5AHMA

Imp-bound form of the deltacbs mutant of impdh from pseudomonas aeruginosa
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
378
structure length
354
Chain Sequence
MLRISQEALTFDDVLLIPGYSEVLPKDVSLKTRLTRGIELNIPLVSAAMDTVTEARLAIAMAQEGGIGIIHKNMGIEQQAAEVRKVKKHETAKAKTYPLASKDEQGRLRVGAAVGTGADTGERVAALVAAGVDVVVVDTAHGHSKGVIERVRWVKQTFPDVQVIGGNIATAEAAKALAEAGADAVKVGIGPGSICTTRIVAGVGVPQISAIANVAAALEGTGVPLIADGGIRFSGDLAKAMVAGAYCVMMGSMFAGTEEAPGEIELFQGRSYKSYRGMGSLVPEGIEGRVPYKGALSAIVHQLMGGLRAAMGYTGSADIQQMRTQPQFVRITGAGMAESHVHDVQITKEAPNYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Studies of Two Variants of Pseudomonas Aeruginosa Impdh with Impaired Allosteric Regulation
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Oxidoreductase
molecule keywords INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
total genus 112
structure length 354
sequence length 378
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5ahmA00
1WBJA 4Z1DA 1SO3A 3NGJA 4UMAA 4FIQA 4E2BA 4R33A 3NO5A 4BI5A 4IUOA 4QSHA 4YWIA 3TU9A 1TJPA 3USBA 1XI3A 4K37A 5LNUA 4OV4A 5K7JA 2ZCGA 3EWXA 4I7WA 2GQ9A 1ICPA 1LCOA 5EA9A 5LGZA 3NDOA 4MY1A 3ABSA 3O1NA 1UJPA 2Q3OA 1QDSA 3NG3A 5DCBA 4KWVA 5AOUA 3ZR4A 4JTEA 2UV8G 2DZSA 1VC4A 4Z08A 3LCLA 3W84A 1Z48A 3P80A 3EWUA 2Y63A 3KFTA 4O0ZA 3CM4A 1VCVA 2Y85A 3UWUA 1OF8A 2FIQA 2BTMA 3LCHA 1YPFA 3TUUA 3DFNA 3WK0A 4LVGA 1K3UA 3FEMA 4BI7A 5KITA 2W79A 3W23A 5DCEA 4NVTA 4AMAA 3KVMA 3G3DA 3STCA 4Z0JA 4L4MA 1Q6QA 3PM6A 3IVSA 4K36A 1KA9F 2QCDA 3UY7A 1LM1A 2C1HA 4QM1A 2XN2A 4NZFA 3R13A 4AHOA 1KW1A 3O15A 2NV1A 4XZ9A 3GVGA 1OYBA 5LNSA 3MW7A 3CWOX 4IQLA 4MY9A 5G2WA 5EL1A 3L5LA 4O1CA 1QPRA 3LI0A 3THQA 5U4NA 2J27A 3MP3A 4KKXA 5HWMA 1H62A 3EXSA 2WO5A 3LCXA 4DO5A 3Q2DA 2JKPA 3PF3A 3O6DA 1AW5A 2QUTA 3O05A 3DENA 3LBCA 4M6VA 3JS3A 2C13A 4CQ8A 3GDLA 3W1RA 2QAFA 2HS8A 2NLIA 1FCQA 4JIPA 3W2MA 3B8DA 2OT0A 3QF0A 3CLMA 2NXHA 2DZPA 3PULA 3LHWA 1VYPX 4B5NA 5HUOA 3UZJA 3KAOA 2R91A 1SSGA 1ALDA 4O54A 1IXPA 2CZ5A 3IGSA 2RDTA 3TC7A 4WOZA 4PEKA 5D09A 1LROA 1DJNA 4OHQA 4C1KA 3TFXA 1BEUA 1W8SA 3G1HA 2CZFA 4K8HA 4NX0A 4O50A 3GKFA 1AMKA 4IJBA 4UTMA 3TR2A 1IXQA 4A21A 1Q6LA 2YYUA 3TJXA 3KXQA 1ADOA 4DF2A 1R47A 4ZMGA 4CQAA 3KRSA 2RKXA 3FYPA 1UBSA 1S3HA 3LHTA 1F05A 1TJRA 2VENA 4OBTA 4TU1A 3P60A 2A1YA 4UTLA 2ZZ7A 3TCEA 3S1VA 4YCPA 4OU1A 1MZHA 1VYRA 4CCEA 4EF9A 3AJXA 1LOSA 4ZQNA 1TO3A 4HSOA 5G4WA 5L9FA 1WV2A 3MHFA 4EVZA 5FF3A 2YFOA 4GWEA 3C52A 1G4SA 2D73A 3FKRA 4FX6M 4UTWA 1YADA 2YR1A 2V0TA 1XBXA 4D2JA 3N2MA 2J88A 2VFFA 2OT1A 3IIZA 1OFOA 2AGKA 2BZNA 3STGA 5A5WA 1AW1A 2Y7DA 2BXVA 4ZQOA 1K8XA 1GQNA 4AF0A 5AN7A 1YTEA 1L6SA 2ZA2A 4WY0F 1FWNA 1TRIA 4UTTC 4LS1A 3GX9A 5DN1A 3DKLA 4JR5A 1TPC1 3P7YA 4EWND 2PRLA 3PC0A 1FUYA 1Z41A 4N2YA 1J4EA 1EP2A 2DJLA 2G96A 4KFNA 4ADUA 1D9EA 1KM1A 3QYQA 2QKFA 3O06A 1R30A 3SR7A 1H7NA 3HGRA 2VEPA 3UZ5A 1B4EA 1JUEA 1XCFA 4MLJA 1GZGA 3K30A 4BI6A 2NX9A 1F76A 5K3VA 1R46A 2NUYA 3IIOA 3MMTA 3TX9A 3T78A 1KM3A 4Q32A 2E68A 2QCDB 4OT7A 4R53A 1FXPA 1XXXA 2WKJA 4NZJA 1DVJA 1CW2A 5G1YA 4OV9A 3PUDA 4TMBA 1OFBA 5E1QA 2X30A 2QAPA 5D33A 2B7QA 2QCNA 2DZTA 4JICA 1H5YA 2H6RA 4KFOA 2FFCA 1I2RA 3I7QA 3W1LA 1V5XA 1OFAA 1W54A 1EIXA 2C15A 4GJ1A 1FCUA 4AAJA 3M9YA 5T26A 5EYWA 2V2CA 3P5ZA 1RZMA 3LRLA 3M0ZA 2A7NA 1DHPA 2H90A 2B7PA 5AB3A 3NQVA 4EOUA 4JTJA 3PG8A 2ZA1A 1K02A 3DHDA 3EXTA 2CWNA 4FNQA 4MFEA 1QOPA 2QDGA 3NQAA 3PG9A 1F74A 3W1PA 3HPSA 1EUAA 3TSMA 3SFKA 3BGGA 3HJZA 4O15A 1KLYA 4UMCA 3C61A 2ZZ3A 3EWWA 3W7LA 1RR2A 2V30A 4DEFA 3HQ1A 3S5ZA 1H7WA 3BW2A 3HG2A 3P8IA 1U5JA 2NXGA 3DFTA 5D2VA 4CLMA 1S5VA 1TMHA 3T7VA 3DI0A 4HSNA 1WBHA 1F7BA 3C2OA 3S1UA 2EGZA 5E0KA 1D3HA 3BPWA 3C2VA 1VCFA 2EPHA 4GUGA 1R2RA 3GNDA 2Y7EA 1B4KA 3LCGA 2WJZA 4PC8A 4TIMA 1RPXA 3C8FA 3MI6A 1F73A 3HO8A 4N9DA 4LVBA 1ZJIA 1TTPA 4UNLA 4M5PA 5K9DA 4A29A 2VEIA 3KVKA 4RKAA 5G2IA 1GVSA 5ABTA 4AHQA 1DQWA 4Y9AA 1BWLA 1KV8A 1FDYA 1H63A 2ZTJA 1XC4A 3INPA 2CLOA 2RFGA 1Q3NA 4JY8A 3M5VA 3MYOA 4IX0A 1W0MA 4M19A 4EIVA 2VFGA 4NT0A 4K38A 3LXAA 4J9JA 3G1VA 3TC6A 3QRHA 5BW6A 1FBAA 1TPEA 1F5ZA 4LV9A 3QH2A 3C6CA 3MHGA 1JR1A 1W56A 2C3ZA 2QJHA 1GEQA 2WNNA 2YSWA 1OJXA 3GAYA 4JTKA 4UNKA 1XBZA 3LHUA 3W7OA 2QDHA 4UTIA 4O1BA 4WXZA 3B06A 3U6WA 4PH6A 1IIHA 4K6AA 4MZ8A 1JQXA 3B05A 1QPOA 3V75A 4QISA 1JCXA 4UFIA 3QQ1A 2WNQA 2CLLA 3L2IA 5G1TA 1VQTA 3DH7A 4DQWA 1SZGA 4QIUA 1OFDA 2H8ZA 1F2JA 3UY8A 4C1LA 2ZFAA 4Q4KA 3P61A 3G0SA 2JKEA 3W7CA 2C0AA 2A0NA 3QM3A 3O8AA 4LNYA 2C19A 2X1RA 1FCBA 3M44A 1TTJA 3TV8A 5LHEA 3NPVA 1SQ7A 2V9DA 1QOQA 2PRHA 1TPDA 4TX9A 4UUIA 3WJZA 1RQBA 5D04C 1O95A 3GDTA 3LGEA 5HINA 3HPZA 3FOKA 3O63A 2ISVA 3STEA 1YXYA 2B7NA 1PCKA 2VC6A 4GE8A 4AXKA 3U2OA 1EP3A 3SW6A 3O16A 1FXQA 2J9YA 1DV7A 4O8RA 1LRTA 1VZWA 1W3TA 4UC5A 3W2LA 3CIXA 4JY9A 3UXAA 1SFJA 1XKYA 1GYNA 5HULA 5LNRA 3R89A 3G18A 4CNPA 1KFKA 4N9BA 3G1YA 3LV6A 1LTDA 1AL8A 4X3ZA 3LTYA 2YPIA 4HT3A 3E02A 1OFPA 4IWWA 3OG3A 4I7VA 3UPWA 1H50A 3TKFA 3N73A 4JTTA 4LRSA 2FB3A 3OEXA 3RMJA 2WSQA 3CB8A 3EX1A 1G69A 3TE9A 3ATYA 1TQXA 3SGZA 4WQ6A 4O28A 1JVNA 1FWRA 1O60A 3IIVA 1EP1A 2X1UA 2ZRVA 3BO9A 5DLCA 1XUUA 1TPFA 4QNEA 2QUUA 2DU2A 3OVRA 4H4IA 1SZNA 1Q45A 3H55A 4BK9A 2YCEA 4FF7A 3NXFA 3W70A 2XN1A 4N6EA 5F4WA 4X2RA 3W6YA 1LBFA 3DFOA 4E38A 3W2UA 4GUIA 5EMUA 2NX1A 3G0UA 4AB4A 3I7RA 1RV8A 5KTLA 4K39A 3SIZA 1VRDA 3QZEA 1OFEA 2Y7GA 3DKJA 4GRSA 3L66A 1Z44A 4IX2A 4LT9A 1MEIA 3NPUA 4QAIA 1WXJA 3NQ6A 3WFAA 5C2XA 3HGSA 1KM5A 1TPUA 2YXGA 1SSDA 3W1UA 4A22A 2XFWA 5AC7A 5IM51 1OX4A 2VXNA 1OG0A 4M6QA 1K8ZA 3NQCA 3UD6A 3NZRA 1GVOA 3M5YA 4K7YA 4UTWC 4WOQA 5AFDA 4HNVA 3W71A 2ABBA 1I4NA 2Q8ZA 4FX8A 1FY6A 4AVFA 1O94A 3M5XA 4YXGA 1X8FA 5K4ZA 1RVGA 4CNNA 1H1YA 3W2JA 3T40A 1T0OA 1YXDA 1UCWA 3G22A 1H61A 2FLIA 4M7TA 2QUVA 2QCMA 2E1DA 1LOQA 3NL3A 1SW0A 2C6QA 4G1KA 3W75A 3ZWSA 4MOZA 5LGXA 2DZXA 4JTLA 1A53A 3LB0A 3C2EA 2X1TA 1K7FA 2Y6ZA 1R2SA 1P1XA 4UMBA 4NQ1A 4UR7A 1IGSA 8TIMA 1ZFJA 3QMTA 5K4XA 4GUJA 2TPSA 4XKYB 3LX9A 3VCRA 4ICNA 3HBLA 1QPQA 4IPIA 2YYTA 4AWSA 5G2HA 2W0UA 3G24A 4GUFA 4DF1A 3HB9A 1TPWA 2EF9A 4JGDA 5FF7A 4JTFA 3M41A 3IVUA 4RZ4A 3N3MA 5KSWA 1K7EA 5LZLA 3LRMA 2BLEA 4R34A 1WDWA 4N9EA 5K2ZA 3F4WA 4ZZ9A 1ME9A 1YPIA 3I65A 4UR8A 2QCHA 5CZJA 1W5NA 5D32A 1TTIA 3LTSA 1SU5A 3W72A 1SW3A 3PSWA 1TPB1 3KRZA 2EAWA 3W7PA 1W1ZA 1OK6A 1TV5A 3LXCA 2RDUA 3LTPA 4HIBA 3BLEA 3KRUA 4O13A 4NJIA 4MZ1A 4A3UA 3BLFA 5F2IA 1NFBA 2QF7A 4LUIA 3RF9A 1XDMA 3A21A 3UWZA 1TV7A 2VFIA 4CNOA 4KFPA 2JKAA 4JTIA 1A5BA 1QO5A 4Z1BA 5BMXA 1OX6A 2C16A 2V81A 1WYIA 4Q33A 1VH7A 1H1ZA 1C8VA 1ZNNA 3GXPA 3W87A 1G7VA 3NPXA 1I2QA 3DFSA 3FFSA 2H3DA 3QFEA 4U28A 4HNUA 2Y89A 4BR1A 4Y6GA 3S8HA 3L65A 2V82A 2ISWA 3CQ0A 1HG3A 4RV8A 3HG4A 3G1XA 2OX1A 3NQDA 5DELA 3HF3A 2A6LA 4HN4A 1PS9A 4NXKA 3UXDA 2ZRZA 1MO0A 3W1XA 5HWNA 4DPPA 1Q6RA 1KFEA 1SZEA 3T44A 4PA8A 3BW3A 1ZENA 4O17A 3ELFA 4O4VA 1I45A 1AK5A 1L2UA 1LORA 1M5WA 1P5BA 4RZ5A 3R12A 3F03K 1JCNA 3NA8A 3NR0A 1RQEA 4K8EA 1TTQA 1JUBA 1NAL1 3L0NA 5H91A 3NQMA 2QCCA 3TA6A 2E5DA 4NNBA 1SZFA 2JBMA 5CGQA 4MYXA 3W7IA 1H60A 1JCMP 2H8XA 3TXZA 4O0KA 4H3DA 4LU0A 1JJKA 4X9SA 5BOOA 3NQFA 3EWZA 4A2SA 3TAOA 2RH9A 2E5CA 3N14A 1WX0A 4Z1AA 1I2NA 3GKAA 4NNCA 2NV2A 1X6UA 3RLUA 2QJGA 1EUNA 2G97A 1QMLA 2CZDA 2Z0IA 5I3KA 5D38A 3IGXA 2I14A 3UWQA 2ATMA 3FIGA 1WA3A 2WPBA 5FEPA 3W83A 5F4SA 4UFKA 5C55A 4JTSA 1OX4B 2WSRA 3W2KA 3W1AA 1UASA 2ZZ4A 1VJIA 3DFPA 3L67A 4ZQCA 1NVMA 5FEWA 3M6YA 4YMZA 3DFQA 3FJ6A 3PBVA 5AYZA 4FNSA 2GUUA 2E6DA 5F1VA 2X1SA 1ICSA 3S0CA 3W07A 4O16A 4PTNA 3GLCA 2GOUA 2DZWA 5I3HA 1YDOA 3PR2A 3PVFA 3S42A 5HNRA 2A85A 3A5FA 3TFCA 1TSIA 2TSYA 1AG1O 3S1WA 4RXGA 3KHJA 1FQ0A 2W6RA 4O11A 2PURA 3NQGA 3MI3A 1HTIA 2PCQA 3PAJA 4JYFA 1W5MA 3QMRA 3LV5A 3FLUA 3NQ7A 4MUZA 2NWRA 4JX4A 5K9CA 2GPTA 3WJYA 4ADTA 5HMSA 5LKYA 3ABRA 2TYSA 5K9XA 5F1UA 3VNDA 2H3BA 4LWWA 3HGJA 3LLDA 1UB3A 4RXFA 3EWBX 5HR6A 1H7RA 3WK1A 5FF0A 1LRQA 2ALDA 3UYCA 1X1ZA 3W1MA 4ZL1A 1ZCOA 3PWAA 1EB3A 1OK4A 1XL9A 3W22A 3DGRA 1H51A 2X16A 1JQVA 2CLEA 1C29A 3W74A 3BLIA 3CEPA 3NM3A 1GTHA 4LVFA 2HTMA 3PB0A 3HPXA 3VE7A 4DXVA 3T4CA 4O10A 2CLKA 1XDLA 5LNWA 4RCXA 3M43A 4RR4A 2VFEA 4OQVA 3GB6A 5BMWA 3GDMA 4N02A 1FWWA 4FIRA 1HO1A 3MI2A 3IIXA 3QPYA 3TQ0A 3VE9A 5HWJA 3LCIA 3DXIA 3NNTA 3O6CA 3IEBA 1SFLA 5FI8A 4W9TA 3DAQA 2P0OA 1P0KA 4WY0B 2YW4A 5D05A 3BG3A 1JCLA 3RU6A 1Q6OA 2ZRUA 3EEGA 3LERA 1GPWA 4WY0A 1H7OA 2FQIA 4UFHA 3LXBA 5D30A 3KVLA 1YTKA 4GC4A 2YZRA 3QMSA 1RD5A 1VHCA 1OABA 2A2IA 1SR9A 4O52A 4UIOA 1DKWA 2A21A 3FKKA 4MJZA 4XUGA 3CU2A 3MJYA 1C9DA 3FJLA 1YYAA 4WD0A 3MBFA 1LDCA 3P5YA 3W88A 2TRSA 4JIQA 3IRDA 4LRTA 1GYLA 1G4PA 5AHFA 5DBTA 1OFQA 2EKCA 5LHFA 3I6RA 2ABAA 1KTBA 3GXNA 1B9BA 3LHZA 4LS2A 5AHIA 3GDRA 2Z1BA 3TMQA 1MSSA 4FNTA 4AH7A 2A6NA 1S5WA 1K03A 3VFLA 2FDSA 4O53A 4Y8FA 2Y61A 3P84A 3SECA 1K7XA 1DJQA 3P74A 4I7UA 3MYPA 5CSSA 4LOCA 3M1ZA 1ME7A 7TIMA 1M7OA 2WNZA 5EKYA 1FDZA 3TAKA 4S2BA 3DU0A 1JCJA 3G0XA 4LVAA 2CFFA 4ZVJA 4N6FA 4O14A 4XQ6A 4MVAA 1OYCA 2OZ0A 3MWAA 4P61A 5KMYA 3LM7A 1QO2A 1TRDA 2ZZ1A 1F6KA 3BARA 3NYZA 1CI1A 3BV4A 3C4UA 5FEXA 4ORIA 3B04A 5DBUA 5AC8A 2DP3A 3I68A 3EKZA 1VLIA 3FS2A 1YDNA 3TSDA 3A5VA 3SI9A 3NZ1A 4Y96A 5KZDA 1DOSA 2NUXA 2DZVA 3IIPA 2YX0A 1KM4A 3NVTA 1J2WA 1NF7A 1SUXA 1ZAHA 3E12A 4IOTA 1ICQA 3S1XA 3N34A 4JTGA 3S9YA 1GWJA 5F2MA 3D0CA 4DBEA 4JS3A 1GG1A 3R8RA 1H7XA 1QFEA 1EWEA 3NL2A 4PL2A 1PV8A 4BWLA 3EX4A 1ZALA 3T55A 4WJEA 3LHYA 1TYGA 2Y62A 1B3OA 4JX6A 1HFBA 5U7SA 1TREA 3BW4A 1E51A 1KM2A 3O6YX 1G67A 4MYAA 1ML1A 2CLIA 4ZQRA 4DELA 2JGYA 1I8JA 1HUVA 3S5NA 1RQHA 1QWGA 3KVJA 1Y0EA 3WK3A 1KFBA 4LY8A 3DI1A 1MEWA 1O5XA 5KZMA 4BFAA 2V5LA 4ONVA 2J9ZA 3QW4B 4IXHA 4DO4A 4BWLC 4WXYA 4O18A 1NF0A 3CTLA 4I9AA 1KFCA 4RLIA 4S1FA 3WJWA 1L6WA 3GDKA 1S5TA 4PL1A 3M7WA 4IPJA 2V2DA 1B57A 1CX9A 5DXXA 3W73A 3W7DA 2VOMA 1HL2A 4UTTA 5CPNA 3N9RA 3ANYA 1G7UA 5J5RA 4HPJA 1PHWA 2O7QA 3L5MA 3EB2A 1P0NA 4JX5A 3PB2A 4JNMA 1M6JA 2Y70A 4FB7A 4GNJA 1PCWA 1BWKA 1EPXA 4JXCA 3QPZA 1H7PA 1QR7A 2ISSA 4PODA 3ABOA 4WX2A 1YDVA 3GZ3A 3TJLA 2Q3RA 4FEZA 3O07A 1SO5A 3N19B 1TPVA 3L68A 4QITA 3ZS4A 2RDWA 3NAVA 4NUWA 4DF0A 5D03A 4KWWA 2E6AA 3A23A 1XUZA 1N8FA 4N9CA 3JRKA 4FNRA 2P10A 4L4LA 1R2TA 2GQAA 2E77A 3PBUA 1BTMA 1A5AA 2Y7FA 4RJEA 3STFA 4P2VA 2HS6A 2FPTA 4NJHA 4XTIA 3PBYA 4R7JA 1J5TA 4JTHA 3PSVA 1YLVA 4RK8A 3UWWA 2ZTKA 2ZZ2A 4QQ3A 3TQVA 5AYXA 2TMDA 3WJSA 2VKZG 2QCFA 3W86A 3ABQA 2YW3A 3CWNA 2B7OA 4CQ9A 3BG5A 2XN0A 3LCFA 1JULA 3FA5A 5DY2A 3EWYA 1PL9A 1GVQA 4LV4A 3UNDA 2J24A 3HMJG 5EPDA 1KFLA 1A5SA 1LOLA 2FPYA 2PE4A 3BG9A 5CKSA 5E93A 2AAMA 5CPLA 5C54A 1TV8A 1A50A 3L0KA 2NX3A 4FNPA 1WQ5A 2Z2UA 3A9IA 2GVGA 1W3IA 1EA0A 2NWSA 5L6UA 3EX3A 5A8GA 1LZOA 2QR6A 4HNNA 2E5BA 1JRBA 3RFAA 3CEUA 3TXVA 2YFNA 1X7FA 1VPXA 4FNUA 5D37A 3G1AA 4FXSA 3G1FA 2WQPA 3VKJA 1VR6A 2FTPA 3F1QA 1IIGA 5CPOA 3HOJA 4AF0B 1VHNA 3MHUA 4H6KA 2FJKA 3E49A 3B0UX 2CW6A 3TW7A 5C6MA 1NSJA 3W7NA 3EX2A 1GOXA 3YPIA 2YGYA 3OVPA 1T96A 1VYSX 4LTSA 4TR9A 3KOFA 1W5PA 1V7YA 4FHAA 1GT8A 4POCA 3PY2A 1EEPA 1TPH1 5HR7A 2V5BA 1KM0A 4Y90A 4HPXA 3TMLA 3M16A 3ZFHA 2I1OA 5G4EA 1UUOA 1EX5A 4IXXA 1OVDA 2VFDA 1UUMA 2I9EA 2AQWA 1ONRA 3UWVA 5I3IA 5AC6A 2JGQA 4K7VA 2A7PA 3S6DA 3PUOA 1M7PA 5CPMA 3S5YA 5J5DA 5CZ0A 1K8YA 4MY8A 1KBJA 3NQ2A 1DBTA 3W1TA 2VFHA 3EX6A 2GVJA 1OYAA 3W7EA 3S5OA 3P62A 4MJMA 2Z6JA 2ZRYA 4HKPA 4RX0A 1LLZA 4ZQPA 1KTNA 2QCGA 3NL6A 5BNKA 1IF2A 2J6XA 1PE1A 3QC3A 3OA3A 1KM6A 2A7RA 3HGOA 4LC8A 4RZ6A 5TBOA 5F2GA 3QSTA 3U8GA 4JEQA 1TCDA 4LC6A 5FESA 5I3GA 1O4UA 3LRKA 1KBIA 4UTHA 4XTDA 3GR7A 2P1FA 4MIMA 1JCYA 3QSRA 3G8RA 3GNNA 4LW7A 4ORMA 4DO6A 1WAUA 3WK2A 1VS1A 3DBPA 4A2RA 5D02A 4Z0SA 3BVJA 5TQLA 4GXMA 3ATZA 4OGZA 4TO8A 4FXRA 2CU0A 5MHBA 2ZQ0A 4XBSA 3Q58A 2X2GA 4NNAA 2IQTA 1BKSA 3Q94A 2NZLA 1FCVA 1LP6A 4LVDA 1OHLA 2YDAA 2CLHA 2NUWA 3A24A 3JR2A 4IMGA 2Z6IA 2ATSA 1FWTA 2GQ8A 1LBMA 1X1OA 2KZHA 3TK7A 1DQXA 1PVNA 1HO4A 5IBXC 4OE7A 1VCGA 1AL7A 2BSLA 3R5EA 5F4XA 3UWYA 3VI2A 3BK0A 1W37A 3I7SA 3W76A 3W7JA 6ALDA 3TW6A 1OX5A 3UQNA 1N7KA 5C5YA 4WUIA 1GTEA 4JD4A 5AYYA 5AHLA 3F4NA 4BF9A 1GVRA 3SSJA 2BWGA 3E9AA 5HQEA 2O7SA 1FDJA 3P82A 5I3JA 5AHMA 2OJPA 1QCWA 5FF4A 1G6CA 5IBXA 1PIIA 1KLZA 3EKLA 4DBDA 3G1DA 3W7MA 3NQEA 3P67A 3IVTA 4FX7A 4UTUA 3MP4A 1SO6A 4UFMA 4ZQMA 2PRMA 3CC1A 2VELA 3W1NA 1WOAA 2LLEA 1XM3A 2Y88A 4NJJA 4EF8A 4O1AA 1MXSA 2OMAA 5EY5A 3IV3A 4UFJA 3B0VC 1W5QA 3C2FA 5AHNA 3P8JA 4UTJA 1SO4A 2C14A 4O4WA 3E0IA 2R8WA 3H54A 1NEYA 2FPVA 3HG3A 3FYOA 2WV8A 5CZSA 2VEMA 4IMDA 2R14A 4FO4A 1SPQA 2QJIA 3HG5A 1ZAJA 5H2ZA 3B03A 4O1DA 4UXDA 4O12A 3NEVA 4M6PA 4QJ1A 4HHPA 1G4TA 5CZTA 4E0CA 1TQJA 1I2PA 2ZBTA 2DZUA 2NXIA 1LLWA 2WOQA 1FWSA 5LSMA 4OWGA 2PC4A 3QQ0A 3M5ZA 1LRNA 2ZDRA 5BRBA 1DORA 4XKYA 5GVJA 1T8XA 2FB2A 5I3FA 3GIYA 1KTCA 2F7FA 4GBUA 2DJXA 4ML9A 3Q37A 2Q8LA 4NJGA 1OFRA 3QEZA 4N4QA 2G5WA 1XFBA 3CT7A 2F84A 4IGHA 5KINA 3WJXA 3RNDA 4QNWA 3B0PA 5FF2A 5HUPA 2V8ZA 3CPRA 3H53A 3KX6A 3C3NA 1FX6A 4O57A 4O19A 1U83A 1WOBA 1TB3A 5D2YA 3DHFA 3TQKA 1A5CA 3M47A 2DORA 2J9XA 4MKNA 3CHVA 1YTDA 4YL2A 3GYEA 3DZ1A 2GJLA 4X22A 4AEOA 2ZRWA 5DXYA 2GJNA 4NU7A 4IMCA 4NX5A 3NPWA 2R94A 3ZWTA 2ZRXA 4MZYA 5EBUA 4Z1CA 1L6YA 4E2DA 1ZAIA 2V2HA 1THFD 3IGUA 1YXCA 2HMCA 3NQ8A 3EXRA 5TIMA 3W7HA 4JTUA 1G4EA 3AO0A 3LI1A 4UFLA 1KFJA 2HSAA 3W7GA 1DL3A 1PHQA 1VGAA 2ZZ5A 3C0JA 3C56A 3UPBA 3LCWA 4N4PA 2ZZ6A 3NM1A 4DPQA 3L5AA 1OF6A 5D2TA 2VEKA 1IXOA 4M7SA 4GFSA 4LUJA 5HJLA 3LBMA 5AHEA 1LBLA 4JDYA 1AW2A 3PUEA 1W5OA 2JK2A 3PBWA 4GUHA 3LLFA 3GAKA 3MO7A 1IXNA 2C18A 4XWUA 3G8EA 1GG0A 4MPQA 2QCLA 3NOEA 1JRCA 3GR8A 3B4UA 5DY3A 3V1PA 2E09A 3OVQA 3LHVA 3N9SA 3R2GA 2B4GA 2WSYA 3GK0A 3MBDA 1TIMA 1GVFA 5F2LA 5CSRA 2E6YA 5D2XA 3W7KA 3TDFA 4UTKA 3PS7A 3L9CA 3TNOA 2QCEA 1W31A 3A22A 3RK8A 1LYXA 1SW7A 3NL5A 4PCFA 4U4MA 1T99A 3BGJA 1P4CA 5LNVA 3THAA 4AWUA 3QJAA 1QAPA 3RLVA 1GJPA 1XBVA 4AHPA 2ZA3A 3TSBA 4MFDA 4NXSA 3N2XA 3L0GA 3G3MA 3SGUA 3G1SA 3TROA 4TMCA 3W2NA 4AWTA 1JUKA 3SJ3A 4PFMA 3MUXA 2EHHA 2GVLA 6TIMA 1QPNA 5FEZA 3W85A 3W7QA 5SWUA 1D3GA 1F6PA 2A5HA 2B0MA 3LOTA 5D2WA 3TIMA 5G5IA 4ADSA 3L21A 4NJKA 3LDVA 4YLWA 4UCGA 4HNTA 3OIXA 4LS0A 4XBKA 2OCZA 2QEZA 3QW3A 4WZHA 1QNVA 3C2RA 1O5KA 2A4AA 2E6FA 1ME8A 3P81A 4S2CA 1MEHA 1W3NA 4JYDA 4CCCA 2ZYFA 3MP5A 3TH6A 4CCDA 1KV5A 2CLFA 4YCOA 4JYEA 1I2OA 2CZEA 2RHGA 1VLWA 1ZHAA 4JDBA 3W7RA 3OBKA 4MLRA 4IMFA 1Z42A 4ALDA 2G95A 3W9ZA 3W1QA 3HIJA 1L9WA 3OHIA 5CG7A 4IMEA 3E96A 5KZEA 3CIWA 2CLMA 4JN6A 3SZ8A 3W3OA 3GXTA 5DCDA 1EWDA 1XBYA 1ZY9A 2BX7A 1N55A 3SY5A
chains in the Genus database with same CATH superfamily
3T0DA 3PPGA 1EL3A 4FIQA 4BQ5A 1TA3A 1B54A 3P3BA 1XR2A 4BI5A 5FJIA 3SADA 3ARPA 4IF2A 1XI3A 2PTZA 1GVYA 3UETA 3FYYA 5LNUA 4OV4A 2AL1A 1TUFA 3OQEA 5E0FA 1J0IA 2GQ9A 4Q6XA 3WLOA 1ICPA 1LCOA 3WCZA 3H7VA 4MY1A 4CVUA 3H7RA 2HQAA 3B8UA 4AZ5A 1UJPA 2E8YA 5DCBA 5AOUA 3AXHA 4G1NA 1ZQ5A 3KS6A 2MANA 4Z08A 2D20A 3LCLA 3APTA 4U5KA 1Z48A 5D8ZA 2C1IA 2WZIA 2D2JA 3KBMA 3A3XA 4O0ZA 1VCVA 2FIQA 2BTMA 4MMWA 3SUVA 3QZAA 3FEMA 3W24A 1KRAC 4E2VA 3KVMA 1R3TA 3G3DA 4Z0JA 5JMUA 4L4MA 1IYXA 1KA9F 3GH4A 3OODA 2H9AA 2WHMA 4AD4A 3VD7A 3K1DA 4UCFA 4AHOA 1KW1A 3O15A 5MKGA 4C1NA 4XZ9A 3WUEA 3GVGA 1UZDA 3WQWA 3CWOX 1FWAC 5EL1A 2RAGA 1ESWA 3KL5A 3THQA 2C7FA 2ZC8A 1H62A 3VX1A 4UQ9A 4DO5A 3Q2DA 1AW5A 4LCQA 3SY8A 4M6VA 2QS8A 2WHLA 3JS3A 2C13A 3QKEA 4HCDA 4GXPA 4E5TA 2NVDA 2FMOA 4DUVA 3QF0A 2NXHA 1VYPX 5HUOA 3NO3A 1SSGA 2CZ5A 2VUNA 1ENUA 3AS2A 3ERPA 4C1KA 4JFTA 4K8HA 4NX0A 3AU2A 1AMKA 4DJDD 4A21A 3S2CA 1Q6LA 2YYUA 3NYDA 3KXQA 3CL7A 1XFCA 4DF2A 3AIUA 1GORA 4Z2GA 3N12A 3FYPA 4GH1A 1S3HA 3DCPA 1PKMA 1Q5MA 3R11A 5C8BB 1DP0A 1AZ2A 3TCEA 3A13A 3BLDA 1BVNP 2YBUA 1MZHA 4OU1A 4CCEA 3ID7A 4ZGYA 3W4RA 1AJ0A 3OB8A 4EXQA 1OC5A 1M9HA 2D1ZA 3MHFA 3PZNA 3VPLA 1KR0A 2P8CA 5FF3A 1TV3A 2YFOA 1MXDA 3RG6A 3LS9A 1AJ2A 1VFMA 4RNJA 2V0TA 2PWFA 1EYWA 1AUSL 2J88A 3VGHA 3RX4A 3O0FA 1EA9C 2AGKA 1XLDA 5EU9A 4GA8A 3M0LA 3POHA 2X7WA 4ATDA 1GQNA 5CBIA 2VCCA 4LQ1A 1SYTA 1PZ2A 1BYBA 4WY0F 2E67A 4LS1A 3U57A 3B3DA 1C7SA 4HHHA 4EWND 1ZRQA 3UGVA 1ITCA 2DJLA 3U5YA 2PDGA 1OD8A 4G7FA 4U31A 4ADUA 4NZ3A 2QKFA 1IV8A 1R30A 2P88A 4YHGA 2Y5JA 1H7NA 5JUVA 3UZ5A 1GZGA 1XYFA 1EBGA 2FYMA 3MMTA 3CZEA 5DMNA 1S5MA 1QHOA 1R7AA 4NZJA 3SEPA 1CW2A 1HKKA 4OV9A 4DXKA 3T2QA 3H4GA 1OFBA 1FWJC 2OKOA 2WVSA 2PDQA 2QAPA 3BLKA 4UZUA 3LSCA 2DZTA 3BURA 1H5YA 1ZJBA 3I7QA 3LZ3A 5CC7A 1EIXA 2C1GA 1JXJA 2J7CA 1PBGA 5DF0A 3V0TA 3VIIA 1RZMA 3V5CA 3R58A 4LSBA 1CXIA 1IEIA 1JAEA 3CV1A 3PZQA 3PNUA 2JQXA 1PPIA 4EPEC 1XYBA 3PG8A 2CWXA 3SIMA 3WLPA 3R8HA 1UA7A 2CWNA 3LENA 1TR1A 3FA4A 1W3LA 3BDKA 3EOOA 2IPWA 4ZENA 3W1PA 3OZMA 4US6A 2J74A 3HJZA 1XYCA 2YBTA 3RPTA 1RR2A 2V30A 1KGWA 4MWAE 3VAVA 1H7WA 1M01A 1C8YA 2BMBA 1TMHA 1W32A 1WBHA 1F7BA 3S1UA 4LBRA 1W17A 3OU8A 1VCFA 3ABXA 4PB3A 1KWKA 2WC7A 3VVGA 1B4KA 4J3XA 4PC8A 2WLZA 2P3EA 1TTPA 4IPPA 3DUGA 3H8AA 4FMVA 3KVKA 2FZ8A 1GVSA 4KWUA 1JZ6A 1UKQA 1XYAA 1KV8A 5CSYA 3ARVA 5EMMA 2VRKA 4IZGA 5EMJA 2ZTJA 1P0DA 3ZZ1A 1XC4A 2A3CA 3SUUA 2RFGA 4M24A 4IX0A 2HJPA 4PMVA 5T9CE 2Y5EA 4LUTB 4J9JA 3G1VA 4HMNA 1UA3A 1ZP3A 3RLGA 1UQZA 1FBAA 3ZT6A 3N9KA 4XKMA 2OWWA 3C6CA 3ITXA 1W56A 1JZ8A 1QNRA 2C3ZA 2QJHA 1GEQA 3PZOA 3VM7A 1IWAA 2ASHA 2PWVA 1OJXA 4PCNA 4BEUA 4DUWA 2DT3A 4UTIA 3TW9A 1XLFA 3AISA 3EEZA 3T0AA 2P76A 2YIHA 1NOFA 4ZBCA 3GDBA 1DE5A 3PTKA 3VYLA 2D69A 2WNQA 4L65A 3OLIA 3PJTA 1KNWA 5GJNA 3AUJA 5G1TA 2OX4A 2MUCA 4D71A 1Q8AA 4OOZA 4H9UA 4RDVA 1SZGA 4WGXA 4Q4KA 3P61A 4PUDA 3W7CA 3K8MA 1KXTA 2A0NA 4LNYA 4R9XA 1FCBA 3FK4A 2ON3A 3RPMA 1TTJA 3QY8A 2ZVRA 3BMWA 4PMDA 2VJXA 4MJ2A 1VKFA 2YCLA 2WKLA 2V9DA 2PRHA 5CJ5A 4UZSA 1UP0A 1AQ0A 1XHGA 5D04C 1O95A 3RMEA 5HINA 4HOXA 1E6NA 4XAGA 1UWTA 4AZBA 3STEA 4YTRA 2VC6A 3SUWA 4AXKA 1EP3A 4KPLA 5I2UA 1FXQA 2J9YA 1OZMA 3ZOAA 1LRTA 1W3TA 2PZNA 2HBVA 4JY9A 4PTXA 3RCYA 3ONBA 1GYNA 2ZC1A 4M3PA 1KFKA 4N9BA 3G1YA 3ONCA 3N2OA 4IP5A 4B4HA 1E72M 3OG3A 2HK1A 3UPWA 2ZADA 1E9YB 1TWSA 4YJ5A 1YE4A 3CH9A 3AHYA 1PKLA 4EANA 4Z42C 3EX1A 1V6YA 3TE9A 1TQXA 4WQ6A 3RM4A 4MM1A 1FWRA 1O60A 2BY3A 2PTWA 4MWAA 3VOIA 4Q7NA 3SDOA 2ZRVA 5DLCA 3BCJA 2F9RA 4GIAA 2DU2A 3BLOA 3PPCA 3RR4A 2ZUMA 3NXFA 4N6EA 4AEFA 4DY1A 3QR3A 4X2RA 3DFOA 3IJ7A 2P53A 3BMVA 3QV9A 2NX1A 2TAAA 3I7RA 4JCMA 1CLVA 5KTLA 4K39A 3IS4A 3QZEA 3RU8X 2Y7GA 2EPOA 1Z44A 4V1YA 3FSUA 3MZNA 1P7TA 3EYPA 4PMZA 1WXJA 5C2XA 3SN0A 5JIPA 5H8MA 1SSDA 4A22A 2XFWA 2D24A 4WJXA 4DZ5A 5IM51 3RX2A 1OG0A 1K8ZA 4KCVA 4K7YA 3C5QA 2D2OA 3LD5A 4XK2A 3QGAC 2Q8ZA 2XVPA 3IK4A 4IL0A 1X8FA 3I4KA 1RVGA 4CNNA 1FHUA 3W2JA 1T0OA 3UCCA 1YXDA 4E6MA 2FLIA 2QCMA 3MA8A 3NL3A 3DFYA 4MOZA 4JTLA 3T2PA 3C2EA 2Y6ZA 1GJUA 4JN7A 4UMBA 4NQ1A 8TIMA 1ZFJA 5K4XA 4WSJA 1WXYA 3VCRA 3E5PA 3HBLA 1C91A 3GFZA 5G2HA 1ISWA 2HROA 1OGSA 3G24A 1GGOA 4AIOA 2EF9A 5FF7A 3QHMA 3N3MA 3LRMA 2XIQA 2IQ0A 2BOFX 2DGAA 1ME9A 1YPIA 1HVQA 5CZJA 2J8TA 1TTIA 1SU5A 2XTKA 2G3IA 1TV5A 3VU2A 3W6MA 3TNBA 2RDUA 3WNKA 4MPKA 5FSEC 5I77A 1J18A 3FN9A 4NJIA 4A3UA 3BLFA 2J13A 2YL5A 2PDKA 1RCXB 4CD7A 4LUIA 1EDGA 2X0YA 3APYA 1IZJA 4GGBA 1KBBA 4CNOA 3BXWA 2JKAA 3P0XA 4JTIA 2PI6A 3L2MA 1A5BA 3WDQA 2C16A 1C8VA 2UY4A 3AHVA 3GXPA 3W87A 3UG3A 4XO6A 1QK2A 2GZXA 2H3DA 2QUMA 3QFEA 3FSTA 4QAWA 3S8HA 1KD0A 1CWYA 1IE7C 4RV8A 3HG4A 4G8TA 2OX1A 1GKPA 4KCUA 4GNVA 5T8GA 1S46A 4H6EA 2ZUWA 3RRXA 1JIBA 5T91A 2GDUA 1VFOA 1F9CA 4O17A 4NZ4A 3IJ6A 1TV2A 1XP3A 1LORA 1M5WA 3M7SA 1P5BA 4IJRA 4RZ5A 3F03K 1UIOA 1RQEA 4H8NA 2WSKA 1UD8A 1U5VA 1XQLA 5CGQA 4K3ZA 4BZYA 4D6FA 1JCMP 4JKLA 3TWBA 4AY1A 3N11A 3UWEA 3EMZA 2HNHA 3WQ6A 4Q8OA 3NQFA 3UG4A 3MUZ1 2E5CA 5JXQA 3N14A 1C92A 2OGJA 1HP5A 4C5YA 4FXFA 4NNCA 4GMEA 2CZDA 4QSFA 5I3KA 4JCLA 4WSKA 2ATMA 1WA3A 2WPBA 3THDA 3SCPA 3QZ6A 1WNOA 1TZ9A 5C55A 1XINA 4W88A 4WCJA 3B9OA 4DXXA 3VKDA 2O9RA 3TONA 3FJ6A 5AYZA 1ONXA 5MKGB 2X1SA 2ZWZA 3W07A 4O16A 4PTNA 1J9YA 3VNMA 4U2ZA 3PR2A 3VUPA 2TSYA 2GLKA 4QGCA 1FQ0A 3NQGA 2BOGX 3TTYA 2E4TA 5I23A 3H2NA 4P7OA 5JH1A 2F61A 4ADTA 5K9XA 3N04A 3DG7A 4LWWA 5HR6A 2WLYA 2ALDA 2DIJA 2OQYA 4NF7A 1NDWA 3DGRA 4YU1A 1B0IA 3AXIA 3IUIA 1Z7AA 4DLFA 4DWSA 1L2QA 3NM3A 1U22A 5CGTA 3FAWA 4ZB5A 1GQLA 3CZ8A 4NYUA 3WLRA 3VIFA 2QJJA 3VDAA 1LL7A 4H01A 4WR3A 1XDLA 1E6RA 3KUMA 5DT5A 4RCXA 3SRKA 4HPHA 1XS2A 2VFEA 2GSEA 4OQVA 5LIKX 1IEQA 1HKVA 4JAWA 2DW7A 1VPQA 1N8IA 1AODA 3NNTA 3IEBA 1CZ1A 1DWAM 1E1CA 1UBPC 1Q85A 3DAQA 1UR9A 1KRCC 1F8MA 3V3WA 4HGXA 1CTNA 4NZ1A 4WY0A 4J7RA 1RPKA 4Q8TA 4AFYA 4JTRA 2OLAA 2CERA 2YZRA 1BVWA 3CZKA 2OOGA 1VHCA 4NL1A 3P14A 3H2MA 2DSKA 1C9DA 3FJLA 3TTEA 2BGQA 3REQA 4HP5A 1LDCA 2YXXA 2TRSA 4JIQA 2VRQA 4LRTA 1GYLA 1UD4A 1G4PA 2VD8A 1C7TA 1ODUA 4DUOA 3I6RA 4W89A 1UKSA 1B9BA 3PJUA 1DYSA 3EDJA 2CZVA 4D6DA 2Z1KA 4ES4A 4FNTA 1XGEA 4Q6JA 2BVTA 3VFLA 3T8QA 2Y61A 3TJ4A 4MNMA 3M1ZA 3VZXA 2WNZA 2OOFA 5H1WA 1FDZA 3BAYA 4QP0A 4ZVJA 3M0HA 3UW6A 1ZJAA 3CHCA 5ECVA 4HZMA 3GU9A 5CBBA 2WQDA 3WMBA 5LA1A 1TRDA 2OYKA 4IICA 2QIWA 3BARA 3J7HA 4QJ5B 1SM9A 5FEXA 4ORIA 5HQLA 4MTVA 3VNZA 3R10A 3BAXA 5FCZA 2VX6A 3SI9A 3UJSA 4M82A 1V0MA 2XWEA 3WQCA 1NF7A 1UP2A 1EOMA 1JL8A 2R1KA 3UJRA 2PDXA 3WQ4A 3QY6A 4PCSA 1BRLA 3WL1A 1NQ6A 1V6VA 4MB3A 4DZHA 1ZALA 4E3VA 3RILA 4B5WA 3LHYA 2Y62A 1B3OA 1FH8A 4QJ3B 5U7SA 3TN3A 4WHBA 2PA6A 1ZBKA 2F2KA 2QPXA 3O6YX 1GOMA 4DELA 2JGYA 1BHGA 1RQHA 1QWGA 1Y0EA 5FL0A 2O4QA 4CGTA 2XVNA 5HDRA 2VX7A 4ECLA 1XCWA 4ONVA 4PTDA 4AW7A 1BGGA 4DO4A 4WEVX 3CV2A 3SN4A 4O18A 1ADDA 4I9AA 4UOQA 3R94A 3UVIA 3GDKA 3MKKA 4GJIA 2V5KA 1EGVA 5HMFA 4BKNA 2ZOXA 4GO8A 1EJTC 1HL2A 1UJQA 2RGMA 1QHZA 2R1LA 4UTTA 5CPNA 1ZPTA 4XIAA 1EFZA 1G7UA 4B5SA 4QDWA 4RL3A 1Y7VA 3EB2A 4W8BA 2V69A 3PB2A 1Z69A 1GONA 4FOUA 4LH8A 1XW8A 1PCWA 4JXCA 3QPZA 1QR7A 2ISSA 2OO0A 4GOAA 1YDVA 3CASA 3IJQA 2Q3RA 3O07A 1TPVA 4HU4A 4DF0A 1J6OA 3WQPA 4LXFA 1QVBA 4JQ2A 3NEHA 4L4LA 4S39A 1R2TA 1RBOB 4RJEA 3STFA 4IG2B 4P2VA 1AQMA 3EWDA 3PBYA 2CBVA 4JTHA 3PSVA 3ZMRA 2G3NA 2ZTKA 4L56A 2TMDA 3ENLA 3V36A 5FJJA 1R9ZA 2B7OA 4FLOA 4PRRA 4CQ9A 1CGTA 1Q4WA 3EWYA 3N4EA 3UNDA 4D9PA 1OCQA 4CQCA 5EPDA 3WQEA 1KFLA 2FPYA 5E9XA 2AAMA 3QFWA 5D9MA 2QDDA 2D23A 4RDYA 3PPHA 2NX3A 2PODA 2BGSA 1DWIM 1LWJA 2Z2UA 2GVGA 1EA0A 2NWSA 5L6UA 1RALA 1YBQA 3VZZA 3THUA 2GGGA 3NQBA 4KQNA 3RFAA 4XX6A 2YFNA 1EBHA 4FNUA 4ZSUA 5D37A 3KLKA 2IS7A 2PWHA 1J79A 3G1FA 4JIHA 3K4WA 3GO2A 3VC5A 4NKCA 1IIGA 4AF0B 5C9XA 4H6KA 3VOGA 4I5RA 3B0UX 2W67A 4TQTA 3KBJA 1TMLA 3FA3A 1ZU8A 2XH7A 3H26A 3WELA 3D46A 1F3TA 4LTSA 4XUYA 2YA1A 3CUHA 3AS0A 4POCA 1UWAA 4ML4A 4I9TA 4H9TA 5HR7A 4IL2A 2V5BA 2ZX7A 4S38A 1DJXA 3TMLA 1QOXA 1J2BA 3SRHA 3TYCA 1NQKA 2ESCA 3BICA 1Y8BA 4IXXA 1OVDA 3GUGA 4OBRA 1B1YA 4J28A 4RE4A 2QLYA 4W5UA 5A6AA 3S6DA 2OU4A 1XH0A 1PWMA 5IDZA 4F0RA 3WDRA 5J5DA 5CZ0A 3CMGA 3WNPA 1VBUA 4E8GA 4L6OA 3NQ2A 4PMXA 3I3DA 3UZXA 4IPNB 8RUCA 4OKDA 4MJMA 3VM5A 1VFTA 3B4YA 3NL6A 3EPOA 1YBQB 4F79A 4UQAA 1PE1A 3QC3A 2OKTA 3HGOA 4LC8A 4RZ6A 5TBOA 5A8NA 3KCOA 1WZKA 2ZKMX 1LUCB 2VQUA 4H41A 3LRKA 1HQTA 1KBIA 3LK6A 1BF2A 4JZ5A 4EXAA 1JDFA 3BOLA 3GNNA 3UA3A 4D6GA 2ICSA 4ORMA 4PCPA 1WAUA 4W87A 4DO6A 3WK2A 2ACQA 3R7MA 4QJ4B 2ZQ0A 3Q58A 2X2GA 4ATWA 5EFFA 1QWKA 4BA0A 1UR2A 3DC8A 3NZGA 3PZIA 4IQDA 2HEJA 1CEOA 1XYMA 1FCVA 3QR1A 1OHLA 2CLHA 1FWBC 3QYSA 3A24A 1NU5A 3JR2A 4A3QA 1UP3A 3A64A 1FHDA 4B92A 1DQXA 1PVNA 3EDFA 3QHNA 1EGMA 4U3CA 3WUGA 1E4IA 1XIJA 3BK0A 2NVAA 6ALDA 5CC6A 3ITVA 4WUIA 4XBJA 2AQOA 5AHLA 3UFYA 3F4NA 3CV6A 3E9AA 2DIKA 3GYCA 2G0WA 1G6CA 3U5UA 1RLCL 2DT1A 2X09A 6REQA 2J7HA 3W7MA 2V5CA 1RA5A 1JDAA 1WDSA 1OCNA 4ICCX 1KFWA 2PP3A 3GFXA 4G56A 4MNKA 1EC9A 3AWNA 1Q65A 2VELA 1WOAA 5C71A 2VGIA 5XIMA 2Y88A 1C8XA 4DNHA 3MO4A 2F6KA 4ZXOA 1MXSA 2OMAA 5HQMA 3R1ZA 1W5QA 8A3HA 1KXVA 5AHNA 3P8JA 1SO4A 4GH3A 4M51A 1UZ1A 3H54A 1V8EA 2CBIA 3FYOA 2XIMA 2WV8A 2JEQA 4W7UA 1SPQA 1KCLA 3MZ2A 5H2ZA 4WGHA 3DX5A 4O1DA 1UWIA 3NEVA 5CZTA 3LPOA 4M6PA 2J8GA 4JOMA 1W1VA 4GI8A 2NXIA 4MUPA 3L23A 4MHBA 3T2OA 5T9BG 5EMKA 4J3ZA 2ZDRA 1JPDX 5AC5A 1CB2A 4C7GA 1MRAA 3GNXA 4QEHA 4TX6A 5GVJA 1UZ4A 3BCDA 3WLNA 2FB2A 3GIYA 1B3ZA 1XC6A 4ML9A 1NWUA 2DJXA 4QLJA 3SCTA 3UJEA 4LB3A 3CQJA 3E2SA 3CB3A 2J7DA 3CT7A 3DHPA 4AZCA 3D3FA 3KCLA 4QNWA 5FL1A 4CKQA 4XZIA 1FX6A 3MCOA 1TB3A 4QQUA 5D2YA 1HL8A 1DXFA 3M47A 2DORA 3FEQA 1YTDA 4S3EA 3WZ0E 4F2UA 4X22A 4AEOA 2ZRWA 4BF5A 2R94A 4MZYA 4ZB2A 3W7HA 3MUIA 1E43A 3AO0A 2WC4A 1C8QA 1DL3A 1PHQA 4DYJA 2ZZ6A 4DPQA 1DWJM 2X7VA 3OA5A 1EO7A 1QATA 4B2DD 1I1WA 5HJLA 5AC4A 2V68A 4NZCA 3NSNA 3RRAA 2QJMA 4JDYA 3PUEA 3PBWA 6XIAA 3GAKA 1RAKA 3MMDA 2YCLB 2C18A 3G8EA 3RHGA 4BEQA 1E6SM 3M0VA 1JRCA 3B4UA 4YYFA 1J11A 2E09A 3LHVA 2I5QA 1NDVA 1ODZA 2WSYA 3MBDA 5A6JA 1PWLA 1GVFA 1JZ7A 4S3AA 3W7KA 1WB0A 3TDFA 5BZAA 5CJNA 3OVGA 3L9CA 1W31A 2XFRA 3PZGA 4B5UA 4FLSA 2PDBA 4PCFA 1T99A 2OWCA 3VD9A 1K8CA 1P6CA 1RP8A 4DAIA 1DXEA 1WKEA 1WZLA 2ZA3A 5BCAA 4MFDA 2J7EA 4NXSA 1A4LA 4GD0A 2WBGA 3F4CA 3G1SA 3TROA 3W2NA 2JIEA 1W3KA 2YZ5A 3SJ3A 4ZXLA 1J5SA 3MB9A 5FEZA 4J3TA 3LOTA 2PFHA 1XD0A 2BODX 5FAJA 3TIMA 4ADSA 2HCVA 3LDVA 4YLWA 4PSPA 3OIXA 7A3HA 4V27A 3SQSA 2QEZA 2WCAA 1V03A 4S2CA 2YBVA 3KTSA 4O0QA 4CCCA 2ZYFA 1GVIA 1WUEA 2HZGA 4JYEA 2AGTA 1UC5A 4Y2WA 2RHGA 3W7RA 4E4FA 4HA0A 5HPCA 3BJSA 4IMFA 2NW0A 3A6OA 3W9ZA 3JU2A 4GIEA 3GD6A 4GYKA 3NTYA 4JN6A 4AVOA 3GXTA 5DCDA 1V3HA 1XBYA 1HJXA 3UJFA 1TZ7A 3ALGA 1HKIA 1IT7A 1N55A 1WBJA 4Z1DA 4A8IA 1S2AA 3NGJA 3V5FA 1FRBA 4E2BA 3WDJA 2ONEA 4R33A 1UD6A 3AYRA 1TKKA 2VL4A 3MJMA 1LWHA 4NAEB 3TU9A 4OFCA 5BWFA 4DBSA 1Y5WA 1OWQA 2ZCGA 1FWIC 3WMLA 3QV8A 2Y4SA 1QI3A 3NDOA 4A3HA 3IRSA 3AXMA 3ABSA 3O1NA 4LANA 2Q3OA 1AFSA 3NG3A 4GGHA 8XIMA 2UV8G 1VC4A 2XIJA 1P0EA 3C0LA 4Z2HA 3W84A 3MT1A 3P80A 1JZ4A 4QROA 1UR8A 1YPFA 2O9OA 4LVGA 1K3UA 1EKOA 2W79A 4AMAA 4GCXA 4K36A 3IVSA 5C9WA 1IZCA 2PUZA 2QCDA 1LM1A 5A8OA 2C1HA 4B5TA 3K1GA 3GXIA 2DT2A 2OSXA 1X97A 4MF4A 2XUCA 4D6JA 3R25A 2NV1A 4HJFA 3PFRA 4R7OA 1K70A 1ZSXA 5CEWA 1OYBA 5LNSA 3ISIX 1DE6A 4MY9A 5G2WA 2DH3A 1QPRA 2J27A 3MP3A 2JFEX 3WQFA 3LY0A 3EXSA 2ALRA 5FOOA 1E6PA 3OTRA 2ZUNA 4LYRA 3O6DA 5JU6A 3H2AA 2BHZA 4H6QA 3DENA 3W53A 4GISA 3W1RA 5BXRA 1R38A 2NLIA 1FCQA 4JIPA 4D8AA 2GJPA 1PIFA 1OC6A 4C6BA 5H8PA 1VB9A 2OT0A 4Q8UA 2BNJA 3GFYA 4FLQA 3PULA 3SGGA 4FP1A 3KAOA 3I4EA 1EQCA 1GW9A 4PE8A 4PEKA 1O7AA 2WJDA 1WO2A 1DJNA 2XM1A 1W8SA 2YJQA 3G1HA 2CZFA 4IIDA 1FKXA 3R43A 4WSHA 4JKMA 4IJBA 3TJXA 3O7UA 4A05A 4L5ZA 4D6HA 2OSYA 1KQYA 4ATLA 3KRSA 3F7JA 2BXYA 1TJRA 4XVDA 1XRSA 2A1YA 4UTLA 2ZZ7A 4DBWA 1HGYA 3S1VA 4YCPA 5LXXA 4C60A 4EF9A 2BASA 2WZHA 3UPMA 1BKHA 4JEJA 1RH9A 3C52A 3CYJA 1G4SA 3FKRA 1LG2A 2QUNA 4XD5A 1GYMA 4D2JA 1UWRA 3WX7A 3ZJKA 3BSHA 2OT1A 2GVYA 2PTXA 2EG7A 3N15A 3STGA 3BOXA 1BXCA 4UQCA 1GKRA 2PP1A 3EOSA 4TVDA 1K8XA 4AF0A 5AN7A 4UOZA 3P0WA 1L6SA 1TRIA 4LF2A 2RGLA 3BOFA 3DKLA 2GVEA 1TJ2A 3KL0A 1NTHA 2QZRA 4KFNA 3SO7A 1E6ZA 3GTIA 1KM1A 3O06A 3OIHA 4G5DA 1GCYA 3EAUA 4V1XA 4C1NB 5K3VA 2WMJA 3LEPA 1HXJA 4HMDA 3T78A 1KM3A 1XKJA 3UJ2A 2DFAA 2E68A 4D6CA 2QCDB 1W8GA 1FXPA 2WKJA 4MSSA 4JHOA 4L1GA 3TQPA 3K8KA 1E15A 5G1YA 2I5GA 1SZRA 5BOFA 3VFCA 1K77A 3AWOA 3UR2A 3L4ZA 1KO0A 2X30A 2IXUA 4KFOA 2FFCA 3W1LA 7CGTA 1E71M 2C15A 1FCUA 2HV5A 1TELA 4KESA 5T26A 2V2CA 3WL0A 1CCWB 1CIUA 3LRLA 2OFJA 4FLRA 4RW5A 2EBNA 2H90A 2B7PA 4HTBA 4EOUA 3VIKA 1ZGDA 1QNSA 1UPMB 2V3FA 3HPAA 3AS1A 4YVPA 3PHAA 3AMDA 1JFHA 1WDDA 4NAEA 4N0RA 5EB8A 4MFEA 3NQAA 1MFVA 3PG9A 2ZXAA 1FFQA 1LQAA 2B81A 1YE6A 1I60A 1EUAA 3TSMA 3KBSA 3BGGA 4QBXA 3C2YA 4UMCA 4ZOAA 3CV7A 4W8LA 3UERA 1YNYA 2VZUA 5CAHA 3HQ1A 3S5ZA 2ZX9A 4J2PA 3UP8A 4W8AA 4LUTA 4WDUA 5AYBA 1XICA 1U5JA 3N6JA 3U4AA 4URIA 5E0KA 4N7QA 1POKA 4XAZA 3GNDA 2XGBA 4EAYA 4TIMA 3LMYA 3C8FA 1JAKA 3H21A 1DQUA 4XZLX 4UNLA 4Y9PA 2I56A 4A29A 3W0KA 4RKAA 2DDXA 3AUOA 4AHQA 1DQWA 1BWLA 3VUSA 3ZO9A 4OJYA 3URQA 3NZPA 3INPA 2CLOA 4PBFA 1JPMA 4AZCB 1E40A 4JY8A 2O9PA 2VFGA 3ES7A 3B8WA 3LXAA 2R9RA 3PWIA 3QRHA 4MKVA 2XIBA 3RR1A 3B8TA 5BW6A 3BWWA 3VIPA 2V3DA 3QH2A 2WMIB 1W3HA 2G50A 2VQTA 2WNNA 2QT3A 3ARSA 3GAYA 4UNKA 2FKPA 2XIIA 4MB1A 4ENLA 3BAIA 1F07A 1VF8A 3U6WA 3B06A 2ADAA 9CGTA 1PZ1A 1NWTA 3QLDA 1E0WA 4PH6A 4XSMA 1IIHA 4K6AA 2NQLA 1QPOA 3RJXA 3M0IA 1XIEA 4UFIA 3QQ1A 1JZ2A 3CYVA 4ZE5A 2BDQA 1D8WA 5A8QA 4YTUA 4M8UA 4HK7A 4DQWA 4NI3A 2OLHA 3UY8A 2ZFAA 3N29A 3RO8A 3O8AA 2C19A 2X1RA 5GPRA 4HTYA 2CKRA 2J47A 3E0WA 3PWGA 1OG6A 2WCSA 1SQ7A 3UVAA 3ES8A 2CIPA 1TPDA 1TWDA 4UUIA 2VGBA 3WJZA 1RQBA 3GDTA 3N6QA 2Y0FA 2OEKA 1M7XA 3S4TA 3O63A 5DX7A 1E3ZA 4P7RA 2Z24A 3EOLA 1WDPA 3GTXA 2QIIA 4GE8A 2Q71A 4Q4OA 1DV7A 4O8RA 3AQUA 1ELSA 2D0GA 3D5HA 1VZWA 4X63A 4UC5A 3CIXA 2MNRA 2PB1A 3G18A 2VRJA 3WNOA 3LV6A 4GCAA 4KT2A 4G9PA 1JYWA 1OFPA 1X8CA 4GQGA 2FGLA 4G2DA 1H50A 5ABGA 2JALA 4CEXC 1E3XA 1UWSA 2FB3A 5I02A 3RMJA 3PP7A 4HA3A 1KC7A 4M81A 3SGZA 1A4MA 3L4TA 4P7NA 4RE2A 3SQLA 3V0UA 4O28A 4IFRA 1HJVA 2VX4A 5C7VA 4HYVA 4JIEA 3W25A 1NDZA 3AMGA 1V3LA 1XUUA 2P5NA 4HOZA 2QUUA 4PB4A 4MB4A 3NUKA 4BK9A 1R3QA 5HJYA 4E38A 3W2UA 1A3WA 3AHZA 1RV8A 2EXOA 5FSDC 3SIZA 1DJGA 4Z2JA 3DKJA 2ZDSA 4HN8A 2XU2A 3HGSA 1KM5A 4JBRA 4PTVA 1TPUA 3RJYA 3WLMA 4PBEA 1GZ1A 2YXOA 2FHCA 2Z4GA 2GGHA 2AMGA 1OX4A 2GJRA 3OBEA 5AFDA 1BPLB 4O8AA 1Z6KA 2ABBA 4AD0A 1I4NA 3MWCA 3RDKA 4FX8A 2FVKA 4I8YA 3M5XA 3UR7A 5K4ZA 1V93A 3TA9A 1TV4A 1H1YA 1NJJA 3T40A 3GXDA 3G22A 5I79A 3WF3A 1J0YA 1H61A 1XISA 2IW0A 1LOQA 1MWOA 3VZYA 3TYAA 2XISA 4LX4A 1CNVA 4INFA 4LAUA 3ITTA 4QS6A 1A53A 5ABHA 3LPGA 1R2SA 4S23A 4GPNA 3UNTA 5FAGA 1OB0A 4K68A 3TYUA 1A47A 1W9XA 3HMCA 2C8NA 2RDXA 1SFSA 3PUGA 4IPIA 1I9CB 4CU8A 1D2KA 4J35A 3GQYA 3OGVA 1OT1A 5HANA 3QGKC 4KH2A 4BQ4A 3IVUA 1K7EA 3DBNA 1K9DA 2BLEA 1OGBA 4P8UA 3BH4A 3HZ3A 4RZBA 3W01A 3WLTA 4F8XA 4GZJA 4UR8A 1VFSA 5D32A 3LTSA 2P50A 4KS0A 1SW3A 3F5KA 4GYFA 2CHNA 2EAWA 1KGUA 3LPPA 3W7PA 5D9OA 1OK6A 3S2NA 2PDNA 2Y8KA 3DYOA 3LTPA 1J96A 4HIBA 3VK5A 6REQB 3RLHA 4MZ1A 3CO8A 5F2IA 1CB7B 1K9EA 3A21A 2J25A 2IMRA 4QCFA 4Z1BA 3CBWA 4DO7A 2V81A 1N8WA 3E3HA 1H1ZA 3B9DA 4OVXA 3BL3A 1I2QA 2J62A 3VKAA 5C70A 4ZO7A 2Y89A 3L65A 4NRSA 1HG3A 4XAYA 3G1XA 5D8WA 5DELA 4HN4A 4L4PA 2WVUA 3UG8A 3CMFA 3UXDA 4NXKA 1MO0A 3EPMA 1EOKA 4FPSA 3QLLA 3URAA 2WBKA 2D2GA 2XVKA 4JFSA 2WVTA 3VKBA 5C0QA 1C90A 2W61A 1UG6A 3ARZA 3NA8A 1YNQA 3NR0A 1EO5A 5ABFA 5LIXX 1JUBA 1V51A 1W9BM 3L0NA 1X6NA 3NSMA 1CGWA 1V6WA 4JL1A 2QCCA 2EJAA 1SZFA 2VR5A 3TXZA 3GBEA 4F0SA 4LU0A 1US3A 3SCSA 2HRWA 3ZR5A 3GC4A 3S5SA 3V4BA 4C7DA 1TX0A 1PDYA 2UY5A 1FH9A 5LIUX 5JBEA 3TTOA 3FX4A 2XPKA 1EC7A 2Z0IA 3F4DA 2WB5A 3FIGA 5FEPA 3W83A 3GE7A 5F4SA 2WSRA 4GKTA 1O66A 1XIMA 2BHUA 2IKIA 3M6YA 2GUUA 2E6DA 5F1VA 3ARTA 3IJDA 1P7TB 1OY0A 1E9IA 2XYLA 5I3HA 1YDOA 3PVFA 5HNRA 3TFCA 3A5FA 1JDEA 1TSIA 3S1WA 4ZEPA 4RXGA 1UH2A 2W6RA 2PURA 1DIOA 2QPUA 4ZODA 3NVDA 1HTIA 2PCQA 2Z7KA 4OOUA 3HQPA 3WIJA 3AIWA 5EFDA 3AU6A 2A79A 2DSVA 4C6MA 1JDDA 3FLUA 2HXUA 1M65A 4FA3A 2PC8A 1X7IA 3WJYA 1B3VA 5LKYA 5TF0A 2TYSA 2Z28A 3MANA 3BJFA 2AQVA 1H7RA 3G5EA 3K46A 3WK1A 2VCAA 5E6ZA 4DWSC 3W22A 2QW5A 1H51A 3KTXA 3OYXA 3Q4DA 2CLEA 1PTGA 5C7HA 3W74A 3BLIA 3CZLA 2V38A 5J8LA 3PB0A 3HPXA 3VE7A 3AIBA 4DXVA 3T4CA 4PMUA 2D22A 2Y24A 2CLKA 2OQLA 1V7AA 1DTUA 5CPQA 3LA4A 4PFHA 3T08A 2IPFA 4RR4A 3E0FA 3BMXA 2YA0A 1MXGA 1KXQA 3A4JA 1U1HA 4N02A 1XJBA 3QHOA 4GC3A 1FWWA 1YEYA 1UHVA 1LQ0A 3AS3A 3QPYA 1EXPA 4JN8A 3AIVA 3QY7A 4QFUA 5JH2A 3O6CA 1FOBA 1SFLA 2BB0A 2NVCA 4LYQA 1RBLA 4DZIA 1P0KA 1HKJA 4WY0B 5D05A 5IHSA 3BG3A 1JCLA 3GTFA 3BANA 2OO6A 1T41A 2E9BA 4LAMA 1IGWA 3KOZA 1CDGA 1B90A 3GNOA 4NYYA 2JE8A 3E74A 3NO1A 3PNZA 3JVAA 3VIJA 1YTKA 1RD5A 3WH6A 3ZQ9A 1G94A 2W62A 1CBGA 1XD1A 1OABA 4PB5A 1SR9A 4UIOA 5DANA 2A21A 3WQGA 3FKKA 2UZ9A 4KERA 1A5UA 1YYAA 1R5YA 1M03A 3IGHX 3W88A 4W93A 2XFFA 1JYVA 1HNYA 4B2DA 1OFQA 2EKCA 4KIEA 1G0CA 2YCIX 1KTBA 3E2VA 3L4XA 3LHZA 4RV3A 5AHIA 3GDRA 4M1BA 3WBXA 3TMQA 3FXYA 3PPFA 4RE3A 1BTCA 4O53A 2WKGA 3BLLA 2GSHA 1E5JA 4CD4A 3SECA 1DJQA 3P74A 4I7UA 1ME7A 3DN5A 5CH9A 3TAKA 1JCJA 4LVAA 2CFFA 4N6FA 2ISFA 4MVAA 1E4LA 1XIGA 2EJ1A 3WN6A 1K6WA 3NYZA 2PDPA 1CI1A 3C4UA 2J75A 5JIWA 5AC8A 3EGJA 5IHRA 3FS2A 3TSDA 4GY0A 3A5VA 4Y96A 5BU6A 2DZVA 3IIPA 2QDEA 4S3DA 3NVTA 1J2WA 3GUWA 2PPGA 3GWQA 1Q4NX 4IOTA 3N34A 1DXIA 4ZO6A 2PDHA 1PO9A 3S9YA 4GHRA 1GG1A 1GK8A 3VABA 3AFBA 1EWEA 3NL2A 4BWLA 4WJEA 1TYGA 4OECA 1HFBA 1T7LA 3ORWA 3S1GA 4GQRA 4C6KA 1TREA 1E51A 4S3GA 3REQB 3EWCA 2YL6A 4DNMA 2CLIA 1XX1A 3T1GA 4FI4A 1JF6A 3XIMA 3S5NA 4CQDA 1R6WA 3GW3A 2W3ZA 4WKHA 5KZMA 3U9IA 3SY1A 2CKSA 2V5LA 5A2BA 3CUIA 3TJIA 2DPEA 3RITA 4BWLC 4HB7A 4WXYA 4GVFA 4HOWA 3OHMB 1KFCA 4S1FA 1ADSA 3H2CA 2F6UA 3ZJ7A 1AD1A 3M7WA 2AKMA 2OWXA 1L6FA 3M6DA 2V2DA 1B57A 1CX9A 4WF7A 5DXXA 3N9RA 3AZRA 2YCKX 1LUCA 4HPJA 1PHWA 3VKKA 3L5MA 4E8CA 1P0NA 1T5AA 4JNMA 2GDVA 4KGLA 4GNJA 3W02A 3UG5A 1QNOA 2Z1SA 3ABZA 1Z89A 4PODA 1OC7A 3TEVA 2OZ8A 3QC0A 3TJLA 1ECEA 2QGYA 3N19B 3L68A 4QITA 4CNTA 4NUWA 3R4IA 5D03A 3A23A 5AECA 2X0SA 1V3JA 1VFLA 2E77A 4FXJA 4M56A 1BTMA 1A5AA 4V33A 1EJXC 2FPTA 5F7UA 4F0KA 1CECA 3KE0A 4P5UA 5ABEA 4QQ3A 4GBDA 4C6DA 4CVWA 4AQLA 1YHTA 3ABQA 1V02A 2YW3A 4PTMA 4Q4SA 4WKAA 3PJXA 2V63A 1F6YA 2KAUC 1A3HA 3FA5A 3NJ3A 1PL9A 2J24A 1MQRA 3HMJG 1O1HA 1JYXA 1O68A 3KWXA 1DWGM 2DSWA 1A50A 3L0KA 1WQ5A 1E0TA 4DWSB 1W3IA 4GYJA 3VILA 5A8GA 2Q02A 1FWHC 1LZOA 1HN1A 1US0A 2OYLA 4HNNA 2E5BA 3N2TA 1JRBA 1RHCA 3SRFA 2VGFA 2FH8A 3GIPA 2WQPA 4XZMX 4F66A 3F1QA 5CPOA 1VHNA 3MHUA 1ZZMA 2ZXDA 5C9ZA 1GOXA 4WDXA 4XIMA 3YPIA 1W1PA 1T96A 3Q65A 1VBGA 1VYSX 1GT8A 2XZ7A 4MB5A 1UR0A 1VP5A 2ZX6A 3JUGA 1H2JA 3W6LA 2I1OA 4P8VA 3C0SA 1OADA 2VDGA 1LLOA 4I9MA 2GGIA 1EJVC 1UUMA 2Y8VA 3UWVA 4ZOEA 2JGQA 1AH4A 2A7PA 1ZLPA 2VMFA 2R1PA 3WBWA 4JIRA 2Z7GA 4KEVA 4U33A 2PLJA 3MMUA 2VFHA 4ZOCA 1YQ2A 2GVJA 3W7EA 3DYMA 3UESA 3S5OA 1X39A 2DH2A 2ZRYA 1IR2A 1FWEC 4HKPA 4RX0A 4UOJA 4IIGA 3PBMA 2HVNA 1PX8A 2QCGA 3CUXA 3T0CA 5BNKA 2J6XA 4C6JA 3HM7A 2ZIDA 2GUBA 5GQBA 5I03A 1XIIA 5F2GA 4IP4A 4YVVA 1RLDA 4E8DA 1ITXA 4LC6A 1O4UA 3A47A 3I3BA 4AX7A 1ECQA 4XTDA 1JCYA 4H9XA 2XSAA 3FY1A 4A2RA 5HNUA 3EA2A 4Z0SA 5TQLA 1KWGA 1G5AA 4Q8NA 1XLAA 1WCGA 4XBSA 3S2LA 1WKFA 1OIFA 3WFZA 4EE9A 2Q6ZA 3Q94A 1WDRA 2IKHA 1QBAA 1Q2SA 3HV9A 4LCRA 4KWOA 4LVDA 4MWAB 1AQFA 1NP2A 3ARRA 3TR9A 5DMLA 1FWTA 4IGMA 4QG9A 1C93A 2CXEA 2GQ8A 2XWDA 1LBMA 1X1OA 2J7BA 3TK7A 4DI9A 2FH6A 4OE7A 1VCGA 4F2BA 9XIMA 3EA1A 4S3CA 2BSLA 4J1OA 2PGWA 1P6WA 2BVYA 3I7SA 3T8LA 3TW6A 1OX5A 1BRLB 1Q13A 1GTEA 5AYYA 1XWYA 5AZ0A 4BF9A 3SSJA 3CUFA 3P82A 3WUBA 2V3EA 4B15A 4FR1A 1MUWA 5FF4A 1GW1A 1KLZA 3IAPA 5RUBA 2JF6A 3NQEA 1QK0A 1XLIA 9RUBA 1SO6A 3BCFA 4ZQMA 2IKJA 3CT2A 3W1NA 1J0ZA 3ZVHB 4IG2A 3KEHA 4DJFD 4Q8QA 5EY5A 3IV3A 4UFJA 1YDYA 1H49A 2C14A 3GHUA 5IFPA 5CXPA 1NEYA 1MW0A 2FPVA 1SGJA 4C6PA 2IPJA 3HQNA 3CIVA 4IMDA 4DJDA 2R14A 2AKZA 3HG5A 4JTAA 4AIUA 2A3BA 3B03A 3WKZA 4CUCA 4QJ1A 3BZGA 1I2PA 1UWQA 4E3TA 1OM0A 3MVTA 1LLWA 1XSIA 4MAZA 1TWIA 1WE5A 4ICMA 2PC4A 3L2LA 4WKFA 2YLAA 3KRBA 4LALA 3LUTA 4YYCA 4H6RA 2A3EA 4XKYA 1L6GA 3KBVA 2RUSA 3WD1A 4A8NA 3S6TA 4GYPA 2Q8LA 2WWDA 1OFRA 4N4QA 4IGHA 1BG4A 2FDMA 3B0PA 1JZ3A 2V8ZA 1WOBA 3GH5A 3TQKA 2J9XA 4TV6A 4CN6A 3QQWA 2RJGA 1JPIA 2GJNA 4PUUA 1K9TA 3NPWA 1VBRA 5EBUA 1L6YA 3I10A 1ZAIA 1THFD 5TIMA 3NQ8A 4MNJA 1VGAA 3C56A 1EZWA 4QLKA 4TOQA 1UR1A 5D2TA 4EK7A 1IXOA 3U3HA 4M7SA 4GFSA 1GPFA 4LUYA 4YWSA 3STPA 3GG8A 3LBMA 5AHEA 3QBUA 3N4AA 4LEFA 1UH3A 1AW2A 5DQPA 3LLFA 4A8LA 2OSWA 4DM2A 1GG0A 3KP1A 3V1PA 3OVQA 3WQ5A 3FNDA 3DIPA 2B4GA 3CPUA 1TIMA 4IT1A 1R3WA 3WSUA 4WIWA 1RK5A 1FHVA 4ERGA 4ZTXA 1NARA 5D2XA 3NOYA 3OJGA 3QKZA 2DUAA 2X05A 3FV9A 3OZPA 1D7FA 4EPBC 1RY0A 1M1BA 3WD2A 3RK8A 1JFXA 1SW7A 3D6NA 3HU7A 1BYDA 1QU4A 4AZIA 2PDCA 5LNVA 3AJ7A 3QJAA 3F2DA 3DYPA 1XBVA 3EB3A 1W1B1 3GR4A 3TSBA 1UUQA 5FKYA 4J3SA 3RM8A 5HK4A 3PZUA 2WK2A 1JUKA 4FF5A 2EPKX 6TIMA 2EHHA 2GVLA 3WLQA 2VR2A 4PUMA 4LB4A 3S47A 7TAAA 4DZAA 5A8MA 2VOTA 4AZHA 2A5HA 2B0MA 5D2WA 1DJWA 5LA2A 3L21A 2CITA 4NJKA 4UCGA 4GVHA 4LS0A 2O55A 2OCZA 3DFHA 4WZHA 2E7FA 3C2RA 5BROA 2J66A 2G37A 4PRWA 2E6FA 2A4AA 3GXFA 5D4YA 2Z2AA 4JYDA 3MP5A 3H23A 3NWRA 3WEOA 2CLFA 4OTKA 3ZIZA 2CZEA 4GXWA 1VLWA 4MLRA 2FVLA 1IHIA 4ALDA 4D6EA 3HTWA 1R9XA 2XVGA 1SVDA 1CPUA 5AYIA 3CIWA 2CLMA 2WZTA 3W00A 1KKOA 1EWDA 1ZY9A 2I16A 1W1A1 1K1DA 3WF1A 3WMCA 3SCNA 2WYSA 4JFWA 3E5BA 1XRFA 1JI2A 4H7ZA 3SY5A 2FMNA 3N2BA 1S2TA 4HNCA 3CUZA 1UWUA 4QSHA 1TJPA 4Q4MA 3USBA 1R87A 4UB9A 1V0LA 2ACUA 4GQQA 1GZJA 3MUY1 5K7JA 2E9LA 3EWXA 4U3AA 4HU8A 5LGZA 4GINA 3SRDA 1XLJA 2O0TA 1O12A 2DZSA 3LU2A 8XIAA 2QGHA 4Q8VA 3EWUA 2Y63A 2WJEA 3KFTA 4WDTA 1OF8A 3LCHA 1QPKA 1YMYA 3QN3A 3DFNA 1Q6GA 4BI7A 4XZHA 3E1F1 3ALFA 4Q4PA 4KBXA 3STCA 2NSXA 2PLKA 3V1HA 1Q6QA 3PM6A 1NWSA 4AZ7A 1SR0A 4L9XA 4NZFA 3VCNA 3WDIA 1RD6A 3CQHA 4BHYA 2VCBA 3MW7A 4IQLA 3UT0A 5KEZA 2GGJA 3VOCA 5BXTA 1W9DM 3LI0A 4L4OA 1H0IA 3MPGA 5HWMA 4ZO8A 1F3EA 3LCXA 3PF3A 4Z2LA 2QUTA 3O6AA 3LBCA 1UD2A 4QHRA 2PAJA 2HS8A 4H04A 5A94A 3ZJ6A 3B8DA 3E2RA 2KX9A 4LCSA 1OINA 3LHWA 4HBKA 4B5NA 4ZTYA 4LF1A 3UZJA 3PTDA 2GGEA 1ALDA 2HDJA 1R7OA 1R3YA 2RDTA 3TC7A 4WOZA 5D09A 5E6YA 4OHQA 3TFXA 7ODCA 4A3YA 3CAQA 3VGDA 1HKMA 4UTMA 2WAGA 3TR2A 1IXQA 3SQMA 3MSRA 5JBDA 2QV4A 3MTWA 2IUZA 4BJHA 4LAOA 3ITGA 3M07A 2OLSA 1R47A 3UU0A 3LHTA 3AXKA 1XLGA 4OBTA 4HK6A 4HZ8A 4PMRA 3VMOA 5M5DA 4YPJA 3AJXA 4J5NA 4NILA 4ZQNA 1NOUA 4GFIA 1TO3A 1VFHA 4C91A 1UOZA 1FH7A 5G4WA 5GNYA 4GWEA 1B30A 4FX6M 1YADA 3KWSA 1CXFA 2VFFA 2GQ3A 3IIZA 1OFOA 2BZNA 3S2JA 1NELA 3RGTA 1FTXA 2BXVA 1R85A 3IPWA 4ZQOA 3CJPA 3W28A 3B9NA 3TN4A 4ILSA 4H9MA 4GX8A 2NQZA 1YTEA 1E1FA 1VIWA 3WEMA 2BV9A 4RNHA 2E9MA 4L61A 1WZMA 4UTTC 3GX9A 5I07A 5EBAA 5DN1A 4JR5A 2WC3A 3P7YA 2PRLA 3PC0A 2O92A 1UKPA 1Z41A 1EP2A 2G96A 1MYRA 5HBFA 2YLLA 3QYQA 1V6UA 4Q3MA 3HGRA 1B4EA 4MLJA 3GS6A 3K30A 4BI6A 1F76A 1MQQA 3LYEA 2OTDA 3QR0A 3KZPA 3IIOA 2F8QA 1U1JA 4Q32A 1J12A 2NQ5A 3PUDA 5E1QA 5E09A 3OGRA 2GDQA 1JNDA 2B7QA 3LZ5A 1PJ9A 4C65A 4L64A 4Q8WA 2Z00A 4NASA 3SAZA 1RY8A 1V5XA 1OFAA 1W54A 2OPJA 4MWAD 2XZ9A 4GIYA 3G2GA 3MDWA 1EDQA 1S2WA 2UY3A 3M0ZA 3H2EA 4PZVA 3POCA 2A7NA 3W38A 2GWNA 3NQVA 4RDWA 2WVVA 1Q6FA 1E9ZB 3AALA 4BQ2A 4JTJA 4ACYA 4DAFA 3IANA 5FD0A 1K02A 3DHDA 3K5XA 2OEJA 3EXTA 4FNQA 3WD4A 1QOPA 4ZB0A 1J93A 4DJDC 3A3HA 4L9YA 3HPSA 5TNVA 3SFKA 1KCXA 3AHXA 1RJQA 1KLYA 2WMGA 3FGCB 3C61A 2ZZ3A 1EF2A 1MMFA 3EWWA 3W7LA 4DEFA 3FJNA 3BW2A 4US5A 2NXGA 2NQJA 2VC5A 4LBUA 4EXBA 4X60A 3DFTA 1O5RA 5D2VA 1CGUA 4GQ0A 3NSXA 4CLMA 1GQIA 1JG9A 3T7VA 4S3FA 1K4HA 3XISA 4KGJA 3C2OA 4LEQA 2EGZA 3ZSTA 1D3HA 3BPWA 3VNYA 3F5JA 2EPHA 3CHDA 4D1IA 1R2RA 4W4QA 1NY1A 3LCGA 2EKGA 4KETA 5LYRA 1TJ0A 1RPXA 2WM1A 4LVBA 1YW1A 3O3RA 5K9DA 3HQOA 2VEIA 1FDYA 4KMQA 1ZBWA 3CMJA 1Q3NA 3M5VA 3MYOA 4M19A 4EIVA 1DWFM 3CZGA 4YHEA 3WY1A 1U33A 4KEMA 2PDYA 4L6HA 2F2HA 4CNUA 4IH3A 3UYIA 1TPEA 4IIEA 3SCWA 1F5ZA 1HJUA 2Y2WA 1JR1A 7PTDA 2YSWA 2POTA 1XBZA 5CC5A 2XDFA 2QDHA 5I3DA 4WXZA 4FSAA 2JF7A 4B91A 4MZ8A 3CO4A 4E4PA 4NZ5A 3B05A 1UOKA 3VKCA 2X40A 1KXHA 3DG6A 2CLLA 1G9HA 2VVSA 4C6NA 5A2AA 3CNYA 4QIUA 1RP9A 4C1LA 3G6MA 2PWUA 2AMXA 2DV0A 3QM3A 4OIFA 1U30A 3CPGA 4HU0A 5LHEA 3NPVA 4Z1YA 2ACSA 1HIZA 1M41A 4ACZB 3GU1A 3GG7A 2UWFA 3LGEA 3O0KA 4QDPA 3V5OA 4J2MA 5XINA 4QE4A 1YRRA 3FOKA 2HE8A 2ISVA 3WQOA 1YXYA 1A80A 4GVIA 2YKKA 3T07A 3U2OA 5A6MA 2W92A 3O16A 3L4VA 4X0NA 3THCA 1M53A 3TLLA 2I7GA 1SFJA 5HULA 5LNRA 3RCMA 3TOPA 3HFTA 5M1TA 1AL8A 4X3ZA 3LTYA 2YPIA 4HT3A 3Q67A 1Z3NA 4LY4A 3HA1A 3TKFA 3N73A 4DYEA 4F9DA 2WSQA 3M46A 1VFUA 3CB8A 1BXBA 1G69A 1XDJA 5AVHA 3IIVA 5M3WA 4DX3A 3P6LA 3S3GA 4WRHA 2ZUSA 2A3AA 4CU6A 4IMAA 3OVRA 1BVZA 1Q45A 4EP8C 1J10A 3H55A 5EGRA 4R88A 2E0PA 2XN1A 5F4WA 3NURA 3W6YA 4IGNA 1Q7MA 1REQA 4GUIA 2NQ9A 4M0XA 3G0UA 4AB4A 1VEOA 2PDFA 3RN6A 1XSJA 1UMLA 4D72A 2PDLA 4YTQA 2BP1A 4AUBA 1OFEA 1WAWA 3VOHA 4GRSA 3L66A 4IX2A 2XG9A 3CZJA 4LT9A 3LQGA 4DJFA 5HA7A 1MEIA 4UTFA 4QAIA 3NQ6A 3HV8A 4OUEA 2G3FA 5CJMA 2WSPA 1D8CA 3KL3A 5AC7A 4X9YA 2VXNA 3VA8A 1MRQA 3UD6A 2PZ0A 3JW7A 3M5YA 3OLDA 2GK1A 4UTWC 5CC3A 1BFNA 3ZLHA 2REQB 4HNVA 1LQ2A 3VDGA 3R79A 1PXGA 3CS2A 3K2GA 1CYGA 4AVFA 1O94A 2BBFA 4YXGA 4NIRA 1O1ZA 3DG3A 3WD0A 1TX2A 3WO8A 2DIEA 3GW0A 1SJBA 5AVNA 2HISA 2QUVA 2DSUA 2R1MA 4M80A 5LGXA 1F3WA 2DZXA 1B31A 3VIHA 2X1TA 3L4WA 2VZTA 4I6KA 4HMEA 1GOKA 4CNSA 4UR7A 1X1NA 3SB0A 4UWMA 4GUJA 2PWDA 4ROQA 4DN1A 4XKYB 2OZTA 3NGFA 4IJCA 3H7UA 2POZA 1XLMA 2YYTA 5I0DA 4DF1A 4UR9A 2G4JA 1DHKA 1TPWA 1PX4A 5DMYA 4JTFA 4JHMA 3M41A 5LIYX 4C6LA 5KSWA 2IQDA 2HBXA 5LZLA 4R34A 1WDWA 5K2ZA 4ZZ9A 4DJEC 3I65A 5E5CA 4AG0A 3ARYA 4LUSA 4H9ZA 4H7VA 4GYPC 3CUJA 3QOMA 4J3WA 3PSWA 1TPB1 3AMLA 4GZEA 5HAOA 1W1ZA 1Z8AA 4YTSA 1K6AA 4CD6A 2QMJA 3LXCA 1XPGA 3IUDA 4UQBA 1HKWA 3BLEA 3KRUA 1NFBA 2QF7A 1RCQA 1JEZA 1XDMA 2D2HA 3OQ8A 4L7ZA 4RE0A 3WBEA 2XIOA 3LLXA 1KCZA 1BXNA 2XM2A 3E2QA 3N13A 3ZYZA 2PBOA 5BU9A 4F0LA 1QW9A 5C2GA 5CQ1A 1WYIA 4Q33A 4ERIA 4HMCA 3GG1A 1V08A 3NPXA 3DFSA 1TVLA 4U28A 2PDJA 4HNUA 4BR1A 4Y6GA 3T0BA 2V82A 2ISWA 2VC7A 4GKLA 4DB7A 1PS9A 5CLTA 5HWNA 1Q6RA 1SZEA 4PA8A 3BW3A 1ZENA 3W26A 3ELFA 4O4VA 1I45A 3WH5A 2H9AB 1JCNA 1HF6A 2QXWA 3GM8A 4K8EA 1TTQA 5PTDA 4PUNA 5H91A 3E6EA 5IRPA 4V15A 2E5DA 1S1PA 2JBMA 3H4XA 1VJSA 2OZ3A 2QJNA 4J27A 4S3KA 4AC1X 3OYZA 3GSMA 1JJKA 4X9SA 4B3ZA 1V3KA 5BOOA 3AC0A 1DJZA 4C5ZA 4A2SA 3TAOA 4AIEA 2RH9A 4G6CA 1W1TA 1V6XA 4Z1AA 1W91A 9XIAA 3GKAA 1QXLA 3V18A 1X6UA 1J0JA 1J0HA 2YDRA 3K4DA 3RLUA 1EUNA 2G97A 5D38A 3IGXA 4AZGA 2I14A 2R6OA 2X2YA 4UFKA 1EHAA 3AYVA 4Q8MA 4JPGA 1L8PA 1XF0A 3W2KA 1PB0A 2ZZ4A 1IT0A 3VGGA 4LPCA 1OBAA 3VGFA 4MKSA 1ICSA