5AHIA

Crystal structure of salmonalla enterica hisa mutant d7n with profar
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
244
structure length
232
Chain Sequence
b'MIIPALNLIDGTVVRLRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIGSTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGWQENSGVSLEQLVETYLPVGLKHVLCTDIRDGAGSVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQCWQN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-(5-PHOSPHORIBOSYL)-5-[(5-PHOSPHORIBOSYLAMINO) METHYLIDENE
publication title Structure and Mechanism of Hisa from Salmonella Enterica
rcsb
source organism Salmonella enterica
molecule tags Isomerase
total genus 74
structure length 232
sequence length 244
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5ahiA00
3L5MA 1DKWA 1B57A 4DPPA 3USBA 3KRSA 4IMDA 3P5YA 2VKZG 1AW2A 2A7RA 1P0NA 4AWTA 1JCYA 2E6DA 3NA8A 2G95A 3O6CA 4O14A 5AYZA 2NLIA 3GDTA 3P81A 4O0ZA 1O5XA 2UV8G 1MZHA 2QDHA 1W5MA 3W7JA 5DCDA 2WOQA 3S5YA 2YR1A 4M7TA 3QQ0A 4M7SA 1SR9A 3NG3A 2ATMA 1OFQA 5C55A 1VZWA 3ZS4A 1PHWA 3LCFA 2ZFAA 1OABA 2VOMA 3LOTA 3GDRA 1TSIA 3HPSA 2RKXA 1PCWA 4QAIA 3FKKA 1EUNA 1XDMA 3BW3A 3INPA 4UTKA 2QCCA 3ANYA 2YZRA 3G18A 4UTWC 3R2GA 1PHQA 2I1OA 4HNVA 2A0NA 2QUTA 4MY1A 3NOEA 3KVMA 1TPC1 2I14A 5AN7A 3PWAA 3IGXA 3OA3A 4N9DA 5CZJA 1QWGA 4TX9A 1GYLA 2F7FA 4JTSA 3B04A 4NJJA 5LGZA 4ADTA 3S1WA 3C2EA 3NL3A 3FLUA 3M5YA 3NO5A 3SGUA 4CNPA 1DHPA 4UFMA 2YSWA 3RLUA 3V75A 3P60A 3QRHA 2A7PA 5TIMA 1MSSA 2V8ZA 3CM4A 4Q4KA 4ZQPA 4Q32A 1F6KA 1F74A 2VXNA 4QM1A 5HNRA 3W1NA 5FEWA 4UCGA 3CIWA 3FJLA 1DORA 2OCZA 1G7VA 4XQ6A 5D33A 1F7BA 4IXXA 3GYEA 3HPXA 3YPIA 4QITA 5C5YA 3W7DA 4BI7A 3W1MA 5D05A 4HSOA 3FFSA 2KZHA 5D30A 4IPIA 3PC0A 4DPQA 1K03A 3HO8A 2B7QA 4H4IA 3W85A 1MXSA 2VEKA 4K8HA 2P1FA 1FWNA 1W5PA 1X7FA 4FO4A 1J4EA 4UTTC 1QPRA 3G0XA 4NX0A 4PC8A 4GNJA 4RZ6A 1GVSA 4TU1A 4JDYA 4TR9A 2H8ZA 3PBWA 1H7WA 3OG3A 3STEA 2P0OA 2Y6ZA 1KM1A 1GOXA 4PH6A 2NX1A 4UFHA 4FX7A 3P80A 5AHNA 3HGJA 3PSWA 5AYXA 3NPXA 2WPBA 3G0SA 3SECA 1KLYA 2R8WA 1FQ0A 1JVNA 3TW6A 1M7OA 5AC6A 3GZ3A 4FNTA 4CQ9A 4CLMA 4O16A 5HUPA 1QCWA 1LZOA 1KBJA 3DBPA 1RQHA 1SPQA 2A21A 4NZFA 1LBMA 3OHIA 2NX9A 2WSQA 3MBDA 3WJZA 2D73A 2ZCGA 4JX6A 1KW1A 3QC3A 5EPDA 5DBTA 3HJZA 1LYXA 4AXKA 3FOKA 1FX6A 1TV8A 5K2ZA 3UNDA 3W76A 4DBEA 3UZJA 1H7RA 4A2SA 1A53A 3B06A 1OFDA 3W73A 2YFOA 3GK0A 4I7UA 1LBLA 4M19A 4L4MA 4FB7A 3W84A 2QJHA 2LLEA 5EA9A 5AHFA 2C15A 3B4UA 2J6XA 1DJQA 2ZZ7A 4RK8A 4I7WA 3UWWA 1WAUA 2X16A 4AWSA 4UTUA 4O15A 3ABQA 3EKZA 3THAA 3AO0A 3EX4A 3O05A 5F2IA 1LP6A 4KWVA 4IOTA 3KVKA 2PRHA 2GQ8A 4NXSA 3QZEA 3PULA 4NU7A 3W83A 1CX9A 4LU0A 3SZ8A 3W9ZA 3LCIA 1YPFA 3U6WA 4KKXA 3BLEA 4X22A 4QIUA 3W74A 1ADOA 3IEBA 2Y62A 1VH7A 4BK9A 4HNUA 1OHLA 3I7QA 1AW5A 1KTCA 2QJGA 3TUUA 4IGHA 5LZLA 3R89A 1NEYA 4D2JA 2Y7EA 1MO0A 4RX0A 3Q58A 3MHUA 4RKAA 1HO1A 3I68A 5EL1A 4MYAA 3P8JA 1VQTA 1H50A 3G1HA 2ZYFA 1XI3A 3C3NA 1TB3A 4Y90A 1XUUA 1LRNA 3MBFA 2E5CA 2CZFA 4O57A 2A85A 4FEZA 1KFLA 1W5QA 4HSNA 3UWZA 2Y7DA 1OJXA 1KV5A 3CT7A 4LT9A 1ZALA 3C52A 2XN0A 3M7WA 1K7EA 2RDWA 3KAOA 4HT3A 1ZJIA 1XL9A 2CLHA 2E77A 4OBTA 2FFCA 1YTDA 1PVNA 1VYPX 2TRSA 4QSHA 2J9XA 5BMWA 4U28A 1UJPA 3HMJG 1S5VA 2PRLA 1K8XA 3KFTA 3C6CA 4JICA 4FIQA 3T78A 3DFSA 2X1SA 3NZ1A 4KFPA 4J9JA 5BRBA 5D32A 5AC8A 2ISVA 3I6RA 4YLWA 1G6CA 4JY8A 3E02A 1M5WA 5I3JA 5LSMA 2QAFA 3F4WA 3W22A 4P61A 3DFTA 3LTPA 3TAOA 1YXYA 3LCWA 3C56A 5LHEA 3LCGA 2ATSA 2NZLA 1ME7A 3O6DA 2YDAA 1LBFA 3QJAA 1JRCA 3MJYA 1W5OA 3BW2A 2ZZ1A 3JR2A 3NNTA 3UXDA 4LUJA 3KXQA 3VI2A 3TDFA 4GUHA 2B7NA 3DHFA 2QCDB 4GUIA 3H54A 5FESA 3PAJA 1MEIA 1PIIA 3EX2A 4LOCA 5LNSA 4A22A 1BWLA 4AH7A 5HWJA 1HL2A 3EWBX 3LXCA 4RV8A 3UWYA 1TTQA 1KFEA 3NQ8A 3TAKA 3T55A 3P67A 1IIGA 3BLFA 3CB8A 3HG3A 2TPSA 3W1LA 1GTHA 1JCLA 3H53A 1OX4A 2CLFA 3FKRA 4LVAA 3C0JA 4GWEA 1JUBA 1ZENA 3TJXA 4JTGA 1QFEA 4O4VA 5I3HA 3F1QA 3TU9A 1ICSA 2ZDRA 2F84A 3W70A 3I7RA 2DJXA 5LNUA 2ZTKA 4LY8A 3NPWA 5LGXA 1M7PA 1DOSA 3HG2A 1UBSA 1M6JA 2V81A 3EXSA 3IRDA 2CFFA 2PCQA 3SIZA 3HF3A 3L0NA 3MUXA 2JBMA 3E0IA 2QDGA 3M44A 3GAKA 1W8SA 4CQ8A 5D37A 3QSRA 4FNSA 3NAVA 2ZTJA 3EX6A 1GPWA 3EWYA 4JTFA 5FI8A 4O28A 1AW1A 3NQ7A 3HGSA 2A7NA 5BMXA 1JQXA 2J88A 1GQNA 1H63A 5D09A 3W7RA 4IXHA 2BTMA 4RLIA 3W7QA 1FWRA 3NR0A 4UTTA 1UB3A 1FWTA 4S1FA 5CGQA 1H1ZA 3ABRA 4JYDA 3WJYA 2QUVA 3M43A 2XN1A 1N8FA 3PB0A 3MI6A 4BR1A 1U83A 4WZHA 2DZXA 5CZSA 5H2ZA 5F4XA 3W7PA 2GOUA 3N14A 4M6QA 2A6LA 3NQDA 1LCOA 1LROA 3GB6A 5D2VA 1GG0A 3DFNA 4Z08A 3SSJA 1PL9A 1HFBA 4ZQCA 3GX9A 5F1VA 2ZA2A 4LRSA 3L66A 3T7VA 4PA8A 4MFEA 3M16A 5DCBA 4NJHA 1AL7A 2C14A 4AWUA 2ZBTA 1JUEA 1TPDA 1IIHA 3QEZA 3C2VA 4XZ9A 5K9CA 2J24A 4FF7A 1L9WA 3AJXA 5F1UA 1SO6A 2WV8A 5HJLA 3LTSA 3TW7A 1IXOA 5EBUA 4QNWA 2OJPA 3TMQA 2JKAA 2PRMA 2YXGA 1KM0A 2J27A 1EPXA 1K3UA 3S1XA 1SW3A 4JY9A 4EOUA 1R47A 3PBVA 1NVMA 1NFBA 2Q3OA 3PUOA 2JKPA 1VC4A 1F2JA 2TMDA 3NQ6A 2Y61A 5AHEA 3D0CA 4A3UA 4N9BA 1PS9A 1ZFJA 1K02A 1H7NA 1VJIA 5DXXA 3W7CA 4DEFA 4Z0SA 5G5IA 4O53A 1IXNA 1KBIA 3LERA 3QW3A 3IIPA 3GLCA 4GUJA 4DBDA 1WX0A 3HQ1A 7TIMA 2VC6A 4NQ1A 3P84A 5U7SA 4W9TA 5K4ZA 3TFCA 1F6PA 1OF8A 4FXSA 2NUXA 4BWLC 1QAPA 1IXQA 1VLIA 3TFXA 4AB4A 2GVJA 1R46A 1YTKA 4ZQMA 2A1YA 3GIYA 1C29A 2Q3RA 1ML1A 3QM3A 1ONRA 1SSGA 3KHJA 1OF6A 3TK7A 5TQLA 3KRUA 3EX1A 4UFJA 5FEPA 1VYRA 2B4GA 2OT0A 4O52A 1SFLA 1JQVA 1KLZA 3L9CA 4UTMA 3QMRA 4R53A 2V30A 1TTJA 2DORA 2Y88A 3EWUA 3EXRA 3H55A 5BOOA 1B3OA 1O4UA 2QAPA 1FCBA 3S5OA 2YX0A 3P82A 3PSVA 1OK6A 2HSAA 2G5WA 4LS2A 1A5BA 1WDWA 2Y7GA 3L0KA 1TPB1 3IIZA 3ATYA 3DFOA 4MY8A 4PODA 1R2RA 2QCEA 3HPZA 5G1YA 3BARA 4LTSA 3N9SA 2FPYA 2QR6A 4CNNA 1LOSA 2A5HA 1F76A 1Z42A 3G8EA 4GUFA 1ZCOA 4JR5A 4JYEA 1I8JA 3W1RA 5GVJA 3S6DA 3TSDA 1Z44A 4JTIA 1KM3A 4A2RA 3B0VC 3O15A 1VGAA 1I2PA 4WY0B 4UXDA 2TYSA 4WY0F 1XKYA 5G2WA 1DL3A 1W3TA 1G4SA 1JCNA 1EX5A 2CWNA 1SU5A 5L9FA 3BG9A 2VFEA 1TQJA 3G3DA 4O8RA 3QPYA 1TO3A 4OQVA 3NL6A 4FXRA 5TBOA 4UTJA 1IXPA 4JDBA 1D9EA 1GVOA 1VPXA 1GWJA 3P8IA 1YDOA 2GPTA 3CPRA 1ME9A 4ICNA 3W7HA 3NL2A 4LS0A 1EP1A 4R7JA 3BGJA 4YXGA 3DFPA 3LCLA 3DI0A 2ISSA 3EWWA 3RF9A 1KM4A 4DXVA 1GZGA 1RQEA 2E6YA 3HBLA 1W31A 3LV6A 1VR6A 3M41A 5DXYA 3FIGA 4CQAA 4S2BA 4X9SA 4MZ8A 1VLWA 3STCA 2ZZ5A 1XXXA 4DELA 1KM2A 1C9DA 4HKPA 3WJWA 4ZQOA 5MHBA 3L67A 4WJEA 1O5KA 1MEHA 1PCKA 3O16A 4Q33A 5HR6A 2FPTA 3SR7A 3LLDA 2TSYA 4CCDA 2C16A 4UTHA 2C19A 5HR7A 1WBHA 3BG5A 1DBTA 3MW7A 3A24A 1KFKA 3L21A 4OT7A 2QEZA 1X1ZA 4FNPA 3ZFHA 1Q6LA 2VEMA 3GNNA 2G97A 2CLKA 2DZVA 4O10A 4M5PA 2E5BA 3TROA 2V2HA 1SSDA 1YPIA 1VYSX 2ABBA 2QCNA 1UASA 2EKCA 1ZAHA 2Y89A 5EYWA 1QMLA 4AHQA 3QF0A 3VNDA 1YYAA 4WOQA 4NUWA 4OV4A 5CG7A 4O1CA 4N4QA 2YPIA 4GFSA 3G22A 2C18A 5D03A 4GXMA 1HG3A 1Z48A 1YDVA 4A21A 3CIXA 3DU0A 3TXVA 3TC7A 3PUEA 1N55A 4UR8A 1OYAA 3GVGA 2PC4A 3PF3A 3CLMA 3VCRA 2ZRVA 4O1BA 4JGDA 2QJIA 1HO4A 1LORA 4MLJA 3NM3A 1NSJA 1RZMA 2FIQA 1F5ZA 3S8HA 4EIVA 3GXPA 3NPVA 4O1AA 3PBYA 4FX8A 3N34A 3S5ZA 3W3OA 3W2NA 4GUGA 3W1XA 2VEPA 2GJLA 4LVDA 3EKLA 2EPHA 3W1AA 3TQ0A 2FQIA 4EWND 2WNZA 1H7PA 1X1OA 3BW4A 4XKYA 5CPLA 2EGZA 1A5SA 3VFLA 3W6YA 4IX2A 3BLIA 4UMAA 3DAQA 1RR2A 1YDNA 3LHZA 4O18A 2OT1A 3U2OA 3CHVA 1OG0A 4JN6A 1TMHA 1W5NA 1XBYA 2R14A 3CU2A 5KITA 5K7JA 4YCOA 1WYIA 5D2YA 1ZAIA 3L65A 5CZ0A 2E1DA 1LTDA 1TREA 1F73A 1IF2A 3M6YA 2ZRZA 4UC5A 3W7IA 1I45A 4AF0A 1DJNA 2A4AA 3LHUA 2GJNA 3TX9A 3I7SA 4JTTA 4FX6M 3W2MA 1FUYA 3C8FA 2CLOA 3S0CA 4TIMA 4MZ1A 3M9YA 3DKJA 3LRMA 3QMTA 4YCPA 1WA3A 5L6UA 2QUUA 3I65A 3W7GA 2BLEA 1Q6QA 3FJ6A 3MMTA 1NF0A 4WXZA 5LNVA 4BWLA 4JNMA 4QISA 3WFAA 1WOAA 4O13A 3WK3A 3G24A 2E5DA 3E12A 3LRLA 2GQAA 3DZ1A 5CKSA 3W2JA 3NVTA 3NXFA 1LRQA 4Z0JA 3TC6A 4K7YA 4K7VA 1W3IA 3NM1A 1TRIA 2WSRA 3UWQA 3GXNA 3LHVA 4K38A 2J9ZA 5E1QA 4O12A 1H62A 4LV4A 3E9AA 3ZR4A 4IX0A 1H5YA 4E0CA 1W54A 3W75A 1BKSA 1D3GA 3L68A 3E49A 4K36A 3QPZA 2DZPA 3BPWA 3W1PA 2BX7A 1OFEA 1H60A 4GE8A 3LTYA 3TMLA 3ELFA 1SO4A 4XWUA 1QPNA 1G4TA 1TPVA 2GQ9A 2NXGA 4DO5A 3MHFA 3PG8A 3PG9A 3DENA 5AOUA 1OK4A 2NV1A 4DF2A 2RH9A 1GEQA 4FHAA 1FDYA 4NJIA 5HULA 3P62A 1S5WA 5E0KA 1LM1A 2GUUA 2WNNA 1OX5A 5I3IA 1OX6A 1WBJA 4FNQA 3Q2DA 4LV9A 4UTWA 3A21A 4MJZA 3FA5A 4K37A 4N02A 4JTKA 3R13A 4OWGA 1WQ5A 3GAYA 1GG1A 4BFAA 5AC7A 4Y96A 3HGRA 1U5JA 2ZA3A 3A9IA 5DLCA 3HG4A 4IWWA 4TMBA 2NUWA 4CNOA 2B0MA 5EKYA 2FTPA 1TV7A 3LHTA 5HMSA 2YYUA 3LV5A 4JIQA 3EWZA 3F03K 5LHFA 1H51A 1R2SA 4NJGA 4ZQRA 2DU2A 3SJ3A 3WK1A 4LWWA 1RD5A 3L2IA 3CEPA 5G1TA 4JTJA 1OFRA 1XFBA 3QH2A 4LC8A 3L0GA 5HUOA 3VE7A 1IGSA 5IBXC 4ZVJA 4UFLA 3NL5A 1SZGA 4O0KA 3QYQA 1FXPA 3M47A 2H3DA 1CI1A 3W2LA 4NNCA 2JGYA 3HG5A 4E2BA 2ZQ0A 2BZNA 2V2CA 2ZRXA 3IIVA 4DF0A 6TIMA 3NQCA 1QOPA 4DQWA 4X2RA 3W07A 2E6FA 3MI2A 4OU1A 1O95A 4KWWA 5AB3A 5CSRA 1SO5A 3PR2A 3GR7A 3UPWA 1VRDA 2B7OA 1ZAJA 2DZTA 1PE1A 1I2OA 4UMBA 1BWKA 4UIOA 1L6SA 5I3FA 3QW4B 3M5ZA 4JD4A 1OVDA 3Q37A 5DCEA 3NEVA 2VENA 4N6FA 2V0TA 4I9AA 4N9EA 4XTIA 3DXIA 4OE7A 4RR4A 3WK0A 4UNLA 1JULA 1T0OA 4RJEA 4C1KA 1Y0EA 3W86A 4PL1A 3B0UX 2ABAA 1QO5A 1QR7A 4R34A 5HWNA 1HUVA 4HPXA 1F05A 2QF7A 5KMYA 4KFOA 2YW3A 1EB3A 3M5VA 2A6NA 1VCVA 3IV3A 1VCGA 5EMUA 2Q8ZA 2WJZA 4JTLA 2FJKA 4IPJA 1KTNA 3GXTA 1TJRA 1TPFA 1TTIA 5DN1A 4ADUA 3N2XA 3S1UA 2AAMA 3TQVA 1FXQA 3IVTA 2Z0IA 4UTIA 3TXZA 4HNTA 3NYZA 4Z1BA 3W7OA 1GVFA 1JCJA 1THFD 5K9XA 1H1YA 4UTLA 1W37A 3A5VA 1UUMA 2V5LA 1XDLA 4P2VA 4NXKA 3TR2A 2CZ5A 4DO6A 1JCXA 2NWRA 3UWUA 4ORMA 1V5XA 3G1VA 3IIOA 1TPUA 1C8VA 4HNNA 2CLMA 3LHYA 4YMZA 3DKLA 1XBXA 4IJBA 1H7XA 5LNWA 3MP3A 4YL2A 4HIBA 4U4MA 2ZZ2A 3KRZA 4JEQA 1O60A 1SFJA 1XUZA 4Y8FA 3O1NA 4JIPA 5DBUA 5J5DA 3PM6A 4ZL1A 5ABTA 3OEXA 1Q6OA 2Z2UA 5AHIA 5F2GA 2OX1A 1G4EA 1X8FA 3QMSA 5AFDA 1TRDA 1P5BA 2XN2A 2EHHA 4MFDA 2I9EA 4ZQNA 3NDOA 1GJPA 3U8GA 2DZUA 1H7OA 4QQ3A 4NNBA 2ZZ6A 3TE9A 1XBVA 2VFIA 1FY6A 2VFGA 4O11A 1E51A 3LCXA 2DZSA 3LBCA 3O07A 4LVBA 4ADSA 1KTBA 1QPQA 1XM3A 3W2KA 3HOJA 1GTEA 2YW4A 1R30A 3FYOA 1VHCA 4AAJA 4ALDA 4LVFA 1QNVA 2HS6A 3VKJA 1DQWA 1BTMA 2R94A 2Z6JA 3BK0A 4IMEA 5BNKA 4IUOA 1K8ZA 4IMFA 1W56A 3QFEA 1TJPA 5D02A 1MEWA 4QJ1A 1EWDA 4JYFA 2PURA 4CCCA 4Y9AA 3Q94A 5FF3A 3ABOA 4WX2A 3EX3A 2JGQA 1G67A 3GDKA 2V82A 2QCGA 2Y70A 1NF7A 4ML9A 1LOQA 1T99A 2EAWA 4RXFA 2AGKA 2Y63A 5KINA 4ORIA 4PTNA 4WXYA 1OX4B 1I2NA 2ZZ4A 4H6KA 1VHNA 4CCEA 3BG3A 1S5TA 3DGRA 3LBMA 3MP5A 5D38A 5F2LA 3C61A 3LCHA 3ABSA 3QSTA 1KM6A 4BI5A 4IQLA 1FCUA 4UFKA 4WOZA 1EWEA 1FWWA 4ZMGA 3S1VA 1I2QA 5KZDA 3CQ0A 1DV7A 1SO3A 3EEGA 4FNUA 3NQEA 3GR8A 6ALDA 2CLIA 4H3DA 2DZWA 4OHQA 1ICPA 1ME8A 1LLZA 2ZRWA 3W1UA 3CWNA 5G4WA 2NUYA 3SGZA 4UUIA 4MVAA 5KTLA 1RVGA 3W1QA 3HIJA 1AG1O 3DFQA 2H90A 1I4NA 5A5WA 1JJKA 1A50A 1T96A 1OYBA 4ONVA 3G8RA 1WOBA 5K9DA 1B4KA 2QCDA 3PY2A 3G1SA 3FS2A 2QCFA 2B7PA 2E09A 5J5RA 3LRKA 5I3GA 4XTDA 3RK8A 4S2CA 5G4EA 1FWSA 3M0ZA 3W23A 1KA9F 1CW2A 2JKEA 5KZMA 2NXIA 5A8GA 1XBZA 3KVJA 1TPWA 1SZNA 2ZRUA 4RZ5A 1TPH1 3LI0A 5IBXA 2QCHA 3VE9A 2CZEA 3B0PA 3N2MA 5AYYA 2YCEA 4EF8A 4LVGA 3W87A 5D2XA 1SW7A 1TPEA 3S42A 1YXDA 3PVFA 4NX5A 3W1TA 2XFWA 4PEKA 1O94A 4MOZA 5F2MA 1ALDA 1EUAA 4O54A 4MYXA 5E93A 4N6EA 1OFAA 3JS3A 1DVJA 4DF1A 4Z1DA 3PUDA 1JUKA 5IM51 5CPOA 1K7FA 2C1HA 2Q8LA 5F4WA 3LB0A 5LNRA 5HQEA 1UUOA 2Z1BA 3E96A 3RFAA 2A2IA 1TYGA 3CWOX 4XBSA 3N73A 1A5AA 2RHGA 4LNYA 3RLVA 2FB3A 4RXGA 3KOFA 4JX5A 4K6AA 4Y6GA 2GVLA 2VFHA 1AL8A 2Z6IA 3NZRA 4B5NA 4JTUA 5DELA 1K8YA 2C6QA 5HINA 2G96A 2VEIA 3TCEA 5FEXA 1EP2A 5FF2A 2HMCA 1KFJA 4PL2A 2H3BA 2CZDA 3P74A 1OFBA 1EP3A 4IMCA 5F4SA 1A5CA 2QCMA 3S9YA 4AHPA 5DY3A 3NQ2A 3TV8A 1W1ZA 2RFGA 4MJMA 3G1FA 1EIXA 2E6AA 2OZ0A 4HPJA 1QPOA 4MLRA 3R5EA 1EA0A 3UZ5A 4NNAA 2W6RA 4O1DA 4MIMA 2WO5A 3FYPA 3O63A 3N3MA 1H61A 4EVZA 3EXTA 3EWXA 1KM5A 8TIMA 3C4UA 4JXCA 3IIXA 3W7KA 3UPBA 3QQ1A 4NZJA 3DHDA 3W7MA 4HHPA 4LS1A 2X1TA 2Y85A 2DP3A 2ZZ3A 5EY5A 3W7EA 4A29A 3G1DA 4N2YA 2BSLA 3EB2A 5C6MA 4TMCA 4O50A 5T26A 3W71A 3NQMA 1DQXA 4PCFA 3DH7A 4K39A 2VFFA 1Q45A 1UCWA 4JTHA 5H91A 3O8AA 4G1KA 1ZNNA 1L6WA 4JTEA 4BI6A 3C2OA 3M5XA 1SW0A 2DJLA 4UMCA 5DY2A 3LI1A 4L4LA 4AEOA 1N7KA 1P4CA 3SW6A 3C2RA 1OYCA 1V7YA 3LX9A 3W2UA 1WV2A 4PFMA 2ALDA 2VFDA 4WD0A 3WJXA 2R91A 3BV4A 2ZRYA 3MYOA 3T4CA 1YADA 3T40A 3W7NA 2V5BA 2W0UA 2FB2A 2YGYA 3NGJA 4WQ6A 4ZZ9A 3DI1A 1VS1A 5K4XA 2E68A 1SZFA 3N19B 4N9CA 1KFCA 4OGZA 4N4PA 1QOQA 5FF0A 4UR7A 3TIMA 3A5FA 4JS3A 1XCFA 3N9RA 1SZEA 3T44A 3NQAA 2P10A 4Z1AA 2VELA 1PV8A 3F4NA 3RNDA 4TO8A 3TSMA 2YYTA 3TA6A 2W79A 3TNOA 3MHGA 3GDLA 1AK5A 3C2FA 4FNRA 4E2DA 3L5AA 1Q3NA 1Z41A 3NPUA 2BWGA 3MO7A 2OMAA 1FBAA 1NAL1 1P1XA 3RU6A 3SI9A 1EEPA 2PE4A 1K7XA 3LXAA 2CLLA 5CPNA 3BGGA 2IQTA 3LHWA 1LDCA 2YFNA 3R12A 3GKFA 1FCVA 3O6YX 3STGA 1B4EA 1T8XA 3UY8A 3NQGA 5FF7A 3ZWSA 3CTLA 2QKFA 3B8DA 4MZYA 1YXCA 3L5LA 3P7YA 1GYNA 3OVRA 2QCLA 4LW7A 5G2IA 3LGEA 1LLWA 3KVLA 4WY0A 2NXHA 3LXBA 5BW6A 4WUIA 3UY7A 3UQNA 1RQBA 2HTMA 3LDVA 3MWAA 2FLIA 2WQPA 3W88A 1TCDA 5D2TA 4XBKA 4AHOA 1OFOA 2WSYA 4BF9A 2Y7FA 3SFKA 4IMGA 4DO4A 1XC4A 3UXAA 4NVTA 5HWMA 3MI3A 2X1UA 2FPVA 3PBUA 3G1AA 1P0KA 3UWVA 2X30A 2GVGA 3OVQA 1YLVA 3KX6A 3UYCA 3FEMA 5KZEA 3IVUA 4JX4A 4GRSA 1W3NA 2V9DA 3UD6A 2JK2A 3NQFA 4GC4A 5FEZA 1YTEA 1ICQA 4GBUA 3BO9A 2HS8A 3TQKA 4M6VA 4R33A 3MYPA 3K30A 4MUZA 4POCA 3TJLA 2NV2A 1FDZA 3IGUA 3B05A 1KV8A 2RDUA 4OV9A 4HN4A 1ZHAA 5G2HA 3IVSA 3PB2A 3B03A 3THQA 4O4WA 1L6YA 4LRTA 2RDTA 3CC1A 1JCMP 2O7QA 3R8RA 1HTIA 2H6RA 2ISWA 3HB9A 1AMKA 4Z1CA 3V1PA 3O06A 1GT8A 4AVFA 4XKYB 3NQVA 5C2XA 3CEUA 3TH6A 1BEUA 4AMAA 4C1LA 3G1XA 2V2DA 4X3ZA 1TIMA 3TSBA 4QNEA 2X1RA 1RV8A 1SQ7A 5LKYA 5I3KA 3ATZA 3SY5A 2CLEA 5AHMA 2WKJA 1W0MA 1Q6RA 4O17A 2BXVA 1QO2A 3JRKA 1G7UA 2C0AA 3OVPA 1LRTA 5FF4A 1D3HA 3WJSA 1GVQA 4NT0A 4AF0B 3G3MA 3MP4A 2J9YA 1VCFA 3LLFA 3W7LA 4MY9A 3G0UA 3STFA 1RPXA 4GJ1A 3GKAA 2CU0A 5D2WA 1R2TA 3A23A 1LOLA 5CSSA 1TQXA 2NWSA 2ZA1A 3OBKA 4RCXA 4YWIA 2WNQA 2EF9A 3A22A 3HGOA 4MKNA 4KFNA 2C13A 2NX3A 3G1YA 4XUGA 5AHLA 5SWUA 1G4PA 2C3ZA 1KFBA 5K3VA 4MPQA 3WK2A 3GDMA 3OIXA 1TTPA 3P5ZA 4M6PA 4UFIA 4E38A 1SUXA 1TV5A 3IGSA 2CW6A 3ZWTA 2AQWA 3RMJA 3LM7A 2FDSA 4LUIA 3M1ZA 4K8EA 5C54A 1B9BA 1FCQA 1JR1A 1OFPA 4O19A 1WXJA 3TKFA 4EF9A 1JRBA 4FIRA 1FDJA 4I7VA 1GVRA 1J2WA 3BVJA 3PS7A 1X6UA 5U4NA 1I2RA 4RZ4A 3S5NA 1G69A 1S3HA 1QDSA 1L2UA 5KSWA 2O7SA 1J5TA 3GNDA 4NJKA 2H8XA 5CPMA 1ZY9A 4UNKA 3P61A 5CZTA 2X2GA 3W72A 4LC6A 5D04C
chains in the Genus database with same CATH superfamily
3L5MA 5A6AA 3MVTA 3USBA 4ZO7A 5J8LA 1P0NA 2E6DA 1TR9A 3NA8A 3I10A 4EP8C 3M46A 5T9CE 3WNOA 2G95A 5CC5A 1FFRA 5AYZA 4O0ZA 2OKTA 4C6IA 4RL3A 2QDHA 1W5MA 2VDIA 2BP1A 1UKOA 3KZSA 1L8PA 2FHFA 2ATMA 1FOBA 4W85A 3LCFA 4ZXOA 1ITXA 3LOTA 3GDRA 3RM9A 2RKXA 2VZUA 1E4IA 1XDMA 4UTKA 2YZRA 2O92A 3MWCA 4UTWC 1DTUA 4QDWA 4HNVA 2A0NA 3AHVA 5EFFA 3NOEA 1JGIA 1S2TA 2I14A 2Q09A 3PWAA 1UZ1A 2O9OA 2F6UA 4N9DA 4TX9A 2VGBA 1VAHA 3B04A 2ZUNA 3RO8A 4J3VA 1VD6A 4OBSA 1TUFA 1WNOA 2OZTA 5HMDA 3FLUA 3M5YA 4UFMA 4AQLA 3V75A 5DRIA 2BB0A 4B15A 2UY4A 3QRHA 1S5MA 4Q4KA 1TR1A 2CLPA 4ZQPA 2OLSA 2XSXA 4Q32A 1MVYA 1F6KA 2OWXA 1GCYA 2VXNA 3A13A 4QM1A 2AOSA 5HNRA 2GJRA 5CCZA 1E9IA 3V7PA 4XQ6A 2VUNA 5JH2A 1XKJA 1Q63A 1DXFA 3GYEA 4YHGA 2VZSA 4QITA 4JL1A 1FP9A 2W5FA 4P5UA 3P2VA 2WHKA 2KZHA 2GK1A 1TZ9A 4IPIA 4DPQA 1K03A 3HO8A 1CIUA 2B7QA 1F3EA 3LUTA 1P6CA 1W5PA 3GXFA 3S4TA 1XV8A 1QPRA 3UCQA 2Q6ZA 4PC8A 3FCPA 4TU1A 3KDNA 2GLKA 2IQDA 4TR9A 5D8ZA 1XLMA 5E09A 2P0OA 2GDVA 1GOXA 1UQYA 1FWDC 4V28A 2WKGA 3N2TA 2G37A 4P8VA 5AYXA 2ACRA 5EGRA 4NI8A 2INZA 1FQ0A 5CBBA 5DX7A 2E8YA 5MF5A 3GZ3A 3T2OA 5DT5A 4CLMA 4O16A 1VP5A 5HUPA 4HA4A 1RQHA 1US0A 4ES4A 3GC2A 2FFIA 3OHIA 2NX9A 1ESWA 2EBNA 4IG2A 3HJZA 4AXKA 3O7UA 3UNDA 5LYRA 3KL0A 3W73A 2CWXA 3WQGA 1RBLA 5EU9A 4RDYA 4ILSA 1UJQA 1CNVA 1S2WA 4E2VA 5AHFA 2UY2A 1EJWC 3EA2A 4NI3A 4JTDA 5KETA 2WNWA 2Y1HA 2W27A 3TZNA 1XP3A 4S3AA 3EMCA 2DIKA 4NXSA 3K5XA 1CX9A 3SZ8A 3W9ZA 3TYDA 3LCIA 4K1GA 4DJDC 3BLEA 1PZ2A 1U33A 3GTFA 1ADOA 4UQAA 4RNIA 5B7YA 3C2YA 2X1IA 2OG9A 1OHLA 5H8UA 4W87A 3Q58A 2AL2A 1HO1A 3I68A 1BG4A 1W9PA 4XV0A 1VFLA 2VO5A 3FV9A 3L7RA 4Y90A 3OLDA 4HMEA 2D0GA 1LRNA 3W24A 1W9UA 4TVDA 1ZQ5A 4MB1A 4HSNA 3BAIA 1OJXA 5E70A 3O2LA 5C9RA 3C52A 3M7WA 2RDWA 3KAOA 4JFSA 1DE5A 1ZJIA 2XSAA 2Z7KA 3CPUA 1YTDA 4AVNA 4KEMA 4QSHA 3KTCA 1V3HA 1Q6GA 5IXEA 3KW3A 1E1FA 1UR1A 2X1SA 3WMCA 1BXNA 1GOMA 4J9JA 3C86A 4O1EA 5I3DA 1JEZA 3I6RA 2FGLA 1DIOA 1G6CA 3F4WA 4E8DA 2EJAA 4U5IA 3TAOA 3AI0A 1Q6CA 4XX6A 4ASTA 2ATSA 2NZLA 1ME7A 5ABEA 1LBFA 3QJAA 1JRCA 3MJYA 3K2GA 3R0UA 3NNTA 1V3KA 1F9CA 2QPUA 3ARZA 3RITA 2V69A 3TDFA 3UWEA 2B7NA 4W8BA 4PMDA 4DVOA 3AAMA 5FESA 3PAJA 1MEIA 4PB4A 5LNSA 3RX2A 3AU2A 3EWBX 3UT0A 1WUEA 1C8XA 3ITGA 8CGTA 3TAKA 1GJUA 3WF3A 5A6BD 2ZKMX 2TPSA 1GTHA 4LVAA 4J1OA 3AZTA 1JUBA 4ERIA 4JTGA 1J11A 3HV8A 1NJJA 3FDGA 4KMQA 2E25A 1JI1A 4L9ZA 2ZDRA 1BPLB 5HNUA 4CD5A 3BAXA 5TD4A 4LY8A 5LGXA 3U2ZA 4C60A 2VR4A 1EEXA 3AYSA 2CFFA 3IRDA 4CEXC 3HF3A 3CZ8A 3PJTA 4HJFA 3E0IA 2PDPA 2QQ6A 4CQ8A 3VMOA 7A3HA 5D37A 3QSRA 4GYKA 3C0QA 1Z3NA 5M17A 3LENA 3Q45A 2P88A 3FJ4A 4JTFA 1LF1A 4E6MA 4YTTA 3NQ7A 3SRFA 5D09A 1H63A 3W7RA 4K1WA 2ZVIA 4ZO8A 3U0HA 1FWRA 4GYJA 4IIFA 4HOXA 1J6OA 3L4TA 2PDBA 4YU1A 1B2YA 3KBVA 4XD4A 3OYZA 4BKNA 1N8FA 4J4KA 3PB0A 4WZHA 1VBJA 3W7PA 2GOUA 2QVHA 1HGWA 3FXGA 3N6HA 3QN3A 3LM3A 1KGXA 4FOKA 5AVNA 4YTSA 1LROA 2VCBA 2FMOA 1PPIA 4GK8A 3KCJA 3EOOA 2XH0A 3WQCA 4Y9PA 3GX9A 5F1VA 1E73M 2BHZA 3T7VA 4KQNA 5REQB 4AWUA 2J7GA 2SFPA 1TPDA 1IIHA 3FGCA 4X2PA 4C6KA 1S2AA 3C2VA 4FF7A 1CYGA 3AJXA 1WDRA 4US5A 2REQA 1CDGA 1IXOA 2PRMA 3U4FA 2GOKA 2ALRA 4ZE4A 1W8GA 1LWIA 1XH0A 1K3UA 1JNEA 1R47A 6REQB 2VURA 4DLFA 2JKPA 3NO1A 3PZOA 1WXZA 1VC4A 5MKGA 1VIWA 1F2JA 2PDKA 5AHEA 3KP0A 1B3XA 4A3UA 1VJIA 3S6TA 3FXYA 4EPEC 3VKDA 4DEFA 1E6XM 2EEXA 5H8MA 4LXFA 3Q65A 3WNLA 2RJGA 2XIQA 3GLCA 3NIYA 3R11A 4DBDA 1WX0A 1GOKA 3HQ1A 5U7SA 5K4ZA 1TJ2A 4L65A 2NUXA 1RJPA 3VNMA 4XBJA 4AB4A 1UR8A 1HKKA 3QY6A 4QTGA 4EX4A 1GPFA 1HKWA 2Q3RA 3MMWA 2YCLB 4HTYA 4XSMA 4XIMA 4KCWA 4DY1A 3PTDA 1ONRA 4GJJA 1LG2A 3TK7A 5FEPA 1M68A 3WD1A 4YS1A 1JQVA 4UTMA 3NDZA 1V6UA 3HTWA 1TTJA 2Y88A 1W1B1 1W3LA 1QATA 3EXRA 3H55A 5FA5A 2IXUA 3LY0A 1FCBA 1RSCA 2EQDA 3L0KA 1KRBC 3HPZA 3TZFA 3N9SA 1GHRA 1F76A 1ONEA 1Z44A 4I3GA 1SMDA 1KM3A 2IUZA 4A2RA 2DW7A 1BVWA 5G1MA 3KWSA 1I2PA 1P0EA 3CLWA 3HM7A 3ZJKA 5I06A 1DE6A 4QCEA 3N4FA 2XM1A 2QULA 3RAOA 1W3TA 1XIHA 4FXJA 2CWNA 2WW5A 4A8NA 2ZXBA 3KBNA 2WJFA 2QHAA 3QPYA 1E70M 1DIDA 4OQVA 4D6EA 4QAWA 2J7EA 4G1NA 1K9EA 3ZJ7A 1FWEC 1ME9A 2OZ8A 5CAHA 1BF2A 2UBPC 4H9YA 3NL2A 5KZ6A 1EP1A 4S3DA 5ENLA 3AU6A 2OOFA 1LJYA 1KM4A 4DXVA 1GZGA 4RDVA 5JBEA 4J40A 2E6YA 3WDHA 2BOGX 1XGZA 4BY3A 1VLWA 4NZ5A 2PGEA 3ZIZA 4DELA 4IUGA 4HKPA 4ZQOA 3L67A 3GHTA 4HMCA 3AS1A 1PCKA 4C6FA 1Q2SA 3W4RA 4Q33A 5HJYA 2OSXA 3AFBA 1V93A 1JGMA 2FPTA 3SR7A 4UTHA 3EB3A 1DBTA 1LWHA 2PWFA 2H9AB 1POJA 2QEZA 3VYLA 7PTDA 4D8AA 4Z1YA 4IHCA 4DZIA 4JQ1A 1US3A 2VR2A 4C6MA 4L80A 3TROA 1JG9A 5CLWA 2ABBA 1ZAHA 3VNDA 4XB3A 1XX1A 1V4YA 3CL6A 5AY7A 1QT1A 1W3JA 4WOQA 1I0BA 4KRTA 4OV4A 4DYKA 5CG7A 2YPIA 2ZX9A 2CEQA 4W88A 4ZA0A 3PNUA 3IPWA 1Q8AA 1Z48A 1YDVA 4NZ4A 2BDQA 1OIMA 4ACZA 3QKZA 4ZB2A 1S2UA 3VNZA 2VCCA 3QZAA 2PC4A 1HJXA 3DG3A 3LN3A 4A8LA 2GUBA 4XK2A 2VZTA 1NSJA 1RZMA 3S8HA 2EPLX 1QVBA 2GJLA 4AWEA 5I7GA 1RCOB 3LQGA 3EYPA 3ARYA 2FQIA 2WNZA 4L6OA 1H7PA 4RV3A 5CPLA 2O0TA 4ZBCA 1OT1A 4H6RA 4XZLX 1A5SA 3VFLA 4IX2A 5GQBA 4NYUA 3THCA 4LUYA 3BSMA 3W28A 1OG0A 1R5YA 1TMHA 5ABFA 2BVYA 4CD6A 4YCOA 1WYIA 5GNXA 1EJSC 1ZAIA 2OR2A 1JFHA 1EYEA 3PTKA 2E1DA 5CZ0A 4Q4PA 5A2CA 2UZ9A 2ZX5A 3W7IA 3FVDA 4DBUA 3I7SA 4C5ZA 4FX6M 2CLOA 2PLCA 4TIMA 3HQPA 3F5JA 5BROA 2P8CA 3LRMA 2CHNA 3KTSA 1RY8A 4YCPA 4QP0A 1OC6A 3V5FA 4H04A 3I6TA 4UTFA 3G5EA 1H09A 1Q6QA 4XVEA 3JW7A 1NF0A 5A1AA 1HXJA 3WF4A 4QHRA 4C5YA 3CO8A 4JNMA 3CZGA 4QISA 1H11A 4JPGA 2XVGA 3N2CA 3EOEA 2C79A 2Y24A 3E12A 3CHCA 1JZ4A 1GYMA 1AD1A 4Z0JA 2PWEA 3IUIA 1TRIA 2WSRA 3FK4A 2VYOA 4FOJA 1TCMA 1YQ2A 3D6NA 4AG0A 1IR1A 3AHYA 3POHA 1XIEA 3OLEA 4YPJA 4LAKA 2I16A 4R27A 2GSJA 1UBPC 4K36A 4CQDA 2BX7A 2PDYA 4LX4A 3ELFA 1CXHA 4Y8EA 1PYMA 3T81A 5BRPA 1TPVA 3GC5A 4EACA 2BHUA 3DENA 3GFZA 3T08A 2PDQA 4WSKA 4AY8A 5HULA 1UZHA 3NO3A 1JPHA 2WNNA 2G4JA 1OX5A 2OFJA 5I6SA 2CNCA 2A79A 1S2CA 3HPAA 4UTWA 2HPIA 4MJZA 3FA5A 1AJ2A 4JTKA 5DF0A 4L1GA 4OWGA 2HRWA 2GVEA 1R38A 1EC7A 3BGAA 4ZB5A 5AC7A 4Y96A 1HJWA 2GK1B 4IWWA 3VAVA 5HMSA 3SCVA 1V6WA 3F03K 4ZQRA 5IFTA 3ZR6A 3L2IA 3GIQA 3M0YA 3CEPA 3L0GA 5HUOA 1HKJA 4GH1A 1F4AA 3NL5A 2DVUA 4D6CA 3D47A 3M47A 2OZ3A 5A8NA 3W2LA 1SJCA 4NAFA 3H26A 2HZGA 1UH2A 3XIMA 1R3RA 2PU1A 4IIBA 3WLSA 4EK7A 5C2GA 1EF2A 2CYGA 4DF0A 2B81A 6TIMA 2OB3A 2OVLA 2DQWA 4FALA 2D20A 2JIWA 4GZEA 4A8IA 1SO5A 4IG2B 4JBRA 1VRDA 3CUXA 2DZTA 3UJ2A 3W00A 5A8PA 1BWKA 1XIJA 1DJGA 1UQZA 2ZWYA 1GKPA 1OVDA 3Q37A 4I9AA 4OE7A 1U22A 1T0OA 4RJEA 1R9YA 3POCA 1RP9A 3ENLA 2I57A 2W9MA 4HPXA 1F05A 4HP5A 4B2DA 2QF7A 5KMYA 4KFOA 3VOJA 3VPLA 1EB3A 3KDOA 1AVAA 9XIMA 4DN1A 4A05A 1IEIA 4AZHA 2WJZA 4NRSA 1B3VA 1UPMB 3U2EA 1KTNA 3AROA 4IFRA 1ONWA 4PCNA 2AAMA 3TQVA 3V36A 1FXQA 3LQLA 1NOFA 3NYZA 2VWSA 1GVFA 1JCJA 1YX1A 1H1YA 2VP8A 3A5VA 3EMQA 5CLTA 3UWUA 2NWRA 1T5AA 1FFQA 4HNNA 2AL2B 3CUGA 4YMZA 4IJBA 4PMNA 1H7XA 4C65A 1XPGA 4JQ3A 4JEQA 1O60A 4GI9A 3SEPA 6XIMA 1XGEA 1HP4A 3WEOA 2BNJA 4X0VA 4GABA 5J5DA 4XD6A 1S2VA 1E71M 5HPOA 4IF2A 4ZL1A 1KC7A 3NZPA 3LPFA 4O1FA 3FNDA 2PU0A 2FMNA 2OX1A 3R10A 4DJDA 3QMSA 4MWAE 1WZLA 3NDOA 1XLIA 3RIKA 4D1JA 4NNBA 4XD5A 5F7UA 4KERA 4J28A 1XBVA 1TMQA 1E51A 2QZRA 1C9WA 1QK0A 1KTBA 1A5KC 4H41A 3QR0A 4IM4A 2YL9A 1GTEA 4ALDA 1QASA 4LVFA 3VKJA 2BGNE 1R3QA 3LSCA 1GKRA 2Z6JA 3BK0A 4IMEA 2NQ5A 3ZZ1A 1X96A 4AIOA 2DSVA 1EA9C 1TJPA 1XQKA 2XIBA 3WLNA 3WMBA 4CCCA 4Y9AA 1UZDA 2P50A 2AMXA 1PWLA 4CGTA 2NQLA 4UZSA 1MMFA 5CSUA 2GGEA 4RXFA 4PYSA 4LYQA 4ORIA 4HK6A 1DXIA 2A3AA 3E2SA 4EXAA 4AZCA 4GGBA 1VHNA 4MPKA 1DWAM 4HHHA 5FJOA 1S5TA 3L12A 3PAOA 3PWIA 2R1LA 1NP0A 5D38A 3LCHA 3ABSA 3QSTA 3GHRA 4BF5A 2ICSA 3QPEA 4WKFA 4WOZA 2OQLA 1EWEA 1FWWA 1L8NA 2DZAA 2PCEA 2J25A 3N04A 1SO3A 2OKOA 3EEGA 4FNUA 3NQEA 4D6JA 3BAJA 6ALDA 2CLIA 4F9JA 3BLLA 2WSPA 4OHQA 4J35A 1ICPA 1IZKA 2QMKA 3WDIA 1V7AA 3WBWA 3PUGA 3N6JA 3SGZA 4AZIA 2R1NA 3VM7A 1RVGA 4A3QA 3UEQA 3HIJA 1AG1O 4UQCA 5XIMA 2H90A 3BZGA 3K8KA 1RCXB 1XYMA 3VZYA 3PY2A 3FS2A 2X41A 2E09A 5T8GA 1UP0A 3LRKA 4TXEA 5G4EA 4FK9A 2JKEA 5KZMA 2FGZA 3B8IA 3F5KA 3LBOA 1SJBA 1XBZA 1SZNA 2G0WA 2ZRUA 5IBXA 2CZEA 3RJXA 5AYYA 4PZVA 3TTEA 7ENLA 5D2XA 1SW7A 1TPEA 1FKXA 3QHOA 3PVFA 4NX5A 3W1TA 2QT3A 5J04A 4O54A 4AZGA 1PX8A 3BJSA 1CGXA 4N6EA 4HPHA 2W91A 3VIFA 3JS3A 1DVJA 4GVHA 4CQCA 4Z1DA 3FGCB 1FH8A 2EG8A 4QE1A 3PUDA 1K7FA 2Q8LA 3CUJA 2REQB 2Z1BA 1TYGA 3PJXA 4XBSA 4XISA 3UBPC 1LL7A 5DRCA 5I00A 3RLVA 4RXGA 3KOFA 3A9BA 4K6AA 5CSYA 3PP7A 3VNKA 4DZAA 4C90A 3BDKA 2C6QA 1RH9A 4OKDA 1A3WA 3T05A 1UH4A 3UR2A 1XJBA 2J7CA 3O0FA 5LIKX 2ZICA 5M5DA 4AHPA 5DY3A 1O6IA 3NQ2A 3KEHA 1VF8A 2RFGA 3O0KA 4IICA 1LWJA 5FJRA 3H4WA 1X98A 2OZ0A 4HPJA 5I77A 1QPOA 3PZUA 3R5EA 3UZ5A 2W6RA 4O1DA 1KXHA 2WO5A 3FYPA 3O63A 1MRAA 1VFUA 4FOUA 5LIWX 3EXTA 3TOYA 4PMJA 4UQ9A 3VDCA 3VNJA 4RNHA 4US5D 1FWFC 3UPBA 4ZODA 1SM9A 3RM4A 4NZJA 2D1ZA 4HHPA 4DWSA 2X1TA 1PZ3A 3HFTA 2DP3A 5EY5A 3TLQA 3W7EA 4A29A 3BJFA 4GIAA 4ZCWA 4TMCA 3F2CA 4IIDA 1B90A 5I2UA 4MB5A 1O5RA 3ECQA 3W71A 2J74A 3DH7A 3MKCA 1D3CA 4G1KA 2GWNA 1ZNNA 4HJWA 4JTEA 4AUBA 4H2HA 4KETA 4V1XA 4TTGA 3DYOA 2WSKA 4D6GA 3WLQA 3MVIA 4M29A 3AMKA 2J4GA 4L4PA 4AEOA 2X09A 5FAJA 1KBBA 3C2RA 3KUMA 1OYCA 4DUXA 3W2UA 3BLKA 3OVGA 1Z6KA 5FKYA 3EBVA 2PWDA 2VFDA 4FAMA 2YXXA 1MRQA 2PUZA 2HNEA 3WYZA 2OPJA 1MQPA 1PWMA 4MWAC 2ZXQA 4BEUA 4ZSTA 4I5UA 4F4RA 2XFRA 1VPYA 2Z2AA 3DI1A 1BD0A 3LSBA 4OGZA 5FF0A 3IJ8A 2HJPA 3CQJA 3CAVA 1JYWA 5B7ZA 1SZEA 2R1MA 3GQYA 6TAAA 4Z1AA 3B0YA 3F4NA 3EZ4A 3EPNA 4U2YA 3URNA 3VK5A 2V6AA 3MUAA 3C2FA 3WUGA 1E9LA 3L5AA 1VPQA 3QV8A 2QMJA 1Q6DA 3SGGA 1MUMA 5I09A 3RX4A 1NAL1 4GD0A 5DO8A 3AS2A 1SYTA 1K7XA 1L6FA 2CLLA 1S38A 1I1XA 3B8WA 2IQTA 1XLEA 4H01A 2GDUA 2D24A 2PWHA 3BOXA 1CB2A 4L9XA 3NQGA 3CTLA 2I5IA 3OLIA 2QKFA 3B8DA 1W1VA 2NQZA 2W66A 3P7YA 4OFCA 3V35A 1HF6A 3BSGA 2QCLA 3KBMA 1JD9A 3W01A 1XSJA 3MV11 1DWFM 3S1GA 4Q4SA 3UQNA 1RQBA 4EXQA 3TYZA 3U5UA 1OCQA 2FLIA 3VX0A 4BA0A 5CPSA 2OEJA 1SR0A 2WSYA 1ZS2A 3SFKA 4OZOA 3UXAA 5HWMA 3MI3A 2FPVA 4QJ4B 3G1AA 3E5BA 4WKAA 1BTCA 3CGTA 3T1GA 3UYCA 5FD0A 3SURA 1UG6A 1BAGA 1UWQA 3PZGA 1W3NA 2BGSA 2HK0A 4GC4A 1MWOA 3THDA 2VZVA 3ARXA 3WCZA 4ACZB 2PODA 3SQMA 4LUSA 3TQKA 2BVWA 4R33A 3K30A 3VD9A 2CITA 4CN4A 1UPPA 4MUZA 4POCA 3H24A 4ZO9A 4GGHA 3B05A 3VGGA 5G2HA 5A6SA 1EBHA 4EPDC 2RDTA 2O7QA 3V0UA 1HTIA 1GQLA 2ISWA 2PB1A 2CXGA 3IJ9A 2ZC8A 2V2DA 3TSBA 4QNEA 3GH5A 4DHGA 5ABFB 2BHYA 1V02A 1XW8A 2CLEA 5AHMA 4UOJA 3B97A 4WIWA 1QO2A 4PTMA 3P0XA 4XZBA 3DFHA 4P7RA 3JRKA 3UPMA 1H0IA 1LRTA 5FF4A 3WJSA 2OX4A 3K8MA 5BOFA 1KQZA 1GORA 3VCCA 1XFCA 3GTHA 1AZ1A 4PRWA 2CU0A 5D2WA 4AZBA 3WO8A 3MUY1 1O66A 1DHKA 3VZZA 1LOLA 4LYKA 2NWSA 4YWIA 4Q7NA 2I5QA 1FWIC 4XUGA 3AIBA 5SWUA 2C3ZA 3M64A 2EPNA 3EPOA 3ONCA 7ODCA 2R1KA 1SUXA 2HVOA 2YA2A 1YKWA 3ZWTA 2CW6A 3WDRA 2NQ9A 4IIGA 4K8EA 1BRLA 1B9BA 1JCTA 1OFPA 4NSBA 1JRBA 3OODA 3WFZA 1G1YA 4B3KA 1J2WA 4PUEA 3NTYA 5U4NA 1GEHA 1KKRA 3S5NA 1Q5MA 1G69A 5A94A 4F9DA 2CIPA 2OGYA 4UNKA 3P61A 2VHLA 3FHAA 4D1IA 2DVTA 1DKWA 2PLJA 3TTSA 2HVMA 1E0UA 4DPPA 4I9TA 1YRRA 1PO9A 5EMLA 4HA0A 4IMDA 1TJ1A 2VKZG 4AEFA 3O6CA 2VL4A 3GDTA 1E6NA 2UV8G 3WFLA 4MHBA 3W7JA 1C8YA 2WOQA 1QHPA 2ZUUA 4LYRA 2YR1A 4M7TA 3QQ0A 1OFQA 5A8OA 1VZWA 1QNSA 3ZS4A 1P0DA 5D9OA 1K1DA 4HCDA 5GJPA 1C90A 2VD9A 2PWGA 4AZ5A 3R2GA 1PHQA 4PB3A 4UR9A 4AFYA 2D2GA 4MKVA 2YXOA 3KVMA 1TPC1 4ML4A 3KBWA 2FGBA 3AWNA 3IGXA 3UXKA 4IFOA 5CZJA 4JIRA 1CGTA 2F7FA 1GW9A 2INFA 4NJJA 4UNIA 4NAFB 3ANVA 1VEPA 1JF6A 5AECA 3NL3A 2R82A 5GPRA 3GUGA 2DH2A 1VFFA 2YSWA 3RLUA 3VZXA 3G6MA 5TIMA 2V8ZA 5DMLA 5DQPA 3VIMA 5JU6A 2OCZA 1G7VA 3I3EA 5HANA 3R8GA 1F7BA 1GVIA 2OLHA 4LF1A 5C5YA 3LMZA 3W7DA 1Q13A 1X7IA 2XZ9A 4H4IA 4WJXA 1AH4A 4FO4A 4UTTC 2P76A 3G0XA 3VFCA 4GNJA 1GVSA 4JDYA 1E72M 3PJUA 1EHNA 3OG3A 3STEA 3LGDA 2Y6ZA 3JU2A 1J01A 1OM0A 3MCMA 4PH6A 3OLGA 1UROA 4FX7A 3P80A 3HGJA 3PSWA 4F0KA 4IT1A 1KLYA 2QIIA 4LAZA 3KLKA 1H41A 4KEZA 1JVNA 1YEYA 5AC6A 1SGJA 2FZBA 4CQ9A 3H2CA 1T8QA 3G6LA 2YL5A 3DBPA 2A21A 3LMYA 4XAZA 1IZJA 4NF7A 3WJZA 5JIPA 1WZMA 1KW1A 3RPTA 3QC3A 5EPDA 1RVKA 2AGTA 2EO7A 3FOKA 1TV8A 2JF6A 4A3YA 1H7RA 4A2SA 1DJZA 2YBTA 3B06A 4AY1A 3H70A 4ZOAA 4CU6A 4M19A 4L4MA 3I3DA 3W84A 3B4UA 1PTGA 2PDXA 1DJQA 2ZZ7A 3N17A 4RK8A 4XUYA 2RDXA 4UTUA 3M07A 3MO4A 1H4PA 2YB4A 4KCUA 1M7XA 3EKZA 3AO0A 3O05A 5F2IA 3MCOA 1ISZA 4JN7A 4MGGA 3UYIA 2G8ZA 4QR6A 2GQ8A 4GZ7A 4WDTA 3QZEA 3PULA 3W83A 4Q4QA 1YPFA 3BL3A 4IGNA 3BOFA 1GOOA 5EB8A 3EGJA 2ZUSA 1CGWA 1AQMA 4QIUA 3W74A 3AXKA 3IEBA 1JPDX 3MKVA 3RU8X 2E3ZA 1KTCA 4D8LA 2HEJA 4HPGA 4U33A 4RE3A 3R89A 1U2YA 2PSNA 3PPHA 1VBGA 2P3EA 5EL1A 1JI2A 3H23A 3ZYZA 3W37A 1VQTA 3R4IA 1H50A 1QHOA 3G1HA 2ZYFA 1I6NA 1XI3A 1TB3A 2PDCA 3GHUA 3CH0A 1EGVA 3QY8A 4JOMA 3MBFA 2E5CA 1NDYA 4FEZA 4DJDD 1KFLA 1W5QA 1CGVA 4C1NA 4AZCB 3WQOA 1ZALA 4M56A 4C6JA 2XN0A 4HT3A 1JDDA 2YIHA 1UWUA 1XL9A 2CLHA 2E77A 4H9UA 4OBTA 4PEEA 2FFCA 1VYPX 4DJEC 2J9XA 5HJXA 1A3XA 3HMJG 3WELA 1K8XA 3H2MA 2DDXA 5A6JA 4W4QA 3ITVA 4X0NA 5FJUA 1T6MA 5BRBA 4J7RA 5AC8A 2WJDA 1X39A 4YLWA 4JY8A 5I3JA 3W22A 4P61A 1F07A 2WCSA 5KEZA 2ZC1A 6PTDA 3KE0A 1FA2A 2XIOA 2RGLA 3LCGA 2PDJA 3O6DA 4P8UA 2PPGA 2YDAA 4YNGA 1EF3A 3G77A 1W5OA 3JR2A 1F3TA 3H8AA 4LUJA 3KXQA 4GY7A 3K13A 3R7MA 4HMDA 3M0XA 1E9ZB 4GUIA 3AIVA 4FR6A 3H54A 2ZUWA 4AIEA 1PIIA 1BWLA 5HWJA 1HL2A 4RV8A 4H9ZA 1S5NA 3L4ZA 3ES7A 1A4LA 3SFWA 3W1LA 1JCLA 4LAUA 1OX4A 2A3CA 3FKRA 3C0JA 2VGIA 4AD4A 4OVXA 1ZENA 7CGTA 1VBRA 3U57A 3ZVHA 3A12A 2VX5A 1RAKA 4JNYA 1ICSA 1UUQA 3EOLA 2EG6A 2QLYA 3NPWA 4FLSA 1M7PA 2DW6A 3RLHA 2YBUA 5BZAA 1D7FA 5DMMA 3QBUA 4URIA 2HBXA 3RR1A 2YJQA 3BAKA 3HZ3A 2VMFA 1NDWA 1AJ0A 4FNSA 2ZTJA 3EX6A 4DUOA 4S3JA 3EWYA 5FI8A 2PGWA 1AW1A 3PBGA 2OLAA 3HGSA 4A6GA 1IEXA 2A7NA 5BMXA 2ANUA 3WG6A 3CH9A 5HOSA 4IXHA 4RLIA 4PB5A 1FWTA 4S1FA 2X0HA 3PNZA 1H1ZA 3M43A 3GZAA 3DFYA 3VNYA 3PPGA 1S1RA 2XVLA 4XZMX 1J0JA 5CZSA 3NCOA 4ZB0A 3GW0A 3N14A 3UESA 3IJ7A 2CETA 4GPNA 1LCOA 4WHBA 1ISYA 1GG0A 5EMKA 4RE4A 3GNPA 1PL9A 2ZE0A 2P0IA 4HCLA 1V6VA 2P5NA 2ZA2A 4LRSA 1S39A 4PA8A 3M16A 2C14A 2DGAA 1JUEA 1SJDA 2PA6A 4BQ4A 5K9CA 2J24A 4DWSB 1SO6A 2WV8A 4P8WA 1VFTA 3LTSA 2J8TA 1RLDA 1FWJC 3SCRA 3TW7A 4KGJA 1HJVA 1KM0A 4HZ8A 4Q6JA 3S1XA 2VRQA 2C71A 4PMXA 2Q3OA 3AIWA 1Q85A 3NQ6A 2Y61A 3I3BA 3WKZA 4GACA 3ALFA 6ENLA 1ITCA 1NWRA 1PS9A 5DXXA 1PB0A 2PDMA 4Z0SA 1KBLA 3DECA 4W86A 4O53A 1IXNA 3P3BA 2HE5A 5I07A 3A47A 1XYFA 3SJNA 1BYAA 4FLRA 3IIPA 2XGBA 5E5CA 1DEDA 1ZPTA 3S2JA 2VC6A 3TFCA 4DAIA 3T0CA 1QAPA 4L4OA 4YTUA 1HP5A 1XYCA 4MUPA 2GVJA 4HTBA 2YA1A 4DWSD 4N7QA 1YTKA 3APYA 1JDCA 1FP8A 4LBSA 4KGLA 1X8CA 2DQXA 2W92A 4JFUA 5TQLA 3KRUA 3H21A 2OT0A 2QDEA 2QJJA 2ZOXA 3QMRA 4L6HA 2E40A 1BSIA 4DI8A 3C5QA 3VD3A 4QEEA 4MWAA 3IJDA 4HHMA 2YX0A 5FL0A 3PSVA 4XO6A 3W6LA 2G5WA 1WDWA 2Y7GA 2GGHA 5JUVA 1R9XA 1BGAA 2XHYA 3BARA 3MY9A 2QR6A 3MSRA 5CPQA 4M1RA 4F2TA 4JR5A 1KGWA 4JYEA 3W1RA 5GVJA 3S6DA 3ID7A 2XH7A 3UVIA 1UWIA 2FVKA 1VGAA 3O15A 2F8QA 3SADA 4WY0F 3SUSA 5G2WA 1EX5A 4DRSA 1V51A 2B31A 4Q8QA 3UG3A 3AIUA 3BG9A 2VFEA 4QQUA 3R8HA 3C0LA 1KFWA 4O8RA 4DNHA 1MNZA 3OZOA 3H2EA 3VOIA 1RHCA 4UTJA 4JDBA 1D9EA 1GVOA 1VPXA 4LNCA 3KCLA 3C0SA 2GPTA 3CPRA 2QJMA 1UP2A 1UIOA 1TUXA 3BGJA 1UWRA 3LCLA 3DI0A 2ISSA 3HQNA 2WVUA 4GG9A 4LUSB 1WDQA 2EJ1A 1W31A 4INFA 4WKHA 2Z1WA 2OODA 3MZNA 3STCA 5T9BG 4DYEA 1KM2A 1P6BA 1C9DA 2TAAA 3WJWA 3H12A 5MHBA 1A5UA 1CXIA 3FW6A 1W2PA 1LL6A 3W02A 1O5KA 4LJ3A 1L0PA 4W7VA 3GVQA 4EPBC 3LYEA 4IL0A 3RJYA 2C16A 5C9ZA 3MW7A 3GNNA 1U1HA 2DT1A 5BOEA 1WB0A 4ACYA 3H7UA 3CTTA 3ZT6A 1SSDA 4X61A 1MNSA 1B5TA 2QCNA 1UASA 1PIGA 3WH5A 1HT6A 4AHQA 3QF0A 4AX6A 1CT5A 1H5VA 3WQWA 4NUWA 3T0DA 3KP1A 1QBBA 4N4QA 4W5UA 3WQFA 2C18A 5D03A 3URBA 4GHRA 2HXUA 2ON3A 3CIXA 4L5ZA 2WANA 4UR8A 2OO0A 5D9PA 4QCFA 4O1BA 2PTZA 1C8QA 1OY0A 4DO7A 4JFVA 1UR4A 2MNRA 4W8AA 4MLJA 2FIQA 1F5ZA 1MW3A 4FX8A 1BXCA 3WQVA 4XZWA 2CKSA 5CBIA 5RUBA 2FHCA 1E5NA 1BRLB 1J9YA 3TQ0A 3F4DA 4XKYA 4KWUA 2J47A 4HZ7A 3W6YA 3DAQA 2Z4GA 3RR4A 1WO2A 4ZTXA 1RR2A 4B9YA 4BZYA 1YDNA 4O18A 3OB8A 4JN6A 1TE6A 4QE5A 1B9ZA 4MADA 3N6QA 1CECA 5K7JA 3QR1A 3VTRA 3O6AA 1XLBA 3WQ5A 1W1TA 2HCVA 5M2FX 3SRHA 3VGHA 2WMHA 4WVXA 1RUSA 1F73A 1IF2A 3M6YA 5AYIA 1I45A 4Z17A 4I9MA 4AF0A 4JTTA 1FUYA 3HU7A 1IR2A 1YW1A 3E0VA 3M9YA 3DKJA 1QW8A 3K1GA 3QMTA 1M03A 3W7GA 3MMTA 4QG9A 4BWLA 2YCKX 1TA3A 3AQUA 4H9XA 3WFAA 4O13A 3WK3A 5LXXA 2VC5A 3S46A 2HNHA 3W2JA 1LRQA 4K7YA 2QDDA 3NM1A 3MUZ1 3UWQA 3CHEA 3LHVA 4K38A 3CIVA 2Y8VA 1LQ0A 1QI3A 4H8UA 4IX0A 2YDRA 1EL3A 2BY2A 3PZMA 4QS6A 1W54A 4PCSA 1D3GA 3QPZA 3PPFA 1GNXA 2DSKA 3KL5A 1UKQA 1E9YB 1KBKA 3CMFA 1FHUA 3TMLA 3WD3A 1QPNA 2W63A 2NXGA 3BOLA 4DO5A 2D0FA 3PG8A 3VILA 1E6QM 1OK4A 3CHDA 1FTXA 1QJWA 3FHQA 4DF2A 1GEQA 5I0DA 4FHAA 1AA1B 4G9PA 4NJIA 1S5WA 5JMUA 5EMJA 4XIAA 1OX6A 4JZ5A 4FZIA 5C8BB 2O55A 1VEOA 3VC6A 4K37A 4N02A 3R13A 3HFYA 1GG1A 3M0MA 2ZA3A 5DLCA 3F4VA 1Z69A 4CNOA 5EKYA 1TV7A 3IJLA 5LHFA 1R2SA 1XWYA 3S47A 2WMKA 1OFRA 3QH2A 4LC8A 1IGSA 3N13A 3CZJA 2ZXAA 4WK9A 3TQPA 4F48A 2OQHA 2G50A 4IZGA 2H3DA 2X7VA 3EMZA 4EWJA 4E2BA 4WSHA 4JKKA 4PCTA 2V2CA 1UIPA 4AC1X 3IIVA 3T6CA 1LQ2A 4DQWA 2V5JA 3W07A 3MI2A 1VFOA 2IPJA 1CTNA 3PR2A 3OQ8A 1PE1A 4UMBA 4UIOA 1EJUC 4JKLA 4I5XA 2VTFA 1EJVC 5CC3A 4G7EA 3OG2A 4GQ0A 3NEVA 3UG5A 3WMLA 1B3ZA 4MB3A 1JPIA 4CD4A 1ZCCA 3WK0A 4UNLA 5CC7A 2JFEX 1JULA 2BV9A 1Y0EA 3W86A 1QR7A 4R34A 4TX6A 2CHOA 1OC7A 4GOAA 2YW3A 1EXPA 4PUNA 3KL3A 3ZM8A 2Q71A 5EMUA 2WM0A 4PCPA 4H8NA 2W62A 5IRPA 4U2ZA 2FKPA 5DN1A 4ADUA 5HK4A 4P7QA 2Z0IA 4UTIA 3TXZA 4KPLA 4Z1BA 1DTNA 2Z28A 3L4VA 1UUMA 1CXLA 1XDLA 3ARSA 4P2VA 3HN3A 2CZ5A 3UZWA 1FH9A 4DO6A 2VRJA 4TTUA 1RCQA 1DJWA 3AS3A 2R6OA 1NELA 4J3ZA 3RGTA 3LHYA 3VIOA 4YL2A 3LPOA 4HIBA 1TJ0A 4U4MA 3KRZA 4M6UA 3ZJ6A 1XUZA 4PGLA 4Y8FA 2A3HA 3BQ6A 3O1NA 4JIPA 3VIIA 4C6DA 3PM6A 1V79A 1V3IA 4C1NB 3CV6A 3GG7A 1Q6OA 5AHIA 5F2GA 1G4EA 2GSHA 5AFDA 3UERA 4DZHA 2NT0A 4GINA 4MFDA 4ZQNA 5EBAA 3U8GA 4QQ3A 2WCGA 4AMCA 3E5PA 2VEFA 4ZSUA 1TG7A 3VIPA 4M1BA 1KNWA 3LCXA 4HYRA 3WH8A 3L23A 1E0XA 2Q8XA 1XM3A 3W2KA 3LK6A 4GQQA 4JIIX 3RPDA 2YW4A 1JPMA 1RALA 4M51A 1B3YA 1CWYA 1QNVA 4X63A 5EMYA 1S46A 2QPXA 2WB5A 4IUOA 3UA3A 1BQCA 2XINA 3RILA 1NARA 1IE7C 3CO4A 3QFEA 3ORWA 3GG8A 3MMDA 2VX7A 5D02A 1ADDA 1V3MA 4QJ1A 2PURA 1EDGA 3Q94A 1E1EA 4KCTA 1UHVA 2E7FA 3ABOA 2YA0A 3FA4A 1HL9A 4WX2A 3T8LA 3SN0A 3QOMA 1G67A 3DBNA 1Q4NX 3UGRA 2O4QA 2V82A 2QCGA 4I5RA 1NF7A 1M7JA 1LOQA 1T99A 2HK1A 5JBDA 1YNQA 2AGKA 2Y63A 4G6CA 1OX4B 3NGFA 3QTGA 3QGVA 4H6KA 4HQVA 2F2HA 3GU2A 2BODX 2VC9A 3WD4A 3MP5A 3ZVHB 2MANA 4F2UA 2QYGA 1X6NA 2QGYA 2F6KA 1UH3A 1HN1A 4TVCA 1OINA 4ZMGA 5KZDA 3ZSTA 3MS8A 3W27A 3BSHA 4IGSA 4Q3MA 4KIEA 2DZWA 1FHVA 4GIYA 3WZ0E 1SFTA 2DSWA 2WZEA 3CWNA 3WMSA 4UUIA 2OYKA 3XISA 4A35A 4XZNX 5KTLA 3D46A 3N1AA 1XG4A 3W1QA 4CQBA 4H19A 3VINA 4ICMA 1FWAC 2V63A 1XIIA 1I4NA 1JJKA 1T96A 1OYBA 1O7AA 3G8RA 1WOBA 4Z2HA 2PDNA 5K9DA 3N15A 4E3TA 3G1SA 1ZTVA 2B7PA 2O4MA 2OQYA 2VR5A 4XTDA 3MC5A 2J8GA 3RCMA 2X0YA 1MFUA 1JAEA 1XGDA 3HPFA 2WBKA 1TPWA 2PAJA 1TPH1 1VFSA 3VE9A 4YYFA 4B5SA 3N2MA 2YCEA 4LVGA 3L2LA 2JQXA 3VDBA 1TWSA 1TWIA 1YXDA 5CPTA 4PEKA 1O94A 5F2MA 4MYXA 3MDWA 1AH0A 3MANA 1E56A 4F0SA 1EO5A 1OFAA 1TV3A 2J7HA 1RY0A 5AZ1A 3WUFA 1JUKA 5IM51 1JZ8A 3CQKA 5F4WA 1ZSXA 5B80A 5TAOA 3VDGA 1ISWA 3RO6A 3N73A 3VOFA 2HE8A 4LNYA 1KO0A 2V5KA 1BKHA 4OECA 2FB3A 1OZQA 4LEQA 5LA0A 2VFHA 4DBSA 4HVXA 4I6KA 4GVFA 4B5NA 1E0VA 4NZ1A 5HINA 2G96A 3TCEA 5IHRA 2VCAA 1KFJA 4RUBA 2H3BA 2CZDA 3P74A 1OFBA 1ZJHA 1YE6A 2QCMA 3AIRA 3TV8A 1W1ZA 2PFHA 3RMEA 1KRMA 1XH2A 1E5JA 1C7SA 2Z25A 3G1FA 1CXKA 1EOMA 3USZA 2IKGA 5FCZA 4ATLA 1WUFA 1UR0A 4MIMA 3ARRA 2BY1A 4IJRA 4HK5A 4ZOCA 1PKMA 3RHGA 1DP0A 1H61A 2XVNA 4EVZA 2J13A 3GNOA 7REQA 5A2BA 1Q7MA 1AJZA 3BLPX 3QQ1A 1ZL1A 1RP8A 2D2OA 3CL7A 3EPMA 2Y85A 1AUSL 4JFTA 1XPYA 4N2YA 2BSLA 5C6MA 3FA3A 2V5DA 1DQXA 3AWOA 4PCFA 1KXTA 4GYPC 4K39A 3QR3A 4MWAB 4F2BA 1D8CA 3VKCA 1L6WA 3M5XA 1SW0A 3H4XA 1PDYA 3LI1A 1RJQA 1O1ZA 5LIYX 1J2BA 2X42A 5E0CA 4QGCA 3WJXA 3BV4A 2PD5A 3RUBL 2ZRYA 1ZB5A 1VJZA 3T40A 2V5BA 2NSOA 1AFSA 1ODUA 4IQJA 1C91A 2XH4A 1XDJA 5K4XA 1VS1A 4QDMA 2E68A 1KFCA 2ZX6A 1FKWA 4H8HA 3URQA 3T44A 3NQAA 1OT2A 1OCJA 4O0QA 3T4WA 2P10A 2J8FA 2WJEA 1OCNA 2VELA 1R3YA 4JTCA 4S3KA 3KCOA 5HNNA 1W3KA 5C7VA 4HNCA 1XSKA 1OG6A 3ITXA 3I4KA 1Z41A 3NPUA 1V0MA 3MO7A 1EC9A 3QLDA 3UJSA 2OU4A 3CUHA 1FBAA 3C3UA 1NFPA 5CEWA 3M6DA 2PE4A 2PD9A 5CPNA 5JBFA 3BGGA 3UF9A 2C7FA 3WH9A 2IPWA 4BEQA 4S38A 3O6YX 4KESA 5C2CA 4RPPA 3EOUA 4IFKA 3G1RA 4PUUA 4MZYA 4ZOBA 4W7UA 5IOBA 3WENA 3K8LA 3R0KA 4V15A 3KVLA 2GFTA 4WY0A 3LXBA 2Y8KA 4PMRA 3MWAA 4EAYA 3URAA 5D2TA 4C6BA 1OFOA 4QSFA 3GW3A 4IMGA 3S2NA 1XC4A 4NVTA 3REQA 1QU4A 2QXWA 2XIJA 2X30A 1EKOA 1N2VA 2GVGA 1QOXA 3KX6A 5KZEA 1OEPA 4U5KA 3UD6A 4KT2A 4QJ5B 1HKVA 1ICQA 2ONEA 4AZ6A 1C92A 5CGMA 3BO9A 2VUYA 2FZ9A 2BMBA 3V3WA 3T09A 1WCGA 4C7DA 2NV2A 4J3WA 1GQKA 3CV7A 2PBOA 2HROA 2RDUA 4OV9A 4AEEA 2WQDA 3E2QA 1VIZA 2XGIA 4D72A 3OZYA 3VUSA 1IWAA 9RUBA 4MNKA 3MQTA 3R8RA 2H6RA 4R88A 3ZLGA 2WC4A 3TYEA 1GT8A 4XKYB 3CEUA 2V3EA 1KXVA 4QBXA 3ARTA 1X1NA 1RV8A 5I3KA 1XQLA 3WEZA 2O9RA 4W7WA 5C7HA 1J12A 4O17A 4Y9NA 4KRUA 1ZP4A 1G7UA 3D5HA 2C0AA 3OVPA 3N29A 4Z2KA 4AF0B 3G3MA 3MP4A 4TUFA 3RDKA 4GFIA 4GJ1A 1R2TA 2JALA 2BG5A 4RCXA 1YDYA 5HATA 3KWXA 4MKNA 2C13A 2NX3A 3LZ5A 2INEA 3KHDA 3GXIA 3WK2A 2VRKA 1TTPA 1TA3B 2XFFA 5T91A 2WYSA 1TV5A 4Z2GA 1ITQA 2TODA 1K9FA 2FVLA 1OBAA 1QNQA 3H7VA 1E6RA 4LH8A 1XH1A 3V1HA 1M1BA 4DJFD 1U5VA 1FDJA 2GVYA 3NXLA 2DT0A 5ECVA 3BVJA 3PS7A 3TOPA 3IWPA 2RAGA 1PKLA 1X6UA 4KEUA 4J2MA 1JZ3A 2PP0A 1L2UA 2EKGA 3GNDA 3UFYA 4NJKA 3V4BA 2H8XA 2VM8A 4UOZA 4KW2A 3WBYA 3MPGA 2EPOA 3TCSA 3RYSA 4LC6A 2AKMA 4JIEA 1B57A 3UZXA 3CHFA 2F6XA 1W32A 1JCYA 1OC5A 4GX8A 1XRSA 2Q01A 1U1UA 3AISA 4O14A 1AQ0A 3P81A 1B54A 1O5XA 5A6LA 3M7SA 2D3NA 1JDAA 2WVVA 3S5YA 4E8CA 2J6VA 3NG3A 5C55A 4D71A 5JXQA 2ZFAA 2VOMA 1TSIA 3HPSA 1PCWA 1ECQA 1EUNA 3TTOA 3B8SA 3INPA 1FVPA 2QCCA 3ANYA 4QJ3B 3G18A 4JIHA 2NW0A 3MUIA 4S39A 2QUTA 1IZCA 4DNMA 1M41A 2FTWA 4AIUA 5AN7A 3WLLA 4IP4A 4GNVA 1EBGA 1UOKA 3ICJA 2VGGA 4GISA 2DFAA 4ADTA 3ZO9A 4F79A 3S1WA 4CVUA 3NO5A 2GQ3A 4CEUC 2Y8UA 2GYIA 2G3MA 4BQ5A 3P60A 4LCRA 3MU7A 1Z8AA 4PE8A 1F8MA 4ZEPA 3PTQA 3W1NA 3BC9A 4JHZA 3MUCA 4ECLA 1I75A 5FEWA 4UCGA 3CIWA 3EA3A 3I4EA 2J79A 3YPIA 4G7EB 4LF2A 1W9DM 8RUCA 1J0YA 3GVRA 4BI7A 3QQWA 4JTAA 3R0DA 3FFSA 3WDJA 4NG3A 3PC0A 1MXSA 2WPGA 2VEKA 4K8HA 4OUEA 4S3GA 3CAQA 3MV01 3WLRA 3ITOA 4PMUA 2CBIA 4NX0A 1Y5VA 1WDDA 4RZ6A 2WK2A 3K1DA 4ERGA 1C7TA 1GGOA 3PBWA 4ZGYA 3ALGA 5JIWA 1F8IA 3SQLA 4H7ZA 4DLMA 3QGAC 2ZADA 3B8TA 3WUEA 4AD2A 2NX1A 4UFHA 5AHNA 4HPNA 2XGZA 4FMVA 4KBXA 3FSTA 3NPXA 3G0SA 3SECA 3A6OA 5I24A 3ME3A 2R9RA 1M7OA 3W26A 2FJUB 4C6OA 4FNTA 1M04A 1QCWA 4NZFA 1SPQA 1LBMA 2ZCGA 4JX6A 3CYJA 2X8RA 1E3XA 3E2VA 1LYXA 1LT8A 3OPSA 4PFHA 1FX6A 3GM8A 3S83A 3UZJA 4W84A 4Q8VA 4FA3A 5HMEA 5CQ1A 2YFOA 3CV2A 1LBLA 2VX4A 2OWCA 4AY7A 2V3FA 1NWTA 3FSUA 2YDQA 4D6DA 1OD0A 1Q7QA 3SCUA 2QJHA 1E15A 2LLEA 5EA9A 3AMDA 4Q8PA 2G3IA 2J6XA 2NVDA 3WQEA 3AICA 5HXMA 3UWWA 2X16A 1JIBA 3NSMA 4O15A 1TV2A 2UY3A 3ABQA 3THAA 3EX4A 4IOTA 3KVKA 1A5OC 1CB7B 4AZ7A 1V8EA 2FZ8A 1EDTA 4LU0A 3U6WA 4KKXA 3GTNA 2WAGA 4CU7A 4X22A 4ZTYA 1VH7A 4HNUA 3I7QA 1AW5A 2QJGA 3TUUA 4IGHA 1OD8A 2Y7EA 2VQTA 5C0QA 3MHUA 4MJ2A 4RKAA 5GJMA 4MYAA 2W4XA 3P8JA 1KKOA 3IGHX 4HA1A 4Z42C 3U7VA 5A69A 4DWDA 2CZFA 4O57A 2A85A 4YWSA 3VIHA 3UWZA 3XINA 1KV5A 3CT7A 1NH6A 3ITTA 1K7EA 1XLFA 1MYRA 3VIGA 1J0ZA 3TN4A 1P7TA 5BMWA 3AOFA 1E6SM 1UJPA 2PRLA 3KFTA 3C6CA 2XIIA 3SCPA 3NZ1A 2J77A 5H6HA 1PIFA 1CBGA 5D32A 4QX4A 5CXPA 3CL8A 3E02A 1M5WA 2QAFA 5D9MA 9XIAA 3DFTA 4C7GA 3LTPA 2L5HA 3LCWA 4OTKA 3C56A 1ZUAX 5LHEA 1WKDA 1L2QA 2HV5A 1MFVA 3GBDA 3P6LA 3WQPA 1MW1A 2QPSA 2QVNA 3KOZA 4W89A 4CU8A 3UXLA 3UXDA 3UXIA 3R43A 1RXOB 1JPKA 3RM8A 1EGZA 3VI2A 4GUHA 1NWSA 3NJ3A 4LOCA 4A22A 4AH7A 1TTQA 1XYBA 4K3ZA 3S2MA 3GBEA 3BCDA 3T55A 1CLXA 3P67A 1IIGA 3CB8A 4AX7A 3E0LA 3VO0A 3TWBA 3H53A 4QLJA 1Y5XA 3CV1A 2YDSA 5I3HA 3BMWA 3F1QA 4GQRA 3UG4A 2F84A 1KWKA 1BFNA 3GU9A 3W70A 2DJXA 2E9LA 5AZ0A 2ZTKA 5LNUA 1N8WA 3HG2A 1UBSA 4A4AA 3KS5A 1M01A 3EXSA 3BANA 1B0IA 2PCQA 3WQDA 1IEQA 5I23A 2JBMA 2ZDSA 2QDGA 3L4YA 3M44A 3WF1A 1J0KA 2JEQA 1GPWA 3TJIA 4BJHA 3AXXA 4WCJA 1JQXA 2J88A 4NL1A 2BTMA 3FY1A 4FP1A 3L2MA 1OGBA 4TV5A 4WSJA 1W1YA 2VJXA 3ABRA 4JYDA 2IS7A 2QUVA 1K4GA 2XN1A 1TMLA 3MI6A 2DZXA 3W81A 1Y7VA 5H2ZA 1Z89A 2XSBA 2PEVA 1WAWA 2A6LA 3NQDA 5HPCA 3QHNA 1R85A 3DFNA 3SSJA 4V1YA 2OWWA 2VDGA 7REQB 4ZQCA 3H22A 3EWDA 1LQAA 5E6YA 4L1WA 1GZ1A 2VT0A 1LT7A 4LUTA 3U48A 3ZR5A 2PTWA 4HOZA 1L9WA 4D9PA 5F1UA 1GVYA 5HJLA 2Y0FA 1GUVA 2Y2WA 5EBUA 4QNWA 3QOKA 2YXGA 5BXSA 2F61A 2WMGA 2J27A 3BAWA 4QRNA 1DXEA 2I17A 3W0KA 3GC4A 2OELA 3PBVA 1NVMA 1XD1A 3PUOA 5HBFA 3H2OA 2QV5A 3AHTA 1WE5A 2BXYA 3GRIA 3VVGA 2OEMA 3D0CA 3GVVA 1QNOA 4N9BA 1ZFJA 3BCJA 1H7NA 3G2GA 1UP3A 3FAWA 3FVMA 5G5IA 4GI8A 3QLLA 2XUCA 4B5XA 5EFDA 4R7OA 4A3HA 7TIMA 4H83A 3VNIA 1F6PA 2XYLA 4BCEA 4WLCA 3LPPA 2DSUA 1IXQA 1VLIA 4GYPA 3TW9A 4AISA 4LFYA 2GZXA 3W25A 1EOKA 4Y7EA 1YMYA 1R46A 2A1YA 3STPA 3GIYA 1C29A 1WP6A 3UZYA 1UZ4A 2YBVA 3WF2A 1JXJA 3QM3A 2Y4SA 3H2NA 1OF6A 3EX1A 3CS2A 2G41A 4FF5A 4U3AA 1KLZA 4LPCA 3QV6A 4R53A 2FZNA 1F61A 2Z1VA 1LUCA 5BOOA 3VX1A 1YE4A 2QAPA 4C6NA 3IJQA 5CJNA 3P82A 1A49A 1OK6A 4LS2A 5ABGA 1TPB1 2YL6A 3IIZA 3ATYA 3DFOA 4MY8A 4PODA 1U1JA 1R2RA 2QCEA 2QW5A 4LTSA 4IFKB 2E0PA 4NP7A 4JL2A 4TV6A 3CNYA 1LOSA 3TNBA 3G8EA 4GUFA 1ZCOA 4HYWA 1I8JA 3WEMA 3TSDA 4JTIA 1UKPA 2FTYA 4WY0B 3SY8A 1XLHA 2GGIA 1XKYA 3WNPA 4CCZA 2PZNA 3U3HA 1I1WA 1DL3A 1G4SA 1JCNA 2PDIA 2QV4A 3RN6A 3ISIX 3MMUA 5L9FA 3VA8A 1TQJA 4B4HA 3REQB 1TO3A 4QG8A 2XU2A 1M53A 3NL6A 2X40A 3IACA 4FXRA 5TBOA 1E40A 1E43A 1GWJA 3P8IA 4CN1A 4YTRA 1YDOA 4ICNA 4KCVA 3W7HA 3GS6A 2JE8A 2E8ZA 4LS0A 3DFPA 3EWWA 2VOTA 3RF9A 3WNNA 3QVQA 4D6HA 2UY5A 4DUWA 1E6PA 3HBLA 2PTYA 1GK8A 1VR6A 2WKLA 3M41A 5DXYA 1W9BM 3GFYA 2CERA 2PI6A 4X9SA 4MZ8A 1G0CA 1A80A 3SCQA 1CEOA 3FYYA 3UJFA 1A3HA 4G8TA 2A3BA 3PN8A 4WJEA 5FAGA 4GIEA 1SVDA 3SN4A 3O16A 4ZFCA 4IH3A 2EXOA 4RNFA 2TSYA 4CCDA 3E2RA 4GJIA 3VOGA 3BG5A 1KFKA 3L21A 4J3UA 1X1ZA 4FNPA 3ZFHA 1Q6LA 3NOYA 1A5MC 1BYDA 2VEMA 2G97A 2CLKA 2KAUC 3F2DA 3AZSA 3KOXA 3HJEA 2E5BA 4AIBA 1Y5WA 1YPIA 1VYSX 2Y89A 1QMLA 5BCAA 4MMWA 1OGGA 3WQ4A 4PTXA 3OU8A 4GFSA 4M24A 4XO7A 5A6MA 8XIAA 2ZUVA 1AQFA 2PDUA 3G22A 4GXMA 4P7LA 1MQQA 4V2XA 4A21A 2WMIA 4GCAA 1HJSA 4PR4A 3AJ7A 3PF3A 3VCRA 3OW1A 4JGDA 2GUYA 4IL2A 4MF4A 1LORA 2PGRA 4GXPA 1MW0A 4EIVA 3NPVA 3N18A 4Q7BA 1IHIA 1HGYA 3ZVIA 1UD8A 2VEPA 3OGSA 3EKLA 3W1AA 3SQSA 1B31A 4GZIA 2PLKA 1X1OA 4HN8A 4NZCA 2EGZA 3BLIA 3OTRA 3EDKA 5CJMA 3LPGA 1SMAA 4ZO6A 2G3JA 3LHZA 3U2OA 3EAUA 3DUGA 2R14A 3PZIA 3CU2A 2Z26A 5KITA 3TYAA 1NDZA 3N12A 5D2YA 2ZX7A 2YCJA 3V5OA 4UWMA 1HZYA 3S2CA 1K8CA 2XZ7A 2ZRZA 3S2LA 1DJNA 3DOPA 2GJNA 4GCXA 3EA1A 3W2MA 4PMOA 3C8FA 3VGFA 4MZ1A 4IJCA 1XLGA 1E1CA 2WZHA 3QZ6A 3WQ8A 1XCXA 2FHB