ITYA 4N4QA 3A9BA 1KFJA 1SJDA 1B3XA 3B8VA 2VZVA 2PURA 4JCMA 1V79A 4W9TA 4YTSA 5H6HA 2YKKA 3I7QA 1HL8A 2E0PA 2DSZA 2G4JA 4AYGA 2OZ0A 5HA7A 5JIWA 5F7UA 1YIXA 2VCCA 2Z1XA 2D0HA 4Q8NA 3EA3A 4IP7A 3O0KA 1E3XA 3LPGA 4GUFA 2JFEX 4JDYA 3R8RA 3TN5A 1JYXA 3CZ8A 4EOUA 1DJZA 3ZJ7A 2E5CA 4C6LA 1C9DA 2DUAA 4CNOA 3H2CA 3VAVA 3KOWA 5DBTA 1BKSA 3RR1A 1B3WA 3WDHA 4XKYB 4G1NA 1H7NA 3NL3A 4OZOA 4H83A 2GVJA 4QLJA 5AYXA 3W1NA 2WNWA 1R3WA 2OZ3A 4JKLA 1TE6A 4Q4RA 5D04C 1KR1A 5B80A 3AU6A 3SUSA 1BG9A 2H8ZA 4RE3A 3QR0A 2X41A 4G5DA 4J3TA 1SMAA 1UKOA 3FYOA 1AW2A 4XB3A 4UOZA 3LSCA 2DZBA 2Y5EA 1JIBA 2A7PA 4PULA 1AUSL 3LU2A 1WV2A 3AMLA 1XW8A 2BVTA 3CTLA 1PKMA 3UR8A 1KM0A 3MWCA 1KD0A 1XLLA 1VYPX 3UZWA 1UC5A 1BFNA 3APYA 1KGXA 3DI1A 1ZPTA 1W1IE 2PWVA 3HU7A 3LCLA 2A0NA 1E6RA 2QJIA 4LJ3A 3N1AA 1V3IA 3UCQA 3S9YA 1ZB5A 2EG8A 5FEXA 2WWDA 1AZ2A 1BWKA 1FUYA 1PCWA 3UGRA 1WYIA 1WBJA 1G7UA 2WBGA 1SYTA 4NAFA 2GGJA 3N3TA 4ZB2A 1GJUA 3FXYA 3WNPA 3OZPA 4ZCWA 3FJ6A 2ACQA 5DEZA 3CMJA 4EPBC 1WDQA 4JTGA 4LV4A 3IJIA 3IJLA 1ZU8A 3K4WA 2PWGA 2Q01A 3KP0A 2V30A 1OFDA 1TPC1 1KTBA 1E6XM 1JAKA 3S9IA 3TCSA 1K4GA 4EANA 4O0QA 3H2AA 3UG8A 5E0CA 1FWTA 3PJXA 4PMYA 2PB1A 1LG2A 1QBBA 4PTMA 2Y5SA 2P5NA 2ZKMX 2ZUUA 2BDQA 3QGKC 1ML1A 3ZR6A 2GYIA 1V51A 3G1YA 2WO5A 3KS5A 1YDOA 1VCVA 5E9AA 3RHGA 3K4DA 1V3MA 1J79A 3W3OA 3TN6A 2C16A 3LV6A 1KBJA 3KBNA 4YVVA 4KFPA 1AH3A 4AG0A 4IIDA 3OPSA 2E67A 5A5WA 3S1XA 4LH8A 5CEWA 4QEHA 3CUHA 4RCXA 3LBCA 4UFIA 1DXFA 3RMEA 1CXHA 3WK3A 2FQIA 2DUXA 3K8LA 4O57A 3BQ5A 3QHNA 1TPFA 2A2IA 1JD9A 2PU1A 3UD6A 4O1EA 5AY7A 2CESA 1A80A 1JEZA 1TTJA 3A12A 3LGEA 2QDGA 5TIMA 4UR7A 3W7GA 1VRXA 4JR5A 3KP1A 3MA8A 2RFGA 1T8XA 3QRHA 3MC5A 2DZPA 3S3GA 2BHYA 4PMRA 3AWOA 4DJFC 3T4WA 1YNQA 3KDOA 1KNWA 2F7FA 3G1VA 1FWBC 5IFTA 2JKPA 2LLEA 5HMEA 4HPJA 1ME7A 2ZVRA 3BICA 4JTUA 5CZJA 4INFA 5AYBA 1KFKA 1B3OA 1N2VA 4JIPA 3S83A 3VGDA 1Z89A 3VK5A 3OG3A 2C6QA 3P0XA 5A6LA 4GNKB 5DX7A 3DFPA 3BG9A 2D20A 4JYFA 5A8PA 3NQ6A 3VIMA 3NL5A 4MYAA 3OQ8A 1W9VA 1VJSA 3CLWA 3P7YA 4S3DA 2V9DA 4J2MA 2FMNA 2PGFA 2CHNA 1QPRA 1WZKA 4CVWA 3WUFA 3FVMA 3T08A 1U2YA 3KOFA 3FHQA 2ZXDA 1JYWA 1GKRA 1JZ7A 4ERIA 1Q65A 3WDQA 3YPIA 3ENLA 4IIBA 4KT2A 2P8CA 1J6PA 1C8XA 1O60A 4LRSA 1DL3A 4D6IA 1F3XA 3CV1A 1TV5A 3UT0A 1G69A 3VNZA 4M29A 4C6IA 3FYYA 4QISA 4UOJA 1X38A 5HNNA 4PUKA 5CZKA 5C5YA 3QTGA 3WMCA 4H8UA 3QXBA 3BSHA 2J7FA 1E9LA 1W3JA 1W3HA 5KETA 4S3FA 3TFCA 3L66A 1QFEA 3DOPA 3W38A 2PBGA 1Z44A 5C71A 3MZNA 3QQ0A 5ABEA 3B4UA 4FXSA 2TRSA 3DN5A 4KRZA 3RX4A 4LNCA 3GBEA 4HYRA 2TAAA 3PJTA 4GY7A 4S3GA 4DJEA 2VGGA 4H8NA 3U7BA 4L1GA 1L0PA 3BW3A 4DXXA 4ZQOA 2Y6ZA 3CB3A 1E5NA 3ITCA 4WDUA 1VLIA 3TYDA 3T0TA 2FFCA 4N6FA 3P8IA 4ZOEA 4GXMA 1SZEA 4GG9A 1Q6LA 3J7HA 1YDVA 1C8YA 3C0LA 4FNUA 3R2GA 3LXBA 5GJNA 3AZRA 3P82A 1TJ2A 1XSKA 1TVLA 1CIUA 2BSLA 3HZ3A 2DFAA 4H7ZA 4DWSD 2E4TA 3EDKA 4UBPC 2I17A 4D8AA 4CUCA 2CBIA 3VDAA 1UD6A 3I68A 4DZIA 7REQB 4DZHA 2PDIA 5AC8A 3GFZA 1ISXA 2DP3A 3Q4DA 1JCLA 3KOXA 2G96A 4XQ6A 1RH9A 3WG6A 3IUDA 3HB9A 5E5CA 3PZIA 4EACA 1CECA 5JIPA 4ZBCA 4FX7A 1XYAA 1XQKA 3BH4A 3H7VA 4X61A 1OWQA 3M64A 4L9ZA 4D72A 3ONBA 1SFTA 3F7JA 2QPSA 1GVYA 4RR4A 5U4NA 1OBAA 4OBSA 4BWLC 3W07A 2DVXA 4XAGA 1JULA 1XDJA 2QNEA 1PTDA 2IXVA 4B3ZA 3PZ9A 4JTLA 2O9TA 2CXGA 2X30A 1TZ9A 1K6WA 2E7FA 2D23A 3I65A 3PZTA 3II1A 5E6YA 2WSPA 3PUGA 3RCMA 5AC4A 1JPMA 3KTCA 2B81A 3G0SA 4DBUA 1GHRA 4FHAA 4Q7BA 3CU2A 3DFSA 2IQ0A 1FWCC 2UWFA 4AC7C 4JNYA 2R94A 1SZRA 5HK4A 3DG3A 1EOMA 1B90A 4W8LA 2OXNA 2C1GA 5I3DA 2IKHA 2GDQA 1TV2A 2RJHA 4U4MA 1JCMP 4UTLA 4S38A 2XFRA 4E3VA 2YCEA 1GOQA 1TZ7A 3CUFA 1IT8A 4NZ1A 2ISVA 5LHEA 5I09A 1W1ZA 5E93A 1EX1A 2PC8A 4JFSA 3VD3A 2WQDA 4TQTA 1P1MA 2CERA 2I9EA 1EJVC 1TX0A 5JXQA 2JE8A 1MUWA 3ICJA 5ABFB 3MW7A 1VENA 3RMJA 5BXRA 1NU5A 7TAAA 3ARPA 2VFIA 1F05A 2TODA 1VR6A 3ME3A 4EF8A 3K2GA 1EX5A 3LK6A 1OIFA 3QJAA 4HMDA 3LENA 4BHYA 4DELA 3WH6A 2VURA 3A4WA 2E6FA 1LT7A 4IH3A 2NQ5A 4YMZA 4MM1A 5BNKA 3FCPA 3W86A 1J93A 3UJRA 1ECEA 3NYDA 4JXCA 1BXNA 2OOGA 4CN4A 3CO4A 4MY1A 1ME9A 1LL6A 1P7TB 4HNLA 4PUWA 2BGSA 3B0PA 4PUUA 4WKAA 3OBEA 1NVMA 8CGTA 5FIPA 2ZTJA 3LXAA 3FVDA 1B30A 2FZMA 3KLLA 2JIEA 4AZCB 4RNJA 1JVNA 2WCAA 1ZFJA 1G0CA 2QVHA 1HKKA 4M0XA 3WLSA 2R6OA 2R8WA 3R7MA 4DJDC 5FF0A 2GGEA 4LXFA 4LAMA 1LLOA 4RE4A 2R1MA 1DJQA 1O1ZA 3ES8A 5M5DA 2ZZ1A 1E56A 2ZRVA 1UOZA 3PB0A 4MZYA 4LVFA 5KSWA 4ECLA 3N9SA 1SUXA 3H21A 1D7FA 2X1SA 1LL4A 3SBFA 4AZ7A 2WSYA 4FS9A 5EFDA 4FOJA 2OQLA 3EX3A 1TTPA 1EC7A 3AALA 3TNOA 3A6OA 4IWWA 5A6KA 2J7BA 5I2UA 3EKGA 2DPEA 1TVNA 3NEHA 2V5DA 4F0KA 1UASA 2VC6A 5GNZA 2YSWA 4LT9A 3M7WA 4UMCA 1N82A 3IIXA 4U3AA 3CHCA 3QPYA 3UWQA 4ACYA 1GVSA 1XC4A 5BRQA 1W17A 2HRWA 1CTNA 3SRKA 2PF8A 2RDUA 3LBOA 1JNDA 4AIEA 3ARXA 4GINA 4IPNB 3VIPA 2EKGA 1MXDA 3DFNA 3EDFA 4GC3A 3S1WA 3H12A 4R85A 4E0CA 2YPIA 4POCA 3LHWA 1R0MA 4W4QA 2DT2A 3IIPA 4K8EA 2QJGA 2YL9A 1HJWA 1CLVA 1FWHC 3CAVA 5EA9A 3R8HA 3WD1A 4XIMA 5KITA 5EKYA 1FWSA 3ZS4A 3ZOAA 3R0DA 2OWWA 3UPWA 3RM8A 3SGZA 1LRNA 2I5QA 1JUBA 1KRMA 2GJLA 1ISWA 5KMYA 2ZZ4A 3VGFA 2QXWA 1YDYA 2NWSA 2VC7A 3GY1A 4L6HA 3OGSA 3OYZA 3BLDA 1REQB 3IGSA 4Z1CA 2J8GA 5BRBA 1XCFA 4PSRA 1KXHA 3GDTA 4AHPA 3KBMA 2XSBA 2KZHA 3LPPA 3SIZA 1PKLA 2E8ZA 3OLIA 1SJCA 1CNVA 3QHMA 3CHDA 4DJFA 3RM4A 3CIXA 1BF2A 1O6IA 1XFCA 2Y7FA 1XRFA 1EWEA 3GAKA 3TTEA 2AAMA 1P0BA 1JF6A 3AICA 3BG5A 5E70A 4HPGA 1OYBA 3BCJA 1FKXA 4RDWA 5L6UA 4F2UA 1I0DA 3GNPA 2YZRA 1PKNA 2R1PA 4YJ5A 4AWSA 1YXYA 4Q6JA 2UY4A 4TV6A 3EOLA 3TNBA 3OLEA 1K77A 4H4IA 2H8XA 3MVIA 4MWAC 2QCMA 1KRCC 1K9TA 1XLGA 2Q8XA 1THFD 2XZ9A 4MWAA 2RKXA 3IVUA 4AD4A 4O4WA 4A3YA 4QXIA 3MSGA 2ZDRA 3WH8A 1DWHM 3M0YA 4HNUA 5EU9A 1GYNA 1FKWA 3VYLA 3SZ8A 2X0HA 2YBVA 2WOQA 3SCOA 5CSUA 4ZFCA 4DWSC 3D47A 3VILA 1JCJA 3BLFA 3AXHA 4PFMA 3L68A 3LHTA 2GQ3A 3B06A 3ITOA 2O9PA 4NXKA 1H51A 3AIBA 3M4HA 3EMZA 4PRRA 4ML4A 4A22A 4LV9A 1XRSA 1LWJA 2XN2A 1DVJA 3GO2A 3L0GA 4Z2JA 3LRLA 1LWIA 1KW1A 3QBUA 1C92A 4D6DA 1W3TA 3CB8A 2PLCA 2D69A 3RRAA 3JRKA 3F4WA 1C29A 1Q85A 2Z7GA 2VVNA 1OQFA 4JTSA 3MY9A 2FZDA 1ZTVA 4AWUA 1Z7AA 3UPMA 1C8QA 3H24A 4YHEA 4X22A 4R5EA 3BAXA 1H49A 4J3WA 4NXSA 3UWEA 4NKCA 3LSBA 4XO6A 3TJXA 1ONEA 4F8XA 4JN8A 2WNZA 1E0XA 1TQJA 4ATLA 1Z9AA 4J40A 3S4TA 3SFKA 1P6WA 1NOWA 2HZGA 3G0UA 3N2BA 4FNQA 2CXEA 4DO6A 3D46A 1H63A 3IPWA 1ZJBA 4IJBA 5A6JA 2NUWA 4HK7A 2CLFA 2PGEA 4I9TA 1VP5A 2C1IA 2ZX8A 4DHGA 4BQ3A 1CX9A 4PRWA 3G6MA 5I7GA 1WKEA 4PTDA 2A79A 3U8GA 2D0FA 2WSRA 3UG3A 3R58A 4LAZA 3B97A 1QI4A 1V0KA 3QOKA 1ADDA 1X39A 2CLLA 3ECQA 5KZEA 3UWUA 2VDIA 3KCLA 3O15A 2J7HA 1VEMA 1ZJHA 3H2FA 1N55A 4JQAA 3TA6A 3ABXA 1Q45A 2EGZA 4JFTA 1SM9A 1RUSA 4FLSA 2ESCA 3DX5A 5C70A 4O8RA 2QDHA 4JTCA 2J78A 3QQWA 4F0HA 1UR2A 1H1NA 1P0NA 4XD6A 1W1VA 3C86A 4U3CA 3PBMA 3S6TA 4R3UA 2B31A 4YL2A 1ESWA 4MNKA 2WHJA 3M6DA 1A3HA 3A4AA 4IP4A 3E38A 1ZENA 5EBUA 1TPDA 3TUUA 1H3GA 2WNQA 3UYIA 3WNKA 4IHCA 3PM6A 2UY5A 2J7DA 3GTXA 3RJXA 3RAOA 1CGUA 3TP4A 3LBMA 3SEPA 4ZGYA 1K4HA 4NYUA 4IFKB 2ZXQA 2X05A 4JTIA 3RF9A 1UYQA 4YU1A 3VNLA 1XLAA 4W85A 4HSNA 4CGTA 3H23A 3JZUA 3A9IA 4O14A 4PCSA 1ALDA 3U2EA 5I5RA 1QHOA 3GG7A 3SJ3A 3I3EA 4HZMA 2BMBA 4E4UA 3FV9A 3POCA 4BY3A 1VBJA 5CBIA 2WJDA 2P3ZA 3EKLA 5FI8A 1S2UA 1J4EA 3E2QA 4FO4A 4A3UA 3T6CA 1A47A 3QMRA 1E6ZA 3CT2A 2FDSA 4AZIA 3T8QA 5F1UA 4DM2A 3LCHA 3SCTA 4AD2A 1NEYA 2CLIA 4DY1A 4CNTA 4W5UA 3HTWA 1DXIA 4DBEA 1DE6A 4OJYA 4HA3A 1OYAA 4FXRA 2WAGA 3QOMA 3GFYA 1SR9A 4JD4A 4QS5A 5I78A 4URIA 2C8NA 1C7TA 4L56A 3G1SA 2VHLA 4DZ5A 1L2QA 2WZMA 4A29A 1BEUA 4I9MA 3W28A 3N9RA 1TRIA 3AYTA 1AQHA 5J5DA 3PUEA 4ZQPA 3MSRA 2Y7DA 3WFAA 1US3A 3WQDA 4PTVA 2GK1B 1A4MA 2WVVA 3C2EA 1WX0A 1ZAIA 5BXSA 3M7SA 2NV1A 1PYFA 5G4WA 3M44A 4I8YA 1DPMA 1D8WA 3NL6A 4ZXOA 5FESA 2Z0IA 1JYNA 3SN4A 5HMSA 5HJLA 5HAOA 5BRPA 4AH7A 1GKQA 1H0GA 5FACA 3PZNA 2WQPA 4RUBA 4BEUA 4AIBA 4DBDA 4FLRA 3GKFA 4R33A 1XCXA 2IPWA 4XZWA 3SURA 1WB0A 3HF3A 4C1LA 3NZGA 3IANA 3R4IA 3CV7A 1KQZA 3VD4A 2DEPA 4GQGA 3T0CA 1TA3A 1UZHA 2Q02A 1XLKA 4HTBA 3CQJA 2OT0A 3OODA 1PCKA 2PLKA 3UZ5A 3NA8A 4M19A 5K9XA 3GXIA 3CGTA