5AHMA

Imp-bound form of the deltacbs mutant of impdh from pseudomonas aeruginosa
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
378
structure length
354
Chain Sequence
MLRISQEALTFDDVLLIPGYSEVLPKDVSLKTRLTRGIELNIPLVSAAMDTVTEARLAIAMAQEGGIGIIHKNMGIEQQAAEVRKVKKHETAKAKTYPLASKDEQGRLRVGAAVGTGADTGERVAALVAAGVDVVVVDTAHGHSKGVIERVRWVKQTFPDVQVIGGNIATAEAAKALAEAGADAVKVGIGPGSICTTRIVAGVGVPQISAIANVAAALEGTGVPLIADGGIRFSGDLAKAMVAGAYCVMMGSMFAGTEEAPGEIELFQGRSYKSYRGMGSLVPEGIEGRVPYKGALSAIVHQLMGGLRAAMGYTGSADIQQMRTQPQFVRITGAGMAESHVHDVQITKEAPNYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Studies of Two Variants of Pseudomonas Aeruginosa Impdh with Impaired Allosteric Regulation
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Oxidoreductase
molecule keywords INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
total genus 112
structure length 354
sequence length 378
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5ahmA00
3TJXA 2ALDA 5EBUA 5F2MA 4ICNA 3S6DA 2DZUA 4S1FA 1I2QA 1Q6RA 2VC6A 3C56A 4R33A 1GG1A 1F2JA 2P0OA 2FJKA 3AO0A 1X6UA 2D73A 3OEXA 4UMAA 1GVFA 2BXVA 2ATMA 3CLMA 4AHPA 5HUOA 3LB0A 4LTSA 1YPIA 5EYWA 3W84A 2PC4A 4Y8FA 3QMSA 1VLIA 5AHLA 1H1YA 3PUDA 4JDYA 3TQKA 1V5XA 2V5LA 3W7IA 1NF7A 4AHQA 4MKNA 1R46A 3ATYA 3LCFA 1M5WA 3TX9A 1TO3A 1OG0A 4NJIA 3DH7A 4ZVJA 3R13A 1TPB1 2BSLA 1FBAA 4JTGA 5HULA 5LNSA 3SFKA 1JCMP 5T26A 1SZGA 4P61A 3KXQA 2DORA 5EA9A 3NAVA 4R7JA 4UTKA 3W1QA 4BR1A 1T99A 5D30A 3SIZA 2GQ9A 3A23A 1X1OA 4PH6A 5AC8A 4HPJA 3NL6A 4JY9A 3MO7A 3TE9A 1XDLA 2NZLA 1TTQA 4XKYA 1FCUA 3E02A 3R5EA 1EUAA 4JX4A 4JY8A 1NAL1 4LY8A 3MI6A 2A7RA 4CQAA 3NQVA 4CNOA 1W0MA 2NXHA 3HPZA 1QPRA 1K7EA 1YDNA 2GQAA 1VCFA 3W2NA 1F74A 1DOSA 3RNDA 3HGSA 3LERA 4NX5A 2NUYA 1LBMA 1TB3A 3KFTA 1H7NA 5A8GA 1MZHA 4ZQRA 1FY6A 3A9IA 3M6YA 2VKZG 1KM0A 4ZL1A 5D38A 5K9XA 2ISSA 2ZQ0A 1DQXA 3BG5A 3M9YA 3HGJA 3PG8A 3BV4A 4GJ1A 4IQLA 4GUHA 1TJRA 4JX5A 2B0MA 3DFPA 3G1FA 4DEFA 3TXZA 4LWWA 4B5NA 4ML9A 3IGSA 4O12A 1HO4A 1IGSA 1I2RA 2H8ZA 3O05A 3NOEA 3NNTA 3PVFA 4PFMA 1FXQA 3L67A 3OVRA 4RK8A 2WNQA 1W8SA 4A21A 3NG3A 4GBUA 4IMCA 2WV8A 3O15A 2VFIA 4O18A 4N9CA 2J88A 4O1AA 3S1VA 3G1DA 5FF4A 1GVQA 4L4LA 3L68A 4OT7A 2YYUA 3LCXA 2G95A 4D2JA 2AAMA 4O19A 3QW4B 3EWWA 3DFOA 2Q8ZA 3N3MA 1FX6A 3LTPA 2ZTJA 2A1YA 4BI7A 2P10A 3W72A 2CZ5A 3G8EA 1OF6A 1NEYA 5AC7A 1ALDA 3S1XA 1K7XA 3C2RA 2OMAA 4DPQA 3UWZA 2V0TA 2ZZ3A 3I7RA 1YTDA 2DJXA 3CEUA 4ZQNA 3L21A 1KTCA 3W83A 5FEWA 3W7LA 3T44A 2ZRVA 4CNPA 3UXDA 5EMUA 4P2VA 1W3IA 4AVFA 5HQEA 4I7UA 4A29A 4POCA 4LC6A 1OYBA 2VXNA 1K8YA 1X7FA 4K37A 1H7RA 5AYYA 2DZVA 3W75A 1ZFJA 1QNVA 4JIPA 1TPH1 3G1YA 4X22A 3GDMA 1IF2A 2C13A 3HG5A 4IX2A 4LVDA 5DY2A 2ABAA 3UPBA 3E49A 4UFKA 4JDBA 2VFEA 4UTWC 1GEQA 2EF9A 3W2UA 3A21A 4GFSA 4GNJA 5D2XA 2R91A 2OZ0A 1W5NA 1WXJA 5LGXA 3O06A 4TMBA 5CPOA 1GVSA 3CHVA 1VLWA 1W5QA 4FNPA 4GC4A 3LBCA 4O13A 3C0JA 1JCLA 5AYZA 1EPXA 5I3HA 4UTIA 2CLLA 3NM1A 1K7FA 4MIMA 3IIVA 5CZTA 1GYLA 4OWGA 1SUXA 5E1QA 4O16A 3H55A 5TBOA 1QPOA 3TJLA 3P5YA 1R30A 1FQ0A 2W6RA 3O07A 2HMCA 3HIJA 5L9FA 2BWGA 2X16A 2PE4A 4N6EA 3T40A 3W7PA 2VELA 3UWQA 3PSVA 3F4NA 1VS1A 3M1ZA 2NV2A 4AWUA 4RZ5A 1OFOA 1XC4A 3CEPA 1G69A 3A5VA 4MJZA 4UR8A 2ZA1A 5D2VA 3W7KA 2TRSA 1XXXA 2GVJA 3EXRA 2ZRXA 1R47A 1JCNA 1TTIA 3DBPA 1LYXA 3IGXA 4O1CA 3F1QA 1EUNA 1QMLA 1SO6A 4LVAA 1LORA 5K7JA 3ABSA 1UUOA 3NM3A 3NPWA 4O15A 1MSSA 1B9BA 4RKAA 3BLFA 1JR1A 3HQ1A 5C6MA 4IGHA 3EB2A 3TAOA 1XM3A 3TSMA 2B7OA 2RDUA 3ZFHA 4MY1A 4MYXA 4A3UA 1FWSA 1QO5A 1EEPA 5G1YA 1N7KA 3NO5A 1P1XA 4C1KA 4EVZA 3STEA 4UFHA 1P5BA 2BTMA 5EKYA 1WDWA 1KM4A 1KM5A 3P84A 4PL1A 4N2YA 3TSDA 3CU2A 3QC3A 3IGUA 3NZ1A 2Y7GA 3NXFA 1GWJA 2ISVA 3G0UA 3PG9A 1WBHA 4FF7A 4YCOA 2I1OA 3NPUA 5LNVA 3N9RA 4Z0SA 5E0KA 4PL2A 5KTLA 3NL2A 1JUKA 1AL8A 3UXAA 2Y61A 3BG3A 2H3BA 4RX0A 1QDSA 4RZ6A 4QSHA 2WPBA 1MEWA 1P4CA 5J5RA 1H5YA 1DKWA 4UMCA 5F2GA 3G24A 4FXSA 1OYCA 1AW1A 3T78A 3B03A 5KINA 5AHFA 3W7OA 2Y85A 4TX9A 3W7GA 3EWXA 2QCDB 1XI3A 4EIVA 1JULA 3DHFA 1G6CA 5LNWA 5BMXA 1XUUA 5CZ0A 3R8RA 4JYEA 4IOTA 1LBFA 4NXKA 4LT9A 3UWYA 1KV8A 4OV9A 3LV6A 1YXYA 3SGZA 5G4EA 3QRHA 3P62A 1K8ZA 1TPVA 1RQBA 2Z1BA 4AWSA 3RMJA 3ATZA 4TO8A 4LRTA 3HO8A 3NPVA 4XQ6A 3LTSA 3TAKA 2DZPA 3TCEA 4UTTA 1TQXA 2ATSA 5FI8A 2WO5A 5I3FA 5K9DA 2V9DA 4FNTA 1SR9A 1VGAA 5DXXA 1JCXA 3GXNA 4HSOA 4JYFA 4OBTA 1XBYA 3SECA 3WJXA 2Y7DA 4CLMA 4KFNA 3NVTA 1CX9A 1AMKA 4S2BA 2C6QA 4HKPA 5LNUA 4ZQPA 2B7NA 3FJ6A 1KFEA 2DU2A 3GNDA 2CLKA 3W7RA 1ICPA 2DZXA 1BEUA 5CPMA 2C3ZA 1ZHAA 3TMQA 4E0CA 3P74A 5LHFA 3O6DA 3MBFA 3W1NA 1KBIA 3MHFA 4PTNA 4WJEA 3I6RA 1I2OA 3EWBX 2J27A 4Y96A 1HL2A 2Y70A 1T0OA 3S5OA 4ZZ9A 2ZRZA 3IIZA 1SW7A 1TV8A 4HNUA 3EWUA 3M5ZA 3NA8A 3FFSA 3JR2A 1F73A 3WJZA 2W79A 3E12A 5C2XA 1H51A 1OABA 4QIUA 3LHZA 3S5YA 5CSRA 3PR2A 4K36A 2WOQA 3G1XA 3INPA 1RVGA 3FIGA 1LLWA 4LS1A 4NJHA 1OFEA 2CLMA 3KRSA 4FNQA 3TV8A 5HUPA 1LOSA 4W9TA 3S42A 4ORIA 2V2HA 3ZWTA 3KX6A 1JRCA 4O54A 2A2IA 3TDFA 1SFJA 1I2NA 4UMBA 1W37A 2EPHA 4N02A 4ZQCA 1VZWA 4M6PA 3R2GA 3W3OA 1KLYA 3G18A 3LCLA 1WOBA 4MLRA 2YW3A 3TKFA 1F05A 3PF3A 3RK8A 1FWNA 4O4WA 1CI1A 1A5SA 4YWIA 2V81A 2Z2UA 3SI9A 4HT3A 3W7MA 4IJBA 3U8GA 3GNNA 4DF1A 1LP6A 1YTKA 3IVTA 4QNEA 1W56A 3HPSA 3EKLA 4O14A 3NL5A 2VEIA 2EGZA 1X8FA 2OX1A 1JVNA 3QPYA 2BZNA 4N9EA 4JYDA 4DPPA 2HSAA 5HWNA 4BI5A 5K4ZA 1QCWA 3P8JA 1IXOA 4JTLA 2DZWA 1H7XA 4AB4A 3LBMA 5AYXA 4MZ8A 1Z48A 4AWTA 2YZRA 2NV1A 3NDOA 2RHGA 1EB3A 2ZZ1A 3PBUA 2DZTA 1JJKA 3CTLA 4TIMA 1XBXA 1L6WA 3NGJA 1BKSA 4GUFA 4UNLA 1XDMA 2G96A 2V30A 3EXSA 3W2MA 1UCWA 1PHWA 3E9AA 3W88A 1ZAJA 2Q3RA 1OX4A 5ABTA 3V75A 4K38A 3KVKA 1W3TA 2A5HA 5EL1A 2H6RA 6TIMA 3W6YA 3C2VA 4JIQA 1UBSA 5AOUA 4O57A 3LDVA 2QJHA 3L2IA 4UTHA 4Q4KA 1W54A 5I3GA 4GRSA 1FWRA 3P5ZA 3QSTA 2A21A 1GJPA 1YLVA 2G5WA 4UNKA 3EEGA 4NXSA 3PB0A 3EWZA 1W31A 1YXCA 1W5OA 4BI6A 4LVFA 3W07A 1RQHA 1G7VA 3G1VA 4NJKA 2FB3A 1CW2A 1S5VA 3A22A 2H3DA 3GVGA 4E2BA 5AN7A 2ZRYA 4O28A 1H63A 2CFFA 3S0CA 1GYNA 2ZCGA 3H54A 1XUZA 1B4KA 3FYOA 5D04C 3N2MA 3TXVA 3GB6A 5FEPA 4CCEA 4O1BA 3TK7A 5DN1A 5I3KA 1PE1A 2GJLA 1RD5A 3B06A 4IMGA 1KM1A 3PUOA 2HS6A 2QDHA 2YFOA 3FYPA 1EX5A 5HNRA 2JKPA 4UFLA 3C8FA 3O63A 5DELA 4X2RA 3UY7A 1TPUA 4XWUA 3ZS4A 2FQIA 4O50A 3UY8A 2GVGA 3KHJA 3FJLA 3B0VC 3QPZA 2F7FA 3WFAA 4Q32A 4MZ1A 3TIMA 1AL7A 4NJGA 1XL9A 1ME7A 2ZBTA 3GZ3A 3PB2A 4HN4A 3O6YX 3F4WA 3M43A 3G0XA 4ZQOA 2C1HA 5HWJA 2X1SA 3W2JA 1VPXA 3TROA 1RZMA 3B0PA 5AC6A 2A7NA 1FCVA 4YMZA 2YX0A 4O10A 3T4CA 1DORA 2NXGA 2I9EA 2ZZ7A 2FTPA 1KA9F 5CKSA 2NUWA 4DO6A 1LOLA 1F76A 2RH9A 4MZYA 3MHUA 2J6XA 3NQEA 1K8XA 3TA6A 2G97A 2PRMA 4YLWA 1N55A 2OCZA 2B7QA 1JCJA 3VKJA 3NQMA 4LU0A 3W7EA 4AF0B 1WX0A 1TSIA 4LC8A 5CZJA 3NQAA 4KWVA 3MJYA 2R14A 3BO9A 3DFQA 4IXXA 5KITA 2CU0A 2JKAA 3SGUA 2A7PA 1IIHA 2GJNA 3ANYA 3P80A 5F4SA 1JRBA 3GDLA 3GDKA 3WK0A 1XKYA 4WXYA 3TW6A 3G1SA 1MXSA 4OV4A 1KM3A 1A5AA 2QDGA 3UWWA 4K7VA 3SJ3A 5D09A 1M6JA 2FDSA 3FA5A 2X1UA 4JX6A 4TMCA 4NNBA 2OJPA 3QEZA 3A5FA 3W1AA 3EX4A 5U4NA 4UTUA 3IRDA 4UXDA 1QR7A 1B4EA 4JD4A 3LOTA 1K02A 1VYRA 4KFPA 1VCGA 1SU5A 2VEKA 1PCWA 2NX9A 4JTFA 1YYAA 2TSYA 3SR7A 2X30A 3DZ1A 3W7CA 4QAIA 2ZFAA 4U4MA 4UTTC 2Y63A 4AHOA 1TPDA 5LKYA 1SZNA 1IXPA 4U28A 3TC7A 3LXCA 5H91A 3C6CA 5TQLA 5D05A 4N4QA 1O95A 1LTDA 2JKEA 5DLCA 3PBYA 3KVMA 1PCKA 2YR1A 5IBXA 4RZ4A 2Y7EA 5U7SA 4WX2A 4Z1CA 1OFQA 3M7WA 5D03A 5A5WA 2P1FA 5D33A 3N14A 3VE9A 3GXPA 4XTIA 3OHIA 1QWGA 1TTJA 3R12A 3W73A 1MEHA 3C4UA 5K9CA 2CZEA 4XBSA 3W2LA 1QPNA 2E5BA 4JN6A 3GK0A 3QSRA 3DAQA 5D32A 5DCEA 2R8WA 3S5ZA 1C8VA 2LLEA 3M41A 1DV7A 2J9ZA 4TU1A 5I3JA 1KW1A 3EX3A 1LCOA 2YCEA 1JQVA 4EF9A 4JNMA 1T96A 2Y88A 2YPIA 1FXPA 1B57A 4ADTA 4FNUA 3FKRA 1RQEA 3W1RA 1QAPA 3W2KA 1SFLA 2ZYFA 5FF7A 2V2DA 1Q45A 4WY0F 3TQVA 3U6WA 4CCCA 3UQNA 4GWEA 1WQ5A 2NWSA 3IEBA 3W1UA 2ZZ2A 2QAPA 1AK5A 4EWND 4EF8A 3NEVA 3IIPA 4QJ1A 5BNKA 1OF8A 4HPXA 3IVUA 4NNCA 3BW4A 2CZDA 1VHNA 4UR7A 1WOAA 1VC4A 2ZDRA 3USBA 4GUGA 1FCQA 4IMFA 3I7QA 1TIMA 1D9EA 3C2OA 3P82A 3CB8A 4JXCA 3QW3A 4KFOA 1TRIA 4A2RA 4JTHA 1NSJA 4M5PA 1VCVA 3FS2A 2KZHA 5G1TA 1TRDA 1VRDA 1WA3A 3UWVA 4ADSA 5G2WA 3L0GA 1H1ZA 1TV7A 4X3ZA 5CG7A 1ADOA 5K2ZA 4UC5A 4LUJA 1YXDA 4RXGA 6ALDA 1LROA 3LXAA 3GR8A 3DI1A 1OFRA 3HG3A 4NQ1A 3NYZA 1OHLA 2E09A 3WK1A 3F03K 1P0KA 2C15A 3LHWA 3N73A 4YL2A 4MFDA 3TUUA 1H60A 2X2GA 1BWKA 4FIQA 2JK2A 4WUIA 1VR6A 3MYPA 3EX6A 2PURA 3N2XA 1GTEA 1SW0A 3HGRA 3LLFA 4XTDA 4MYAA 3SY5A 2QCGA 5CSSA 3LRKA 1HO1A 4GUJA 4J9JA 1G7UA 1H7WA 1M7PA 2E6FA 3GDRA 2ZA2A 3S8HA 2ZA3A 3W22A 2Y62A 3O1NA 4G1KA 2C18A 2DP3A 1K03A 4MOZA 3D0CA 2CLOA 3DXIA 4NJJA 1OX5A 1SSGA 1TCDA 3KVLA 2Z6JA 3SW6A 4A22A 1GG0A 1PL9A 3GAKA 3OG3A 3S5NA 3W1TA 1DHPA 4O4VA 3PSWA 3PM6A 3PBWA 3DFTA 5HWMA 1DBTA 3M44A 1WBJA 1G4TA 4N9DA 3VNDA 5CPNA 3JS3A 1JQXA 2NX1A 4K8EA 4AF0A 1UUMA 4BWLC 3MP3A 1SO3A 4RCXA 1FCBA 3OIXA 1J4EA 1JCYA 4UUIA 1QFEA 1QPQA 1TREA 5C5YA 3LLDA 1EP2A 1Q3NA 2WNZA 1EP3A 1TMHA 4JTSA 1SQ7A 1GVRA 4M19A 3LHUA 3W23A 3EX2A 5LGZA 3B04A 5SWUA 3PBVA 1TPFA 4MVAA 3GKFA 3BGJA 5K3VA 4NZFA 3DKLA 3TSBA 3E96A 4XZ9A 1B3OA 5J5DA 3BVJA 1H61A 1G67A 3BLIA 4JICA 3G1AA 3LCHA 5BMWA 3QMTA 3KAOA 4UTLA 3PS7A 4Y6GA 1L6YA 4IPIA 5FESA 4HHPA 2QCNA 1JUEA 4JTTA 1IIGA 2AQWA 3L66A 3GKAA 3LX9A 3KRUA 2E6DA 4M7SA 3HGOA 4M7TA 3YPIA 5DCBA 3P7YA 2FFCA 4QM1A 4PEKA 3SZ8A 5H2ZA 2FLIA 3Q37A 1GT8A 5F4WA 3UPWA 2QCEA 3P67A 1R2RA 4FO4A 3MMTA 2E5DA 1OK4A 4FXRA 3LRMA 5CZSA 3CT7A 3I68A 1L6SA 3VE7A 1THFD 2V8ZA 3WK2A 2J9YA 2IQTA 4NVTA 3ZWSA 1OFDA 4N9BA 3TNOA 1TJPA 2VFGA 3DFSA 4NNAA 2Q3OA 3LM7A 3BW3A 1RPXA 1LDCA 2V5BA 3L65A 1D3HA 4PCFA 2QCHA 3FEMA 4BK9A 1ZAIA 4AXKA 2WJZA 3MBDA 2QCDA 1GTHA 1K3UA 2DZSA 2ZRUA 1GQNA 1KBJA 1XBVA 1OYAA 2YYTA 4OE7A 1F7BA 2A6NA 2C0AA 3I7SA 4XBKA 1ML1A 5LSMA 1FDZA 3NL3A 1ZNNA 3QMRA 4O0KA 3LXBA 3QQ0A 4HSNA 2JGYA 4JTKA 3ABQA 1OJXA 5D37A 1L9WA 1G4EA 4I7WA 4K7YA 4K8HA 4QISA 1SW3A 3CIXA 4WY0B 5EPDA 4YCPA 4FX7A 3QJAA 3I65A 2VFHA 3STFA 3QQ1A 2QF7A 2UV8G 1P0NA 3CC1A 3TQ0A 4LVGA 2WQPA 1LRNA 2YGYA 3VFLA 3E0IA 2QJIA 2X1TA 3HOJA 2GUUA 3B8DA 2XN2A 3DGRA 4Y9AA 1SSDA 3MP5A 1ICQA 4BFAA 3BPWA 4A2SA 4PA8A 3GDTA 1XFBA 7TIMA 2QUVA 1W5MA 3RU6A 1FDYA 3HJZA 1KM2A 1VQTA 2BX7A 3CQ0A 3DFNA 2ZTKA 4CCDA 1NF0A 1ZENA 2E6YA 5IM51 4I7VA 2YSWA 2WSYA 4N4PA 3WJSA 2VEPA 3TMLA 3HF3A 4K6AA 4ORMA 2C16A 3G0SA 3DKJA 5AHEA 1J2WA 1ONRA 1LOQA 2A6LA 1OFBA 2ZZ5A 5IBXC 5D02A 1SZFA 3BGGA 1HG3A 2WSQA 3LHTA 3UYCA 3HMJG 4GE8A 4WD0A 4L4MA 3R89A 1FDJA 2RFGA 1SZEA 4H3DA 1DQWA 3W9ZA 1PHQA 3ZR4A 4E38A 4FB7A 5FEXA 4IXHA 1I45A 1O4UA 1TPEA 3UD6A 2NXIA 3T55A 4O17A 4EOUA 2CLFA 3HPXA 4O8RA 3JRKA 1KLZA 2VENA 1EA0A 4YXGA 2E68A 3M5YA 4IX0A 3KOFA 1ME8A 4WQ6A 2VOMA 2O7QA 3C2EA 1UJPA 1DL3A 3M47A 3DENA 2I14A 4OQVA 3LCIA 1GZGA 2NX3A 2ISWA 4LS0A 5DBUA 2NWRA 3EXTA 4UTMA 2GPTA 1WAUA 2X1RA 3V1PA 3IIOA 4IUOA 3N9SA 3IVSA 4NUWA 2E77A 2EAWA 1L2UA 3GAYA 3C52A 2XFWA 1Q6OA 4RV8A 1PS9A 3EKZA 4LV4A 1KM6A 3FOKA 1Q6LA 5AHMA 1YPFA 3NQ8A 2YFNA 4HNTA 2CWNA 1KFKA 1M7OA 2CLIA 4Q33A 3K30A 1F6PA 5AB3A 4GXMA 4UTJA 2YXGA 3P61A 4UFMA 2QUUA 1WYIA 4RLIA 1RR2A 5GVJA 2PRHA 2A0NA 2QKFA 5HINA 3W76A 1E51A 4QQ3A 2E5CA 5HMSA 3Q58A 4TR9A 3RF9A 5KMYA 4S2CA 2VEMA 4DELA 3TC6A 4K39A 2TYSA 4O1DA 3EWYA 3GX9A 3THQA 2DJLA 4AEOA 3CWOX 3T7VA 1MO0A 1JUBA 4WZHA 2RDTA 4H6KA 2FIQA 4M6VA 2CLHA 1FUYA 3LGEA 4I9AA 1I4NA 2PCQA 3NQ2A 4AH7A 5C54A 1QO2A 3HBLA 1KFLA 2FPTA 3UZ5A 5LNRA 1FWTA 2QJGA 2GQ8A 4FHAA 5EY5A 4LOCA 4R53A 3GR7A 4Z1AA 4OU1A 2C14A 1IXNA 4QITA 4WOZA 1A5BA 1TPC1 2QUTA 3ELFA 3BK0A 5AHNA 4PC8A 3BARA 2XN0A 1TQJA 3W1LA 3O8AA 4O0ZA 3LCWA 4GUIA 4DBDA 4KWWA 2A4AA 1S5WA 4UTWA 1WV2A 2JBMA 4HNVA 2VFFA 4WXZA 1SPQA 3PC0A 3B0UX 1KFBA 3CM4A 2EHHA 3S9YA 2RDWA 2QCCA 3MW7A 3Q2DA 2QR6A 1Z41A 1H50A 3N34A 3WJWA 1ZAHA 2WKJA 3W7QA 5MHBA 5AHIA 1RV8A 1OFPA 3PWAA 1W5PA 1LM1A 4Z0JA 4NX0A 3W1PA 3A24A 1SO5A 1O60A 3CPRA 1VYSX 3STCA 3L5LA 3WK3A 4MLJA 1A53A 4X9SA 3TU9A 1QOQA 3LHYA 3L0KA 3UNDA 3NQ7A 5E93A 2Q8LA 2V82A 3W85A 1AW5A 1AG1O 3O6CA 3OA3A 3OVQA 3P81A 3C2FA 5D2TA 1BWLA 2J9XA 1VH7A 5KSWA 3G3MA 4MJMA 2ZZ4A 2E6AA 3QF0A 4WY0A 3PY2A 4MPQA 5BRBA 3DU0A 1DJQA 4BWLA 2HTMA 1T8XA 4H4IA 4LRSA 2Y89A 3QZEA 4LW7A 3W1MA 3NQGA 4DBEA 1LRQA 3TFXA 5AFDA 4WOQA 2TPSA 4O11A 3NQDA 1KTBA 4LV9A 1LRTA 2Z6IA 3VCRA 1QOPA 3L5MA 3PUEA 3BG9A 1W1ZA 3QH2A 1O5XA 1DVJA 4JTEA 1H62A 1MEIA 4JGDA 3OVPA 3B05A 3VI2A 1TYGA 1HFBA 3G1HA 1ZJIA 2CZFA 3UWUA 4BF9A 1G4SA 4JTUA 4UIOA 1HUVA 3ABRA 5BW6A 4N6FA 3W86A 2EKCA 3LRLA 5CPLA 4ZQMA 2Y6ZA 2H90A 3M16A 1I8JA 3U2OA 3B4UA 5HR7A 5FF3A 3W7JA 3CWNA 4IPJA 5LHEA 3MHGA 3NPXA 5FEZA 4M6QA 2Y7FA 4UFIA 1NVMA 1DJNA 1TTPA 2CW6A 1F5ZA 3QYQA 5KZDA 5DBTA 5BOOA 1NFBA 2ABBA 3S1WA 3ABOA 3W74A 3NQFA 3G22A 3QFEA 5G5IA 1GPWA 5KZMA 1PV8A 1X1ZA 3BW2A 3MP4A 2ZZ6A 3NZRA 1D3GA 4MY8A 3UZJA 1HTIA 3RFAA 3NQCA 1S3HA 2E1DA 2OT0A 3W1XA 3S1UA 5C55A 5G2IA 1BTMA 1N8FA 3W7HA 2FPVA 3EX1A 1KFCA 1YDOA 4HIBA 1H7PA 1V7YA 3THAA 1IXQA 1A5CA 3W7DA 2O7SA 4AMAA 5L6UA 4DO5A 1U83A 1R2SA 3DHDA 1TV5A 3M0ZA 4ADUA 4ZMGA 1O94A 4DF0A 4IMDA 3NQ6A 4ALDA 1TPWA 3QM3A 1PVNA 5K4XA 3MUXA 4CNNA 1A50A 1OK6A 2V2CA 1O5KA 3W87A 4HNNA 4LVBA 3LHVA 1ZALA 3NR0A 3SSJA 3L0NA 4XKYB 3HG4A 1OVDA 3GLCA 2PRLA 3MWAA 1KFJA 3C61A 3WJYA 4C1LA 5F4XA 1KTNA 1LLZA 2GOUA 2W0UA 2YW4A 1OX4B 2XN1A 3IIXA 4DO4A 1W3NA 2JGQA 3LTYA 4UFJA 2CLEA 3TR2A 3DI0A 1EWDA 3W7NA 1SO4A 4JS3A 2A85A 3TH6A 2Z0IA 3N19B 4LUIA 5FF0A 4CQ8A 4NU7A 4FX6M 1EP1A 1C9DA 3LCGA 5KZEA 3OBKA 2R94A 4IMEA 5F1UA 4FIRA 1VJIA 4OHQA 1XBZA 5I3IA 1UASA 1VHCA 4NZJA 2VFDA 1Z44A 8TIMA 3HG2A 2H8XA 1LBLA 4Z08A 4RXFA 1EIXA 3KVJA 4UCGA 1GVOA 4KKXA 3Q94A 3MI3A 3P8IA 3FLUA 4Z1DA 4JEQA 4O52A 3LI1A 4JR5A 1Z42A 4IWWA 1PIIA 3GXTA 3AJXA 3MYOA 1FWWA 3G3DA 2QAFA 1H7OA 4OGZA 3L5AA 3M5XA 1OX6A 1AW2A 5F2LA 1ZCOA 2OT1A 2QCFA 1XCFA 4ONVA 4DXVA 1Q6QA 3W71A 3G8RA 4E2DA 1YADA 5LZLA 1YTEA 2BLEA 1EWEA 4RJEA 4FNRA 4MFEA 2F84A 4AAJA 1R2TA 1J5TA 2B4GA 2QCLA 4RR4A 3LV5A 2AGKA 2FB2A 3PULA 4O53A 4NT0A 3W70A 2B7PA 5D2WA 5F2IA 5G2HA 3P60A 3STGA 1G4PA 4Y90A 5HJLA 5CGQA 4MY9A 3MI2A 1LZOA 4FEZA 5TIMA 3C3NA 1ME9A 2J24A 3RLUA 1KV5A 5F1VA 3M5VA 4MUZA 3HB9A 1S5TA 2QCMA 3TFCA 2QEZA 5DCDA 1C29A 3IV3A 3O16A 1OFAA 2RKXA 1I2PA 2WSRA 4LNYA 4PODA 3LI0A 1YDVA 2ZRWA 2NUXA 3KRZA 3L9CA 1ICSA 5HR6A 4QNWA 3RLVA 2FPYA 4FNSA 2C19A 3GYEA 3PAJA 1UB3A 2YDAA 2NLIA 5DY3A 3FKKA 3TW7A 4CQ9A 1ZY9A 4FX8A 4LS2A 1U5JA 4Z1BA 3GIYA 1F6KA 4DF2A 1Y0EA 2WNNA 4XUGA 3BLEA 3H53A 2GVLA 1GOXA 4JTJA 3CIWA 4JTIA 5G4WA 5FF2A 4DQWA 2TMDA 5D2YA 5DXYA 1VYPX 4R34A 2HS8A
chains in the Genus database with same CATH superfamily
1IWBA 1MMFA 2REQB 4PCTA 2WM0A 3PZQA 2WKLA 3C56A 1B31A 4R33A 3VABA 5HBFA 3ITCA 2IQ0A 2P0OA 2FJKA 3AO0A 1X6UA 3OEXA 1GVFA 1FTXA 1S2CA 2Y24A 3MDUA 3QGKC 2HISA 1GQIA 1XSIA 4AHPA 4XZBA 4LTSA 5I24A 3DYMA 3W84A 1DJYA 3PJWA 3LEPA 1OZQA 2OB3A 3UZYA 1NF7A 1K9DA 4MKNA 2VR4A 3K13A 5CSUA 3UG4A 4M24A 1TO3A 1E6RA 1OG0A 1KWKA 3ONBA 2YKKA 3SFKA 1Q6FA 5T26A 4I8DA 1WNOA 3KL0A 1CLVA 3BAJA 1W6TA 1NIUA 1GKRA 5I02A 3WLMA 1UC4A 4H6EA 3GXFA 2YCLB 5D30A 5FJRA 4PB4A 1X1OA 1EF3A 4HPJA 3NL6A 3UU0A 4AISA 3MO7A 2PLJA 5E0CA 2QULA 2ZWYA 2F2KA 2R82A 1EJXC 1IGWA 2HNEA 3GHSA 3MI6A 2IUZA 4CNOA 2Z29A 4ROPA 4EANA 3HPZA 2FTYA 4NI8A 3CZLA 1K7EA 1YDNA 4OOZA 2WZTA 4V33A 1F74A 1DOSA 1WCGA 1X8CA 3PNUA 3LERA 2PTWA 1TR9A 2GK1B 4GYKA 4H9TA 1TB3A 2Y5SA 4R3UA 4W85A 4F2BA 4ZQRA 1B9ZA 4C91A 1FY6A 4LUSB 3M6YA 2VKZG 3P0WA 4ZL1A 5D38A 1KCLA 3M9YA 4NF7A 5GNXA 2OQYA 1US0A 1MNSA 1TJRA 2JEPA 3OLGA 1R5YA 3M0JA 4LWWA 4F40A 5E09A 4KEUA 3BC9A 4MAVA 4PMRA 4GGBA 3A4JA 3NOEA 1PUDA 3GM8A 2PLCA 3IJIA 2EG8A 3PVFA 3S2CA 1DIKA 3V36A 4DHGA 4F0RA 2OKOA 3D5HA 2FHBA 4A6GA 1NOWA 2C1GA 3M64A 3O15A 1D8WA 2J88A 4MUPA 1DJGA 4GZIA 5FF4A 3WIJA 2DDXA 4CD5A 3PHAA 2XGIA 1GJUA 3LCXA 3KUMA 2FH8A 5DO8A 2AAMA 2OLAA 4O19A 1LF1A 1VFLA 4XD4A 4Q7IA 4LEFA 3LTPA 4KIRA 5AC7A 3S1XA 1UD5A 4BHYA 1K7XA 3V4BA 3SGGA 4UR9A 1A0DA 3MSYA 3VGHA 3SRFA 5IXEA 1L0PA 1QUMA 3L21A 1KTCA 4YHEA 3L4YA 3WSUA 1HW6A 5FEWA 4RNFA 5BU9A 1W17A 1W9BM 4DM1A 1TA3A 5EMUA 4FLSA 1TG7A 4AVFA 1LT8A 3N11A 5HQEA 3EPNA 4POCA 1A0CA 4CGTA 3PUGA 5TNVA 1K8YA 1X7FA 1H7RA 1V8EA 3W81A 1PYMA 3W75A 1RA0A 3ARTA 5E9AA 1MXDA 3UT0A 5C71A 4JIPA 4X22A 4P7NA 4IX2A 1ZJBA 3GXIA 3FN9A 5AYIA 3E49A 4UTWC 3W2UA 4IHCA 4GNJA 3T0AA 2QPSA 3LA4A 3URQA 2R91A 3ZLHA 2OZ0A 3GNRA 3E5PA 3NSNA 3VOGA 4FXFA 5CPOA 2O4MA 4XZNX 3VOIA 3ZJ7A 4RNIA 5GJPA 1EL3A 3LBCA 5AYZA 3IUHA 3NM1A 5ABFA 2PU0A 5E1QA 4OWGA 3F2BA 1DIEA 2JIWA 5TBOA 3R7MA 3KCOA 1BQCA 2HMCA 5L9FA 2HE5A 1X7IA 3UWQA 3RG6A 1S2VA 3M1ZA 3DHPA 1OFOA 3CEPA 4PUKA 3UZWA 1G69A 1Q6CA 4MJZA 3T8QA 2ZA1A 3PTMA 4PCPA 4V1XA 3DESA 3REQA 2F9RA 1HVQA 3KLKA 2ZICA 2A3LA 4IZGA 3FEQA 2YA1A 5EU9A 2Y8KA 3F1QA 1QMLA 4LVAA 3ABSA 2FGZA 1I0DA 2PTXA 3HQ1A 3WYZA 4F0LA 2GL5A 3VPLA 1TZZA 3N3TA 1MFUA 2RDUA 4WDTA 3CHEA 3DG3A 1FWSA 3GDBA 3NO5A 3RLHA 4I3GA 3VUSA 3R94A 5EKYA 1WDWA 1PZ0A 4IP5A 4HCDA 3PWGA 4Q8TA 1IEXA 1PWLA 3CU2A 4UWMA 3QC3A 2XSXA 3IGUA 4NRRA 3TW9A 3NYDA 3WLOA 4AZCA 3S2JA 5LNVA 2Z26A 3N9RA 4NASA 4PL2A 4QDMA 1AL8A 5CJMA 3T0TA 1EO5A 4RX0A 1MEWA 1EJWC 3ZOAA 4BQ5A 4ERIA 3SCRA 1OYCA 3W01A 4B3KA 1KKOA 1P0EA 1E3XA 2Y85A 4E4UA 4TX9A 3W7GA 3WLPA 3KTSA 3TP4A 3II1A 3WNMA 3EDDA 1DPMA 4WJXA 2Z4GA 3R8RA 2CEQA 1XLBA 4IOTA 3AHTA 4LT9A 1O66A 4OV9A 3VC6A 4Q6JA 2GDUA 4LUTA 2GFTA 5G4EA 3WLQA 3ATZA 2FMNA 3AIRA 3BSHA 3WUBA 4RE3A 1RLDA 5B80A 1CXKA 1MUCA 3ZR6A 2DUXA 5I3FA 4D6HA 4L64A 2PP1A 1WZMA 2FJUB 3DCPA 1F3EA 4HSOA 3WJXA 1CX9A 1AMKA 2NT1A 4S2BA 2C6QA 1FKWA 4HKPA 1KFEA 2DU2A 4ATDA 1SMAA 3I6TA 2WM1A 3OQEA 1ZHAA 4IISA 4W4QA 5LHFA 2WSKA 3MBFA 4KBXA 4L56A 3W1NA 1G5AA 4K68A 2X7WA 5CC5A 3MHFA 4HA0A 4TVUA 4WJEA 4XG1A 5H8MA 2PWVA 4Q8QA 2OGYA 4WRHA 2Y70A 1SR0A 1J96A 2ZRZA 1P7TB 3RM8A 1AJZA 1BYAA 2AL1A 4RE2A 1B54A 3EZ4A 3FFSA 5AKQA 3E12A 1TIWA 1OABA 2QT3A 3LHZA 4IP7A 2X7VA 2WOQA 4ZB0A 1LLWA 1OFEA 2EPNA 3THCA 1LG2A 3S9ZA 1LOSA 4W9TA 3S42A 3O9NA 1EDTA 3BUVA 1R9YA 2FHFA 4IQDA 4GACA 1A4LA 1S3TC 1SFJA 1I2NA 4LH8A 4UQDA 4UMBA 3QV8A 2WCSA 4IQJA 2EPHA 4N02A 5DRCA 1XLGA 3FJ4A 3LCLA 1WOBA 1PYFA 2WANA 3TKFA 1RCOB 2BVDA 4YWIA 4GXWA 3K4WA 2V81A 2Z2UA 4X60A 4HT3A 3W7MA 1YTKA 3IVTA 4HMNA 3HPSA 1PJ9A 4O14A 1TELA 3V0UA 1ECQA 3PZGA 5FJOA 1POKA 2BZNA 2XH4A 4JYDA 3GY1A 5HWNA 3FK4A 3P8JA 1OT1A 2DZWA 4HU3A 1H7XA 5AYXA 4JQ3A 4XKMA 3NDOA 3PBUA 4G2DA 1XBXA 3TZFA 2OELA 2O4QA 4IPNB 3DG6A 2G96A 3EXSA 2D69A 4J3ZA 5EMJA 3W88A 1JXKA 1XIDA 1CPUA 1IQ8A 4K38A 2A5HA 1PKMA 4S3GA 3L2LA 5AOUA 1K4GA 1W1IE 3LDVA 2QJHA 4AZ7A 4UTHA 1FP8A 2PFHA 3B0XA 2A21A 1EJ7L 2G5WA 4NXSA 3PB0A 1W31A 1W5OA 3CQIA 1CYGA 1WUFA 3G1VA 4NJKA 1DWJM 5AN7A 2CFFA 2ZCGA 3N2MA 3VM7A 2I9UA 1EBGA 2GSHA 4D8LA 1J6PA 1T40A 3PUOA 4PMOA 2HS6A 2YFOA 2OGJA 4ZOCA 3AMKA 5HNRA 2INFA 5ENLA 5DELA 5M03A 5IFPA 1H49A 3ISIX 3ZS4A 3AIUA 2VR5A 3RU8X 5ABFB 3QY8A 3ZLGA 2W67A 1UR3M 1J0ZA 3FJLA 5J8LA 3TIMA 4NJGA 5E0FA 4U3CA 3LD5A 4HP5A 1JNDA 3POCA 2BOEX 2ZBTA 3E74A 3PB2A 4EP8C 3F4WA 1BVNP 1B3YA 1VPXA 2INEA 3O6AA 1M01A 1RZMA 3M07A 3VMNA 1MW0A 3AALA 4O10A 2E8ZA 1XRSA 3HMCA 1X38A 2PLMA 4A3RA 1DORA 1HKKA 3C0SA 2DUAA 3R1ZA 2OO0A 2NUWA 4DO6A 5BU6A 2QDDA 3MHUA 4IIEA 5EFFA 1PIFA 3GHTA 3TA6A 4YLWA 2PRMA 5JH1A 3HPAA 1N55A 2OCZA 2B7QA 4LU0A 4AF0B 4W84A 1KCKA 1UQZA 2O56A 3Q4DA 4KWVA 4GH1A 1DP0A 5KITA 3IK4A 1BRLA 3EWCA 3M4HA 3SGUA 2A7PA 2GJNA 3UCQA 1SJBA 4AC7C 3WK0A 4WXYA 3TW6A 4AFYA 1MXSA 3JU2A 4OV4A 1A5AA 2QDGA 1DWIM 2GWGA 4E2VA 2PDLA 3FA5A 2J7CA 4E4PA 3S83A 2C7FA 1HXJA 2OJPA 3CZKA 3QEZA 5U4NA 5AY7A 1UJQA 1K02A 4MPKA 1SU5A 2NVCA 1PCWA 2BGSA 1YYAA 4MJ2A 1EXBA 3DZ1A 4QAIA 2BY0A 2OG9A 3I3BA 3K2GA 3BURA 3W00A 1DEDA 4AZCB 1E40A 3BLPX 3C6CA 5D05A 3ZSSA 4N4QA 2P8BA 1VF8A 1Q4WA 1E1CA 1LTDA 1V03A 2JKEA 2DVTA 3PBYA 4YHGA 4XVEA 1QI4A 2DUZA 4PMYA 4XSLA 1XG4A 5ABHA 3ARXA 4WX2A 5D03A 5A5WA 5D33A 3N14A 1EQPA 4PB5A 3UW6A 1KR1A 1TTJA 4GMEA 3R12A 4YTUA 1E70M 1MEHA 3W2LA 1QPNA 4JN6A 3QSRA 1E15A 1YKWA 5DCEA 4TV6A 4P7QA 4ASTA 5JUVA 4ZA0A 4G7EB 3QKZA 1DE5A 4GVHA 5I3JA 3EX3A 1ISZA 4F66A 2Y88A 1FXPA 1J0KA 3R0KA 4RDVA 3CZGA 2PTZA 4ADTA 1KNWA 3SN0A 1FH7A 1QAPA 1SFLA 1MQQA 1MYRA 1Q45A 4EWND 3KM8A 9XIMA 1SM9A 3BSGA 3PZTA 4Z2IA 8XIAA 4HPXA 3UR7A 4LAMA 4NNCA 4UQAA 4NIRA 1VC4A 3VZYA 4ZENA 3WL1A 3C2OA 4JXCA 3CB8A 1NSJA 3E1F1 5EMYA 4GZEA 1Z69A 4H9MA 4ZFCA 4R9XA 2XIOA 1JD7A 1RUSA 4X3ZA 4HD5A 1UUQA 3GTHA 4UC5A 4WDXA 1YXDA 3PJXA 4QAWA 3LXAA 1WUEA 3NFUA 3DI1A 2A3BA 2ZX9A 3E2SA 5CGMA 4KRTA 4LNCA 4NQ1A 3Q67A 4HNLA 1J79A 3WK1A 2GWNA 3FW6A 1KXVA 5CH9A 4X63A 3RUBL 4AX6A 3TUUA 3CUFA 1H60A 4G56A 1XH1A 1QJWA 1YBQB 2JK2A 3QV9A 2CXEA 1CLKA 3ZVIA 5I23A 4B5XA 3HGRA 3LLFA 3SY5A 4MYAA 3TOYA 3VTRA 3A4WA 3WQPA 2JF7A 1UKPA 2ZA2A 5LIUX 3POHA 4OTKA 3M0KA 4GO9A 3O1NA 2R1PA 1N82A 2XGZA 4L1XA 1SFTA 1SSGA 4WGHA 1GG0A 3ARUA 1Q7QA 4HQVA 3UP8A 4S3BA 1NARA 1PX4A 4GZ7A 5CLWA 3CV1A 1G4TA 1XKJA 5CPNA 3JS3A 3VNLA 2XFFA 4BWLC 1C3FA 3K8KA 3MP3A 2WMKA 2ISFA 4M82A 1TREA 4NAFB 1DJIA 1EP3A 1W32A 2ZX5A 1WXYA 4MDOA 3W23A 5LGZA 5SWUA 3B04A 4PTVA 1TPFA 1KCZA 2CIPA 4JQ4A 5KETA 5K3VA 1QI2A 3T81A 2WWDA 3VGDA 2J6VA 1B90A 3NQBA 3TTOA 1B3OA 1AQHA 2AKMA 3BL3A 1XIFA 2NQZA 1G67A 3EOLA 3LCHA 3QMTA 4JPGA 4GC3A 1L6YA 5FESA 3NIYA 1JUEA 4JTTA 2AQWA 1CGWA 3CV6A 4GKLA 1HN1A 3S6TA 1DIDA 1TVPA 2BVTA 3SZ8A 3UPWA 4PUEA 3R8HA 1R2RA 4J3XA 3UCDA 3WF2A 2E5DA 4MG4A 3LRMA 5CZSA 1E73M 1E0XA 3CT7A 3I68A 4YN5A 1I60A 2V8ZA 3ZWSA 4FR1A 4I9JA 3KP1A 1TJPA 3OYZA 4ZOEA 1NFPA 2VFGA 3DFSA 3BW3A 3AMLA 3RN6A 1D3HA 4PCFA 2IKGA 2E0PA 1ZAIA 3M6DA 3ALFA 3H24A 3PPHA 1GTHA 2W63A 1Y5WA 1BSLA 3CUZA 1XSKA 1GQNA 1EHAA 4H6RA 4XUYA 4OE7A 1E6QM 3CAQA 6REQB 2A6NA 1FRBA 2VRKA 4EKJA 4R27A 4EPBC 2AL2B 3QR1A 4XBKA 1ML1A 5LSMA 4BA0A 3NL3A 3QMRA 1UG6A 3D3FA 3FSUA 3H26A 1JZ4A 3BMVA 4HK6A 3LXBA 3MY9A 4R7WA 3QLDA 1L9WA 2EKGA 4K1GA 5A6MA 1G4EA 3P6LA 1H3GA 4C6LA 1B3ZA 1Y7VA 4K8HA 4RV3A 1RALA 1SW3A 3CIXA 1CLXA 4YCPA 4FX7A 1MFVA 3I65A 2VFHA 3STFA 4KGLA 1DXEA 1H09A 2F8QA 3CC1A 3E3HA 2WQPA 1PSCA 2YGYA 3VFLA 3KL3A 5RUBA 3HOJA 2GUUA 3B8DA 2XN2A 3MB9A 3B97A 4M81A 1ICQA 1XYZA 3BPWA 4PA8A 1EO7A 3PZUA 1OCJA 4RPPA 1D2KA 1VQTA 2ZTKA 1NF0A 3S46A 4GFIA 5IM51 2E6YA 2VX7A 1RLCL 2HPIA 3WJSA 1SZRA 2XFRA 3HF3A 4ORMA 4GQRA 4HU8A 4LEQA 1XJBA 5AHEA 1AODA 1J2WA 1ONRA 1AA1B 1LOQA 4Q4SA 1OFBA 2ZZ5A 5D02A 3W6LA 3BGGA 4OUEA 3GH5A 4DYEA 3SUUA 2WHLA 2J66A 4F0KA 1FDJA 4AUBA 4H3DA 3QR3A 1ITUA 2YIHA 5G1MA 3CO4A 3WF0A 3K4DA 2DIEA 3ZR4A 4LYPA 3B9AA 1JGIA 4FB7A 4IXHA 1K1DA 2NXIA 3T55A 2FVKA 4P7RA 1PKYA 3AMCA 1XDJA 3R0UA 4IUGA 3BJSA 1GVYA 3HURA 1CNVA 1UKOA 1ZPTA 1HKVA 3GS6A 1TA3B 3KOFA 2J79A 2VZSA 1DL3A 4C6NA 3DENA 2BVYA 4GY1A 4LS0A 4YYCA 1UMLA 3EXTA 1KRMA 2X1RA 1W8GA 3IIOA 2Y8VA 2C0HA 3GAYA 1UA7A 3TYEA 2QS8A 3ZXWA 2B31A 1OG6A 2DIKA 4D6DA 2CPUA 4KF1A 4DVOA 1Q6LA 2NQLA 1NU5A 3NQ8A 2YFNA 1KFKA 2F2HA 4BQ4A 1M7OA 3JZEA 3CZJA 2CLIA 2RGMA 1VFSA 4HCHA 2YXGA 1R9XA 3GG7A 5GVJA 2P5NA 5HINA 1QXLA 4L1GA 3W76A 2A79A 3OB8A 4CN1A 5HMSA 1J10A 1J11A 5DFAA 4TR9A 3RF9A 5KMYA 4QG9A 1EIBA 3H4GA 3IJ6A 2CESA 3OGRA 1KC7A 5H8PA 3KBVA 2CKRA 1WKDA 3THQA 3GTNA 1LL7A 2NQJA 4XAYA 1UD6A 4JFTA 1BGGA 1RSCA 2RDTA 4DAIA 2D2JA 2WZHA 3LGEA 3RRAA 2V3EA 1I4NA 5LXEA 3PZOA 3CUJA 3FHQA 3UZ5A 5C9WA 1FWTA 1WPCA 3L2MA 4R53A 4UQBA 4Z1AA 2HPMA 4LY4A 3CPGA 5BROA 4MM1A 1TPC1 1UP3A 1KXHA 2QUTA 4NI3A 3P93A 2ZUVA 1V0NA 2CBJA 2F6KA 4PUNA 1TQJA 2WNWA 4XISA 3LBOA 4O0ZA 4GUIA 2C79A 4DBDA 2DGAA 4KWWA 2A4AA 1S5WA 1OC7A 3PTKA 4HVXA 4HNVA 4WXZA 1KFBA 3CM4A 2EHHA 3R0DA 3VIGA 2ZVRA 2TODA 1XYBA 3UFYA 1I0BA 1UP2A 3WJWA 4IFOA 3IACA 1OFPA 2V3DA 1VIZA 3N29A 1XX1A 1ZBKA 3AOFA 1GEHA 1VYSX 4MLJA 4X9SA 3T2OA 3TU9A 3MCMA 1QOQA 1AZ2A 1W3HA 1VJSA 5C0QA 3DERA 4W8BA 1ENUA 2VC7A 5E93A 4AWEA 3O6CA 5TAOA 4LUSA 2OEJA 2J9XA 1VH7A 3IJLA 2YCKX 3R79A 2YLAA 2GSJA 4H8VA 2E6AA 4Z2HA 2P53A 3N9KA 1FP9A 1P6WA 4KETA 4GQGA 1S1PA 4LRSA 3N2CA 2Y89A 4LW7A 3RYSA 3W1MA 2VTFA 4DBEA 3FA4A 3MV11 2XVLA 3AYSA 6REQA 1V4YA 1E3ZA 5HOSA 3R10A 2Z6IA 1XLCA 3L5MA 3MUZ1 4CQBA 1H62A 4KQNA 1MEIA 3WNNA 1JXJA 2PA6A 4F9JA 4EPEC 1TYGA 1MQRA 4JAWA 3UWUA 4UIOA 3EDFA 4XIAA 2EKCA 1HL9A 4KRUA 1L2QA 3VAVA 4P8WA 5FF3A 4EK7A 3BAWA 1IT7A 3CWNA 1Z6KA 4J27A 4B5VA 1EEXA 1ELSA 1OQFA 1XLIA 1UZHA 4ICMA 5FEZA 3RR4A 4M6QA 2D23A 4UFIA 1NVMA 1DJNA 1TTPA 4NZ5A 2XUCA 5KZDA 4G1NA 5BOOA 2ABBA 3ABOA 4ZE4A 1PO9A 1UQYA 5G5IA 4OKDA 1X1ZA 2NT0A 1D3GA 4OZOA 3UZJA 3F4DA 3CS2A 4CKQA 2E1DA 2HE8A 3UJ2A 3H8AA 1W2PA 2OT0A 1KBBA 1MW3A 4I9TA 1BTMA 1X6LA 3EX1A 1UHVA 2HEJA 3LS9A 3W7DA 2O7SA 3SQSA 5L6UA 4DO5A 4J3VA 4P5UA 3DHDA 1MRQA 1VPYA 3M0ZA 9RUBA 3C8NA 1Z9AA 4IMDA 3NQ6A 3QM3A 1PVNA 2E28A 2UY2A 1A50A 1OK6A 1PX8A 4HNNA 2XDFA 1X1NA 3ABZA 4LVBA 3CQJA 4IFKB 1UC5A 2YLLA 2BY1A 4FR6A 1K9FA 3CB3A 1IEQA 3L0NA 3WNLA 2OO6A 1OVDA 4ZXOA 4QE5A 1LJYA 1KFJA 3N15A 4AZHA 5F4XA 3H2FA 3M0XA 3EBVA 3IIXA 1E5JA 3W82A 1CXLA 4NG3A 4OJYA 1TR1A 3TR2A 3W7NA 4JS3A 1CEOA 1XICA 2IPJA 3N19B 3SQMA 1EJSC 3WKZA 4DJDD 3V0TA 3IAQA 2DH3A 3NGFA 4NU7A 1K9TA 1XGZA 3USZA 2DFAA 1EP1A 3GBEA 2R9RA 5KZEA 3OA5A 4GYPA 4IMEA 2VD8A 3CZEA 2O55A 3MCNA 3BDKA 2WKGA 1UASA 4M51A 2PGRA 4UCGA 1GVOA 5FIPA 3NZQA 3MI3A 3H2OA 3TNBA 4AIUA 1Z42A 2DQWA 4LQ1A 2QCFA 1XCFA 4DXVA 1CXHA 3SUWA 4GNVA 3AZRA 5LZLA 4ML4A 1HP4A 3WDQA 3OO2A 4MFEA 5A6TC 2F6UA 4AAJA 3OGVA 5BXTA 2QCLA 2B4GA 4GD0A 4RR4A 1PTGA 4PGLA 3HJEA 2FB2A 3PULA 5D2WA 3P60A 2IPFA 1G4PA 2WQDA 3FVMA 3QFWA 4YYFA 1GKPA 3AS0A 4AZBA 3C3NA 4AD4A 2J24A 3RLUA 1KV5A 4MUZA 1BYDA 2QEZA 4DUWA 3ZR5A 1M3UA 4B5TA 1OFAA 2RKXA 3AQUA 4LNYA 3MWCA 3RLVA 2HVMA 5BRPA 3K1GA 2PC8A 1UB3A 2NLIA 2ZUNA 3ANUA 4FMVA 4A8LA 3RX2A 3TW7A 4CQ9A 2JFEX 4ZOAA 4LS2A 4W7UA 2ZUMA 1SJCA 1ITQA 3IJQA 3CT2A 1TV4A 4DF2A 5XIMA 1Y0EA 4XUGA 3H53A 1ZGDA 2ZX7A 2WJFA 3CIWA 1XF0A 5D2YA 4KS0A 1VYPX 4EACA 5EBUA 4ICNA 3S6DA 3CL8A 4S1FA 1Q6RA 1BD0A 4QBXA 1F2JA 2Y4SA 5D4YA 4WR3A 2D73A 3KEHA 4AIBA 2BXVA 1UR8A 3UXLA 2ATMA 4B16A 4UQ9A 4QS5A 3LB0A 1J6OA 1YPIA 1QNPA 1EDGA 3PUDA 4IL2A 3M0MA 1OCNA 1VEPA 3BOLA 4TQTA 3CZ8A 5A6LA 1QHZA 4Y9OA 1GW9A 1TPB1 1R85A 2J7GA 4JTGA 5LNSA 4P61A 2DORA 4US6A 5EA9A 3SURA 3F5LA 2VEFA 3NAVA 4R7JA 3W1QA 3CHDA 4LF2A 3SIZA 3A23A 4PH6A 5AC8A 2W5FA 1J0IA 3TE9A 2WZMA 1WO2A 1XDLA 3ICJA 4S38A 1JIBA 1EUAA 4IPPA 4US5D 5IOBA 1E0WA 4JY8A 1B30A 1NTHA 2FTWA 2CERA 4HHMA 1QPRA 1VCFA 2DT3A 3HGSA 2QGHA 4NX5A 2NUYA 1JYWA 1B0IA 2OPJA 3KFTA 2XH2A 4A35A 4EAMA 1A47A 2JE8A 1W1VA 3K5XA 1HX0A 5DMYA 1CGYA 1KM0A 2ISSA 1DQXA 3BG5A 1E6ZA 3HGJA 2QHAA 4GJ1A 1F4HA 1AH4A 3NDYA 4JX5A 2B0MA 1US2A 4JQ1A 1WZAA 2I7GA 3FHAA 3TXZA 1US3A 4C6DA 3CYJA 1OC5A 5LA0A 4NY2A 1HO4A 5FAJA 2H8ZA 3UJRA 3AHXA 3IUIA 4Z2LA 1TMQA 3NNTA 2OZ3A 1UPPA 2GVYA 4HSHA 3AIWA 4PFMA 3MSRA 3RPMA 7ODCA 1EZ2A 3BCFA 4M3PA 3F7JA 3N6HA 4RK8A 2WNQA 1W8SA 1JPDX 2P88A 4A21A 4IMCA 4LFYA 2WV8A 2VFIA 4O18A 1OY0A 4O1AA 4PULA 1K4HA 3FV9A 4L4LA 3L68A 1CTNA 1UOKA 3KBNA 2BP1A 4OT7A 2YYUA 5EB8A 2G95A 2VL4A 4PBEA 1R3VA 1Y5VA 3GTFA 3GQYA 3QW4B 3RILA 1FX6A 3UBPC 2A1YA 3QZ6A 2CZ5A 1OF6A 4J3TA 1ALDA 3CUHA 1VEOA 3C2RA 2OMAA 3SB0A 3UWZA 2V0TA 3LENA 1YTDA 3UXDA 4C6IA 1WDQA 2GJPA 4RPQA 4I7UA 2XM2A 4LC6A 1OYBA 4IGMA 1PBGA 4V1YA 5AYYA 2DZVA 2V6AA 1ZFJA 2YL8A 1TPH1 3CHCA 4AG0A 1IF2A 4LVDA 3HG5A 2ABAA 2VGFA 3UPBA 1CGVA 2VFEA 1GEQA 5D9OA 2EF9A 2BS9A 1GNXA 5D2XA 1WB0A 4RW5A 1W5NA 2W3ZA 1WXJA 1LWIA 5GNYA 2Z25A 4TMBA 4F2UA 1GVSA 4D8ZA 3LUTA 3T05A 1W5QA 5JVLA 4GC4A 2IXUA 3C0JA 5I3HA 4UTIA 1K7FA 3VD3A 1MWOA 3IIVA 5CZTA 4DJDA 1DTNA 5M17A 3WD1A 1R30A 8A3HA 2W6RA 4HHLA 3HIJA 2X16A 4UBPC 4HZMA 2PE4A 3T40A 4DBSA 3PSVA 3ARRA 1QW8A 1VS1A 3VIOA 3O3RA 4UTFA 4RZ5A 1B3WA 1XC4A 4S3EA 4W89A 1M68A 1KCXA 1WAWA 4LAZA 3VDBA 4ICCX 2ZXBA 3F4VA 1XXXA 3T08A 3MMWA 3OLDA 1R47A 3AHZA 4W7VA 1S2TA 1TTIA 1S46A 2F6XA 3DBPA 5C8BB 1LYXA 4GZJA 2ZC1A 3W28A 1SO6A 3BV7A 1PKNA 1FHDA 5IHSA 3LPPA 4RKAA 2X1IA 4LALA 5C6MA 2D1ZA 3TWAA 3GNPA 4KEMA 5A6SA 4W86A 4KCVA 2B7OA 1NH6A 5E70A 4MYXA 2ZE3A 2CITA 4A3UA 1EEPA 1P1XA 2R1LA 4MTVA 4U5IA 4C1KA 4EVZA 4UFHA 1P5BA 4FOJA 4ZXLA 1V51A 2PODA 3VKKA 4RDYA 1HZYA 4HOWA 5JBEA 1SMDA 3A3WA 4M6UA 1NQ6A 4AY7A 3LGGA 5E6ZA 1JDDA 1JDEA 2ISVA 3G0UA 1BYCA 4LJ3A 4GIEA 4HU0A 2I1OA 4OBRA 4Z0SA 5E0KA 1A0EA 1YQ2A 2PEVA 2ZC8A 3UXAA 4C6PA 1N8WA 3EGJA 3NVDA 2OOFA 1TJ0A 4QSHA 2WPBA 4L6HA 3WQ8A 5F2GA 3UXKA 4FXSA 4PRWA 1AW1A 5KINA 2F38A 2C1IA 1F3TA 3LK6A 2G3FA 3EWXA 1G6CA 2PP3A 2WVUA 5LNWA 5M5DA 1E4IA 1XUUA 4C7DA 2Z27A 3TA9A 3OZPA 3SEPA 4NXKA 3HU7A 1YXYA 3SGZA 5AC4A 1CBGA 3CJPA 3R58A 3QRHA 3P62A 4NYUA 1TPVA 4UCFA 4F8XA 4AWSA 3RMJA 4LSBA 3U5YA 4MJ4A 4FPSA 3A3HA 3HO8A 4V15A 3TTEA 4W8LA 2D3NA 2DZPA 1ODZA 5A6BA 2CHOA 3L4UA 3S47A 1TQXA 2ATSA 1BF2A 1Q5MA 2WO5A 5K9DA 3MDWA 4MB5A 1VGAA 4NL1A 1DWFM 1GYMA 4CLMA 1WZKA 3NVTA 1UWQA 2E4TA 4ZQPA 4GH3A 4F48A 3FJ6A 3T09A 2CLKA 3V7PA 3TWBA 1V6XA 5I0DA 1BEUA 5LXXA 5CPMA 1K9EA 1KXQA 2C3ZA 4NYYA 3P74A 1JPHA 3O6DA 3N4FA 1W3JA 1XLFA 4A3HA 3I6RA 1I2OA 2J27A 2YDSA 3IK2A 3MUIA 4AD3A 4ZZ9A 4GI8A 3W26A 3KP0A 3UG8A 3WJZA 1XCWA 5DANA 3IS4A 3RPTA 1GQJA 3WBXA 1H51A 6A3HA 2VVNA 1PIGA 1ECEA 3S5YA 5CSRA 2L5HA 4K36A 3V5CA 4DAFA 1JZ7A 3A3XA 1XYLA 4NJHA 3H4XA 4PRTA 3AYVA 3TCSA 4DXKA 5HQMA 2QPXA 5DT5A 3TV8A 4PMZA 2ADAA 3B9EA 4ORIA 3U7BA 3ZWTA 4WDWA 2A2IA 3TDFA 3TYUA 3VDGA 4FS9A 1DJWA 1KLYA 3A64A 3CHFA 2YW3A 1F05A 2J77A 3DC0A 4IJBA 3U8GA 2DSUA 3EKLA 4XD6A 1QI0A 4DYKA 4GQQA 3AIEA 7REQA 3QPYA 4AIOA 1RA5A 3BE7A 2HSAA 4JTLA 3N6JA 2CETA 2NV9A 4M29A 2PZNA 3LBMA 4MZ8A 1Z48A 4ZSUA 3HFTA 3WUGA 2ZZ1A 3ERPA 3SN1A 4O8AA 5DMLA 1A5OC 1QRQA 1FH9A 2Y0FA 3VNZA 4L9YA 4UNLA 1XDMA 3WMCA 3SADA 1PHWA 3LQGA 3BJTA 1R3TA 3U2ZA 3DYOA 4QS6A 4BQ3A 2H6RA 3W6YA 5A2CA 2WYSA 1UBSA 1UWUA 4O57A 1EYWA 2RJHA 3L2IA 4H9YA 1W54A 5I3GA 1GJPA 1UW9A 3ZJ6A 1ODUA 4QG6A 4TVDA 1JI2A 3W07A 1Q8JA 1RQHA 3AXXA 4JIIX 3VNMA 3CMFA 2VP8A 2ZRYA 1GYNA 1QNQA 3BAYA 3H54A 1XUZA 5D04C 1RH9A 3TXVA 1MXGA 4JFVA 2GDQA 1JDFA 4O1BA 2GJLA 1I6NA 3B06A 3RM4A 1KM1A 4MNMA 5DRIA 3FYPA 3L4WA 2JKPA 3C8FA 2WMFA 3O63A 1OZMA 3UY7A 2ONEA 3HFYA 2FQIA 4O50A 5HK4A 3UY8A 2I57A 2W9MA 4DN1A 1MW2A 2Z2AA 3B0VC 5I7GA 3PZ9A 5HNUA 4D6CA 5CPTA 1XPGA 1PPIA 2Z24A 4HN4A 3GZ3A 3G0XA 4JN7A 4XK2A 2GJXB 4BS0A 5AC6A 4YMZA 4DM2A 1P48A 2YX0A 3AZSA 1T41A 2YB1A 2NXGA 2AAAA 3EWDA 5CKSA 3WLJA 1J8VA 3EMZA 2E9LA 4MZYA 5EMMA 2PWEA 2UY5A 3ZJ8A 2VRJA 1K8XA 2I5GA 4QROA 5HNNA 3COTA 1TE6A 1JCJA 1YNPA 1XD1A 3H2MA 4DO7A 1QATA 1WX0A 5ECVA 4ZB5A 2YCLA 2J4GA 4LC8A 5CZJA 4AD5A 4I6VA 3MJYA 2R14A 3DFQA 2DPEA 4LB3A 2CU0A 3EMCA 1RBAA 3T2QA 3ANYA 3RCYA 3P80A 1J12A 1XKYA 1TWDA 4GPNA 3G1SA 3CV2A 3UWWA 4K7VA 1XIEA 3SJ3A 4QLLA 1JZ3A 3FYYA 5D09A 1M6JA 2CWXA 5CEWA 1OM0A 1DJHA 3FXYA 4B4FA 1A5NC 4NNBA 3CBWA 1RP9A 3EX4A 1AJ2A 4AW7A 1EZWA 1ZZMA 3KS5A 4G7EA 4JD4A 3ZJKA 1QWKA 2IKIA 3VIHA 3CH0A 2VEKA 3PPFA 2TSYA 2ZFAA 4C6BA 3TTYA 4EX4A 4C6MA 4AHOA 3AMGA 4QJ4B 3MV01 4HA3A 2YCJA 3PFMA 3LM3A 1W9XA 1XP3A 2NQ5A 3DEQA 4ZFMA 2VWSA 5HAOA 4XO6A 3SFWA 4U33A 2YR1A 3BLDA 2Y7EA 2PDXA 5BXSA 3ZVHA 1FHLA 4MB3A 3C0LA 3VE9A 3KBMA 1ONWA 3W73A 3C4UA 3NZPA 5K9CA 2PTDA 2CZEA 1R7AA 4XBSA 3GK0A 4QTGA 1ZU8A 2PDFA 4I5UA 1C8VA 1YNQA 2LLEA 3M41A 1DV7A 1PZ1A 6ENLA 3U5UA 1KW1A 2R24A 3U48A 3R8GA 2YCEA 5CXPA 4DUVA 5IHRA 1WXZA 4H8UA 4H1ZA 4FNUA 1RQEA 4GKTA 5LA1A 4XSMA 3GR4A 3TQVA 3UQNA 1WQ5A 3IEBA 2FVLA 2ZZ2A 4IH3A 1L8PA 1AK5A 1F4AA 2YL9A 4QJ1A 2OYLA 2BVWA 3WN6A 1XV8A 1OCQA 1VHNA 4UR7A 1WOAA 1ISYA 1RCQA 3TVAA 2RAGA 4OFCA 3P82A 3QW3A 4CU7A 4LANA 4W5UA 5TD4A 3LLXA 4NAFA 1VRDA 1I1XA 4ADSA 5XINA 1U5HA 3L0GA 1H1ZA 4MKSA 1O5RA 4BQ2A 2WJEA 2E3ZA 2QUNA 3GR8A 1OFRA 4Q4OA 2FZ9A 2VMFA 3CMGA 3NYZA 3AIQA 2ICSA 1SJDA 5M2FX 3UJEA 3D6NA 2C15A 3LHWA 3N73A 1EYEA 5FSEC 4FIQA 3MYPA 1ZJAA 1T5AA 5HNTA 1V3MA 4ZO6A 1KRAC 1OIFA 5AC5A 5CSSA 4GUJA 4J9JA 1H7WA 1M7PA 2E6FA 4DRSA 3S4TA 5JIPA 4P7LA 1Z3NA 2C18A 2Y5JA 2HXUA 1HJWA 3H22A 4NJJA 1Z32X 1OX5A 1BKHA 1TCDA 2OLHA 3A47A 2Z6JA 3GG8A 5LYRA 4A22A 3W1TA 3OG3A 1EF2A 1B5TA 4O4VA 3PM6A 3PBWA 4MWAD 4AVOA 2X2YA 1E9ZB 3PPCA 1FA2A 7REQB 1E6SM 4N9DA 3VNDA 2W61A 1JQXA 3PNZA 3VD5A 4AF0A 1O1HA 3WH6A 1M04A 4RCXA 3E2RA 3KWXA 1BG9A 1EGZA 3PJTA 1QFEA 4PBFA 5C5YA 1MDLA 4C1NA 3EOSA 1Q3NA 2VRQA 5DT7A 2E67A 3OIHA 1TMHA 1SQ7A 2BHYA 1XWYA 1QBAA 3KOXA 2GK1A 3KZSA 5CBJA 1V3JA 3KRBA 4MVAA 3BGJA 4Q4PA 4S3DA 5FJUA 4NZFA 3DYPA 3JUGA 4KCWA 4HK5A 3E96A 3UPMA 2NSOA 5J5DA 3GFXA 3G1AA 3IWPA 1H4PA 3KAOA 4ZEPA 1Q63A 3CWHA 1I9CB 4HHPA 3JZUA 3L66A 3KRUA 4HHHA 9XIAA 4MSSA 4B2DA 3T0CA 3OODA 3HGOA 5DCBA 1J5SA 1BXBA 1ZBCA 1NP0A 3V5OA 2ANUA 4PEKA 4TV5A 4JIEA 4AIEA 1VBJA 4DWSD 3KTCA 1H0GA 1YW1A 1OK4A 1F6YA 3PP7A 4CN4A 1THFD 2J9YA 2W4XA 1Q7MA 4KGJA 4GYFA 3TNOA 5I77A 3EB3A 1GK8A 4AD0A 1X6NA 4NNAA 4PCSA 2XU2A 3LM7A 1RPXA 4WKFA 3L65A 1G9HA 4J4KA 4DZ5A 1Q2SA 2DSVA 2QCHA 2WJZA 4CD6A 3APGA 3T6CA 5HATA 3R43A 5EBAA 4NAEA 2D2OA 2YYTA 2PBOA 3FX4A 4Q8OA 4NZ3A 4HU4A 4Q4RA 2QGYA 1FDZA 3IJ9A 6CGTA 1B2YA 1ONEA 5EGRA 4M8UA 4IL0A 4I5RA 1OJXA 4H8NA 4MWAC 4YTQA 2GYIA 1N8IA 4K7YA 1XH2A 1YE4A 3WLNA 4WY0B 3QJAA 4H9UA 3GG1A 4N0RA 3SRHA 3WLTA 3QQ1A 2BGQA 2PCEA 4GI6A 1D3CA 2QF7A 2PDPA 1PTDA 1V02E 1X39A 4XV0A 1P0NA 4LUYA 1IR1A 3RO6A 2QJIA 1V6YA 4Y9AA 3W0KA 3BMWA 4QG8A 3ONCA 4A2SA 1U22A 2V3FA 3V0SA 3MUCA 1BLIA 4Z2JA 3PZVA 2ON3A 3PZIA 2GUYA 3G6MA 4K2SA 1QW7A 1FVPA 3TMLA 3XISA 2OODA 1V3KA 4E8CA 3DKJA 3GWQA 3N17A 3H7UA 4IQEA 1TWIA 2WSQA 3LHTA 3QLLA 4WD0A 3ZMRA 4P8XA 3PBGA 2YZ5A 1SZEA 1DQWA 4GINA 3AS1A 4Q8WA 1A5UA 1LT7A 3WDHA 2AMXA 4E38A 1PX3A 4Q7NA 1XLKA 4O17A 2C71A 3ZVHB 5HQLA 3APTA 2FZ8A 3JRKA 3SDOA 3VZZA 4ROQA 2PBGA 1KLZA 1QPKA 5AZ0A 4MMWA 3AISA 1XINA 1HP5A 4Y9MA 2E68A 4L9ZA 2WCGA 2EXOA 3M5YA 4IX0A 5A6KA 1JPKA 3MQTA 4WQ6A 3WX7A 5I00A 3V3WA 4ZOBA 4CD8A 1D7KA 4OQVA 2NX3A 2ISWA 3KOYA 2C8NA 6XIAA 2Q02A 2Z1XA 3OGSA 3KZPA 4J7RA 2Q8XA 2QPUA 2E77A 3C52A 1FWEC 2GQ3A 3MKKA 4LX4A 1M41A 3F2CA 1Q6OA 1PS9A 4IM4A 1KM6A 3C0QA 1JZ5A 1YPFA 3SAZA 2XSBA 3K30A 1F6PA 3QQWA 5AB3A 4GXMA 3L4VA 4UTJA 3P61A 4UFMA 2QUUA 4RLIA 2PRHA 3TTSA 2WHKA 1WKEA 1UD2A 1QOXA 4C6QA 1BRLB 3SCSA 2CXGA 4DB7A 4LCQA 3TQPA 2TYSA 4Z17A 5C7VA 2X05A 2Q71A 4AEOA 4F0MA 3M0HA 1J18A 3T7VA 4H6KA 2CLHA 4BCEA 3PFRA 3N25A 3NQ2A 1UWSA 4PUJA 1ZLPA 1KFLA 3FA3A 3VIPA 1XLAA 5M3WA 3GR7A 1HJQA 2C14A 1W1TA 3OTRA 4QITA 1A5BA 2WVSA 4PFHA 1YDYA 1YX1A 4O1EA 5AHNA 4PEEA 3QXBA 4W87A 3O8AA 3LCWA 2EPLX 9CGTA 4ZTXA 4UTWA 2JBMA 4CNUA 3PC0A 2FKPA 2P3EA 3S9YA 4D8AA 4CNTA 3T07A 1RY0A 3MW7A 3Q2DA 1W3LA 3N34A 2XISA 1YIXA 1VRXA 5AHIA 1RV8A 4XO7A 3PWAA 1NQKA 1W5PA 4LCSA 4LPCA 1E6PA 1O60A 2ZWZA 3WK3A 1W2VA 3LGDA 4EPKA 4XD3A 4CEUC 2VDGA 3NQ7A 1JF6A 3W85A 1AG1O 3I3EA 1TCMA 3C2FA 1BWLA 5KSWA 2ZVIA 4L1WA 3G3MA 1HT6A 2DT0A 2GZXA 4AYGA 5G4HC 3QF0A 4WY0A 3B8TA 5BRBA 3MU7A 2HTMA 4H4IA 1Z7AA 4BKNA 3NQGA 1PEZA 4H00A 2KX9A 3RR1A 3CUXA 3IJDA 1J0YA 1KXTA 3T8LA 3NDZA 2PDWA 2YA0A 3QH2A 2H9AB 1OCBA 4ERAA 4WCJA 4JGDA 3B05A 2PDJA 1HFBA 3G1HA 1ZJIA 3PJUA 4BF9A 4NAEB 3AICA 3ABRA 4OBSA 1JZ8A 4ZQMA 4D71A 4Q6XA 2H90A 1E9IA 2XGBA 4B9ZA 4QJ5B 1AH3A 3B4UA 1BWVA 2YBTA 3W7JA 3THDA 4PR4A 3A4AA 3D3AA 3EPOA 1AQFA 1ZJHA 4IFRA 3ANVA 3BAIA 3S1WA 3W74A 3NQFA 3Q45A 4I9MA 1OC6A 1FFQA 5CQ1A 4PMUA 1GPWA 3BW2A 4AXNA 2YBVA 3K8LA 4HZ7A 3RFAA 1B3VA 3NQCA 1S3HA 2PD5A 1W9PA 5AVHA 1LG1A 3NSXA 1WDPA 2DVXA 2WJDA 4YJ5A 5C55A 4REQB 4PZVA 3L7RA 3HA1A 3VYLA 3S3GA 4H9ZA 2FPVA 4BY3A 1YDOA 3ME3A 1EC9A 1IXQA 1R3RA 1EJRC 3SSZA 4AMAA 5JQ9A 4KW2A 1TV5A 4Q7BA 4ADUA 4BZYA 1O94A 2QZRA 5GJMA 1IT8A 1TPWA 4W8AA 3CMJA 3WQDA 2V2CA 5EFDA 3W87A 3LHVA 3QTGA 3AWNA 5BWFA 4KH2A 4XKYB 4MWAB 3MJMA 2X41A 2PDYA 3WJYA 1LLZA 2XJ7A 1VB9A 3QHNA 4H83A 1RJPA 2BASA 4DO4A 1W3NA 2VUYA 3LNPA 4UFJA 3T4WA 1EWDA 3QR0A 3ZIZA 1WKFA 4K1WA 3TH6A 1AJ0A 5A8PA 1UD8A 4XBJA 4RE0A 1X97A 1V7AA 3LCGA 2R94A 4AC1X 5F1UA 2D24A 3SIMA 4E8DA 3GVRA 5BOFA 1ISWA 5IDZA 1VJIA 5C9ZA 1Z44A 4ZBCA 1EIXA 4KKXA 1XR2A 1CXFA 4C6EA 3ITYA 2WWCA 3LI1A 4TVCA 2TAAA 2VGBA 4IWWA 5LIXX 4OGZA 3L5AA 1UA3A 3WQCA 1V08A 3MCOA 1JGMA 4L6OA 3CQHA 5TF0A 1Q6QA 4JTAA 3G8RA 4H19A 2INZA 2O9RA 4K3ZA 2BLEA 4X2PA 1EWEA 1W1YA 4RJEA 1BVZA 1XQLA 4FNRA 1ZUAX 1R2TA 4O1FA 4AMCA 4D1JA 1KD0A 5DMMA 4RW3A 5G2HA 1PAMA 3LPFA 2OOGA 3MI2A 4WSJA 3Q65A 4FEZA 2XYLA 2Z00A 1D7FA 3GHRA 1K8CA 3BAXA 2CNCA 2P0IA 2GJXA 1RJQA 3FGCB 4EAYA 4LAKA 5DCDA 3IV3A 3I6EA 2YXXA 1A5KC 3WFLA 4C1NB 3LI0A 1CB2A 1ICSA 5JU6A 5HR6A 4QNWA 3EYPA 4QE4A 4EWJA 3PAJA 2J7FA 4JQAA 3VD7A 2CCRA 1QNOA 2J7EA 4FZIA 3QY6A 4Z1BA 3I3DA 3BQ5A 3B3DA 4MNKA 2WNNA 3GW3A 3ARYA 4GA8A 4JTIA 3GD6A 2D0FA 1V6WA 1K6WA 1HNYA 1I2QA 3E2QA 2VC6A 1JI1A 1J01A 3ITTA 4B5UA 3BCJA 5PTDA 4JHOA 4UMAA 3CLMA 2CYGA 5HUOA 5EYWA 4JFUA 2PC4A 3QMSA 1H1YA 1OGBA 3TQKA 4E5TA 1V5XA 4GVFA 2GUBA 3W7IA 4AHQA 8XIMA 1R46A 3HPFA 3ATYA 2WB5A 2PWUA 3LCFA 1M5WA 4NJIA 3L23A 2BHUA 2BSLA 1EPVA 4ZSTA 1SZGA 3GFYA 3KXQA 3MC5A 4INFA 3S6OA 1EGMA 4U10A 4ES4A 5CSYA 1T99A 1XS2A 7PTDA 4FLQA 2IPWA 4D6JA 3JW7A 2NZLA 1TTQA 5CG0A 4HTYA 4AU0A 1FCUA 3R5EA 4HBKA 4M0XA 2I56A 3W53A 2A7RA 2XZ7A 2OTDA 6PTDA 3RDKA 4QRNA 2WMIA 3W2NA 3RNDA 4PRRA 4TXEA 1LBMA 2PS2A 4OOUA 1H5VA 5A8GA 4GCXA 1JYNA 3A9IA 4MWAA 1UH3A 4B5SA 4FA3A 3ECQA 1OBAA 3QOMA 3AYRA 1C7TA 3BCDA 2CBVA 4QE1A 5FAGA 3N6QA 3VDHA 3G1FA 4DEFA 4ML9A 3IGSA 4WSKA 1EFZA 1I2RA 4IIFA 4PTDA 4R88A 1XIMA 1J9YA 4XAFA 4S3JA 2WMIB 4PUDA 1JFHA 1E4LA 4CCZA 4U5KA 1JL8A 2V5JA 3H12A 4FALA 4IIDA 3NG3A 2QVNA 4GBUA 1U1JA 3WQWA 3MSGA 2XIJA 2WCAA 7XIMA 3G1DA 4E3TA 3WH7A 1UD4A 1FKXA 3NCOA 4D2JA 3EWWA 3GHUA 2Q8ZA 3N3MA 3VK5A 2ZTJA 4WJ8A 3QV6A 3W72A 3CTTA 1RY8A 1NEYA 1A5MC 4QHRA 4L65A 2QLYA 4XZLX 4JQ2A 4DPQA 2DJXA 5AZ1A 4ZQNA 3W83A 3W7LA 3E0WA 3E38A 1W3IA 5B7YA 4A29A 3M0LA 1QK2A 2CHRA 1A4MA 2C91A 2VXNA 4J5NA 3P3BA 4GIAA 4K37A 3OW1A 2GGEA 3IARA 4WIWA 5LA2A 1QNVA 5J04A 3GDMA 1IEVA 1S39A 1KFWA 1GORA 1H41A 4UFKA 3GU2A 4PSPA 1XLEA 2ODOA 4GFSA 1KGWA 2O9TA 1TUFA 1IEWA 4B91A 5HJYA 1VP5A 3VIKA 5LGXA 3O06A 5A1AA 3VGBA 3RJXA 1F61A 4FNPA 4US5A 3QZAA 1TMLA 3E6EA 3WF1A 1V3LA 3VU2A 3H55A 2ZXAA 4PTXA 4QGCA 1QPOA 3TJLA 1FQ0A 4F3HA 3EA3A 4F0HA 3O07A 4TUFA 3VOFA 1UWTA 4QFUA 3F4NA 4AWUA 2FH6A 2PDUA 3A5VA 3PWIA 3EDEA 1V6TA 2XWEA 2GVJA 4ZO8A 4A3YA 5ABEA 1E43A 3CUGA 2CBUA 2ZRXA 1VD6A 1YHTA 4O1CA 2PDHA 1LORA 2ZXQA 1S38A 5K7JA 1UUOA 3URBA 2XVGA 2RGLA 3NM3A 3H21A 1PWMA 4O15A 1MSSA 4IT1A 1DTUA 3BLFA 5CPQA 4IGHA 4QCFA 3TAOA 1XM3A 4H7ZA 3ZFHA 4MY1A 2BB0A 1HVXA 2ISDA 3CAKA 1QO5A 3GFZA 1CECA 2WC7A 2HBVA 2HJPA 2GJRA 3V35A 2ZIDA 2BTMA 3UWEA 3H2EA 3WMLA 4DLFA 4JTRA 1UPMB 3P84A 4S3KA 3W25A 3KBSA 3UNTA 3CXOA 2EG7A 1E1EA 1WBHA 1HJUA 4YCOA 1PKLA 3FY1A 3UR2A 5KTLA 3NL2A 4V2XA 1JUKA 4G5DA 2DY3A 2Y61A 4HJWA 1MNZA 4RZ6A 2FMOA 1JAKA 3G24A 3KOZA 2PDMA 3N2TA 1VFUA 3NURA 5AHFA 3W7OA 2GVEA 4XVDA 2QCDB 1WDSA 2PB1A 3DHFA 4EIVA 3GNXA 4HOXA 1ISXA 5BMXA 1ZP3A 3G5EA 5CZ0A 1T8QA 1KKRA 4JL2A 4JYEA 1LBFA 4J28A 3UWYA 2EPMX 3LSCA 4GBDA 1K8ZA 2Z1BA 2WVTA 1HJSA 1UWRA 1MUWA 3ES7A 1P6BA 4RNJA 4TO8A 4LRTA 4HB7A 3NPVA 4XQ6A 3LTSA 1MZRA 4UTTA 4TTGA 1TFVA 1OADA 5JBFA 3WD3A 2HK0A 5CPSA 2HXTA 1SR9A 5DXXA 5I06A 2VQTA 3GXNA 3ABXA 1XBYA 3P14A 3PN8A 4S39A 4GK8A 2B7NA 2WLZA 2BY2A 3E0LA 4KERA 2DZXA 3GZAA 4AY1A 3TN4A 1S5MA 1KBIA 1QI3A 2BBFA 4GO8A 2G3IA 3T2PA 1SW7A 1GQLA 4HNUA 3EWUA 3M5ZA 3WDIA 4ZR8A 3JR2A 1F73A 1JEZA 4FSAA 1EHNA 2QJNA 2W79A 2PP0A 2F61A 5C2XA 1IE7C 1UBPC 2VDHA 3PR2A 1XRVA 3K8MA 3G1XA 3FIGA 4L6DA 1E4MM 5E9XA 2OFJA 1BHGA 3D47A 3VGEA 5HUPA 3UGVA 4UQEA 3RX4A 2V2HA 3KX6A 1KRBC 2DV0A 4QJ3B 2P3ZA 2FZNA 1V3IA 2OEMA 4QXIA 4ZQCA 1VZWA 4M6PA 3R2GA 4MLRA 3PF3A 1FWNA 3WH5A 5BYWA 4O4WA 1CI1A 1A5SA 4QCEA 2Z1KA 3SI9A 2GLKA 4DBWA 3GNNA 4DF1A 1LP6A 4JTCA 4QNEA 1W56A 4MWAE 2IS7A 1NY1A 1RVKA 1VENA 3NL5A 2VEIA 2EGZA 1X8FA 2OX1A 1JVNA 1GCYA 2OU4A 2NQHA 1IXOA 1E9LA 2WHMA 3WLHA 2DZAA 4FLOA 2XZ9A 1R0MA 2R6OA 3OZOA 4OECA 1EB3A 7TAAA 1JJKA 4TIMA 3IGHX 1LQ0A 3VX0A 3NGJA 4JN8A 1KBKA 5KZ6A 4GUFA 2V30A 5CAKA 3W2MA 1UCWA 5BZAA 4FAMA 4XZMX 1ZAJA 2Q3RA 1OX4A 2YJQA 5ABTA 3CQKA 4QEHA 3OP2A 3AIVA 4CVWA 4ZO7A 1QU4A 1UOZA 4JIQA 4XX6A 3EMQA 3MKVA 4PSRA 2ZUUA 4Q4KA 2CZVA 5JXQA 1FWRA 4M1RA 2YDQA 2W27A 1PZ2A 4UNKA 3EWZA 2YDRA 5I07A 1A5LC 2J62A 1YXCA 4LAOA 2AQOA 1R38A 3VMPA 2FB3A 3GVGA 2H3DA 4E2BA 2VQUA 4HZ6A 1F8MA 1B4KA 4DWDA 2QJJA 3TK7A 5DN1A 5I3KA 3BZJA 2E25A 1WDDA 1PE1A 1RD5A 2XIIA 3KW3A 3XINA 4IMGA 2QDHA 4L61A 4D9PA 1OINA 3EAUA 2I5IA 4FF5A 3RHGA 3UYIA 4UFLA 4S3FA 3MUAA 1HIZA 4PB3A 1TPUA 2VI0A 4XWUA 4NP7A 2CBIA 2WMGA 3EOEA 2PDIA 3KHJA 5CCZA 4IMAA 3QPZA 3BJFA 1TX0A 2F7FA 4Q32A 4W93A 1AL7A 3WF4A 1LL4A 1NWRA 5HMEA 3LQLA 2GGIA 3O6YX 1XIGA 3M43A 4ZQOA 4ZTYA 5HWJA 2X40A 2P76A 4J1OA 1GPFA 2A7NA 1FCVA 4KIEA 2OR2A 4ZCWA 3EDJA 3T4CA 2NVDA 4H2CA 1KA9F 4YS1A 3WMBA 2R1MA 4QX4A 2J47A 3HQPA 1F76A 3CPUA 4E6MA 3NQEA 4MNJA 2G97A 2CC0A 4WSHA 3VKJA 1GW1A 2V5CA 1AH0A 1XLJA 4H2HA 1V77A 3W7EA 4Q4MA 1TSIA 2HCVA 3WCZA 3BO9A 3MZ2A 1NWTA 5H8UA 3NXLA 1F9CA 1ESWA 1IIHA 4HYRA 3APYA 4RE4A 3DFYA 3K46A 2OSWA 3GDKA 3KBWA 3WQ4A 4U3AA 2NQ9A 3DECA 3WD2A 4PMXA 4QP0A 1RAKA 2FDSA 1R3WA 3W27A 3A5FA 4UTUA 3TJIA 4PUWA 3IRDA 1QR7A 1XRTA 3B8WA 1NDZA 5IRPA 3HZ3A 3O2LA 4KFPA 4MB4A 1VCGA 1RCXB 3E2VA 4Q4QA 1QK0A 4S23A 4B15A 2X30A 3W7CA 2VVSA 4XZHA 4U4MA 2Y63A 5LKYA 3LPGA 1JYXA 1UWIA 1SZNA 1IXPA 3LMZA 4U28A 5DQPA 3LNMA 4LAUA 3BMXA 3LXCA 5H91A 3WQGA 1O95A 3QV7A 3VKCA 1S2UA 4WKHA 3URNA 5DLCA 4PMDA 2Y5EA 3KVMA 5IBXA 2MNRA 4RZ4A 2Y8UA 5U7SA 4DZAA 3A4XA 4Z1CA 4HA1A 4JNYA 1OFQA 3C5QA 1UH2A 2QJMA 4JL1A 2GDVA 4J3WA 1FHVA 1QWGA 2O0TA 4E2OA 2Z2BA 2E5BA 5FJIA 4JCMA 3VIMA 2R8WA 3DHUA 3U2CA 3KCJA 4IIHA 1GVEA 3LPOA 4TU1A 3UJFA 1IZJA 1JQVA 4EF9A 4JNMA 2ACUA 1M1BA 1T96A 2VZTA 3QBUA 1B57A 3PTDA