5AHIA

Crystal structure of salmonalla enterica hisa mutant d7n with profar
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
244
structure length
232
Chain Sequence
MIIPALNLIDGTVVRLRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIGSTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGWQENSGVSLEQLVETYLPVGLKHVLCTDIRDGAGSVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQCWQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-(5-PHOSPHORIBOSYL)-5-[(5-PHOSPHORIBOSYLAMINO) METHYLIDENE
publication title Structure and Mechanism of Hisa from Salmonella Enterica
rcsb
source organism Salmonella enterica
molecule tags Isomerase
total genus 74
structure length 232
sequence length 244
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5ahiA00
1JQVA 5AYYA 1SO6A 2EGZA 4L4MA 3LXCA 4EVZA 5G5IA 2VFEA 3F03K 4FX8A 2Y88A 3QRHA 1W1ZA 3LCXA 1J5TA 3DI0A 1EUNA 4QISA 5H2ZA 4YLWA 1M6JA 3NO5A 1OF6A 3U8GA 2J27A 4GXMA 4GUJA 3EWYA 3HGOA 3LB0A 3W7EA 1BWLA 2CZFA 2P0OA 2QCEA 3GX9A 3V75A 3KAOA 1VHCA 3QZEA 4LNYA 1X8FA 2G96A 1OHLA 2PRLA 1FCQA 3TXVA 4NU7A 4JGDA 3C2RA 1MEIA 1P0NA 1W3NA 3O6CA 4ZQCA 3W07A 3G24A 5G2IA 2V5BA 5K4XA 3C4UA 1TPUA 3F4NA 1DKWA 3G0SA 1I8JA 3LBCA 3DFOA 4I7VA 4U4MA 1TPH1 3I68A 1ZAJA 3M5XA 4Y6GA 3S1XA 3M43A 2YDAA 3IIZA 3M44A 4UR8A 1C9DA 5BOOA 4AXKA 1EWEA 1AMKA 3LV6A 3L66A 5IBXC 1OJXA 1JUBA 3ANYA 2C15A 4OGZA 3MW7A 1H7RA 3ZWSA 1W5OA 3PY2A 1OFOA 2GVLA 3RLUA 2YSWA 3L0KA 3LXBA 4RZ5A 4QAIA 4MJZA 4N9BA 4ORMA 4XTIA 4AB4A 1KM2A 1KM0A 4ZQOA 2VKZG 5HQEA 4O54A 5BMXA 3OVPA 2ZYFA 3LLFA 5I3IA 3S1UA 1X6UA 1R47A 2Q3RA 4UTKA 4K7YA 1KFJA 4HKPA 2ZZ3A 6ALDA 1ONRA 5F4SA 2AQWA 1OFRA 1TPFA 4E38A 3KHJA 3TSBA 5HWMA 3W2NA 1J4EA 5KITA 4NNBA 1TV7A 1IIGA 2PC4A 3LTPA 5D02A 4IMCA 3W87A 3MI6A 1Z42A 4HNNA 1UCWA 3PR2A 5EY5A 4M6QA 4GUGA 3B06A 3VCRA 4AF0B 2ATMA 3O06A 1OYAA 5T26A 1HO4A 1H60A 1H63A 1I2PA 3W88A 1OABA 3W1QA 1DHPA 3M5ZA 3N73A 5G4WA 3H55A 1H61A 4FIRA 4HSNA 3LCLA 1ZJIA 3CQ0A 3C52A 2NUXA 4QSHA 4MY9A 4NVTA 4BWLC 4MUZA 3DFQA 3W7GA 2WQPA 4UNKA 2WSQA 2FPVA 4Y9AA 3HQ1A 1ALDA 3FS2A 3PULA 1F74A 4BI5A 3VFLA 1WYIA 3CTLA 1U5JA 3BLIA 3NZ1A 2DZVA 2YYUA 3FA5A 3MBDA 1UASA 2NX3A 3D0CA 4EF8A 2WO5A 4JDYA 4LV4A 5SWUA 1DJQA 5I3GA 1R2SA 4FIQA 2CW6A 4YL2A 3AJXA 1JR1A 1QCWA 1SUXA 3RMJA 1L6WA 2NWSA 1Q6RA 1XBVA 1FBAA 4NJGA 3WK3A 4DXVA 3T7VA 3G1VA 2PRMA 3W1XA 3TR2A 3NDOA 2ZQ0A 3G22A 1TO3A 3W6YA 1F6KA 2E5CA 4E0CA 1ZENA 2V2CA 3TMQA 3IEBA 5CG7A 3O07A 4JTHA 4MOZA 5IBXA 3EWUA 3W7DA 4K8HA 1OFQA 1VLWA 1UJPA 1UUMA 4IXHA 1GQNA 4O50A 4WY0B 3SSJA 1PHQA 1P4CA 2C6QA 4ALDA 2EKCA 3IVTA 5KZDA 5C54A 4UTLA 1WXJA 2NV1A 4OWGA 3M16A 1LBMA 3NPWA 3W85A 3WFAA 2R94A 3FYPA 1W8SA 3LHZA 1N8FA 3P80A 2QCNA 4OT7A 4WY0F 3W7IA 3MYOA 4K8EA 4QNEA 6TIMA 1X1ZA 3DHFA 2ZDRA 4Q33A 4LC8A 4GUFA 5AC6A 4JS3A 1SFLA 4YCPA 3N34A 1VLIA 3OHIA 3GAKA 4R53A 1AL8A 5F2IA 1KTCA 2JGYA 4N9EA 2BLEA 2VEKA 1S5TA 1GVSA 2NXGA 4Z0SA 1TJPA 2CZDA 4AWSA 4A21A 5BMWA 4I7UA 2E6AA 3IGSA 4LS0A 1OG0A 4JTTA 5AHLA 1F73A 3LTYA 1WDWA 1K8XA 4PCFA 4UNLA 2RDWA 3M9YA 1B9BA 3LHYA 1F2JA 1FDZA 1LRQA 1W5PA 4BWLA 1ICQA 4ML9A 4QNWA 3G0XA 4ZQNA 1RV8A 1LTDA 4GFSA 5DXXA 4NNCA 2ZZ6A 4QIUA 3TSMA 4JY8A 1FWNA 1F5ZA 4XKYA 1G69A 3DFTA 2ALDA 5FEZA 1LOQA 5I3FA 4FO4A 3PBUA 3CIWA 3GK0A 4K36A 4NZJA 2Y7EA 3OVRA 1RPXA 4QITA 3EXRA 2Y7GA 2EHHA 1A50A 4TX9A 1XM3A 3VKJA 2A7PA 3DENA 5FF2A 3MBFA 3WK2A 1CX9A 3G8EA 1R2RA 4LC6A 3BO9A 3OIXA 1Z44A 4IGHA 3B04A 2CLEA 3P81A 5K9CA 4NZFA 4X3ZA 2E6YA 2J24A 4J9JA 3GNDA 5HR7A 3CPRA 3W7NA 3L5AA 2PRHA 5ABTA 3A21A 4O12A 4O14A 1A5SA 3UYCA 4E2DA 3QW4B 4MKNA 4LRSA 5LKYA 4O57A 1TQXA 3UWQA 3PB0A 2B7PA 1OX4B 3UWYA 1XUZA 4HNUA 2H8ZA 3A22A 3RNDA 4ZZ9A 2ZA1A 3W83A 4TMCA 1MEHA 3NQMA 5AHEA 4AEOA 1OF8A 2JK2A 2OZ0A 1NFBA 4LVFA 3EWXA 5DY2A 3CIXA 3MP4A 2Y70A 3P62A 3HF3A 4O1CA 3Q94A 3LHUA 1G4EA 5AHFA 1GOXA 3GXPA 4NQ1A 3L68A 4OV4A 3G0UA 2E6DA 2QEZA 2YFOA 4QM1A 4MPQA 2Y7FA 3BK0A 3M1ZA 2WSYA 3LDVA 3LX9A 2NZLA 1HG3A 1KTBA 3STCA 1F6PA 4IMDA 4UTMA 1G67A 1EP2A 2JBMA 4GNJA 2RH9A 1WQ5A 2B4GA 3GDMA 4EWND 3ATZA 3A9IA 5CZ0A 5G2WA 4WX2A 3TC6A 4A2SA 3I7QA 5G2HA 4JTLA 4O16A 4LUIA 1KM1A 4HT3A 3DZ1A 3GNNA 2FLIA 2X16A 4OBTA 4TO8A 3KVMA 5I3HA 5K7JA 3S0CA 4MZ8A 1YYAA 3NQAA 3Q58A 4JDBA 4YWIA 3DFPA 1OYBA 3TU9A 1DQWA 3QMRA 1V5XA 4DPPA 4HPJA 4AAJA 1K8YA 4PTNA 1H7OA 4LOCA 3EKZA 3H53A 1SU5A 2X30A 3M47A 5F1UA 3B0PA 3QQ0A 4O17A 5D30A 3FIGA 1KV8A 4N4QA 1O95A 3QQ1A 5AFDA 4ZVJA 1W3IA 4RLIA 2J9YA 3QM3A 2WV8A 3PC0A 4AH7A 4FX7A 1W37A 1H1ZA 1VC4A 1KLZA 3E0IA 2ISVA 4FNUA 4LTSA 4HPXA 3QW3A 2GPTA 2QCFA 1SZEA 4LVDA 3GXNA 5CPOA 2VFHA 3A24A 1A5CA 3HPXA 2J9ZA 4WUIA 1FCVA 3SR7A 3QJAA 4MYXA 3T78A 3PF3A 5HWNA 3ABRA 4L4LA 3EB2A 1G7UA 4UMBA 1LORA 2ISWA 4JX4A 3TX9A 3UZJA 4UMAA 4UFMA 1KBJA 1KBIA 3VE9A 2ZZ2A 3S5NA 3TKFA 4B5NA 1QFEA 3JR2A 5IM51 3O6YX 2C0AA 3DH7A 2Y7DA 3P67A 1IXPA 4UC5A 2TMDA 3CM4A 2ATSA 2QCDA 5LGZA 3GR8A 4R34A 2A0NA 3W86A 1F76A 4CCDA 3TSDA 5HMSA 1X1OA 3W7LA 2ZRYA 5AHMA 4PFMA 1K03A 2V0TA 1FWTA 2DZWA 1T99A 1LLZA 3BGGA 1YDVA 3NQ7A 4UFKA 4M7SA 1UB3A 3UNDA 4O18A 1OFAA 3DKJA 3NG3A 4OE7A 1CI1A 5CPLA 3O63A 3ZS4A 3LHTA 5D2XA 3UWWA 2NLIA 1VR6A 1ICPA 3MJYA 3MMTA 5DLCA 2PE4A 1ME7A 1QDSA 2VENA 3FEMA 3OEXA 4UIOA 3NQ8A 3DU0A 3OG3A 4HSOA 1TTIA 4LRTA 3BW4A 3YPIA 1SSGA 3LTSA 1FX6A 4IMGA 4TMBA 4XTDA 1KFBA 1RVGA 3W1LA 4DF2A 5D32A 3TA6A 3BARA 4A29A 5D05A 3ABOA 3N14A 3MO7A 3DGRA 3THAA 5CGQA 5G4EA 5I3JA 3GXTA 4QQ3A 1AK5A 1N7KA 2A7NA 2YW3A 2DZUA 2VXNA 3VI2A 2H3DA 4CNOA 3TQKA 4RXGA 1KFCA 4JTEA 3IVUA 2E77A 4MJMA 2B7QA 1O60A 3NQVA 1G4PA 5J5RA 1X7FA 1H7PA 2CWNA 1SPQA 3VE7A 1ZFJA 1ZAIA 3PUEA 2YW4A 4MYAA 3E96A 3M41A 2A21A 3IV3A 1YDNA 1VJIA 3HG2A 2J9XA 1GYNA 4O4VA 3E02A 3TCEA 3I65A 1TPWA 3W1TA 1QAPA 1TYGA 3S8HA 3FJ6A 2Y62A 2DP3A 3NPUA 3TQVA 1QMLA 3HBLA 5L6UA 1KV5A 3NPXA 1BEUA 1HUVA 3BW3A 5DCBA 5H91A 3R89A 1SR9A 1W3TA 2ABAA 1HFBA 3G3DA 1GYLA 2ABBA 4JYDA 2YZRA 1F05A 1LRTA 5EL1A 4OV9A 3NL6A 1SW0A 5CPMA 1SQ7A 1QO5A 3CWNA 3WJYA 4BK9A 1P5BA 3E12A 3QSTA 5TQLA 4FF7A 2DZTA 4IJBA 5F1VA 4LS2A 2VFFA 3PBVA 3LOTA 1XI3A 3WJZA 2QF7A 1W5MA 3W7JA 3N3MA 5D2VA 4LY8A 4IXXA 3W7HA 4FNRA 1XC4A 3LRMA 3LCWA 2UV8G 4EOUA 4AWTA 1GG0A 1YTEA 3W2JA 3ZWTA 5TBOA 4CQ8A 2PCQA 3C2VA 2V82A 5GVJA 2QUVA 3P84A 5DBUA 4I7WA 4JTGA 4WJEA 1OFBA 3SJ3A 1YXDA 3NVTA 1QPOA 3ABQA 3EX3A 2DORA 3STFA 3W1RA 1WV2A 3LI1A 2Y6ZA 4ADUA 3C2EA 3G1HA 3UY8A 4DO5A 2C1HA 4ZMGA 4N2YA 4XWUA 3ZFHA 3T44A 4FXSA 1YTDA 3STGA 1Q45A 2NXHA 2ZFAA 5CZTA 3W1PA 2FPYA 2VEIA 3EWZA 4RR4A 1DORA 4AHPA 3KRZA 3L65A 4GE8A 2QDGA 1HO1A 2CLIA 3QFEA 1FUYA 1PIIA 1J2WA 4JYFA 2WKJA 1DL3A 3MWAA 2P1FA 2GQAA 3I6RA 1D3GA 4AHOA 3S6DA 1DQXA 2QCMA 4ZL1A 3HGRA 1H5YA 3S5ZA 2CZ5A 3MYPA 1Q6QA 2IQTA 1KM5A 4IX0A 3S5OA 4JR5A 3P7YA 1AG1O 3PBWA 1I2QA 3W3OA 5BRBA 1TIMA 3B8DA 5D33A 3M0ZA 2QAFA 3LERA 1XUUA 4PC8A 4KFNA 4MZYA 3SGZA 1NSJA 1KM6A 1O94A 5KZMA 1HL2A 3L5LA 3QEZA 5KSWA 3O16A 4O1AA 2C19A 3NXFA 3TJXA 4NXKA 4HIBA 3WK1A 2J6XA 3DAQA 3W7PA 1OX6A 3T40A 4PA8A 2BTMA 1XDMA 4RKAA 1H62A 4U28A 3R13A 4I9AA 3SECA 3W1UA 1H50A 2B7OA 2C13A 2OCZA 1RR2A 2FB3A 5HUPA 1PL9A 2QJHA 3EWBX 2D73A 3UXDA 1SSDA 1XFBA 1OK6A 3NL3A 4LVBA 5AC8A 2H6RA 4G1KA 5DXYA 4M19A 3GR7A 4NJKA 4UFHA 3RLVA 3IIPA 3W1MA 1LYXA 3LHWA 3BG3A 1WAUA 2FDSA 4S2BA 3C61A 1JRBA 1C8VA 1RQBA 1ZY9A 4DF1A 3WJXA 1SO3A 2B0MA 4KKXA 3BLEA 1OVDA 3JS3A 5F4WA 5AHNA 3B0VC 1WOAA 3PG8A 3LM7A 4IMEA 3U6WA 4HN4A 2WNNA 4KWVA 2DJLA 2H90A 3IRDA 3O6DA 1KFEA 2ZBTA 2R91A 3HPZA 3LV5A 4UFJA 2H3BA 4Y8FA 4DBEA 2QJIA 3IIOA 1JCLA 3L9CA 3TFXA 3KRSA 1KTNA 1TSIA 5D03A 3RFAA 3HGJA 1THFD 5LZLA 2NX9A 3UWVA 4UFIA 3W2KA 4M6VA 1OFEA 1YADA 4AF0A 2C3ZA 3MHFA 5D2WA 3OA3A 3NA8A 3RF9A 4ONVA 3PWAA 4RV8A 2Z0IA 1NVMA 1LLWA 1VHNA 2X1SA 2ZA2A 4UTHA 1KFKA 2I14A 4LWWA 4FXRA 2KZHA 1KW1A 4ZQPA 3NYZA 1B57A 3GVGA 3N2XA 4O4WA 3TROA 4IPIA 1JULA 3HJZA 2RDTA 3UY7A 3PSWA 2F7FA 4RCXA 3RK8A 1L2UA 2FJKA 1LP6A 5G1TA 3A5FA 4D2JA 5LSMA 1YPFA 2E09A 5AOUA 1WBJA 1SFJA 1TREA 1OFDA 3NZRA 3NQEA 1E51A 1ICSA 1A53A 1TPVA 1WA3A 2XFWA 3LCHA 1JRCA 5DELA 3HGSA 5KZEA 1YXYA 3SGUA 4K7VA 3C3NA 1QPQA 2XN2A 4QJ1A 3L0NA 4O10A 1W56A 5MHBA 2DZXA 2DU2A 1VYRA 5EPDA 1CW2A 3W7RA 5HWJA 5LHEA 3G1DA 4PEKA 2FFCA 4H6KA 3FFSA 1PVNA 4JY9A 5D37A 1TPDA 4ORIA 2X2GA 4GBUA 1ZCOA 1EA0A 5BW6A 2W0UA 2JGQA 2RFGA 3P60A 4JNMA 3OVQA 2ZA3A 2JKAA 3W1NA 3OBKA 4WY0A 2VEPA 1IXNA 5FF3A 2YR1A 4RX0A 4FX6M 3KXQA 5AN7A 3P82A 3BGJA 1LBLA 1XBZA 3LCGA 3W1AA 2BZNA 2TRSA 2FTPA 4A2RA 1VCVA 1T8XA 3HG5A 4IPJA 4UTIA 2A6NA 2JKPA 1O5KA 3MHGA 1G4SA 2QR6A 3G1AA 3G1XA 2Y61A 1OX5A 4WQ6A 1MO0A 4XBSA 5F2LA 4LVGA 3CLMA 4DPQA 3NGJA 2VFGA 5CZJA 5LNUA 3MP3A 4KFOA 2OJPA 4RZ4A 4JICA 3WJSA 2A7RA 2FIQA 1K3UA 3BPWA 3T4CA 5TIMA 1GEQA 3DBPA 3ATYA 3BG5A 4N9CA 3L2IA 3PM6A 3R8RA 2VELA 1QNVA 3BW2A 3S5YA 3GDRA 2QCGA 2W79A 3STEA 1VH7A 4JTSA 4DEFA 4LUJA 2BX7A 1L6YA 5D09A 3PG9A 2FB2A 3FOKA 1IIHA 4IOTA 3EEGA 4KFPA 2ZRZA 2ISSA 2WNQA 4IX2A 2J88A 2CZEA 3WJWA 1NF7A 3O8AA 5AC7A 4HNVA 5D2YA 4WZHA 2E1DA 3IIVA 5D38A 5K4ZA 3NAVA 3LXAA 1F7BA 1NEYA 1I2RA 3O15A 1VCGA 1LOSA 4UUIA 3TAKA 3CHVA 2V2DA 4NNAA 4RK8A 4X9SA 4JEQA 2V81A 2C18A 3TMLA 2G97A 3INPA 3NM3A 1H7XA 2F84A 3JRKA 3BVJA 1WBHA 4AMAA 5HULA 1BWKA 3V1PA 3QPZA 4MZ1A 3B05A 4JIPA 4LT9A 3C0JA 1SO5A 3C2OA 3TJLA 1WOBA 4H4IA 3KX6A 4M7TA 3EKLA 3NOEA 1JCMP 2CLFA 1GTEA 5G1YA 4MIMA 1Z41A 3TXZA 2V2HA 1QO2A 1S5WA 1H7WA 1TCDA 2QUUA 4RXFA 4JTFA 1K02A 2EAWA 1OX4A 3USBA 2CFFA 1I2NA 2C16A 2I9EA 3QF0A 4Q4KA 2JKEA 4MFDA 2VEMA 2V9DA 1LBFA 2YPIA 1PS9A 2WOQA 5K9DA 2PURA 4CNNA 5K3VA 3TFCA 4FHAA 2BSLA 1TRIA 2RHGA 1SW3A 4BI6A 4Z1AA 2RDUA 3GKAA 1LM1A 1B3OA 3NEVA 4C1KA 1IXQA 4CQ9A 4LVAA 3PUOA 4JYEA 1Z48A 4XBKA 3NQ2A 4S1FA 3W7KA 4YMZA 4AWUA 3HIJA 1YDOA 1XL9A 2FQIA 4GRSA 2QJGA 5E1QA 4X22A 3A5VA 3IIXA 1DJNA 1M5WA 2QKFA 4JXCA 2NWRA 4N9DA 1LDCA 3TDFA 5F4XA 1JCNA 2AGKA 1N55A 1IXOA 4E2BA 3G1FA 3TH6A 5D04C 5D2TA 5K2ZA 3W70A 2GJNA 3K30A 2QCCA 3UPWA 1KM4A 4LS1A 1BTMA 3L67A 1GZGA 3G8RA 2GQ8A 3N9RA 4MY1A 4DBDA 4FNTA 1B4EA 3N9SA 3NL5A 1VZWA 4GUIA 4JTKA 3LBMA 3QSRA 5HR6A 2A85A 4UTJA 4JD4A 4JX5A 2DJXA 1GVRA 3P8JA 1PHWA 3M7WA 2ZZ4A 1VYPX 4MY8A 3P5ZA 4UR7A 4YCOA 3SW6A 3QH2A 2A1YA 1JVNA 1D9EA 5CPNA 3W2MA 1W5QA 2A6LA 1VCFA 3DI1A 3O05A 1T0OA 1TQJA 3LRLA 4NX0A 1JQXA 3S42A 2VFIA 4JTJA 3CB8A 1ME9A 2OX1A 4CCCA 2Q8ZA 1DV7A 4O0ZA 1AW5A 2V30A 3G3MA 1JCXA 2R8WA 2Z1BA 1EIXA 4EF9A 1SW7A 4JN6A 3EX4A 4K39A 3L5MA 1TPC1 5CSSA 1FDYA 1JUKA 3L0GA 3ZR4A 1TTQA 3N19B 4P61A 4UTTC 3CEUA 2Y63A 1I45A 5EMUA 5DY3A 4AHQA 4O53A 3N2MA 1EPXA 5HINA 5HUOA 1D3HA 1YLVA 3SY5A 1EP1A 1TPB1 5AYXA 3NQCA 4Y90A 7TIMA 4GUHA 4O19A 3CT7A 5DCEA 2O7QA 8TIMA 1LRNA 1GTHA 1H51A 3W23A 2NUYA 4XKYB 4IMFA 2NV2A 3G1YA 4NUWA 1LZOA 3LCIA 4NX5A 3NQGA 4R7JA 4FNQA 3FJLA 3M6YA 1FY6A 3GZ3A 1GVQA 1PE1A 3GDKA 4KWWA 2HMCA 4IWWA 2AAMA 4OQVA 1FCBA 1LCOA 2DZSA 4NJHA 1IF2A 3VNDA 3FYOA 3GIYA 1XDLA 1K7FA 1RQEA 3KRUA 2VFDA 3QPYA 1Q3NA 4MVAA 1A5AA 3SZ8A 1JCYA 4C1LA 3GKFA 2HTMA 4JX6A 1V7YA 2GUUA 1KM3A 4DF0A 2X1RA 1XBXA 3GDLA 3BLFA 4CLMA 2DZPA 1S3HA 1VGAA 3TE9A 4FNSA 1UBSA 3FKRA 3O1NA 5DN1A 1K8ZA 3L21A 4O1DA 1H1YA 2WPBA 2E5BA 4N6FA 2V8ZA 4WD0A 1IGSA 1FWSA 2YGYA 3W2UA 1W54A 3DFSA 4UTWC 3S9YA 3NNTA 4LU0A 3SIZA 2CLHA 3DXIA 4N6EA 5FESA 1ML1A 2C14A 2GOUA 3TW7A 2TYSA 1TV5A 2X1TA 4O8RA 4GJ1A 4WXYA 3R2GA 1R46A 4EIVA 3CC1A 2HS6A 5FI8A 2OT1A 4DO6A 4UTUA 1SZFA 4WOZA 5KINA 2CLOA 1GJPA 4DELA 2TPSA 4CNPA 3UD6A 5L9FA 3HG4A 5LNRA 2E68A 3THQA 1G6CA 1PV8A 1ME8A 3W75A 2E6FA 1FXQA 3CWOX 1FXPA 2QUTA 4OHQA 4WOQA 3HB9A 3TW6A 5LNVA 1FWWA 5F2MA 1UUOA 4TR9A 1ZHAA 2YX0A 4W9TA 3NM1A 3LI0A 1H7NA 2GJLA 2ZZ1A 3EXTA 4BF9A 4JTUA 3Q37A 3C56A 2A4AA 1Q6LA 3M5VA 3W9ZA 4UTTA 1R2TA 3PAJA 1O4UA 3B03A 3A23A 1U83A 4CQAA 2TSYA 3R12A 1G7VA 1MZHA 4UXDA 3S1WA 2WNZA 4FEZA 3DKLA 4PL2A 2Z6IA 2ZRWA 3W2LA 3W73A 3C8FA 4K6AA 4O28A 4PL1A 4PODA 2ZRVA 3GDTA 4HNTA 1EWDA 3NQDA 4N02A 2VOMA 3NL2A 2GQ9A 1MSSA 2Y85A 4UMCA 4Z1BA 5EBUA 4YXGA 3W71A 1P1XA 1QPNA 4H3DA 1LROA 4Z0JA 3BG9A 5AB3A 1GVOA 3W74A 4LW7A 1TB3A 3FKKA 4MFEA 5C6MA 1VS1A 4XUGA 1VPXA 2CU0A 1TTJA 5EA9A 4BI7A 4POCA 5CZSA 2P10A 4K38A 3PVFA 5E0KA 5F2GA 1T96A 1AL7A 4NJIA 2I1OA 1TPEA 3NR0A 3ABSA 1VQTA 3UWUA 3GAYA 4O1BA 1VRDA 4WXZA 1XXXA 2O7SA 4X2RA 1NAL1 1W31A 1FCUA 2Q3OA 2HSAA 1K7EA 4NJJA 1XCFA 5C5YA 3NQFA 2YCEA 1XKYA 2BWGA 1TV8A 2NX1A 3I7RA 1JCJA 2YYTA 3W7MA 2QCDB 3C2FA 3EWWA 4K37A 4UTWA 3W22A 4IQLA 2RKXA 2YXGA 1P0KA 5U4NA 1SZGA 2ZRXA 3KVLA 1RD5A 3MI2A 3KOFA 2WSRA 3P61A 3PS7A 1GG1A 3MP5A 3CEPA 1ZAHA 4BR1A 1EX5A 4NT0A 4M6PA 5FEPA 3LGEA 4GC4A 3EX1A 1GT8A 2R14A 4UFLA 3IGUA 5U7SA 1W0MA 4DO4A 1OK4A 3M5YA 1A5BA 3TC7A 3EX2A 1WX0A 5CSRA 3B0UX 1RQHA 1L6SA 3UWZA 3RU6A 3GLCA 1QWGA 2ZCGA 1EUAA 5FF7A 3TK7A 3MUXA 4O13A 4LV9A 1K7XA 4O0KA 3LLDA 2QDHA 2X1UA 3UZ5A 1HTIA 1FDJA 2OMAA 2Y89A 1YXCA 1L9WA 1QR7A 2ZZ5A 2W6RA 5LNWA 1KA9F 3PUDA 3MHUA 4Y96A 5FEXA 1DOSA 2G5WA 4GWEA 3UXAA 2VC6A 3LRKA 4XQ6A 3F1QA 1DVJA 3SI9A 3KVJA 2EPHA 3MI3A 2Z2UA 4A3UA 5FEWA 1R30A 4MLJA 1PCWA 3I7SA 3G1SA 3TV8A 1QPRA 2WJZA 3CU2A 1OFPA 3HOJA 1KFLA 3W72A 2BXVA 5I3KA 4N4PA 5HNRA 4JIQA 4HHPA 1I2OA 3W7QA 3B4UA 3BV4A 1ZALA 2YFNA 4BFAA 1XBYA 1ZNNA 1MEWA 4M5PA 2FPTA 1Y0EA 3W7OA 1W5NA 1AW2A 3G18A 3H54A 3LHVA 3TQ0A 4TIMA 1OYCA 3WK0A 2E5DA 4O15A 3UQNA 5KMYA 3GB6A 2ZTKA 4Z08A 1SZNA 3AO0A 3P74A 2A2IA 4IUOA 4RZ6A 5E93A 3FLUA 4FNPA 4AVFA 3E9AA 3P8IA 1EP3A 1ADOA 3HMJG 4NXSA 5DBTA 4OU1A 4R33A 1FQ0A 3S1VA 2A5HA 5FF0A 2ZTJA 5EKYA 3PB2A 4ICNA 5CKSA 3KFTA 5J5DA 3C6CA 5HJLA 3DHDA 3R5EA 3P5YA 1VYSX 4ADSA 2B7NA 1LOLA 5C55A 2HS8A 4Q32A 3HG3A 2ZZ7A 4Z1CA 2G95A 3PBYA 5LGXA 1DBTA 3KVKA 3QMTA 3TUUA 1RZMA 3PSVA 3QC3A 2V5LA 4ZQMA 3HO8A 4Z1DA 2XN1A 4A22A 5A8GA 5LNSA 4ADTA 5AHIA 4CCEA 4XZ9A 1YPIA 2CLKA 1M7PA 1KLYA 3W7CA 3HPSA 1M7OA 4TU1A 1Q6OA 4DQWA 1YTKA 3SFKA 4P2VA 2Q8LA 2EF9A 3EX6A 1JUEA 3DFNA 3QMSA 3W76A 1NF0A 4O11A 2XN0A 3EXSA 3IVSA 3QYQA 1MXSA 3GYEA 3NQ6A 5EYWA 5KTLA 4ZQRA 1QOQA 5A5WA 3NPVA 3E49A 4O52A 5K9XA 2ZRUA 3LCFA 3ELFA 3F4WA 1TJRA 1TTPA 4FB7A 1I4NA 2GVGA 5FF4A 2GVJA 2NXIA 3U2OA 1TRDA 1EEPA 3W84A 5BNKA 1B4KA 2OT0A 3T55A 2LLEA 1G4TA 1JJKA 4UCGA 1QOPA 2CLLA 1C29A 2QAPA 2QCLA 2Z6JA 1GVFA 1S5VA 3Q2DA 1EB3A 2QCHA 5DCDA 5AYZA 2H8XA 1GWJA 3TAOA 1AW1A 4S2CA 1BKSA 1SO4A 2NUWA 3IGXA 4MLRA 5C2XA 4RJEA 5LHFA 1O5XA 1FWRA 1GPWA 2CLMA 3UPBA 4PH6A 4JTIA 3TIMA 1PCKA 3TNOA 1TMHA
chains in the Genus database with same CATH superfamily
1JQVA 3MA8A 5AYYA 2EGZA 4L4MA 4EVZA 1FH7A 5G5IA 5FJJA 2G41A 3SUSA 1J5TA 1G01A 2P88A 3VGHA 4GIAA 2V3GA 3GNRA 1XYCA 4JHZA 4GXMA 1F4AA 1BVZA 4GUJA 3V5FA 3QR3A 2V5CA 3HGOA 3LB0A 4CVUA 1C8QA 1QBBA 1MQRA 1TJ1A 4IQJA 2G96A 3VKCA 2PRLA 4NU7A 3W07A 3C2RA 1A5OC 1MEIA 3PZIA 3FW6A 3TNBA 3VDCA 3R11A 3C4UA 3F4NA 1KRMA 2XFFA 1HIZA 1DKWA 4Y8EA 3WF3A 3UBPC 4AZCA 4P7LA 1P6BA 3DFOA 4S3EA 4XAGA 2IKJA 1X97A 1H3GA 4GYPA 1TPH1 3S1XA 1CGYA 5FL1A 4PTXA 3AMDA 3M44A 1C9DA 4NIRA 5BOOA 2CBIA 1M7JA 2OPJA 3KBNA 5GNZA 2ZUVA 5HBFA 3ANYA 2C15A 3MW7A 3QHNA 1OFOA 2CPUA 3WLSA 2WHMA 2GVLA 2YSWA 4QAIA 4LUTB 4N9BA 3GRIA 4ORMA 1KM2A 3HPAA 2GUYA 1MYRA 5I3IA 4YPJA 3S1UA 3NZPA 1EJRC 3OLIA 2BOEX 1XLAA 1KFJA 3EKGA 3PTQA 2ZZ3A 1OFRA 1TPFA 4E38A 3TSBA 2J4GA 3W2NA 4NI3A 4FI4A 3OOQA 4YTSA 3SUVA 4DWSA 3QC0A 4PTMA 3W87A 2Z2BA 1GKPA 5BROA 1I1XA 4PUNA 1K9EA 4EPEC 1OC5A 3S83A 4IM4A 1XH2A 1HO4A 3VKDA 5BOEA 3IJ8A 2XVLA 4QFUA 5E0CA 1DHPA 2XZ7A 3M5ZA 3OZOA 5G4WA 4QCFA 1VBRA 1F3XA 2VM8A 4M82A 2NUXA 4QSHA 4GABA 2UWFA 1E3XA 4MY9A 4PGLA 3FVDA 4BWLC 4MUZA 4UNKA 4GZJA 2XPKA 1PYFA 4HN8A 1F3TA 4UZUA 4BI5A 1ZUAX 3NZ1A 3MCOA 2DSVA 3G77A 1UWSA 3EDFA 1UP0A 1ZP4A 2NX3A 4GY7A 1KD0A 2PDJA 2FHFA 5I3GA 4A8LA 1JR1A 4RDVA 1L6WA 7ODCA 4NZ5A 3MZ2A 3WLMA 2NWSA 2Z7GA 4V2XA 2ACQA 4QX4A 3W1XA 4GFIA 2J47A 2MANA 1EF2A 3W6YA 7REQB 1JXJA 1DTNA 2V2CA 3BSMA 3H21A 3VA8A 6A3HA 5CG7A 4MOZA 3AOFA 1XLLA 3L4UA 5CSYA 4AD5A 4IXHA 2OVLA 2C6QA 3WMCA 2QT3A 3S5SA 3SY8A 1TVLA 1K77A 3KW3A 3GVQA 3NPWA 4IISA 5CGTA 4HMDA 2W92A 4ZO8A 3IV8A 4PCSA 3JZUA 5A6BA 4D72A 3LHZA 2XUCA 1JNDA 4WY0F 4DX3A 2QNEA 4K8EA 4QNEA 3EPNA 5HNUA 4LC8A 5AC6A 4JS3A 1S39A 4HSHA 3IS4A 2W5FA 3S2NA 2YA0A 1GVSA 3H24A 1IZKA 4U3CA 4Z0SA 2PSNA 2F8QA 5G4HC 4A21A 4I7UA 2HXTA 1J0YA 1GGOA 5AHLA 2WWCA 4B5XA 3LTYA 1WDWA 2XVKA 3UR2A 2CETA 4IMAA 4UNLA 1NP2A 1QBAA 2W63A 3T08A 3GUWA 2WMIB 4BWLA 1TX2A 2FTYA 3ZM8A 1YDYA 1K4GA 2BASA 4JY8A 5T9BG 1O6IA 1G69A 4D9PA 5FSDC 4YNGA 2YCLB 1UZDA 4R88A 2VYOA 3OVRA 3E74A 3EXRA 4GYKA 4DB7A 2Y7GA 2DSUA 5C9RA 2A7PA 3AYTA 3DENA 1OBAA 2W3ZA 1UZ1A 2WM0A 1R2RA 4HP5A 1OCNA 3OIXA 1Z44A 3S2CA 4US6A 4IGHA 2CLEA 4PUWA 4NZ4A 5K9CA 1QJWA 1KWKA 1ZSXA 2PDMA 3W7NA 3L5AA 1RCXB 3DFYA 4J2PA 3MWCA 4O0QA 3RIKA 2PDLA 1A5UA 3J7HA 1A5SA 3LZ3A 3F5LA 4LRSA 4O57A 3AXKA 1OX4B 2WHLA 3AMCA 4BEUA 3GHUA 1V02E 1JDCA 2P0IA 5I00A 2BDQA 3ZYZA 1EQCA 3N6HA 3W83A 2R6OA 3BTNA 4JHMA 2FFIA 3HFTA 1EGZA 5DF0A 3ISIX 4PR4A 4GZIA 1PX3A 3CIXA 2OFJA 3MP4A 4O1CA 3M0KA 1TA3B 2BY2A 4CNSA 1G4EA 1OZQA 3KTSA 2PDQA 2Y7FA 4W5ZA 2WSYA 1DJWA 3LDVA 2NZLA 3BSGA 2XH7A 4IG2A 1KTBA 5EBAA 4IMDA 3NDYA 1ONXA 2PDGA 2Y24A 3O9NA 3BLOA 4WX2A 4TUFA 2OWCA 1ZRQA 3GC5A 1QI3A 2OLAA 4C6FA 2X16A 4OBTA 2D0HA 3RM4A 3DFPA 1OC6A 1V5XA 3CZJA 5EMMA 4DPPA 3H53A 2X30A 3BCJA 3LA4A 3B0PA 3WQGA 4C6CA 3FIGA 3UR8A 4AFYA 3QQ1A 1NJJA 1BD0A 1C92A 3PC0A 4PRTA 5DX7A 4FX7A 1H1ZA 4R7OA 3A4XA 3SN4A 4MWAE 3CV6A 1XG3A 3ARTA 2VZTA 2ISVA 3UVAA 1J0JA 3QKEA 3CV1A 4XZWA 3QW3A 2I57A 2ZVIA 2QCFA 1E6RA 1SZEA 3SM0A 4WUIA 4RPPA 1IWPA 4GGHA 4X0NA 1RPKA 3SR7A 3QJAA 3PF3A 3R43A 3R8GA 3U5YA 1F8MA 4PFHA 5F7UA 3EOSA 1FP9A 4JKKA 1MVYA 5E5CA 1Q7MA 4Z17A 1T7LA 2ZZ2A 4JTAA 3ARVA 4BF7A 3U0HA 2C0AA 3DH7A 4HMCA 4NI8A 2BVYA 3VGDA 3CUZA 3TJ4A 3P14A 4WSKA 4GJJA 1XICA 5LGZA 4R34A 3VD5A 4MNJA 3C8NA 3TTQA 3G5EA 2D2OA 5HMSA 1KFWA 4MDOA 1WNOA 2ZRYA 5D9PA 5CC5A 5CLWA 1RALA 1FWTA 2DZWA 3NQ7A 3GNOA 1UB3A 1HP5A 4O18A 3K1GA 1E0WA 5HJXA 1SVDA 3LGDA 1CI1A 1X7IA 3ZS4A 3I3EA 4Z2HA 4TX6A 4HYVA 2GGHA 3TTOA 3AYSA 3UWWA 2NLIA 1WKYA 1HXJA 3PZTA 3MJYA 5DLCA 3W38A 1GOIA 1QDSA 1KXQA 2EPLX 1I1WA 3RJXA 3OG3A 3SBFA 2BOGX 3ICJA 3LTSA 1ECQA 4IMGA 4TMBA 4UQAA 4GC3A 1ITXA 1OZMA 4XTDA 4AY7A 2W9MA 2Y8UA 3LEPA 3W1LA 3UG4A 4GIYA 3V5OA 4A29A 2OYLA 4MF4A 3N14A 1CIUA 1JZ6A 5G4EA 4TOQA 3VNKA 2DFAA 5REQA 4GX8A 2DZUA 2H3DA 4NSBA 3TQKA 4RXGA 1YE4A 1KFCA 1R6WA 3BMWA 4MJMA 4MUPA 2B7QA 3APGA 4PRRA 3VUSA 3WX7A 5J5RA 1X7FA 3K1DA 6CGTA 3KS5A 1V6VA 4DHGA 2YW4A 2P50A 3E96A 1YDNA 2BVWA 5JQ9A 1XLEA 1UR2A 3I65A 4P7NA 3WL1A 3S8HA 1E4MM 3R4IA 3BV7A 2DV0A 2WWDA 2FZNA 3CQHA 1KV5A 3KEHA 1RJQA 1A0CA 1F05A 5EL1A 3WD4A 1KKRA 3KZPA 4OV9A 3CWNA 4JFWA 2JE8A 5TQLA 5F1VA 4F0LA 2VFFA 4C1NA 2RJGA 1SMAA 3WDRA 3ZSTA 1W5MA 3OODA 3W7JA 1UH3A 3ARZA 1J79A 5D2VA 4IXXA 3SB0A 3FVMA 3W7HA 1IHIA 2BV9A 4WJ8A 2HQAA 3LRMA 3LCWA 4EOUA 1GG0A 4PSPA 3W2JA 4QRNA 2O9TA 1XIGA 4HPGA 4IJRA 3C2VA 2QUVA 3P84A 1PTAA 4JTGA 1OFBA 4I3GA 1Q2RA 3CHCA 1QPOA 1M04A 3GNPA 3ABQA 4IFKB 2DQWA 4DN1A 4DLFA 3MVTA 3NFUA 4ADUA 3G1HA 2C1HA 3VYLA 3EDKA 1GCYA 2ZUNA 4CQBA 3KTCA 2DT3A 4XAYA 2FPYA 4R5EA 4RE0A 1XYLA 3EWZA 1FFQA 3L12A 1XLFA 3L65A 3ITOA 1ZB5A 2WHKA 8A3HA 4JFSA 1FRBA 4RDWA 5JIPA 1EGMA 2OZTA 3KTXA 1HKWA 3I6RA 3VC5A 5DT5A 3ARQA 1EXPA 2QCMA 1OD0A 2XGBA 3EDJA 1C90A 1XIEA 1H5YA 3FDKA 2FMNA 3RJYA 4GLEA 2JF6A 3GHRA 2AMXA 5FJOA 4R3UA 2OO6A 1TIMA 3B8DA 5D33A 2WC7A 3S6TA 3LERA 1XCWA 4W93A 4PC8A 4MZYA 3SGZA 2VJXA 1DWJM 2V3DA 1QHZA 1UMLA 4D1IA 3NTYA 5DT7A 5KZMA 5KSWA 5BXTA 3O16A 2J7FA 1OGSA 3R8HA 5HMDA 2INEA 3T40A 4AXNA 4K1GA 4I9AA 3W1UA 3DCPA 4WDUA 5E6ZA 4X9YA 1SSDA 4HZ7A 1OK6A 5KETA 1Q2SA 3FSUA 5A8MA 4A35A 5ENLA 4AD0A 4DBWA 3WEZA 2PGFA 4EPDC 4ROPA 3W1MA 4W89A 6XIMA 1WAUA 4S2BA 1J0KA 1JRBA 1ZY9A 2EXOA 1R9YA 2PTWA 1MZRA 3ITXA 4JCMA 4KKXA 3HV9A 2XH2A 3BLEA 1OVDA 3JS3A 1YKWA 4NKCA 1EFZA 1LG2A 2D2GA 3B0VC 3B9EA 1AMYA 4QXIA 3VCCA 3ARYA 1J96A 1P0EA 3IPWA 2WVTA 2PDCA 4NILA 5BOFA 2ZWYA 3BICA 1KFEA 2R91A 3IGHX 3U2EA 4UFJA 4ECLA 4H9UA 3VIPA 2QJIA 1JCLA 1KTNA 1YNQA 4MJ2A 2XSXA 5GJMA 4ZA0A 2X0YA 3GM8A 2BHUA 2VGGA 3HGJA 5FAJA 1TVNA 4M0XA 1EJTC 2NX9A 2HZGA 2PI6A 3WMSA 2GGGA 3C0LA 2C3ZA 3MHFA 1JZ8A 4XZBA 4CU6A 2JIWA 3RF9A 2GDVA 3T0DA 2ACSA 4ONVA 3PWAA 3IAPA 1VHNA 4E6MA 1U2YA 4QLJA 4LWWA 1DJGA 4HJFA 4WJXA 2GJRA 4IFRA 3PWIA 1EPVA 3N2XA 4Q6JA 3KL0A 1VBHA 3HJZA 2ZX6A 3MUAA 1TWSA 1X8CA 3N29A 1PBGA 2F7FA 1HKJA 1POKA 2ZUUA 4CU7A 5A3HA 1BG9A 1YPFA 2E09A 2VVNA 4A8NA 1J11A 1TWIA 1D2KA 5HNNA 2VCAA 4FAMA 3LCHA 2X42A 3NZGA 1DWFM 3HGSA 3W6LA 2SFPA 3R0DA 3SGUA 1DYSA 4B4HA 1U30A 4E4FA 4DM2A 1YBQB 1X38A 3L0NA 2X40A 4O10A 5MHBA 3ZXWA 4F3HA 1VYRA 5EPDA 4ZBCA 1CW2A 2IQ0A 3WENA 3W7RA 5HWJA 3MUY1 3G1DA 4B16A 4H6KA 1RCQA 2WANA 1TPDA 3VD7A 2JF7A 2JGQA 2RFGA 3P60A 2V68A 4HHMA 4JNMA 4F2UA 3T2PA 3W1NA 3OBKA 3BE7A 2VEPA 2GFTA 1EDTA 2YR1A 4TV5A 3WLPA 4FX6M 5CBBA 1E9IA 3APTA 1R3SA 1L2QA 3LCGA 2PDKA 3W1AA 4NYYA 1DXFA 2FTPA 4I9JA 3HG5A 4UTIA 3OP2A 2XIOA 3TONA 4C6PA 1VFHA 4WQ6A 4LPCA 5F2LA 4AZCB 4LVGA 4IIHA 4UOQA 1OGGA 3KZSA 4DPQA 5I03A 4Q3MA 3OGSA 3BPWA 2D23A 1GEQA 3AQUA 3BG5A 5HQLA 4US5D 3PM6A 3FV9A 3N3TA 1N8WA 2VELA 1QNVA 2PLKA 2DIEA 2YDSA 2W79A 3GDRA 3D46A 3STEA 3CO8A 4JTSA 1C7TA 4DEFA 2P76A 4LUJA 2BX7A 5D09A 3PG9A 2FB2A 4Q8WA 3FOKA 2OWXA 2ISSA 3AXXA 4CQDA 3U3HA 2BBFA 2E1WA 4LY4A 4IX2A 2RUSA 4L80A 2Z00A 2YL6A 3O8AA 4HNVA 4WZHA 3IIVA 1Q66A 5K4ZA 5JU6A 1LL4A 6PTDA 1F7BA 1I2RA 5IOBA 3WQ4A 1VCGA 4B2DA 3CHVA 3ORWA 3WY1A 4RK8A 4DWSB 1R5YA 2C18A 2V81A 1YW1A 4QEEA 3BVJA 4AIUA 3GVWA 1E9YB 1M68A 3V1PA 3QPZA 3PK7A 4S3GA 2J8GA 1XLGA 4LT9A 2RAGA 3C2OA 3TJLA 1RXOB 1WOBA 3V0TA 4M7TA 4GI4A 1QNOA 1JCMP 1GTEA 5G1YA 2WXDM 4MIMA 4GIEA 3WG6A 2V2HA 1QO2A 5I5RA 3XINA 4JEJA 1XW8A 2P3ZA 3RGTA 1N2VA 3PFMA 2I9EA 2CKRA 2GSJA 4Q4KA 3WLQA 4MFDA 6REQA 3VIOA 4ICCX 3OQ8A 2YPIA 3W0KA 1TV3A 2FZMA 1HL9A 1XD1A 1J12A 4GG9A 4FHAA 2BSLA 1SW3A 2OWWA 3SSZA 2OQYA 4LYKA 1K70A 3OA5A 4L1GA 1GW1A 4ZSTA 3H2AA 4I9TA 1OINA 3AICA 1Z48A 2CC0A 4S1FA 2QDEA 1UBPC 4YMZA 1LQAA 2XIMA 3OBEA 4DZAA 4U2YA 5LXEA 4B5WA 4TXEA 2C8NA 2NWRA 1QHOA 1LDCA 4N9DA 5XINA 2VHLA 3REQA 2AGKA 1N55A 3G1FA 5CJNA 5AVNA 3BWWA 4CVWA 3K30A 4YN5A 3UJEA 5KZ6A 5HQMA 3H22A 3G8RA 1XKJA 4MY1A 2BVTA 1B4EA 3N9SA 3BGAA 4GUIA 3QSRA 5HR6A 4UTJA 1WDSA 1W17A 3P5ZA 2WVVA 4YCOA 3SW6A 1DIDA 3IAQA 2G3NA 2PLCA 1JVNA 3KP1A 3M64A 5CPNA 4PB3A 3W2MA 1W5QA 4QDWA 1XLIA 2BGSA 3LRLA 3S42A 4JTJA 1BG4A 3FN9A 3VOIA 4Q8QA 2V30A 1RY0A 2CLPA 2OQHA 2I56A 3NO3A 1IZJA 1LWJA 1KCZA 1SYTA 2FHCA 1FDYA 4RE2A 2PP3A 3ZR4A 3N19B 4TVDA 3CEUA 1I45A 4PMRA 5EMUA 3DIPA 5DY3A 1JGIA 1EPXA 4KW2A 5HUOA 4AZ5A 5G1MA 5H6HA 4Y90A 5E6YA 4GUHA 4O19A 2MUCA 8TIMA 3SJNA 1W1TA 1C7SA 3EA2A 4HU8A 1LRNA 1GTHA 2VP8A 3W23A 4IMFA 1L8NA 2NV2A 3ALFA 4NX5A 5CEWA 4FNQA 4AIBA 1SFTA 5CC3A 2YIHA 3AC0A 3PZVA 1Q6DA 3WSUA 1PE1A 3GDKA 4KWWA 4H9TA 1EH9A 2HMCA 4IWWA 1W2VA 3E1F1 1BLIA 1N82A 2DZSA 4NJHA 4HK5A 3GIYA 2VQTA 1RQEA 3KRUA 4GZ7A 2DSWA 1A5AA 4JPGA 4C1LA 4H9ZA 4EPKA 4JX6A 1UKSA 4AZGA 4DF0A 3KCJA 1XBXA 3GDLA 4KMQA 5A6TC 4CLMA 2G0WA 1S3HA 1W1IE 4PMQA 4I90A 1UBSA 3O1NA 3MS8A 1CT5A 2WPBA 3PZ9A 3VMNA 4GCAA 2V8ZA 4WD0A 3PN8A 4I5UA 3DFSA 3S9YA 2D20A 5ECVA 2R24A 1JGMA 2BODX 1DE6A 4WKHA 2GOUA 2QVHA 4D6HA 3WQ5A 1F3WA 1TV5A 5BWFA 3DYOA 4HZ6A 2X1TA 1N8IA 4GJ1A 4EIVA 2OELA 5FJUA 4EWJA 5FI8A 4UTUA 3WLTA 1P6CA 1JDAA 3GW0A 1GJPA 4REQB 1UA7A 4IG2B 4QJ5B 2I5GA 5LNRA 3THQA 2ZICA 5CQ1A 4GH1A 4AEFA 1P48A 1EC9A 3HB9A 3TW6A 5LNVA 1M9HA 5F2MA 4TR9A 3QFWA 4W9TA 2XGZA 4JTUA 3C56A 1KXTA 3QGKC 4FOUA 1O4UA 3VO0A 3B03A 1U83A 4UXDA 3S1WA 4G1NA 1Q6GA 2Z6IA 5T8GA 3W73A 4PL1A 4IHCA 1US0A 3NQDA 1S2TA 4N02A 3BJTA 3CL6A 1MSSA 2Y85A 4UMCA 4Z1BA 1Y7VA 4YXGA 3W71A 5AECA 1EJVC 1QUMA 4WSJA 3GTXA 2BFGA 3WUBA 4LW7A 2YCIX 1QW9A 5CCZA 4XUGA 4R85A 3BAYA 3VIJA 3DC8A 3DG7A 3NWRA 3WBWA 4DYEA 4BI7A 3QV8A 4UWMA 1EZWA 5CZSA 1XRFA 2IPFA 3GTFA 3U7VA 4YHGA 1T96A 4IF2A 1AL7A 2RGMA 4P8UA 1US2A 1H0GA 5E9XA 2WYSA 1TPEA 1VQTA 3SGGA 3UWUA 1W3JA 4O1BA 2NVDA 4WXZA 2WLZA 4X2RA 2J7GA 1W31A 4S3BA 2CZVA 1UD6A 3N2BA 2HSAA 4NJJA 2BWGA 1TV8A 4RNHA 1JCJA 3W7MA 4FR6A 2RKXA 2YXGA 1P0KA 4NZCA 1JZ4A 2ISDA 3MI2A 3MZNA 4RUBA 4KRTA 3IK2A 1S2UA 1WDQA 4HOXA 4M6PA 1GT8A 4RNFA 3GO2A 2I5IA 1W0MA 2IKHA 1DJIA 4MKVA 2ZOXA 5CSRA 3B0UX 1WXYA 5ABFA 1RQHA 3KBWA 3GLCA 5HANA 1EUAA 2GZXA 3R7MA 3TK7A 4O13A 1E72M 5C9WA 1VB9A 3UZ5A 3GFXA 3UGVA 1YXCA 2AL1A 1BGAA 4KERA 3GVVA 1R3WA 2ZZ5A 4A05A 2W6RA 3ZJ8A 1DWHM 1SZRA 3L4YA 3T05A 1L6GA 2VZUA 2G5WA 1BSIA 2VC6A 4CD8A 3F1QA 3WF2A 1RJPA 1Q65A 4KCVA 5FA5A 3V1HA 1WZAA 2Z2UA 5FEWA 3A13A 5FL0A 1PCWA 2EPMX 3D3FA 3TV8A 1REQA 2PWHA 1TKKA 3HOJA 1KFLA 4URIA 3W72A 4N4PA 1Z6KA 4JIQA 4J35A 5A2CA 1AZ2A 1ZALA 2YFNA 1XBYA 3WO8A 4JHOA 3VABA 1CLVA 4TIMA 4M8UA 1OYCA 5ABHA 1AQMA 2OTDA 5IFTA 2ZTKA 4RZ6A 5E93A 4XISA 5I09A 2WVUA 4C1NB 3HMJG 4NXSA 3VIHA 5DBTA 1NQKA 3LN3A 3OBAA 4R33A 2A5HA 3T6CA 5FF0A 2ZTJA 1TWDA 4AY1A 4ICNA 4BCEA 3DHDA 2DSZA 1VYSX 1XSJA 1MUWA 1KCXA 1YQ2A 4YVVA 1UKQA 2GDUA 4JKMA 2ZZ7A 1NWSA 4M24A 5E9AA 1A3XA 1ZP3A 3AUOA 4UTFA 3QC3A 1QTWA 3HO8A 2XN1A 5AHIA 5EMJA 1MWOA 1YPIA 1M7PA 3W7CA 3U2CA 4DQWA 2EG6A 3SFKA 1JUEA 5GNXA 4MB1A 3QMSA 2OQLA 2XN0A 3QYQA 4C6BA 5EYWA 4ZQRA 1QW7A 4M1BA 1EL3A 2C91A 1GKQA 4O52A 3S1GA 1AZ1A 3LCFA 1V6UA 2QMKA 1KGXA 1TTPA 3CUFA 2PEVA 2GVGA 4V1XA 3U2OA 3UXIA 3W84A 5BNKA 4MNMA 2XIIA 4U2ZA 4INFA 3AMKA 4UCGA 2CLLA 1C29A 2QCLA 3WQCA 3VM7A 3EOUA 5MKGA 3ZMRA 4KT2A 3EB4A 4S2CA 1UMYA 3IGXA 3QTGA 4JCLA 5LHFA 1GPWA 3UPBA 4PH6A 4A3YA 3TNOA 3P0WA 1M03A 1CXEA 2VFEA 4FX8A 2OU4A 1W1ZA 4HNCA 3DI0A 4QISA 5H2ZA 5CG0A 4YLWA 1V4YA 3FA4A 1KXVA 1C8XA 3NO5A 5EU9A 4QE4A 1UROA 3W7EA 3AU2A 3SCVA 3GX9A 3S2LA 5CH9A 3A4WA 4GNVA 3KAOA 4DBSA 3UJSA 3SQSA 3QZEA 2GGJA 4H6EA 1OHLA 3A3WA 5M17A 4JGDA 1W3NA 4ZQCA 2CKSA 2O55A 3G24A 5G2IA 2V5BA 5K4XA 2CHOA 2FZBA 1Y5WA 2FDMA 1TPUA 2PP0A 1Z89A 4OBRA 3SIMA 1QU4A 5IXEA 4I7VA 1F8IA 1HKMA 1EKOA 3UZYA 2YDAA 1SGJA 3EWDA 2XWEA 1Q5MA 2OKOA 3LV6A 3L66A 3DN5A 4DZIA 4HJWA 3QV6A 3MB9A 3OQEA 3CGTA 4GX9A 2ACRA 2DSKA 1H7RA 3ZWSA 3PY2A 4NRSA 3VDAA 2HPMA 2DVXA 1JF5A 3RLUA 2J75A 1H4PA 1M3UA 4Q4SA 4WR3A 1CGUA 2HEJA 5CAKA 4XTIA 2PDPA 4ZQOA 3RLHA 5BMXA 2DW7A 2ZYFA 1A0EA 1X6UA 4CUCA 3WBEA 3GHTA 3P0XA 2R1MA 4HKPA 1LT7A 1ONRA 5F4SA 1NM9A 2PDXA 4K3ZA 5IDZA 4C65A 5JBFA 1J4EA 1CXIA 1UR0A 4LH8A 4PMZA 1FOBA 3TN5A 3RDKA 1BYCA 4IMCA 1FKWA 3MI6A 1NY1A 3NSNA 3MC5A 1R9ZA 2XHYA 3PR2A 5EY5A 2YBTA 3UZWA 2JIEA 3VDHA 1HVXA 3O06A 2D1ZA 2GJPA 4FLQA 2OEMA 1I2PA 3W88A 2PDIA 3H55A 2XDFA 1RAKA 3WF4A 3C52A 3QPEA 1CB2A 1IV8A 2QJNA 4NVTA 2PDWA 3DFQA 2WSQA 1I6NA 2FPVA 3CHDA 4Y9AA 3HQ1A 3FS2A 3PULA 1F74A 1U5JA 2XFRA 2DZVA 1UASA 2GYIA 4C90A 2WO5A 4JDYA 4LV4A 2OSWA 1R86A 2CW6A 3QGAC 2Q02A 4W8AA 1C91A 1J5SA 1SUXA 3RMJA 4KCTA 3N4EA 1XBVA 4MG4A 4NJGA 3B8SA 3QXBA 3WBYA 4DXVA 5A6AA 1FH8A 2PRMA 3UESA 3UJRA 3TR2A 2XSAA 1UA3A 3NDOA 4DM1A 3G22A 3ITVA 2NW0A 4E0CA 5DFAA 3TMQA 2HBVA 4JTHA 3W7DA 1PXGA 3KM8A 5B80A 4CU8A 1OFQA 1VLWA 1UJPA 1PHQA 2J62A 1P4CA 1XPGA 3K13A 4EXBA 1NDYA 3K4WA 5KZDA 1OADA 1BF6A 3E5PA 1YNPA 3SFWA 3H2NA 3WD3A 2I17A 1V6TA 3M16A 1LBMA 3WFAA 2E67A 2R94A 1B5TA 4LB4A 4NRRA 3VX1A 3PANA 3R58A 3KDOA 1VBUA 3CMGA 4OT7A 3MYOA 2PS2A 3DHFA 4HK7A 4XIAA 1SFLA 1VLIA 3OHIA 1KTCA 4AZBA 2JGYA 4IJCA 2J8FA 2VEKA 3T0CA 1NQ6A 2NXGA 1OIFA 3URQA 1SFSA 4E5TA 4AWSA 2VDHA 2E6AA 3IGSA 3F5KA 1X39A 4HHHA 4JTTA 3BAXA 3E5BA 1PPIA 3MPGA 3AHXA 1K8XA 1HGYA 3AJ7A 3EB3A 1GQKA 1B9BA 1DEDA 1A3HA 3KHDA 1VIZA 4AQLA 3G0XA 3QHMA 5AKQA 3B8WA 1RV8A 1LTDA 3KL5A 5AYIA 2ZZ6A 3GG7A 3WH8A 2OO0A 2HDJA 2ZX8A 3WLIA 3ITCA 1F5ZA 2PDFA 4XKYA 2ALDA 4DJEC 2GQ3A 1LOQA 5I3FA 1C93A 4HA0A 4L61A 3GK0A 4K36A 4D6CA 2VO5A 1RPXA 4QITA 1XM3A 3VD4A 5C2GA 1BTCA 3MBFA 3SN1A 3G8EA 2Y4SA 4HCDA 3BO9A 2XSBA 1DJYA 1HZYA 2VZVA 4NZFA 2E6YA 4X3ZA 2J24A 3RX3A 4C6LA 2X09A 4J9JA 3GNDA 5HR7A 3V7PA 3EWCA 2PRHA 5ABTA 3LMYA 4WDXA 3BUVA 3N4FA 4KBXA 4HPNA 5LKYA 1TQXA 2O4QA 1JDEA 4H8VA 2B7PA 3WNLA 4HNUA 3RNDA 1DWIM 4HCLA 4J4KA 1A5NC 1H1NA 6REQB 1ISZA 4ERAA 4BZYA 2JEPA 2FGZA 2JK2A 4GK8A 2PB1A 2OZ0A 1NFBA 3EWXA 2QUNA 4J5NA 2DEPA 1CLKA 2Y70A 1HJVA 3P62A 3HF3A 4JIRA 4DO7A 5TD4A 3BQ5A 3LHUA 1AH3A 1ZJHA 2G4FA 3TYUA 3GSMA 3GXPA 4NQ1A 3BOFA 3WQPA 2QEZA 2H9AA 2YFOA 3LG3A 4Q4OA 3SCPA 2YZ5A 7REQA 1BRLA 4QDPA 1FWGC 4DJFD 3MJMA 1G67A 4GNJA 2RH9A 3REQB 5A6KA 1E56A 2YB1A 4A2SA 3N12A 3SEPA 4RW5A 3UCQA 4HT3A 1TMLA 1ZBKA 1B3XA 2VGFA 5K7JA 3Q58A 4YWIA 1OYBA 2V63A 3TU9A 4AD4A 2VI0A 2Z26A 3PJXA 3H7UA 2A3LA 2BGQA 3POCA 4R9XA 5F1UA 3QQ0A 4O17A 2HVOA 1J01A 2RGLA 4FLSA 2WVVB 4HHLA 4N4QA 2OR2A 3GXMA 3W6MA 1AJ2A 1W3IA 4HTBA 4AH7A 4ASTA 3KCLA 1ESWA 1W37A 4DJEA 2L5HA 5A8OA 1VC4A 1W3KA 4WKAA 1O7AA 4PUKA 1G5AA 3ERPA 3E0IA 5T91A 4FNUA 3O2LA 3WD2A 3CASA 3G1RA 5M1TA 3A24A 1A5CA 3HPXA 3TLQA 1FCVA 1FWIC 3C3UA 5FOOA 1IWBA 4MYXA 4Z42C 5HWNA 3LYEA 3ABRA 4L4LA 3AAMA 3EB2A 4UMBA 1LORA 2ISWA 1WKDA 3PJUA 4C6EA 1KNWA 3S3GA 3VE9A 3TKFA 3BAIA 4MJ4A 5IM51 1ODZA 4IL2A 2TMDA 2ATSA 2QCDA 1TV2A 2BNJA 3W86A 3PWGA 5EB8A 3N1AA 2ON3A 4M29A 5AHMA 1EOKA 3ZJKA 1K03A 2V0TA 5H8UA 3ZT6A 1YDVA 4JQ3A 1NFPA 4KEMA 3S4TA 4OE7A 4A8IA 4W86A 1RBAA 3LHTA 1V79A 4KCUA 5HOSA 4PMJA 3WDIA 3E2RA 3MMTA 2PE4A 4UIOA 4LRTA 4WDTA 1KFBA 3CS2A 1RVGA 5D32A 3TA6A 3BARA 1EOMA 1YEYA 2FH8A 2YCKX 3QYSA 3I4EA 3MO7A 2JFEX 4AWEA 5TNVA 1TX0A 3CT2A 3GXTA 4QQ3A 1AK5A 1GJUA 1UG6A 2FVLA 2KX9A 1XLCA 4WK9A 4JTEA 4PEEA 1EHAA 2BVDA 4IUGA 1O60A 3V5CA 4N7QA 1ZJBA 5HPCA 1H7PA 2VQUA 2CWNA 3VE7A 4P8VA 3UVIA 1HKKA 3S2JA 3PUEA 3GW3A 2YBVA 3M41A 3HU7A 3HG2A 1OIMA 5LIXX 1E6QM 2O0TA 3AS3A 3E02A 4JTRA 3V0UA 4C6OA 1TYGA 2PCEA 3FJ6A 2OODA 4AISA 2C71A 3NPUA 3NSMA 3TQVA 3HBLA 5L6UA 3MDWA 4ACZA 2KAUC 4AW7A 4D71A 1HUVA 5H91A 3R89A 1SR9A 1W3TA 3IWPA 1WCGA 5CPMA 1QO5A 1UIPA 3A9BA 3WJYA 1Q85A 1XX1A 1RD6A 3LOTA 3WJZA 2X7VA 3EA1A 2J8TA 3N3MA 2DIKA 8XIAA 3TCSA 1RA0A 2DH3A 2WCGA 4ZSUA 4H9XA 4DLMA 1XC4A 5JUVA 2DW6A 4AWTA 1IEVA 1XGZA 5HNTA 3ZWTA 2IW0A 5TBOA 1TE1A 1Q4WA 3LSBA 2WW5A 4F2TA 4CQ8A 2V82A 3QZAA 3CAVA 1S38A 4XSMA 4WJEA 3HMCA 3RILA 1JFXA 3UCCA 2NQHA 3NVTA 3EX3A 2DORA 3STFA 3WCZA 3W1RA 3LI1A 1V3JA 3C2EA 3UETA 2FJUB 3LPFA 4XWUA 1B2YA 4ML4A 3TYCA 3LQLA 2J7BA 1RJRA 3DOPA 3STGA 1Q45A 5CZTA 2IS7A 1DJZA 2VEIA 3P6LA 3ZT5A 3EEZA 1D7KA 2PP1A 3CJPA 4AHPA 4M56A 4PUJA 4ZGYA 2QDGA 3MV01 5C9XA 5FSEC 1W9UA 1FUYA 1CGWA 4GJIA 4JYFA 5AVHA 1GHRA 4AHOA 1LF1A 5E70A 3WH5A 4L65A 5ABFB 1W9DM 1VP5A 4GKLA 2J7DA 1R3VA 1VFSA 2JEQA 3HGRA 4QJ3B 1YRRA 2X05A 2IQTA 1O5QA 5J04A 3PBWA 4MM1A 5BRBA 3TTSA 3BLLA 3WL0A 3FAXA 4Z1YA 3FXGA 1NSJA 2YL5A 3SRDA 1XYBA 5HJYA 2O56A 3WUFA 3NXFA 4DWDA 4NXKA 4Q8NA 2Q09A 2E9MA 3S46A 1XDMA 3NQBA 4U28A 1HJSA 1REQB 1H50A 4Z2LA 1RR2A 1QASA 4NY2A 1E0TA 5HUPA 1PL9A 1CEOA 3EPOA 3MMUA 4KEUA 3UXDA 2VC7A 4LVBA 2H6RA 1RLDA 4XD6A 3ABZA 2Y1HA 2DT2A 4NJKA 3RLVA 5LIWX 3IIPA 3LHWA 3KWSA 1OSEA 2HE8A 1A3WA 1OQFA 1CXFA 4XD3A 4DF1A 1SO3A 4JQ1A 3AWOA 3QZ6A 1WOAA 4XAZA 3PG8A 3LM7A 4IMEA 4Z2GA 4D8AA 2OYKA 1BXNA 4HN4A 4KEZA 3WDQA 5BXRA 4KWVA 1E6PA 3M07A 5TF0A 1VFOA 1PAMA 2H3BA 4Y8FA 2DY3A 3L9CA 3IIOA 1TSIA 1KQZA 2HVMA 4CD4A 3PJWA 3RFAA 5C7HA 3SRFA 1OCJA 1XISA 1THFD 4I8YA 4IIEA 4I6VA 4JZ5A 4HU3A 3W2KA 4Y9OA 4F79A 3GTNA 2VUNA 4B92A 3OJGA 1VENA 3U2ZA 1P6WA 3OLGA 4RV8A 1LLWA 4UTHA 3BDKA 3LSCA 1HX0A 2VRJA 1KW1A 4ZQPA 1W3LA 3TROA 2QV4A 3VCNA 1JULA 1S2VA 2GVEA 1I9CB 3HFYA 3UG8A 4RCXA 4BKNA 1MDRA 1L2UA 3KUMA 3FY1A 4LQ1A 1LP6A 3A64A 3SUWA 1T40A 1WBJA 3WMLA 3S6OA 1ZL1A 1OFDA 3FJNA 3TP4A 1ICSA 5A2BA 1TPVA 4DNHA 5MKGB 2XFWA 5DELA 2CEQA 1O1ZA 4GI8A 1QPQA 1E0VA 4QJ1A 4D6FA 2VCBA 4WDWA 2BY0A 2E4TA 4WKFA 5LHEA 5BXPA 4PEKA 2XVPA 1PVNA 4GD0A 1B54A 5D37A 4ORIA 2IXVA 4GBUA 3VNYA 1EA0A 2QMJA 5BW6A 3USZA 1RBOB 3OU8A 4B9YA 3SN0A 2PU0A 5DMMA 2JKAA 3QVQA 3VNLA 3PZNA 3CMFA 3RLGA 5FF3A 5AN7A 1GK8A 1LBLA 5I07A 1W9PA 1U5HA 3HJEA 1VCVA 3SCUA 4PMOA 4IPJA 4DWSD 5IRPA 1ZBWA 2NQLA 1O5KA 1R3YA 3G1XA 2Y61A 2B31A 1OX5A 3B8IA 1EF3A 2GVYA 3EMQA 1IWAA 3NGJA 3EOOA 2QXWA 5LNUA 3MP3A 3LMZA 4GZEA 3Q65A 3EAUA 3HV8A 2A7RA 2FIQA 2HRWA 1JPIA 3WJSA 5TIMA 5GQBA 4NYUA 2ZXBA 4J27A 3R8RA 4AYSA 2IXUA 4A3QA 3BW2A 1XG4A 3N13A 3GIPA 1TUXA 2QCGA 3AIVA 3CH0A 5FAGA 2NLYA 2QULA 2AOSA 5PTDA 5HMFA 1L6YA 1FHVA 1RP8A 4IOTA 5FIPA 3FDGA 2ZRZA 5A1AA 2CNCA 3GC2A 3ANVA 3ARWA 3R0KA 3WNMA 3ZR6A 3WJWA 1NF7A 4F0MA 5D38A 3A3HA 1VPYA 1QATA 1NEYA 1CXKA 3TOPA 3S9ZA 3O15A 3VGGA 3KL3A 3M4HA 4X9SA 4P8WA 1EBGA 4B5UA 2WCSA 3JRKA 2VD9A 3NVDA 1WBHA 3H23A 5HULA 4H19A 2EEXA 2WZIA 1BWKA 4S3DA 2OEJA 3BLDA 4MZ1A 3B05A 4JIPA 1LUCA 4B3ZA 1UD5A 3ZQ9A 1CGXA 3NOEA 2F61A 4H8UA 3I4KA 3QN3A 2I5QA 5DEZA 1CDGA 4XZHA 3TXZA 1TCDA 4JTFA 2QQ6A 1J0ZA 3USBA 5A6BD 2C16A 3DYMA 3PP7A 3ZSSA 1UH2A 3T42A 4HGXA 2V9DA 3VOHA 2WOQA 5K9DA 3GTHA 4OIFA 5CJMA 2WZTA 5LIUX 3T1GA 2O9RA 4PCNA 5D4YA 3QR1A 4LANA 1CCWB 1NTHA 4C1KA 4S3FA 4JYEA 3W7KA 4GPNA 3FX4A 3HIJA 1QI5A 2VURA 3AS0A 3WLJA 2QJGA 5E1QA 3A5VA 1ZZMA 3E3HA 3RM8A 1DJNA 1M5WA 2BB0A 1GJWA 2W27A 4HZ8A 4Q6XA 3UERA 1JCNA 4Q4MA 4E2BA 1UR8A 3M0MA 1W1A1 1TCMA 3PPGA 4C7FA 4XIMA 3TH6A 4C6NA 3UPWA 4U31A 4LS1A 3L67A 1GZGA 4PTDA 4DBDA 2UY3A 4H00A 4P5UA 4FNTA 2J79A 2X7WA 1RSCA 2VD8A 1GVRA 4M1RA 5D9OA 4CD5A 4O1FA 1ENUA 1QHPA 1VYPX 2VR5A 4Q8PA 1E6ZA 5DMNA 1D9EA 2J25A 3L23A 4Z2KA 3BAJA 2A6LA 3O05A 1T0OA 1ISWA 1GVYA 4YYFA 2VFIA 3VMOA 4BS0A 3B9OA 4F2BA 2OX1A 2YKKA 1DV7A 4O0ZA 3G3MA 3W81A 1JCXA 4PBEA 3H6OA 1SW7A 1PX8A 4XSLA 1JUKA 3L0GA 1TTQA 4P61A 4L4OA 4UTTC 5E0FA 3GBDA 2YJQA 2Y63A 2V3FA 4RV3A 1OT2A 4AHQA 3N2MA 1I75A 3MTWA 1OT1A 1D3HA 4A3HA 1V03A 1XIDA 5AYXA 5TAOA 7TIMA 4JNZA 1QI2A 1PIFA 4XKYB 1LZOA 5CAHA 1OM0A 2FYMA 3EGJA 1GOOA 1JYVA 1FY6A 3GZ3A 5I78A 4IH3A 3GIQA 4D6GA 3TWBA 2WC4A 4OQVA 1FCBA 1LCOA 1IF2A 3AMGA 4B4FA 2DIJA 1XDLA 5CBJA 1I0BA 5FJPA 1K7FA 1A5MC 3OGRA 4F40A 3TR9A 3IJIA 3TOYA 4EAMA 1JCYA 1UKOA 4R7WA 3CZLA 3MKKA 3PPFA 3M0JA 3LNPA 2DZPA 2E7FA 2IPGA 1K8ZA 1XCXA 3L21A 1FWHC 1H1YA 5IDIA 1SJAA 4N6FA 1IGSA 4L6HA 1FWSA 3TTEA 1W54A 2F2HA 3NNTA 4LU0A 4NAFB 2CLHA 3DXIA 1ML1A 3CMJA 2XM2A 1UD8A 3CC1A 2HS6A 2H9AB 2PUZA 3E0LA 2PTZA 1SZFA 2CLOA 4GXWA 4CNPA 3UD6A 1BRLB 1E0UA 1PV8A 2ONEA 4H9MA 2E6FA 4OTKA 2EPOA 1DE5A 1FWWA 5CPTA 2YX0A 1VAHA 3EXTA 2ZZ1A 4EE9A 1RLCL 1JCTA 3Q37A 3M5VA 4UTTA 4OUEA 4AMCA 1R2TA 2ADAA 3A23A 4CQAA 1MZHA 1WXZA 4ERIA 1XIJA 4FEZA 3DKLA 4I5RA 1JZ3A 2ZRWA 1AQHA 3C8FA 4O28A 1C8YA 3LS9A 1VJZA 1VIWA 3W25A 4W7VA 1V93A 5EBUA 2YLAA 1LROA 3W02A 4EXAA 2PF8A 2NQJA 5DQPA 1WPCA 2QZRA 3CV7A 1V3LA 4W7UA 1NDWA 3FKKA 4MFEA 5C6MA 1VS1A 1TMQA 4EXQA 1EEXA 2PD5A 5EA9A 4F9DA 2P10A 3BMVA 3PJTA 5F2GA 1W1B1 3KBJA 3GFYA 4NJIA 2I1OA 3KLLA 3SCWA 3AIUA 1AA1B 2WMHA 2F6KA 3GAYA 5E09A 1NAL1 1NDVA 4JOMA 1UP3A 1OD8A 3VXGA 1XCFA 4EAYA 4GA8A 2YCEA 5JH1A 1X96A 4YIWA 3H12A 2AQOA 5EMKA 4IIFA 1NDZA 2YYTA 4ZOAA 4YS1A 2QCDB 3N11A 2EBNA 3TYZA 1JYXA 2EG8A 5A6SA 4XV0A 1SZGA 2ZRXA 2WSRA 3P61A 3PS7A 2DVTA 3MP5A 5FEPA 3RXZA 3EX1A 2PWVA 2Y0FA 1V3HA 4C7DA 4XBJA 2YXOA 2YLLA 4DO4A 4YVPA 3VNZA 1PUDA 3TC7A 3CUJA 3GR4A 1EO5A 2XH4A 1VFLA 4D6IA 4O8AA 1UD4A 1L6SA 3F4VA 3TJIA 2G4JA 2ZCGA 2QIIA 5M3WA 5FF7A 3MUXA 3CZ8A 4O0KA 2WZHA 1V0MA 3LLDA 4ERGA 1L8PA 4L64A 2FGLA 2X1UA 3CL8A 3ZJ7A 1FDJA 2EO7A 2CITA 3AFBA 4QTGA 1L9WA 3W28A 1QR7A 1BKHA 1UPMB 4DUXA 5LNWA 2Q01A 1X1NA 3VOFA 4RW3A 2Y2WA 4ZENA 1KBBA 3E2SA 4REQA 3PUDA 3MHUA 4Y96A 2ESCA 3LUTA 3L4XA 1XINA 3UXAA 3LRKA 4P7QA 1DVJA 1CENA 1GORA 5BXSA 2PDYA 4QCEA 3D6NA 3I7SA 3E6EA 3XIMA 4JTDA 4A6GA 2WJZA 1I0DA 4KIRA 1OFPA 1T5AA 1VFMA 1A49A 5I0DA 3CUXA 3LY0A 3W7QA 1ZNNA 2GK1A 4M5PA 2FPTA 1R85A 5C9UA 4ACZB 1W5NA 1NOUA 1AW2A 3G18A 3H54A 2P53A 1MW2A 3CYJA 4GI6A 3NO1A 3NSXA 3NJ3A 1UOZA 3BJSA 4H9VA 4IT1A 4H2CA 4IQEA 4PSRA 3UA4A 4EK7A 4H01A 5FKYA 3S1VA 2EQDA 4C60A 4UOZA 3RX2A 2VNCA 5J5DA 3KFTA 3AXMA 1KBLA 1JG9A 2PLJA 1SJCA 1DXIA 1LOLA 2HS8A 4Q32A 2G95A 5LGXA 3KVKA 3PZOA 9XIAA 3TUUA 3PSVA 4ZQMA 3BC9A 1BXBA 2RJHA 3WF0A 4L4PA 4A22A 5A8GA 3SCRA 1XC6A 2CLKA 4TU1A 2DUAA 4DI9A 2CBUA 2Q8XA 2Q8LA 3UW6A 3ZO9A 3DFNA 3C2YA 4O11A 1Z7AA 1RHCA 1MXSA 2F6UA 2CXEA 2O9OA 5KTLA 1QOQA 3GFZA 3QV7A 3E49A 3L2LA 2ZRUA 3ELFA 3WLKX 4C91A 2GVJA 2NXIA 3B4YA 1TRDA 4AY8A 2J7EA 1XYZA 4JQAA 1QOPA 2Z6JA 1BSLA 3OGVA 4RDYA 3Q2DA 5AYZA 2QCHA 5DCDA 3OVGA 3ZOAA 3ANUA 4GVIA 4LXFA 1Z9AA 1BKSA 3L4ZA 2WKGA 4QAWA 3U48A 2OEKA 1CZ1A 3SO7A 2CLMA 5DANA 4JTIA 1XGDA 3LCXA 2YL9A 1XS2A 2AKZA 4ZO6A 3T0AA 2PMQA 3P93A 5DO8A 1PWMA 1GONA 1E43A 1OF6A 3U8GA 3OLEA 4LUSA 2VUYA 2NSXA 2P0OA 2C79A 3MMDA 2WCAA 4WRHA 1VHCA 4LNYA 1X8FA 4TV6A 4QP0A 3I3BA 1FCQA 3UPMA 1P0NA 3V0SA 3VKAA 2Q71A 2YDRA 4L1WA 4J3UA 3ZVHA 2ANUA 3G0SA 2C0HA 1QNPA 1I8JA 3LBCA 4JIEA 2R1LA 4U4MA 4ENLA 1IR1A 1ZAJA 1WDDA 4Y6GA 1EO7A 1LWIA 3M43A 2AKMA 3GU2A 1EWEA 3R0UA 1AMKA 1W1PA 2AAAA 3HTWA 1ZCCA 4W84A 1W5OA 2W61A 3WELA 1M01A 3RPDA 4DJDD 3LXBA 4MJZA 5BWAA 4AB4A 5HQEA 4WEVX 4BQ2A 1E15A 4J3SA 3DESA 4UTKA 6ALDA 2I9UA 1PZ3A 2A3BA 2WM1A 2R1NA 5HWMA 3UZZA 5KITA 4NNBA 1TV7A 1IIGA 3OHMB 3RN6A 4H7ZA 3THCA 5D02A 4C5YA 2VR2A 2WPGA 4HNNA 2F38A 1NIUA 3WLNA 1UCWA 2ZX9A 3L2MA 1BFNA 5FJIA 2ATMA 1VFTA 2ZXDA 1W9XA 3WNKA 4Q22A 2ZC1A 4GKTA 5T26A 1E6SM 1H63A 4GOAA 1LL6A 1OABA 3W1QA 1WAWA 3N73A 1JIBA 1J2BA 3AISA 4MKSA 1H61A 4EX4A 3AUJA 3NOYA 4HSNA 3LCLA 3CQ0A 3QR0A 4MPKA 4D6EA 4LYPA 4GIRA 2VR4A 2WQPA 1QXLA 1ALDA 4PTWA 1AH4A 3VFLA 1WYIA 3CTLA 3BLIA 2Z1KA 1AUSL 3ARUA 4KWSA 3D0CA 2ZVRA 5SWUA 4V33A 4Z2JA 1DJQA 4L56A 1GOMA 4AU0A 1SJBA 4YL2A 1BHGA 2Z1XA 1QCWA 3TYEA 3AZRA 2GOKA 5CPSA 1Q6RA 7CGTA 5EMYA 4XVDA 1FBAA 3PTMA 4PULA 1I60A 4JN8A 1GQIA 1XLBA 2WBKA 3T7VA 5CPQA 1F61A 2IQDA 1KR1A 1TO3A 1TVPA 3KE0A 5DMYA 1ZENA 4HOWA 4MNKA 3IEBA 2DH2A 3O07A 5BRQA 1ZJAA 1E9LA 4K8HA 3JVAA 3KBMA 1GQNA 4ALDA 2EKCA 3F7JA 4CN6A 3K8LA 5C54A 3IJLA 3CAWA 3W4RA 1WXJA 3VIKA 4FPSA 4TTGA 4B2DD 1TZ9A 1XIFA 1FWDC 4GO9A 2HWGA 4YTQA 3TZNA 1N8FA 1H5VA 1ZBCA 4LYQA 4JL1A 4Y7EA 2ZDRA 3VZYA 3EOLA 4GUFA 4HK6A 3N34A 4R53A 1KKOA 1AL8A 5F2IA 7PTDA 1UUQA 2BLEA 5C7VA 1S5TA 2PDUA 1FP8A 1KXHA 4I5XA 1YPXA 1JYWA 5BMWA 3ME3A 4ZO9A 4LS0A 2TAAA 2VTFA 3FNDA 1F73A 4JKLA 3WF1A 2P8BA 4PCFA 2RDWA 3K5XA 3M9YA 1XQLA 2VDGA 3LHYA 1E3ZA 1LG1A 1FDZA 1FFRA 4ZTXA 2HPIA 4QNWA 3HQNA 4RZBA 4ZQNA 2BGNE 2ZC8A 4GFSA 4NNCA 5DXXA 4L6DA 4QIUA 3UR5A 4ZOEA 3TSMA 1FWNA 5I6SA 3ARSA 3D3AA 3CV2A 4IPPA 3IRSA 3CK5A 2X2YA 5FEZA 4FO4A 3VGEA 4F66A 2Z24A 3THUA 3U9IA 2EHHA 4TX9A 2J6VA 4GISA 3MSDA 3VKJA 2X8RA 5FF2A 1CX9A 1LUCB 4PBFA 3TN4A 1IQ8A 3VIMA 1XIBA 3BAWA 4WCJA 3BCDA 3DYPA 5HK4A 4O14A 3UYCA 4E2DA 4MKNA 4MDPA 1X6NA 2XISA 3UWQA 3PB0A 1JD9A 1ADSA 2H8ZA 2HE5A 3QY7A 1MEHA 4XK2A 4DY1A 3NQMA 5AHEA 1Q8JA 3W82A 4I9MA 3WQVA 2V5DA 4XO7A 3IUIA 2V38A 5HAOA 2PU1A 3BMXA 1FWAC 3QBUA 3Q94A 2GWGA 4F0RA 1TR9A 4QQUA 3WLRA 4OV4A 2G8ZA 2E6DA 2WJEA 4QM1A 4MPQA 3M1ZA 2QPSA 3OYZA 3BLKA 3DHUA 4TQTA 4QSFA 1Q13A 3N2CA 3CPUA 1HG3A 1A5LC 1F6PA 3EA3A 4JIIX 4UTMA 1A5KC 1EP2A 5IHSA 2PGRA 3AIWA 2B4GA 3O0FA 3ATZA 3A9IA 5G2WA 3TC6A 4Q7IA 4OKDA 1TR1A 1EJ7L 3R79A 4O16A 1KO0A 4LUIA 1GEHA 4QJ4B 3DZ1A 4XB3A 2FLIA 1OCBA 4TO8A 5I3HA 3KVMA 4MZ8A 1YYAA 1DQWA 1PB0A 1RK5A 2OLSA 5BZAA 5I2UA 2ASHA 4X2PA 1QK0A 2PODA 3I10A 1SU5A 4MWAC 2B81A 4GQRA 1K9FA 3M0HA 4I8DA 4JN7A 1S1RA 4ZVJA 1FH9A 1UR9A 2WV8A 2WMFA 1V7AA 4ZXOA 1A4LA 2X0HA 3LPGA 3UU0A 4E3TA 1M1BA 2WKLA 4J2MA 1K8CA 2INZA 3A12A 4LTSA 4HPXA 1BYDA 2BOFX 2GPTA 3QY8A 2WJDA 3LU2A 5M5DA 3GXNA 1NWRA 5CPOA 4H8NA 3WQFA 3EDEA 2J9ZA 1V02A 2Y8VA 1QRQA 3BOXA 1JPMA 4QS5A 3T78A 4E4UA 1M7XA 4HA4A 4PCTA 4AZIA 1B1YA 3UZJA 3IACA 1A0DA 1KBIA 1EXBA 4B5NA 4YJ5A 1RP9A 3O6YX 2QDDA 4IGMA 3P67A 4HOZA 4GGBA 3WDHA 2BMBA 3GR8A 2A0NA 1MQQA 3ES7A 3VNIA 3GTIA 1V3IA 4GQBA 4CCDA 3TSDA 3W7LA 1XD0A 2IPWA 4IGNA 1T99A 3BGGA 4M7SA 4GH3A 4LBUA 4Q4PA 3UNDA 4AZ7A 2J66A 3DKJA 3NG3A 1R3RA 3DERA 3VX0A 5ABGA 4ILSA 1IE7C 2ZUSA 1VR6A 2G3IA 1E1CA 4FMVA 1IEWA 2WVSA 1J0IA 2VENA 4NF7A 4PE8A 3E0FA 3NQ8A 4OECA 4HSOA 3YPIA 1SSGA 3H26A 1FX6A 4B5SA 1R3TA 3RX4A 4W8BA 4DF2A 2Y5EA 1XH1A 3OZPA 3RAOA 2UBPC 3ABOA 1U22A 3LM3A 3URAA 4KGLA 4MWAA 3THAA 1ZQ5A 5I3JA 2QS8A 3ITLA 2W62A 3GS6A 3WNOA 3V16A 3CNYA 1S2AA 2A7NA 1OEPA 3AI0A 3TTYA 4IP4A 5A95A 3SDOA 1EX1A 5CSUA 3TYAA 3IVUA 2E77A 1TJ0A 1CBGA 4V27A 3NQVA 1T41A 3VNMA 5EFDA 3TQPA 2J7HA 4MYAA 2CXGA 2A21A 3IV3A 3OZMA 2V67A 2J9XA 4J3VA 3WQ6A 3GUGA 2HJPA 2WSPA 5C9ZA 5AY7A 5CC7A 4CD7A 5A8PA 4G8TA 4B3KA 2DP3A 4LUYA 1FVPA 3NPXA 2VRKA 4IL0A 5DCBA 1XIMA 4MTVA 4PUDA 3V4BA 3G3DA 1GYLA 2VCCA 4M81A 2ABBA 5HA7A 5GJPA 5BCAA 4F48A 1GKRA 3GD6A 8RUCA 3NL6A 1SQ7A 3E12A 3QSTA 2DZTA 3DDMA 4DVOA 2CWXA 1ZBVA 1XI3A 1T8QA 2E0PA 2J77A 4AC1X 5AZ1A 4PB4A 3AHVA 5ECUA 1P1MA 2ACUA 4LY8A 4E8CA 4AD3A 3SAZA 4FNRA 2REQA 3RRXA 2D69A 1HVQA 1XV8A 2UV8G 2E40A 3WH9A 1YTEA 1GW9A 3FK4A 1D8WA 2RDXA 2PCQA 1NWUA 5GVJA 1AD1A 3GU9A 1EYWA 4UZSA 2JALA 1V0KA 1M41A 1YXDA 2Y8KA 4H6QA 1V0LA 3SUTA 4BY3A 4YTTA 4KS0A 4PZVA 1WV2A 1XLDA 2Y6ZA 4G7EA 4ZMGA 3UY8A 4DO5A 1QT1A 1Z3NA 2Y5SA 2GJXA 3T44A 1XSIA 4FOJA 2NXHA 2ZFAA 1ISVA 1YIXA 1R0MA 3CZEA 3ZT7A 1DORA 3A4AA 2VEGA 4Q4QA 3AZSA 2GLKA 4GE8A 3UYIA 4DAIA 5JVLA 2CLIA 1CNVA 3B40A 3VU2A 1DWAM 1EJWC 1DL3A 2P1FA 3RCNA 3D5HA 2E8ZA 2W66A 1XIIA 1PIGA 1TFVA 3NGFA 1DQXA 4EANA 2W4XA 3CAKA 3S5ZA 3CUIA 2CZ5A 1Q6QA 4J3TA 1JI2A 2XIBA 4LJ3A 2G3MA 4D8LA 1AG1O 1VKFA 5GJNA 1AD4A 3H2EA 3GQYA 1K9DA 3KOXA 1WE5A 4M6UA 1YNYA 1KM6A 4A8RA 1NARA 1LWHA 2W91A 1HL2A 2QGYA 1VJSA 1X6LA 1TZZA 1YX1A 2C19A 3TJXA 2HCVA 2J6XA 1GYMA 4H7CA 3W7PA 1IYXA 2BTMA 4RKAA 2IMRA 1OC7A 1BVNP 3VOJA 2OCZA 3BAKA