5AHMA

Imp-bound form of the deltacbs mutant of impdh from pseudomonas aeruginosa
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
378
structure length
354
Chain Sequence
b'MLRISQEALTFDDVLLIPGYSEVLPKDVSLKTRLTRGIELNIPLVSAAMDTVTEARLAIAMAQEGGIGIIHKNMGIEQQAAEVRKVKKHETAKAKTYPLASKDEQGRLRVGAAVGTGADTGERVAALVAAGVDVVVVDTAHGHSKGVIERVRWVKQTFPDVQVIGGNIATAEAAKALAEAGADAVKVGIGPGSICTTRIVAGVGVPQISAIANVAAALEGTGVPLIADGGIRFSGDLAKAMVAGAYCVMMGSMFAGTEEAPGEIELFQGRSYKSYRGMGSLVPEGIEGRVPYKGALSAIVHQLMGGLRAAMGYTGSADIQQMRTQPQFVRITGAGMAESHVHDVQITKEAPNYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
publication title Crystallographic Studies of Two Variants of Pseudomonas Aeruginosa Impdh with Impaired Allosteric Regulation
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Oxidoreductase
total genus 112
structure length 354
sequence length 378
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5ahmA00
1K03A 4NZJA 4QJ1A 3W7JA 1TRDA 4OHQA 3LRKA 1X1ZA 4JX4A 3A23A 3I6RA 1QPRA 4JTIA 5LKYA 3IGUA 3TSDA 4FNRA 3OVPA 3LHZA 1D3GA 1OFQA 1OF8A 2QCGA 4DPQA 4Z1CA 5D32A 3M5YA 1EP2A 4FXRA 1JUBA 4N9BA 4GC4A 5KMYA 3DU0A 4BK9A 5BOOA 1W5QA 4IXHA 2DZXA 1F73A 4JTSA 2E68A 1TPC1 1VH7A 4L4LA 1K7XA 1A53A 2J24A 4MOZA 1OFDA 3OEXA 1NF0A 1JCYA 1LM1A 1W1ZA 2YDAA 4K39A 5T26A 4ZQPA 1A5SA 1WBHA 2A85A 2CLHA 3MP3A 1GTEA 3L0NA 2F84A 1WV2A 2CFFA 3PF3A 2FB3A 2OCZA 3G8EA 4M6VA 3PR2A 2DJXA 3DKLA 2R91A 3GXNA 5G2WA 3LM7A 3TROA 5CKSA 2NXHA 2XN0A 3P7YA 4D2JA 4ZL1A 2DZTA 1RQBA 2DZPA 3IRDA 4RR4A 4C1KA 3MWAA 4NXKA 4UR7A 5FEXA 3HPSA 3NO5A 3FKKA 3PBVA 3LB0A 1KFJA 2P0OA 1O4UA 4FO4A 3MP5A 3EXTA 1OABA 2TRSA 3PY2A 3TAKA 2Y7DA 3QMRA 1YTEA 4U28A 2HTMA 3MBDA 2H90A 4RXGA 4RK8A 3S5ZA 2QJHA 4NJGA 2PRMA 4ADSA 3KVKA 1U83A 1UB3A 1UUMA 4NU7A 2NWRA 2V30A 3I65A 2VFFA 1G7VA 5D33A 4YLWA 1K3UA 4XQ6A 3VFLA 3W1AA 3N2XA 1P0NA 3TE9A 1R2SA 3H54A 3W71A 5GVJA 4XBKA 1O94A 4BI7A 2YFOA 2OT1A 5F4SA 4I7WA 3PUEA 4PC8A 3W2JA 3MUXA 3W2NA 2A1YA 1LRNA 3QMSA 5EPDA 4QM1A 3S42A 4K36A 2ISVA 2NUXA 2W79A 5D38A 3USBA 2E6DA 5EBUA 5FF0A 3MHUA 4UC5A 5FEZA 3QM3A 3GYEA 1SO6A 1QDSA 1Z41A 3S5YA 2YCEA 1AL7A 5C54A 1IXQA 7TIMA 4JXCA 1I2NA 3QRHA 5EYWA 2VFEA 4AHOA 3N34A 3EX1A 5CZ0A 5L9FA 5AOUA 2CU0A 2WSYA 2ZZ5A 3O06A 3NQ7A 4DF2A 4ADUA 1WQ5A 3STEA 2CLKA 4PL2A 1TYGA 2ZZ4A 5HMSA 1GTHA 1SSDA 3LHUA 2R14A 4JYEA 1GJPA 2NXIA 3PBYA 1LOQA 2DJLA 3W7QA 4RZ4A 2ZRVA 4CCEA 2EPHA 2FIQA 2QCDA 4RZ6A 4MY9A 3TSBA 3W2UA 1DVJA 1X6UA 3IGSA 3HBLA 3KRZA 1RZMA 2ISSA 1AW1A 4POCA 3PB2A 4GBUA 5EKYA 8TIMA 4FNSA 4CNPA 4O0KA 3GR7A 4R53A 4AH7A 4K6AA 4UR8A 5HWJA 2WO5A 3TXVA 2PURA 3FJ6A 4DBEA 3M41A 3L66A 3TQ0A 4FNQA 3MHFA 2X16A 3TW6A 2HS8A 1AW5A 5CSRA 3RK8A 5FESA 4J9JA 4DF1A 1RQHA 3LV6A 1M7OA 5BMWA 3UY8A 1RR2A 4CQ8A 3BW2A 3T78A 1TPFA 4CNOA 3TJLA 3GIYA 1PV8A 3BGJA 2CW6A 1KFKA 1F74A 4UTIA 1TREA 1OX6A 3R5EA 1GVFA 1DQXA 3NXFA 5A8GA 4NJIA 3EEGA 1KM3A 1LYXA 2YYTA 4Y96A 2RDWA 4FNUA 1W37A 4KFNA 3GDTA 3EWXA 3QW4B 3BV4A 1TTJA 2ZDRA 3GX9A 3PBUA 3LCWA 2Y62A 2P10A 3S1VA 4UFMA 5LHFA 2ZZ1A 1SW7A 4PODA 4A21A 4RLIA 2C19A 2VEMA 4WY0F 4CCCA 2X1RA 1JQXA 3DFOA 1DJNA 2VC6A 2HSAA 1I2OA 3HPXA 1OFEA 3CQ0A 4W9TA 1JCXA 3BVJA 3W1RA 2ZZ7A 1XDLA 3WJYA 2EHHA 4K37A 3LI0A 1P1XA 1FY6A 3DAQA 2HMCA 2A0NA 1W3IA 2JBMA 3CLMA 4O15A 3O6YX 4UFLA 3M9YA 2ABAA 1W5MA 2WPBA 3QQ1A 2WV8A 4HIBA 4N6EA 3W7EA 4G1KA 3CEUA 4LS0A 3P5ZA 4HNTA 5K9DA 3V75A 4AWUA 3KAOA 3C52A 5U4NA 4IXXA 3F03K 3IIZA 4TIMA 3QPZA 2QUVA 3SFKA 1EPXA 1SW3A 4AAJA 4KFPA 1AK5A 1M5WA 3DZ1A 3B0UX 3PWAA 3W9ZA 5IM51 3TCEA 3KVJA 2E5DA 2OT0A 4MYAA 3W1QA 3G18A 1GEQA 3HGRA 3UZJA 1YXYA 4AWSA 1ICPA 1P5BA 4UMCA 3SI9A 3N14A 2J9YA 2C15A 2CLLA 3LBMA 3CWOX 3NGJA 4GUGA 5KTLA 4PFMA 5AHMA 4UMBA 4FXSA 4UTLA 1I45A 1XKYA 1I8JA 2ZA2A 3W7DA 4O1CA 3HB9A 3LLDA 5HNRA 3E12A 5C2XA 4FNPA 3NZRA 1O60A 1GVRA 1UBSA 2WNZA 1FCBA 1LRTA 2CLFA 3TFXA 3W75A 2GVJA 2DZVA 3CTLA 4YCPA 4UTTA 2CLOA 1WAUA 1T0OA 1FBAA 1GVSA 3B8DA 3NPWA 3W7KA 5AYZA 4O17A 5TBOA 1KFCA 4FF7A 4DBDA 1JCNA 2WNQA 3MBFA 4ICNA 1XI3A 1ME7A 4Q32A 2J9XA 2X1SA 3A9IA 3FA5A 4LS2A 1AMKA 3I7RA 3NQCA 3QZEA 3L5LA 3NOEA 5G1TA 3ABRA 3WFAA 1QO2A 3P82A 3NNTA 4MJMA 4N4PA 3IV3A 3HGOA 4UIOA 3SW6A 4NX5A 1TPH1 5EL1A 5TQLA 3PS7A 2WQPA 3UQNA 4JGDA 4O14A 2YX0A 4ALDA 3DHFA 3CIWA 4S1FA 3DFTA 3H53A 1ALDA 1FXPA 3LERA 3OBKA 2ZZ6A 4NZFA 5KSWA 3VNDA 4O50A 1XBVA 1X1OA 1WA3A 1MO0A 1VCVA 3QQ0A 4UFJA 4UTWA 2Z2UA 1GWJA 5LSMA 1T99A 5FF2A 1LLZA 1M6JA 4MY8A 4LUJA 1SZFA 5IBXC 2LLEA 3MI3A 3C61A 1SUXA 3VCRA 1I2PA 5HQEA 1NFBA 2QDHA 3AJXA 2I9EA 4RJEA 4GUIA 4Z0SA 3UWUA 4X3ZA 3IVTA 1NEYA 2NUYA 3OVQA 4Y9AA 5HR6A 1H60A 3R2GA 2ISWA 4ONVA 3RMJA 3ABSA 2B7PA 3EWUA 1R2TA 2JGYA 4H4IA 3GDKA 4AHPA 2A7NA 1C8VA 1SFLA 2C18A 2VEKA 3W86A 3W83A 4JTEA 3NM3A 4XTIA 1Q6LA 1L6YA 2QJIA 4ORIA 5HUOA 4TR9A 4LTSA 4O13A 2DU2A 1KM5A 3TK7A 1OX4A 4RCXA 1W31A 1QOPA 4GUJA 5KZDA 3TU9A 3NL6A 2EF9A 4HN4A 2R94A 3L2IA 1TCDA 3NPVA 4JR5A 3TA6A 1UASA 5HWMA 1JCLA 3WK3A 4HSNA 5G2IA 1W3NA 1A5CA 1K8XA 2VELA 2QCCA 4UCGA 1LZOA 1TB3A 4M7TA 2FTPA 1GZGA 3P8IA 4Y6GA 1VRDA 3LCIA 1SW0A 2PCQA 3TW7A 1SR9A 3W1MA 3G1YA 4HSOA 4JTTA 2OMAA 1LBMA 5J5DA 3C2RA 4UUIA 4JTHA 3QPYA 1YDNA 4EVZA 3TC7A 1VLIA 1PE1A 3DFSA 1XL9A 3G24A 4U4MA 1FCUA 3VI2A 5FI8A 5AYXA 3EKZA 3O1NA 1H7WA 1MXSA 2Y61A 3LV5A 1EEPA 4WUIA 5FEWA 3W23A 3WK1A 3NL2A 4I9AA 4HNUA 3LCLA 2V2DA 3C56A 1ZENA 5D2XA 5D05A 3W7MA 1SO5A 2A7PA 5G1YA 5DY3A 5A5WA 1PHQA 4P2VA 2E09A 3W7CA 4ADTA 3OVRA 2QKFA 2Q3RA 2QDGA 2GUUA 3W2LA 1S5VA 3NEVA 3W70A 1LBFA 1VCFA 4WOZA 1H1YA 1XUUA 4JIPA 4O4VA 1R30A 1EP3A 3C6CA 1FCVA 3UWWA 3L65A 4Q4KA 4QNWA 1FUYA 3A24A 5F2LA 3NL3A 4MLJA 4AB4A 3L0KA 1KW1A 3K30A 2FPVA 1ZAHA 1XM3A 4DO6A 1TQXA 4A3UA 3RLUA 2YPIA 4R33A 3RU6A 3TX9A 3NDOA 3CHVA 2QR6A 3DFNA 3W7GA 1EIXA 3DI0A 1I2QA 2GOUA 5EA9A 5F4XA 3TV8A 2X2GA 4E2DA 3W7OA 1F6PA 2BZNA 2ZRXA 2NWSA 1JR1A 3FLUA 4QISA 1J4EA 2BXVA 4O53A 4Y8FA 3S1UA 3M43A 4UNKA 3NA8A 4LWWA 2X30A 2RDTA 1LRQA 4MVAA 5LNWA 4ZQNA 1CW2A 1UUOA 4O54A 1TO3A 4FX8A 3Q94A 4L4MA 3LHWA 4UFIA 3THAA 2V2HA 3QSRA 1RPXA 1L6WA 3DXIA 1D3HA 2ZBTA 4C1LA 3DFPA 5DY2A 4LRTA 2B0MA 3TR2A 2QEZA 5E0KA 3TNOA 3VE9A 2YW3A 1OK4A 1PL9A 1F2JA 3OG3A 2Q8ZA 2E5BA 4N6FA 2Y89A 2Y7GA 3M6YA 3E96A 4K8EA 3QC3A 2ZRUA 3RFAA 3FJLA 5D2WA 3FKRA 1P0KA 3MW7A 5D2VA 3T4CA 2ZZ3A 1MSSA 3B04A 1GG1A 3O16A 3EX2A 1VYPX 5H91A 1VCGA 4ZQCA 2V5BA 3NQGA 3G0SA 3L0GA 5D2YA 2I1OA 2W0UA 3PC0A 3W7NA 3GXTA 4EOUA 1OFBA 3MJYA 2V2CA 1Q6QA 2H8XA 3SIZA 2FDSA 4E38A 5D2TA 4CCDA 3HG5A 3S1XA 2TPSA 3CU2A 4MFEA 3ELFA 4IOTA 4HNNA 2QCFA 1JUKA 1TTQA 2E77A 3W1PA 4GNJA 4AHQA 1FDJA 2NV2A 5AC8A 1H62A 4JTGA 4GUFA 3P67A 3TC6A 4EF9A 5HR7A 4K7VA 1LP6A 1F76A 1TV7A 1OYAA 5CG7A 4OGZA 4BI6A 3DBPA 4JNMA 4GWEA 4ZVJA 4NUWA 2G95A 4NNCA 3LLFA 3LHTA 3BGGA 2A5HA 3QH2A 4M6PA 3UXDA 1S3HA 2IQTA 1BEUA 1ICQA 1KV8A 1GYNA 3UPBA 1CX9A 2RH9A 1PS9A 4JS3A 4NX0A 4JICA 3NQVA 2GQ8A 1TPB1 4NNBA 2ALDA 1IIHA 1UCWA 1QPQA 4R34A 4XBSA 1VYRA 4N9EA 3S1WA 2E1DA 1TPUA 1S5WA 3U8GA 1QOQA 1KV5A 4YL2A 1YPIA 4QNEA 2G97A 1PCKA 4OBTA 1HO1A 2X1TA 3BARA 3QFEA 3FOKA 5LNUA 5BMXA 4O52A 4TO8A 1YLVA 1KM0A 2F7FA 4O1AA 4O16A 1WX0A 1UJPA 2CLIA 3N9RA 1A5AA 2YSWA 1G67A 3TKFA 1ME9A 1GPWA 1SO3A 1ZHAA 3KOFA 1YXDA 2E6FA 2TSYA 3NQFA 5DBUA 5DELA 1GQNA 4JTJA 3O6CA 3EX3A 4DO5A 5KINA 3R13A 2GJNA 2ZZ2A 4PL1A 1GVOA 3LHVA 5D04C 3TIMA 2B7NA 3M16A 2RHGA 5D03A 1TPWA 1YDVA 4XTDA 1DL3A 2B7OA 4N4QA 3CIXA 1F6KA 5IBXA 5E93A 3OHIA 3BLEA 4WD0A 3B03A 2QCNA 3BG3A 5ABTA 2O7SA 1IXPA 2ABBA 1KBIA 5K9CA 1QFEA 4CLMA 5K7JA 1WBJA 2Q8LA 1OVDA 3P60A 5K9XA 4UFHA 3C0JA 4XZ9A 5G5IA 3NQAA 4NNAA 4DXVA 2ZYFA 3HG3A 3TUUA 3I7SA 1SPQA 3Q2DA 1Y0EA 4BWLC 1E51A 2QUUA 3GAKA 3TQVA 3KXQA 5C5YA 1OX4B 3HPZA 1K8YA 2DZWA 3UXAA 4E2BA 4LVAA 3FYOA 1KM1A 3W22A 3G0XA 3W1LA 3TMQA 3HO8A 1FX6A 5FF3A 5F4WA 3IGXA 2QF7A 4JYDA 5CPMA 1VZWA 3BW3A 3G3DA 5AHFA 3S9YA 2BSLA 3U6WA 3DGRA 3LHYA 5TIMA 2YGYA 1TTIA 4GE8A 1TMHA 2D73A 4CQAA 1MEWA 3T40A 1EA0A 3UWYA 3NVTA 1ML1A 5KITA 5I3FA 1IIGA 1B9BA 1A50A 1DOSA 1EWDA 5DCEA 4JIQA 3WJZA 3S8HA 3W2MA 2GVLA 4OT7A 1EX5A 3O15A 4HNVA 1N8FA 1HG3A 3PB0A 4WZHA 2QUTA 2WOQA 3KX6A 2H3BA 3DKJA 3PM6A 1DORA 3G1SA 4FX7A 5AHNA 2BLEA 4MLRA 1YTDA 2E6AA 2ZA3A 4Z0JA 3CB8A 4UMAA 5BW6A 1GVQA 3M44A 4PCFA 4HPXA 2A2IA 2XN2A 3L9CA 1FWRA 1BKSA 3AO0A 3STCA 4O1DA 1FXQA 2DZUA 5C6MA 3NQMA 1OF6A 3T7VA 4DQWA 3KRUA 1KFEA 3SY5A 1F5ZA 2FFCA 3KVLA 1L6SA 4KWVA 2AGKA 4IMEA 5DN1A 1VHCA 2VENA 3R12A 1EB3A 3PSVA 3O8AA 1FWSA 2V8ZA 5CPOA 3IIVA 2ZTKA 3L5AA 1VYSX 5LNRA 3CM4A 1RVGA 2J9ZA 3FIGA 2CWNA 2Y7FA 1FWWA 3LI1A 5J5RA 1MZHA 3LXCA 5FF7A 5CZTA 4IPIA 2C0AA 5AC6A 1BWLA 5AHEA 3M47A 3EX4A 1ZAJA 4NJJA 1K7EA 3STGA 3DHDA 2VFGA 3H55A 4MUZA 3M1ZA 3NZ1A 1ADOA 1G4EA 3UPWA 4PH6A 3UWQA 3ZS4A 1IGSA 3UZ5A 2ZRYA 3OA3A 4LVDA 2J6XA 2AQWA 2OZ0A 1M7PA 1QR7A 2PE4A 1KM2A 3W87A 2EGZA 3M0ZA 2QAPA 2W6RA 4ZMGA 3M7WA 3M5VA 5F1UA 3GKFA 2ZQ0A 5D30A 5DXXA 3ABQA 3F1QA 4UTKA 3LDVA 3QF0A 4HHPA 1QWGA 1KA9F 3GDLA 4P61A 4ML9A 4MFDA 3N19B 2Y88A 4JN6A 1FDYA 2RDUA 3ATZA 4M5PA 2UV8G 5CZSA 1W5OA 2JKEA 3E02A 4Z1BA 2VXNA 3O07A 2ZFAA 3WJSA 3G0UA 1ZJIA 2V9DA 2QJGA 3EKLA 3HIJA 2BTMA 4GRSA 2QCLA 1TIMA 1TJPA 2FJKA 2E6YA 3LGEA 2FB2A 2ZTJA 1NSJA 4TMBA 1B57A 3W7PA 3TFCA 3RF9A 4AWTA 1HFBA 3ZR4A 4I7VA 1BWKA 2A21A 3A5VA 3NQ8A 4RV8A 1OK6A 2GPTA 1KM4A 2VEIA 3STFA 2VFDA 4AEOA 3PVFA 2I14A 1QCWA 1EUAA 4Z1DA 4BR1A 3IVSA 3W74A 2YFNA 1C9DA 4OWGA 1H1ZA 1EUNA 4NQ1A 2QAFA 3N9SA 1O95A 1G69A 2G5WA 4WQ6A 3GLCA 4X9SA 5G2HA 1Q6OA 3V1PA 1VC4A 3W1UA 3JR2A 4IQLA 2VKZG 1RQEA 3DFQA 3MMTA 5HUPA 4OV4A 4MZYA 2E5CA 4YWIA 1JULA 1H7XA 1OFOA 3CWNA 3S5OA 2CZFA 1KFBA 1WOBA 3MP4A 1FDZA 2A6LA 3L21A 4B5NA 5K4ZA 3P80A 1GG0A 5MHBA 5EMUA 2B4GA 1JJKA 4NVTA 3MHGA 3W7IA 1KLZA 3TQKA 4IUOA 1N7KA 3E0IA 2DZSA 3F4NA 3GNDA 2C14A 3WK2A 3W1NA 5D02A 2G96A 1LBLA 5CPNA 1ME8A 4N02A 2ZRWA 4DPPA 4M7SA 3W76A 5LHEA 2Y6ZA 1O5XA 3QSTA 5BRBA 3IIOA 4LNYA 1H7PA 3KFTA 4JDBA 3G22A 3NR0A 4MKNA 1DJQA 2X1UA 3LRMA 3NYZA 1LDCA 3S5NA 3KVMA 1SZNA 1GT8A 3B4UA 3KRSA 2WSRA 1KTCA 1W54A 4UTTC 4JDYA 1IXOA 4ORMA 2YW4A 3W73A 2PRLA 2Z6IA 3NAVA 3LCFA 2FPTA 2BX7A 1LLWA 1XBYA 3BG5A 4K38A 1G4PA 3M5ZA 1H7NA 4KFOA 4FEZA 3VE7A 3W72A 5KZEA 3VKJA 1YXCA 1G7UA 4GUHA 1SO4A 1PCWA 1YYAA 1TPDA 3S6DA 1ZNNA 2VEPA 1KBJA 1IF2A 4JTLA 3C2EA 1YTKA 2EKCA 3G3MA 1DKWA 3NQ2A 2RFGA 3SR7A 3C8FA 3CC1A 3GDRA 3Q37A 4NJHA 1V7YA 3THQA 1ZAIA 2FQIA 4XKYA 1XCFA 4S2CA 3EX6A 3C3NA 3W88A 1XBZA 3SGZA 3IIXA 1PIIA 4IMCA 4BWLA 4A22A 4Y90A 5KZMA 4JX5A 3LTSA 4O28A 4ZZ9A 1TTPA 1Z44A 1H7OA 2H8ZA 3PSWA 5K2ZA 4CNNA 4MZ1A 3E9AA 1WYIA 5CSSA 5LGXA 2A6NA 4H6KA 4LVBA 2ZA1A 2V82A 1OFAA 1HTIA 4GJ1A 1XUZA 4UTWC 4IMDA 3PUOA 4NT0A 2DORA 4A2SA 2CLEA 5I3GA 2V81A 5DBTA 3P84A 1IXNA 5D37A 3INPA 4RX0A 5D09A 3D0CA 3FYPA 5HINA 1G4SA 1N55A 3Q58A 4A29A 3FS2A 1SZEA 2NX9A 1R47A 2NXGA 2YZRA 3B06A 3C4UA 3NG3A 4O4WA 4JTKA 1O5KA 1TJRA 2V5LA 3W7HA 4ZQRA 2AAMA 3UNDA 3G1FA 1ONRA 5H2ZA 3HOJA 2Z6JA 4WXYA 1LTDA 4O19A 3HMJG 4LUIA 4HKPA 1RD5A 3LXBA 2Z0IA 1PHWA 3HGSA 4LS1A 3SSJA 2V0TA 2ZCGA 4JX6A 4GFSA 3N2MA 3I68A 2HS6A 4QAIA 1OJXA 1QPOA 3L5MA 1TRIA 3HF3A 5LGZA 1TV8A 4MY1A 1W8SA 3UWZA 1J2WA 3GAYA 5C55A 3LTYA 4WOQA 4BFAA 4I7UA 2TYSA 3TAOA 4A2RA 3QYQA 3W07A 4LC8A 3ZWTA 1OFPA 3P61A 3GB6A 3NQEA 5FEPA 1LOSA 3ABOA 3R8RA 4IMGA 1OG0A 4EF8A 4MJZA 2NV1A 4TU1A 5DCBA 4Z08A 1JCMP 4IX0A 2YXGA 4K7YA 1WDWA 4O8RA 3BLFA 5E1QA 5L6UA 2RKXA 1W56A 3P5YA 3MI2A 3W84A 3FFSA 3W1TA 3P81A 3FEMA 3W1XA 3NQDA 1VQTA 1Q3NA 4MPQA 1VLWA 3M5XA 1H5YA 1V5XA 4Z1AA 3DH7A 3BO9A 3LOTA 1L2UA 4IMFA 4LY8A 3PULA 1FQ0A 4LOCA 2R8WA 2VFHA 4EWND 1SU5A 1K7FA 2FLIA 4AVFA 3EXRA 3G8RA 3P62A 4OQVA 1U5JA 1F7BA 1OYBA 4FIQA 4Q33A 3UYCA 2ATSA 4JTUA 1DQWA 4LW7A 1WOAA 4IGHA 1NVMA 4O18A 4AF0B 2CZ5A 3O6DA 4N9DA 3EXSA 4HT3A 3LRLA 1ZALA 1KTBA 5LNSA 2XFWA 3W7RA 5EY5A 5DCDA 5AC7A 4QSHA 2P1FA 2JK2A 1H63A 1W5PA 2BWGA 4JTFA 1QO5A 1LOLA 3HG2A 3L68A 3RLVA 5F2MA 2Y85A 3EWZA 1A5BA 2QCEA 4DO4A 5BNKA 1OFRA 3PUDA 3W3OA 4O12A 1XXXA 2Y7EA 3C2OA 4JEQA 4AMAA 4JY9A 4RZ5A 3E49A 3HGJA 4K8HA 4WY0B 1K02A 3UD6A 3ANYA 4TX9A 2JGQA 3LX9A 6TIMA 3BG9A 3BPWA 1VR6A 1KTNA 1H50A 3ZWSA 1TV5A 3PG8A 1W3TA 1DBTA 1VPXA 4YCOA 5K3VA 2TMDA 3CPRA 1DHPA 4X2RA 1X8FA 2QCHA 2FPYA 2XN1A 3WK0A 4IJBA 1HUVA 2A7RA 4FB7A 4EIVA 4QIUA 1QNVA 4PEKA 3A5FA 4O11A 4BF9A 4BI5A 4KWWA 4M19A 2C3ZA 1VS1A 3GDMA 3T55A 1RV8A 1X7FA 2Y70A 1LROA 3BK0A 4YMZA 1W0MA 4H3DA 1FWTA 4ZQOA 2A4AA 3G1VA 4TMCA 5F1VA 1AW2A 1EWEA 4JD4A 3TXZA 1TPVA 4UTUA 3HQ1A 5CGQA 1I2RA 3HJZA 1OHLA 1VJIA 1XFBA 4FHAA 2Q3OA 3NM1A 3EWWA 2KZHA 1TQJA 2GQAA 1L9WA 3G1XA 3DI1A 3O63A 3LCXA 2C13A 3UWVA 1VHNA 5DXYA 2GQ9A 3A22A 1FWNA 5I3JA 2JKPA 3JS3A 1JVNA 5G4WA 1HO4A 3UY7A 2VFIA 3RNDA 3L67A 2C6QA 2H3DA 4MIMA 1S5TA 2EAWA 1JRBA 1TSIA 1KFLA 3N73A 3GR8A 2ATMA 4CQ9A 4IPJA 4LRSA 4DF0A 3BLIA 1MEIA 4NXSA 3NPXA 3F4WA 1KLYA 2OJPA 3B0PA 3DENA 3I7QA 5DLCA 2NUWA 3TSMA 1LORA 5AN7A 5AB3A 3N3MA 4PTNA 3GVGA 3CT7A 3MO7A 4S2BA 2WKJA 4GXMA 1WXJA 1JRCA 1XDMA 4LC6A 3WJWA 1GYLA 4LV4A 1Q6RA 1ZFJA 4NJKA 3CEPA 5SWUA 1I4NA 3GZ3A 3W6YA 1H51A 1QMLA 1QPNA 4XKYB 3QEZA 4LV9A 3SJ3A 3JRKA 1VGAA 2JKAA 1JUEA 3SGUA 4MZ8A 1TPEA 4XUGA 4UTMA 2VOMA 4XWUA 3GNNA 5AHIA 4O0ZA 4PA8A 1C29A 3IIPA 2B7QA 4QQ3A 4FIRA 4LU0A 1SSGA 1HL2A 2J88A 1CI1A 5U7SA 2CLMA 2WJZA 3EWBX 3BW4A 4WXZA 1SQ7A 5AYYA 3A21A 2Y63A 1LCOA 2DP3A 3GXPA 5FF4A 4O10A 1MEHA 5HWNA 2NX3A 3S0CA 1F05A 1OX5A 2H6RA 1H61A 3G1HA 3O05A 4HPJA 1R46A 3ATYA 3LCGA 4QITA 3MYPA 2WSQA 4WX2A 3B05A 5K4XA 2NZLA 4OU1A 3TMLA 2ZRZA 5HJLA 4KKXA 4UFKA 2C16A 4LVFA 3P74A 4IX2A 1DV7A 4AF0A 1Z48A 2NLIA 3W7LA 3PAJA 4YXGA 3KHJA 1FCQA 1R2RA 3G1DA 3PBWA 4N2YA 2QCMA 2PC4A 2YYUA 4OV9A 1GOXA 3GKAA 4JY8A 2CZEA 3MYOA 3TH6A 3SECA 1PVNA 5I3KA 3SZ8A 1XC4A 1B3OA 3EB2A 3TDFA 4X22A 1H7RA 2GJLA 1P4CA 3OIXA 3QMTA 4UTHA 5CPLA 1B4KA 2NX1A 5CZJA 3LTPA 1Z42A 2OX1A 4RKAA 4WY0A 1NAL1 3C2VA 2C1HA 3T44A 5LNVA 3U2OA 1T8XA 1AL8A 4WJEA 2PRHA 1ZY9A 3LBCA 3R89A 3B0VC 1ZCOA 4UNLA 3C2FA 1G6CA 4MYXA 2YR1A 4R7JA 3NQ6A 1Q45A 4E0CA 4LT9A 4FX6M 3TJXA 4N9CA 1JQVA 3LCHA 1AG1O 1QAPA 4OE7A 3PG9A 1ICSA 5HULA 1EP1A 2WNNA 2GVGA 3HG4A 3IEBA 4IWWA 5G4EA 4DELA 3ZFHA 2Z1BA 1YADA 4DEFA 1SZGA 3W2KA 1T96A 3LXAA 5I3IA 3MI6A 1NF7A 5F2IA 1J5TA 3NL5A 4LVGA 3EWYA 3IVUA 3WJXA 2CZDA 2O7QA 2QCDB 3NPUA 1OYCA 1YDOA 3G1AA 1SFJA 4JYFA 3W85A 4O1BA 1D9EA 3QW3A 1B4EA 1BTMA 1KM6A 1YPFA 4AXKA 1XBXA 4ZQMA 1K8ZA 3YPIA 5F2GA 6ALDA 5LZLA 4O57A 3P8JA 5AFDA 4M6QA 1THFD 3GK0A 1JCJA 5AHLA 4FNTA 2J27A 4UXDA 5I3HA 4RXFA 3QJAA 4UTJA 1W5NA 1G4TA
chains in the Genus database with same CATH superfamily
4NZJA 4MB3A 1XGZA 3KS6A 3W7JA 4OHQA 3TJIA 3FGCB 1GOMA 5IXEA 1QPRA 3O9NA 3N1AA 4XO7A 4FNRA 3OVPA 2JE8A 3EDFA 4DPQA 4LPCA 3PPFA 1A0DA 4FXRA 4EP8C 4GC4A 4D1IA 4PFHA 2DZXA 1VH7A 4L4LA 1K7XA 3W24A 3SRKA 4MOZA 3OEXA 3N4FA 4E8DA 4MWAA 1JCYA 1LM1A 2YDAA 2ZUUA 4ZQPA 1W8GA 3MP3A 3UFYA 4PCSA 1GTEA 3L0NA 2F84A 1JPIA 4GQGA 1ITXA 2UY3A 2OCZA 3W38A 5G2WA 3GXNA 5CKSA 3AYVA 1LWJA 2DZPA 3OW1A 3IRDA 3M4HA 4XD3A 3MWAA 1WP6A 3WH8A 3RJYA 1HVXA 1J11A 1JF6A 3NO5A 4EPDC 2WZHA 4CNSA 4HMEA 4GQQA 2PDBA 1EDGA 2G41A 2CNCA 3TAKA 2UY5A 2Y7DA 4U28A 2HTMA 1CLVA 4RK8A 2OGJA 2QJHA 4NJGA 2PRMA 3H2FA 2VCBA 2VO5A 5CPQA 3CHDA 1PIFA 3QKZA 1XS2A 2Q02A 4B5VA 1VD6A 3WDPP 3K8MA 1XISA 4CN4A 1HJVA 2AOSA 3I65A 2VFFA 2HE5A 4XQ6A 5DT5A 1AH3A 1IWAA 1P0NA 3C5QA 6A3HA 2PTDA 1O94A 1QJWA 3H8AA 3TP4A 1OBAA 4QM1A 2ISVA 5DX7A 2W79A 5EBUA 3C0SA 1LUCB 3K2GA 1QDSA 5JBEA 1A5LC 1S2UA 5C54A 1BFNA 5A6AA 1WXZA 3QR1A 7TIMA 3QRHA 2HCVA 5EYWA 1A47A 3FX4A 3N34A 4QS5A 1CGYA 1HKIA 3CQKA 2WSYA 2ZZ5A 3O06A 3UJRA 1UYQA 3CTTA 3STEA 2BHYA 2TAAA 2CLKA 1TYGA 1QHZA 1GTHA 1SSDA 4BZYA 1XYZA 1W3KA 4JYEA 3CYJA 1LOQA 2WCAA 4EPEC 1W9BM 5D9NA 1VFOA 4Y9NA 4KRZA 4B16A 1DVJA 1HT6A 2OELA 3BJTA 1R9XA 4POCA 8TIMA 3KL5A 3AS1A 3NO3A 3BAIA 3UXLA 4AH7A 4R53A 4K6AA 3CL6A 3WH9A 3AIBA 4FOJA 4JHMA 2ZUNA 3SRFA 3KEHA 3MY9A 1AUSL 2WXDM 4HNOA 3P93A 4LUSA 3W4RA 4K68A 3B9EA 1E6PA 2HS8A 4KWUA 4J9JA 1VBGA 3LV6A 3MQTA 3T0AA 3FGCA 2EPNA 4CQ8A 1TPFA 1OCBA 4W86A 2ADAA 3GU1A 4IGSA 3M0IA 3H2AA 3WUBA 1F74A 1UWRA 3K8LA 1OX6A 5BXRA 1EDQA 1CDGA 4C7FA 4AD5A 2DV0A 3VNZA 2R82A 4WJXA 2RDWA 2E3ZA 3WUFA 3T07A 3EWXA 1TTJA 5ABGA 3O2LA 3GX9A 3S1VA 2C0HA 4LYKA 5EMYA 4F0KA 1PX4A 4IQDA 2C19A 2Y5JA 3WD0A 8CGTA 1JQXA 4Q6XA 1DJNA 1OFEA 3BVJA 1DIDA 4LUTB 4H83A 3AHZA 2ZZ7A 1XDLA 2EHHA 1FH8A 1P1XA 1DJXA 1RAKA 1DXFA 5HOSA 4OBSA 3T0TA 3N2BA 4FLRA 2GSEA 2HMCA 1KB3A 3EMZA 3W26A 3O6YX 2FKPA 4PRTA 1MMFA 4KGLA 3WN6A 1Z6KA 4GXWA 1W5MA 2ZKMX 3AS3A 2WPBA 3RR4A 4G1KA 3M0XA 3CEUA 1R3WA 3P5ZA 5K9DA 4GPNA 2ZC8A 3W29A 3KAOA 3VGEA 5U4NA 4TIMA 1RBOB 2QUVA 1Q7QA 1IHIA 2NQLA 3B0UX 5I07A 3KBJA 3KVJA 2OO6A 2VGGA 5CLWA 4MYAA 3OP2A 1G01A 1GEQA 4TXEA 2QPUA 4AWSA 3N14A 2J9YA 5T91A 3GG8A 2C15A 2OOGA 3WF4A 4PFMA 3SUSA 1LUCA 2ZA2A 3QFWA 1IE7C 4MF4A 3LLDA 2PP3A 5C2XA 3H7VA 2CLFA 3ISIX 4F0LA 1TMLA 4JIEA 4UTTA 4HCLA 5AVNA 4L9XA 4ZOCA 1T0OA 1QASA 3MSRA 3NPWA 5AYZA 2C7FA 3CBWA 4DBDA 2FMNA 3MBFA 1XI3A 4I8DA 1AQHA 3A9IA 3R0KA 4YNGA 3B8IA 1AMKA 1H0GA 3BSMA 3CO4A 4IP7A 2CHOA 2ZICA 3ID7A 3WFAA 2YL6A 3ZT5A 1LL4A 5CBJA 2QGHA 4N4PA 4LANA 3IV3A 4UIOA 2PDJA 3SW6A 5EL1A 5DRCA 1WNOA 4J5NA 2PTXA 3H21A 3B8VA 4JGDA 4AX7A 3S1GA 2YX0A 2PGRA 4ALDA 4JCLA 3DHFA 4DWDA 3SCTA 1A3WA 3EMCA 2VC5A 3LERA 3R8HA 4IJRA 4NZFA 4BHYA 4HYWA 1X1OA 1MO0A 4JZ5A 1FWEC 5FF2A 4LAOA 4R7WA 5FJRA 5IBXC 5GNYA 4PMRA 3C61A 1QNSA 1CXLA 1NFBA 2QDHA 1NEYA 2PTZA 2FTWA 2V3GA 4Y9AA 2VQUA 3RRAA 3R2GA 2WHMA 3WEMA 1XLKA 2B7PA 2CESA 1R2TA 2JGYA 3GDKA 3TCSA 1JGMA 4EACA 4XSMA 2C18A 3W83A 4E5TA 4JTEA 4IG2B 1MDRA 4GX8A 3WDIA 2IS7A 4WLCA 2DU2A 3GH4A 1UD8A 4CEXC 1P1MA 4W7VA 1KM5A 3TK7A 1E9IA 4H6QA 4ATLA 1ITUA 1W31A 1QHPA 4QG9A 3LQLA 3S9IA 2EF9A 3L2IA 3ANUA 4INFA 3MS8A 1PWLA 4LCRA 3FCPA 2UY4A 1W3NA 2QCCA 1QOXA 1LZOA 4A4AA 3NSNA 1VRDA 3LCIA 1SR9A 2OMAA 1LBMA 1R9ZA 4JTHA 5D8WA 4Q6JA 1YDNA 1VLIA 2J7CA 3CUXA 4JIHA 1HJWA 4S3AA 1ZZMA 3VNIA 5C9XA 4U4MA 1FCUA 1CGXA 4LBSA 5FI8A 2G3JA 3O1NA 4A6GA 3SN1A 3CZGA 4BY3A 1MXSA 3L4WA 3WMSA 4WUIA 5FEWA 3DG6A 1LWHA 3MVTA 4I9AA 1EJ7L 5A5WA 1XYFA 5I77A 3SQSA 2POTA 3CIVA 3W7CA 4WKFA 1EF3A 4US5D 3RGTA 2Q3RA 2VHLA 2PEVA 2GUUA 5ECVA 3RXZA 3W70A 1LBFA 1H1YA 4XG1A 1JZ8A 4Q4KA 4PUKA 5F2LA 3NL3A 3IS4A 1DP0A 1X6NA 3ARWA 4QAWA 1ZBVA 3RU6A 2YPIA 4Q8MA 3P3BA 2VDGA 4V2XA 3DI0A 5F4XA 5XIAA 2FGZA 2X2GA 1F6PA 2PDWA 1GKQA 1HJSA 4R9XA 4L9YA 4O53A 4FI4A 3BLKA 2WQDA 4UNKA 2X09A 3AWOA 4G5DA 5CC7A 5LNWA 3PNZA 4BS0A 1TO3A 3DFYA 3U4FA 4JIIX 3THAA 3QSRA 1L6WA 3DXIA 2PU0A 2QW5A 4C1LA 3UZXA 1LF1A 3VUPA 2B0MA 4EPKA 2DUXA 2Z25A 3AJ7A 3QGVA 3VE9A 1PL9A 5HMFA 1XG3A 1V77A 2J66A 3M6YA 3VUSA 4K8EA 5LIXX 3K4WA 1YBQA 3ERPA 3QZ6A 1KQYA 4LSBA 5D9OA 2W67A 1P0KA 3PANA 1MSSA 4LX4A 3EX2A 2QVHA 3NQGA 3N6JA 5D2YA 3CV7A 5EMLA 3JZEA 4HHHA 4AXNA 3W7NA 1RA5A 1AH4A 3BLDA 3MJYA 4IF2A 5AY7A 3SB0A 4IG2A 3HG5A 3OGVA 2TPSA 3ELFA 4F0RA 4E2VA 3K4AA 3L23A 3E0VA 1FDJA 1H3GA 2QIWA 3VKBA 1H62A 5CC6A 1IT7A 2JQXA 1F76A 1OYAA 4ZB0A 2GYIA 4QROA 3UCQA 1Q6CA 3U2ZA 3WFZA 1YX1A 3T1GA 3LLFA 4MWAD 2PDYA 2A5HA 3QH2A 4MSSA 4M6PA 1S3HA 4PB3A 2IQTA 1XLBA 3W6LA 1GYNA 4XIMA 4JS3A 4JICA 4IL2A 2GQ8A 5FCZA 3DG3A 4R34A 1VYRA 2AAAA 4IPLA 4DJFC 3EPOA 5C7VA 3VDHA 3TOYA 1S5WA 3U8GA 1QOQA 4MUPA 4YL2A 1YPIA 5D9PA 4C6NA 2G97A 3GC5A 4OBTA 3VU2A 2Z27A 1HO1A 3ZQ9A 5BMXA 4HK6A 4O52A 4CVUA 4TO8A 1R86A 2WMKA 3IUHA 2PDXA 2CLIA 4HYVA 4GZJA 5CBBA 3TKFA 1ME9A 2A3HA 3KL0A 4KT2A 4PMOA 4I90A 1P6BA 3MUIA 5DELA 4YTRA 1Z69A 3O6CA 3GVVA 2OQLA 4FXFA 1WDPA 3TN3A 3R13A 1ISYA 3A9BA 1GVOA 3LHVA 3ITVA 5D04C 2B7NA 1ECEA 3CIXA 4DO7A 3PNUA 2GK1A 5E93A 3KDNA 3OHIA 3UU0A 2HNHA 4GY1A 2O7SA 1GORA 4OOUA 4FMVA 6ENLA 1HVQA 5FA5A 1OVDA 4Y7EA 1MW1A 1PAMA 3VDCA 5IFPA 4ACYA 4MWAC 3EA1A 3C0JA 5G5IA 4WEVX 2E1WA 1NELA 4W4QA 2Z4GA 4WSJA 1SPQA 4NAFB 1E51A 3KOWA 3K46A 4QLJA 3ICJA 5C5YA 4GZEA 1US2A 4E2BA 1KM1A 2IPGA 4ZODA 3MMWA 3V4BA 3HO8A 2OQHA 4QBXA 4JYDA 3BW3A 3WNMA 2BSLA 3DGRA 3LHYA 4DBUA 3MCNA 1A0CA 4BA0A 4ZE4A 2D73A 1UKTA 3WQDA 2DQWA 5B80A 1EQPA 3GVQA 3GHRA 2WANA 5XIMA 3E0LA 3UWYA 3NVTA 3DN5A 3UR2A 2AKMA 5I3FA 2V3EA 1EBHA 3AUJA 4JIQA 4W8LA 3WJZA 2GVLA 3O15A 4TOQA 1N8FA 3PWIA 1JYXA 1Z7AA 5I23A 4UQAA 3UG8A 3QV8A 3L4YA 4DYKA 4FX7A 1YTDA 3M44A 4PCFA 2VOTA 4HPXA 2FJUB 3V36A 4AZBA 1FWRA 1MNSA 1GQLA 3S2MA 5C6MA 3RG6A 3WEZA 3T7VA 2W9MA 4D6FA 1WCGA 2FFCA 1JYWA 1L6SA 2OKTA 4IMEA 3DFHA 3AIVA 3FA3A 4O1FA 3WX7A 1WXYA 3TYCA 1DQUA 2ANUA 4DHGA 4D8AA 5C9ZA 2J13A 4JL2A 1XCWA 1KCZA 1ZPTA 3H6OA 4KETA 1FOBA 2XWDA 1FWWA 4I9MA 3LI1A 1KBBA 3H4WA 3U7BA 5FF7A 2BGSA 3VMOA 2C0AA 3TN5A 1S2TA 3M47A 4HBKA 5XINA 1ZAJA 4NJJA 3T81A 1H11A 4JCMA 3STGA 3M1ZA 1CXIA 4YYFA 1Q8AA 2EG7A 3UPWA 4CN6A 4IFOA 4L80A 3ZS4A 3UZ5A 4GJIA 1AFSA 3AWNA 3OA3A 1WB0A 4O0QA 1BXCA 3VO0A 5JBFA 2OZ0A 1QR7A 4FXJA 2PE4A 4ICCX 1KM2A 2P88A 3WBYA 4QJ5B 1KQZA 2EGZA 3M0ZA 2QAPA 4ZMGA 3OYXA 4DIAA 3M7WA 4HZ6A 4NYUA 2UWFA 3E74A 2PWDA 4NZ4A 5D30A 3BQ6A 1J9YA 1QVBA 3S4TA 1EJVC 3KP1A 1AMYA 1KA9F 4QCFA 2UY2A 3GDLA 1HIZA 4MFDA 4JFWA 4QCEA 1FDYA 3VIFA 1QNRA 4M5PA 1W5OA 1KRAC 2DEPA 2QZRA 3WJSA 3G0UA 4FR6A 2V9DA 2QJGA 3AHVA 2FHFA 4S3GA 3EKLA 1E9ZB 2J75A 1S3TC 2PDKA 2WZEA 4OTKA 4LALA 1AQFA 3MWCA 3TFCA 1C7SA 3RF9A 1HFBA 5TAOA 1BYCA 1UWQA 5A2BA 2BVYA 2Z29A 1EJTC 1BWKA 2A21A 3AHTA 3A5VA 3L12A 4NAFA 4Q4QA 2GPTA 1KM4A 5CJMA 3RX4A 2VFDA 4AEOA 1QCWA 1EUAA 1UKOA 4MJ2A 3ZLFA 1IEXA 1GOQA 2PLMA 3W74A 5T9BG 2PDNA 1F9CA 2ZVIA 1V3MA 1C7TA 4GO9A 4IIHA 1SM9A 4X9SA 1Q6OA 1CZ1A 1VC4A 4IQLA 4CQDA 1DWFM 3MMTA 5HUPA 4EANA 4MZYA 4E3TA 1JULA 2CZFA 4JQAA 1WOBA 3FV9A 4QXIA 3WH5A 5EMUA 3UJEA 1JJKA 2FGLA 2YDSA 1GQKA 3EA3A 1SFTA 4AWEA 1E4LA 1PDYA 3VA8A 1GOWA 2JF7A 4GFIA 3WQ6A 1T41A 3F4NA 3GNDA 3WK2A 4MAVA 3W1NA 4C6DA 1VFSA 3S6OA 3ZLHA 1ME8A 4DPPA 5LHEA 3HMCA 1UJQA 1JPHA 3BANA 1UUQA 4U2YA 1OC7A 4C6PA 3NR0A 3S5NA 2X1UA 3RPTA 1LDCA 2G3NA 1HL8A 2QUNA 2NT1A 4PGLA 2WSRA 4A8NA 4UTTC 1XH2A 2NLYA 4XZIA 5BWFA 3BAYA 3IGHX 3O6AA 4EAYA 1XGDA 3LCFA 3EGJA 2Z1WA 2PWVA 4Z2JA 2YJQA 1YW1A 2BX7A 3BG5A 4FOKA 1YE4A 5KZEA 4FEZA 3WIJA 4GUHA 4Z2KA 1VF8A 4JTLA 4YHEA 3AXKA 2PMQA 3A3WA 1V7YA 3THQA 1ZAIA 6XIAA 4X9YA 3QV6A 4X60A 1YNPA 2ZUWA 1PX3A 1XCFA 3FHAA 3N29A 5CXPA 2CLPA 4C90A 1XBZA 5HK4A 4BWLA 3EDDA 1K9FA 6CGTA 3CWHA 3LMYA 3GG0A 1CNVA 4C6CA 1TTPA 3OLGA 3WQVA 3PSWA 4U10A 3CZ8A 4ZXOA 2GZXA 5LGXA 3PPHA 4H6KA 4LVBA 1OGGA 2ZA1A 2V82A 4DM2A 1HTIA 3GNXA 4MJ4A 1XUZA 3GZAA 1JYNA 3PUOA 3AXIA 3WLTA 3AAMA 4FLSA 3P84A 3S6TA 5D37A 3CO8A 1E71M 3INPA 2AGTA 3J7HA 2OZ3A 1UBPC 1Q7ZA 1TVLA 2OB3A 1GNXA 2PB1A 2YZRA 2NX9A 3NG3A 4EXAA 4JTKA 3Q67A 3T09A 3UNDA 7REQA 2OSWA 1TV2A 2Z6JA 3HMJG 3GYCA 1MNZA 1RD5A 1LT8A 3LXBA 2Z0IA 1QW8A 4WKAA 4RZBA 4UOQA 2XHYA 2W91A 2ZCGA 3PFRA 4JX6A 1R7OA 4LB4A 1BRLB 1OJXA 1RLCL 1TRIA 3FY1A 3UG3A 1QI4A 4CU7A 2I57A 3A47A 1S1RA 1W8SA 2PLCA 4YWSA 1A4MA 5D9MA 2FZ8A 1XSKA 3F4VA 3TAOA 1V3KA 3ZVHB 4A2RA 4UZUA 2X8RA 1IZJA 2ZE0A 5DMNA 1DJGA 4DZIA 1R3YA 5I00A 5CGMA 1ADDA 1LOSA 3ABOA 4PULA 2QDEA 1OG0A 4PB5A 1TELA 3SN4A 5C9WA 1PXGA 1NP2A 3DG7A 2GSJA 1WDWA 3BMVA 4O8RA 1K1DA 4IHCA 4CU6A 2YIHA 3FFSA 3KCLA 2WCGA 1DHKA 1MW2A 4ZB2A 3W1XA 3NQDA 3NSXA 4PMDA 5CBIA 1VLWA 3M5XA 1DJIA 1H5YA 2X1IA 3K1GA 5LYRA 1V5XA 3UZZA 1CIUA 5BRQA 4B9YA 1W3HA 5JMUA 4H2HA 1FQ0A 4EWND 2J7FA 4AVFA 1QI0A 4O8AA 1F7BA 3KOZA 2ZXQA 1NWSA 5C7HA 2DH2A 4BQ5A 1BPLB 2PI6A 3TC3A 1DQWA 4TX6A 4O18A 4AF0B 4N9DA 3V0TA 4HT3A 2DY3A 3LRLA 5LNSA 1PZ0A 2HISA 4I9TA 4DZHA 3H2CA 2QV4A 1JD7A 2XH4A 2JK2A 1GQIA 5A8OA 2GL5A 1MXGA 1R0MA 2CITA 3HG2A 2Y85A 2E28A 1W9UA 5FL1A 2Y7EA 3WD2A 5CG0A 4WY0B 1R9YA 1K02A 3RUBL 3CB3A 4JFUA 1JEZA 4TX9A 2OWCA 3VZZA 2JGQA 2INEA 2WPGA 1JNDA 1VENA 1LL6A 3KS5A 1AJ0A 3ZWSA 1TR9A 3POCA 1DBTA 2XVKA 1VPXA 1ZP3A 2NQHA 2PWUA 3CK5A 4X2RA 2QCHA 4AZGA 1TWDA 2A7RA 4FB7A 4HHLA 1M03A 4PEKA 1NDWA 4HJWA 2NVAA 4FLQA 3WYZA 3M0KA 1SJAA 3WNLA 1FWTA 4ZQOA 4MTVA 3VK5A 4AD0A 1AW2A 4YHGA 4LB3A 4QQUA 5CGQA 5I09A 1XINA 4YTTA 3HJZA 1VJIA 1XFBA 1GOIA 3KP0A 3EWWA 4XAFA 2GDUA 3NUKA 1XIFA 3ENLA 1EL3A 2OVLA 3WBEA 3BQ5A 3MMUA 2WC7A 3VIIA 2H3DA 4D6HA 3WQFA 1IV8A 1KFLA 1HN1A 3GR8A 3HQOA 3UVIA 3SM0A 4NP7A 3B0YA 4IPJA 4LRSA 3TTYA 3F4DA 4DJEA 3LPOA 3B0PA 3I7QA 1HGWA 4GMEA 4JHZA 1OIMA 4DXXA 3MKKA 3CT7A 4C6OA 4FK9A 2ZIDA 3IJDA 1WXJA 3C3UA 2CIPA 1JRCA 1XDMA 4MG4A 2V3DA 4GNVA 1GYLA 3VDBA 1ZFJA 4A3QA 5SWUA 1PJ9A 2J62A 1H51A 1ZTVA 4XKYB 5E6ZA 4F2UA 2YB1A 3LNPA 1VGAA 2JKAA 3B4YA 4PB4A 3SGUA 4MZ8A 3QHOA 4W7UA 4XWUA 4V1XA 5AHIA 4QGCA 3MV11 4PA8A 3IIPA 2ZXAA 2EG6A 1XD0A 1SSGA 4KEZA 1KR0A 1YMYA 1HL2A 2J88A 4C6QA 3VDAA 2QXWA 3PJTA 2ZXDA 4O10A 4LF2A 4IZGA 3S0CA 2BXYA 3O05A 1R46A 3ATYA 2WSQA 4WX2A 2GDVA 4OU1A 4Z1YA 2OWWA 4LVFA 3RLGA 4XBJA 1AD1A 4S3KA 4AF0A 3TYZA 3W7LA 1WZAA 1UP0A 1TWWA 2BP1A 9RUBA 2BG5A 3ONCA 2QCMA 2PC4A 4HA1A 1GOXA 2O9TA 3GHSA 4GZIA 4CQCA 2CZEA 2ZUVA 3N04A 3SECA 4C5YA 4OECA 2CZVA 4L56A 5M3WA 1X1NA 1XC4A 2VD9A 1EC9A 3EB2A 5A69A 4NAEB 3UZWA 3QMTA 3NCOA 2Q09A 3OOQA 1B4KA 1UMYA 5CZJA 4JQ1A 4WY0A 4NRSA 3GTHA 4GQ0A 3U2OA 4WJEA 1TX0A 1W9PA 3R89A 1ZCOA 1YQ2A 1O1HA 2GGIA 3C2FA 1EF2A 5CC5A 4R7JA 2VCCA 3LEPA 3U48A 3NQ6A 4LT9A 2YLLA 4AZ7A 4DZAA 3AIUA 4OE7A 1XLLA 3EPNA 3PG9A 4F79A 5HULA 3HZ3A 5G4EA 2WNNA 1LWIA 4HA4A 2Z1BA 1YADA 4DEFA 4IQEA 3W2KA 4I6KA 3VC6A 4CD7A 3OBAA 4FALA 1CPUA 3W53A 2WVSA 5C8BB 3AC0A 3E0WA 3NL5A 2BHZA 3CJPA 1Q13A 3IVUA 3B40A 2CZDA 4F4RA 1OYCA 4DAIA 1SFJA 1MUWA 3EOUA 1B4EA 4JAWA 1BTMA 2IKIA 3UG4A 5F2GA 2IKGA 4GVFA 3C86A 4O57A 3ZMRA 4M6QA 2DUZA 3W81A 1M9HA 2WSPA 6XIMA 1JCJA 3WLJA 3BE7A 4RXFA 1XQKA 1S2WA 1REQA 1E5JA 1GYMA 1DWJM 3BURA 4HPHA 1K03A 3CV1A 4QJ1A 1XHGA 3VNYA 1OG6A 3LRKA 2J78A 3UR7A 1E1FA 4JX4A 3A23A 3I6RA 3UGRA 4JTIA 5LKYA 3IGUA 3LHZA 1OF8A 5D32A 4JL1A 4C6BA 3EOSA 4RNJA 1B5TA 4EXQA 4N9BA 5BOOA 4AU0A 4AW7A 3EYPA 3FHQA 5A3HA 3GC2A 1P7TA 5IHRA 3P14A 3N25A 1OFDA 3QKEA 3AXXA 4V15A 1AH0A 1NF0A 4K39A 5M5DA 1XLEA 2CLHA 2E9LA 4J28A 4JTDA 1CXKA 2O92A 4S3BA 2CFFA 1Q65A 3BJSA 4M6VA 3QC0A 2R91A 3LM7A 1G5AA 2XN0A 3TTSA 1J6PA 4D2JA 1DWGM 3P0XA 1DE6A 4DY1A 2DT3A 4GH3A 4GA8A 4C1KA 4NXKA 1X6LA 3H2MA 1WE5A 1V6YA 1J6OA 3R79A 3OHMB 3AIQA 1O4UA 5M17A 4FO4A 2OZ8A 1CYGA 5IDZA 1JDFA 5F7UA 4F48A 3CUZA 1YTEA 4NILA 2H90A 1S39A 2O9RA 3IPWA 1U83A 3GVRA 3EOOA 5DO8A 3GD6A 5GQBA 1JF5A 1G7VA 3XIMA 1J0IA 5D33A 4YVXA 2AQOA 1XLJA 3PP7A 4R88A 4XD6A 3TE9A 3W71A 1MUMA 5GVJA 1BF6A 4I7WA 4PC8A 4W87A 2JIEA 3PJXA 3QMSA 2V63A 3ITXA 2OPJA 1U1UA 3LBOA 2WMIB 1TKKA 2E6DA 3MHUA 4UC5A 4D6CA 3JW7A 5FEZA 3QM3A 3GYEA 1SO6A 2YXOA 3BZJA 4PTMA 1AL7A 3ARQA 3F2CA 3QYSA 2WWCA 2VP8A 1B3YA 3KRBA 3K1DA 3APGA 4J3UA 1XIDA 3VNMA 4PL2A 4CVWA 5HMSA 3BAJA 3LHUA 1GJPA 3ABXA 4RZ4A 1W9DM 1PBGA 2EPHA 2DT1A 1PUDA 3IGSA 3HBLA 3KRZA 1GJWA 1VIWA 2H9AB 2ISSA 2CHRA 4GBUA 5EKYA 4KCTA 3LSCA 5JVLA 4G7EA 2RJGA 4CNPA 4OZOA 1QXLA 1E72M 3WLOA 1J2BA 3VKAA 3GC4A 1A5KC 1K9TA 2PURA 3SRHA 4WSHA 4DBEA 3M41A 3TLLA 3L66A 1BQGA 2PWEA 2X16A 1AW5A 3CL8A 3RK8A 5FESA 2OLAA 4F8XA 3F5LA 1RQHA 4NZ3A 3BV7A 1RR2A 4K1WA 4ZOEA 4TVUA 1ZGDA 2XVLA 1AJZA 1KFKA 4UTIA 1TREA 1ZU8A 1DQXA 3NXFA 2VRJA 4NJIA 2YYTA 3CZLA 4Y96A 4FA3A 4FNUA 4IL0A 3VIKA 3GDTA 1F3EA 3WELA 4MPKA 4X61A 2A3AA 3TN6A 4N7QA 3UBPC 3LCWA 2Y62A 2P10A 4UFMA 2Z28A 1V6UA 1DIKA 4G2DA 2AL1A 3HV8A 3UXIA 1UWAA 4RLIA 4CCCA 2X1RA 3DFOA 4OIFA 2HSAA 1I2OA 4Z2GA 4M1RA 1TWSA 4HPGA 3W1RA 1U22A 3WJYA 4GIEA 4D6EA 1YIXA 5HJYA 4B4FA 2J79A 3WNNA 2OEKA 2PC8A 2VL4A 1RP9A 4O15A 1OD8A 1L0PA 2BOGX 4Y2WA 2ABAA 2QQ6A 1PZ2A 1YRRA 2WV8A 2D24A 3FSTA 4LS0A 4J3WA 1W1TA 4IXXA 5EU9A 5CC3A 3SFKA 4WSKA 4S3DA 4AAJA 2XSAA 4LCQA 1AK5A 4EX4A 1M5WA 2VQTA 2GGHA 3PWAA 5IM51 4BQ4A 3W1QA 4KEUA 1UC4A 4XD5A 4J3ZA 1P5BA 3GY1A 4RDVA 2CLLA 4IQJA 4UMBA 4FXSA 2XU2A 1XKYA 5HJXA 1A5OC 4HMDA 1V0NA 3NZRA 3RM4A 3T08A 1FCBA 1LRTA 5LIUX 2XIMA 2DZVA 1TWZA 4YCPA 4DUVA 1E56A 5C9RA 1TJ2A 4QLKA 4ZEPA 1AJ2A 1DWIM 1KFCA 3BLLA 1ME7A 4GIAA 1GPFA 1YEYA 2X1SA 3DX5A 3FA5A 2GJXB 1MFUA 3KZSA 1B30A 4B92A 2DZBA 4LAZA 1A80A 1KXTA 1SMAA 1OINA 2O0TA 1QU4A 4IFRA 4MJMA 3P82A 3PBMA 2QLYA 2BODX 3HGOA 4L4OA 7CGTA 4RE2A 1TPH1 3F5JA 3CUJA 1BTCA 2JFEX 4EK7A 3CT2A 3U3HA 1OC5A 5LIWX 1RUSA 4H2CA 1GUVA 3M46A 3DFTA 1QW9A 4ATWA 3VCNA 1FXPA 4QEHA 4XZBA 5KSWA 3RX3A 4X63A 4E3VA 3AUOA 5EB8A 4UTWA 1GWJA 5LSMA 5GNZA 3QLLA 4PTXA 1M6JA 4LUJA 1SZFA 3VC5A 2LLEA 3HQNA 3ITGA 1L8PA 3MI3A 5HQEA 2I9EA 1FWAC 2YCIX 1PTAA 1VBHA 4KIRA 4UCFA 5DFAA 1OQFA 2ISWA 4RL3A 7ENLA 3EWUA 3QV7A 4D6IA 3RN6A 2VWTA 1QNOA 5I2UA 4ORIA 4LTSA 4EWJA 4DJED 1F8MA 1Y65A 1IWBA 1OX4A 3QLDA 3ARPA 3VDGA 2QNEA 5KZDA 4PCNA 1VPYA 1TCDA 3NPVA 1W32A 4D71A 3TA6A 1JPMA 5HWMA 3WF2A 4KW2A 5G2IA 1K8XA 3ZJ7A 5C70A 4M7TA 5BROA 2FTPA 4KESA 1GZGA 3P8IA 1N8IA 2HBVA 3WLIA 1SW0A 3TW7A 1CGWA 4JTTA 3HJEA 5ABFB 4UUIA 3RPDA 3WKZA 1X39A 2DQXA 4QTGA 1ISXA 1XL9A 3VI2A 3L2MA 5AYXA 3GWQA 5J8LA 2Y61A 1FFQA 2HVNA 4JEJA 3WQEA 3FA4A 3W23A 2BGNE 3VTRA 2R24A 3NYDA 3VIMA 1AQ0A 3LCLA 1J8VA 1BSIA 3C56A 1R3QA 1FWDC 3VMNA 1XP3A 2BASA 3BAWA 5B7YA 5D2XA 1MRQA 5D05A 4KGJA 3WLSA 1JZ5A 3W7MA 5G1YA 5DY3A 3XINA 4B5UA 3DCPA 1Y8BA 2E09A 4GY0A 2CBIA 1EO5A 1E40A 2NSXA 4LY4A 1UPMB 4AD4A 3W2LA 1S5VA 1FWHC 3NEVA 2GFTA 4JIPA 5H8PA 4O4VA 3L65A 3ZT7A 1FUYA 5HANA 1UZ4A 1V02A 3L0KA 1KW1A 2V5JA 3K30A 2CXGA 3WDRA 2FPVA 1ZAHA 1IEWA 4DO6A 4NYYA 4P8VA 2J6VA 4C1NB 1JAKA 3JVAA 3NDOA 3SADA 2QR6A 3QOMA 3RCYA 3WUGA 4E2DA 2ZRXA 4H7CA 3ZVIA 1A3HA 4QISA 4AY1A 4QRNA 3S3GA 3QN3A 7XIMA 2BXVA 5JIPA 4Y8FA 3M43A 1CENA 1XLDA 4LWWA 2X30A 2RDTA 4WK9A 3WLLA 1BYDA 1CW2A 1B3WA 4FX8A 3Q94A 1V08A 3LHWA 2HK1A 4C6FA 2V2HA 3VNLA 2ZBTA 4QJ4B 2CXEA 4C6LA 3FVMA 4E8CA 1P43A 1JGIA 2HVMA 1EC8A 5DY2A 3RM8A 4Q8NA 1L6FA 1UQYA 3MUZ1 4V28A 2QEZA 4AY8A 5E0KA 4J3SA 2D20A 1FFRA 3WDHA 2YW3A 1UHVA 2YOCA 1PSCA 1W1IE 4GYPA 1UA7A 2E5BA 1XRVA 4X2PA 1ZSXA 2VGBA 2J4GA 3FJLA 1ONEA 3T4CA 1R38A 3VIJA 3WH6A 1VYPX 2O4MA 4L64A 4PMJA 2V5BA 2UBPC 2I7GA 2I1OA 1H2JA 2W0UA 3PC0A 2E67A 4FLOA 4NSBA 4UOJA 3S2NA 5D2TA 4CCDA 3S1XA 4MFEA 4IOTA 4KMQA 3CZJA 3H7RA 1JUKA 5FACA 4NF7A 3W1PA 3WQ8A 4S38A 4JTGA 4GUFA 4EF9A 1VFFA 3GM8A 1CECA 4Q4PA 4ZENA 1UW9A 3S2JA 3TONA 2W4XA 2G95A 2G8ZA 1PKMA 1RALA 3UXDA 3LS9A 3C2YA 1BXBA 5ABFA 1KV8A 3UPBA 4NI3A 3QGAC 3PN8A 2RH9A 1PS9A 2XVGA 1J93A 4H9VA 4IH3A 1TPB1 4H9TA 2J7DA 4DM1A 3A4XA 4NNBA 2ALDA 4IPPA 1UCWA 1QPQA 4XBSA 1XDJA 2E1DA 2NQ5A 5A8MA 4UQEA 2J7HA 3DGBA 1KV5A 2YL9A 1I6NA 3CUIA 4Q7BA 5BCAA 1PCKA 1MWOA 2X1TA 4KIEA 3FOKA 4DWSB 3OQEA 5A6SA 1YLVA 3G77A 1PDZA 2GVYA 4U3AA 1WX0A 1UJPA 1S2CA 4LF1A 3T8QA 3N9RA 5G4HC 3EWDA 4JTAA 1SO3A 5CGTA 3SY8A 1O5RA 1QBBA 3VGBA 5DBUA 4DO5A 3AMLA 3SCQA 1VEMA 2VGIA 1SGJA 3M16A 5D03A 1YDVA 1DL3A 4W5ZA 4GVHA 3THCA 2ISFA 4X0NA 2UZ9A 1HL9A 5IBXA 3U7VA 3I10A 3SUWA 4DUXA 3NWRA 1M41A 4XZWA 2PZ0A 2QCNA 3ZJ8A 3GXFA 2OLHA 2HQAA 2FHBA 5AECA 1D3CA 3UW6A 1WBJA 1YKWA 2Q8LA 3V0SA 3VVGA 3MKCA 2F9RA 5JQ9A 3BOXA 5K9XA 3IWPA 4XZ9A 3NQAA 4S23A 4DXVA 3NO1A 2I9UA 2OU4A 3Q2DA 2INFA 3GAKA 3TQVA 3HPZA 4H1ZA 4BCEA 1QI5A 3W27A 3H2EA 3UXAA 4JNYA 2WZMA 2BMBA 2VUYA 1W3LA 1KBLA 3G0XA 4F3HA 1I0BA 4XX6A 4PMQA 2QF7A 1E0TA 3BAXA 5ECUA 3S9YA 3U6WA 1JXKA 4NASA 1NFPA 2YGYA 1E70M 3KLKA 1B0IA 5BRPA 3KTXA 3T40A 3VIOA 2D0GA 2EQDA 2PTWA 1TUFA 3SSZA 3T2PA 1ML1A 5KITA 1IIGA 2ZWZA 3KX6A 5M03A 2KAUC 2H3BA 3EDJA 3PM6A 2WM1A 2BFGA 3G1SA 3K4DA 2BLEA 2Z24A 3UCCA 1ZUAX 1DTUA 4Z0JA 3CB8A 2PGFA 1HXJA 3GFXA 2XN2A 1K6WA 5E6YA 2DW7A 4O1DA 3AICA 1OF6A 3KZPA 5FSEC 4DQWA 2OYLA 2W5FA 1EYEA 1XH0A 2PCEA 3KVLA 4ZSUA 2Q8XA 3AHXA 3U4AA 5DN1A 1VHCA 3R12A 1M04A 3IIVA 3GTFA 2VT0A 1VYSX 5KZ6A 3R43A 1Q6EA 4XISA 4FAMA 1H0IA 2NVDA 3NQBA 3CM4A 1RVGA 3CUGA 2J9ZA 3WUEA 1XIIA 2VYOA 5IOBA 3NTYA 1ITCA 5J5RA 3VD3A 5CZTA 1BWLA 4GD0A 3T4WA 9XIAA 2NQ9A 3ARRA 2WSKA 3NJ3A 1NP0A 3EX4A 3HM7A 1OD0A 4WF7A 3MVIA 4MB4A 3DHDA 3AIEA 2VFGA 3H55A 3PZMA 4PTWA 4PUWA 1RPKA 3CQJA 3LGDA 2J8TA 1QTWA 4DWSA 4PH6A 2VZUA 3SURA 4ZCWA 1XLAA 5CCZA 1RJPA 2J47A 1J0KA 2J6XA 1P0BA 2CC0A 3HU7A 2PDGA 2R1KA 1SJCA 2BVDA 1WDSA 3OPSA 4AIOA 2W6RA 4QFUA 3UGVA 1JPDX 3CAWA 4KH2A 1LQ2A 2ZQ0A 5DXXA 1DWHM 4P8UA 4UTKA 3LDVA 3QF0A 1TR1A 1ENUA 3SO7A 1NWTA 3B9OA 4JN6A 1EJXC 3L4TA 3NDZA 1KD0A 3TA9A 2VXNA 3H24A 3O07A 2ZFAA 1EBGA 1KXQA 2O9PA 3EDEA 4GRSA 1ONXA 1TJPA 2E6YA 3LGEA 3WQ4A 2ZTJA 3G5EA 1NSJA 1B57A 3W7PA 3BXWA 4PUDA 4AWTA 4L6DA 5FKYA 3ZR4A 3TOPA 1O68A 1W1B1 4DYJA 2ZX9A 4U33A 3ALFA 4GQBA 4LYQA 1KWGA 2D2JA 4L7ZA 1C93A 2XPKA 1BVZA 3IVSA 1IEIA 2XSXA 1P48A 1TZ7A 5HA7A 1VFTA 2QAFA 4I8YA 3N9SA 1O95A 4L1GA 4WQ6A 1F8IA 3GLCA 1YHTA 1YNQA 1QNQA 2OXNA 4GHRA 1XYCA 1FWIC 2E5CA 1EHNA 1W1A1 4D72A 3S5OA 3CWNA 1UWUA 3VOIA 3H2NA 3MP4A 1JZ6A 4WVXA 3BLOA 3VZXA 5K4ZA 4RNFA 2JF6A 1XLFA 1T40A 4DJFA 4NVTA 4PUUA 1V3HA 3W7IA 2X05A 7TAAA 4DNMA 2D0FA 3WL0A 1F3XA 3CS2A 2G96A 4WDTA 1LBLA 4N02A 1UKPA 2Y6ZA 1DYSA 2P3EA 4DJDA 4JFVA 5IRPA 4YJ5A 4AYSA 1OY0A 1XYLA 4WKHA 1VFHA 4GO8A 1DJQA 4R27A 4ERIA 3B4UA 3N4EA 1G9HA 1T5AA 3FN9A 4JDYA 4H19A 4H00A 4U3CA 3CAVA 3KL3A 4E6MA 4MNMA 3TWAA 2FPTA 4K1GA 1XBYA 4K38A 1CEOA 4ZTXA 3M5ZA 3NGFA 1H7NA 4KFOA 3VE7A 4H7VA 3CUHA 1WZKA 1YXCA 1SO4A 1A5UA 3ITLA 1YYAA 3S6DA 1YTKA 2OWXA 1DKWA 2RFGA 3SR7A 3NURA 3Q37A 3CC1A 4NJHA 3P2VA 3OZPA 1L8NA 3IJ6A 2PD9A 3BMWA 3RIKA 3EX6A 3BL3A 3OTRA 4IMCA 3U57A 4PTVA 2VDHA 1NWRA 4O28A 4ZZ9A 4L65A 3HN3A 4KCUA 3E1F1 4M1BA 3E9AA 1EZ2A 1JZ2A 5CSSA 4ASTA 1QPKA 4CUCA 2AMXA 2WHKA 4YS1A 2VX4A 4UTWC 4NT0A 2DORA 2WJEA 3AI0A 5I3GA 3ARYA 4KWSA 2HPIA 3UNTA 3NEHA 1IR1A 1YDYA 4IMAA 3IJQA 1PO9A 3Q65A 1N55A 3Q58A 1ADSA 4DBWA 1RCQA 3FS2A 5BXPA 2NXGA 3AROA 4O4WA 1NQKA 4TTUA 4GH1A 2AAMA 3G1FA 1E1CB 5H2ZA 3HOJA 4WXYA 4PBEA 4HKPA 1WAWA 3ANVA 2G37A 1RBLA 1UA3A 1PHWA 3SSJA 2OGYA 3N2MA 2EEXA 2IMRA 1QPOA 4QEEA 2AQVA 2G50A 3L5MA 3CV6A 3VGFA 5H6HA 3HF3A 3GNRA 3DEQA 3AYTA 4O1EA 1QI2A 3KBNA 3FAWA 5C55A 3LTYA 4I7UA 2PGWA 1H41A 4HHMA 4LC8A 3BDKA 1OFPA 3GB6A 3NQEA 2HBXA 1GVEA 4NL1A 5FEPA 1IT8A 3GDBA 3ZO9A 3ORWA 4MJZA 4C6EA 5ENLA 4ZBCA 4H9UA 4GI9A 2E0PA 4DX3A 3FAXA 2PDCA 1XGEA 4C5ZA 1EGZA 4A8RA 1ELSA 3FDKA 2WK2A 2WMFA 3WDQA 1L2UA 4HTYA 3TYBA 3HURA 1R87A 3PULA 4JN8A 3LPGA 4LOCA 1HP5A 2EPKX 3EXRA 3G8RA 3B8WA 2XM2A 3WMLA 3M0YA 2EKGA 1UD5A 2E7FA 1CXEA 4Q33A 3UJ2A 1C3FA 3UYCA 2ATSA 5I03A 1H4PA 4PEEA 5AC4A 4W8AA 1NJJA 4F2TA 4K2SA 1ZJHA 3O6DA 1MYRA 3EXSA 1XCXA 1MW0A 5FAJA 5DCDA 1E6QM 3A4AA 4MADA 5AC7A 1U5HA 4CU8A 3EKGA 3WF3A 2PD5A 1QO5A 3ITCA 3L68A 2Z26A 4LBRA 2G3IA 2QCEA 1RK5A 3R94A 5BNKA 1IZCA 3PUDA 3EDKA 4B5SA 4O12A 1IQ8A 4GCAA 2Z00A 3WNPA 4UQBA 3ANYA 4YU1A 2BNJA 2YBUA 2EO7A 3LX9A 1XLCA 3BG9A 2P5NA 3BPWA 1KTNA 1H50A 4QDMA 3OVGA 1DPMA 1W3TA 3RU8X 5K3VA 4Q8UA 1DHPA 2DSWA 2XN1A 4EIVA 4KEVA 3A5FA 4BF9A 4GYPC 2C3ZA 1VS1A 1RV8A 2C8NA 4AG0A 4YMZA 4H3DA 2A4AA 4PBGA 2YL8A 3WQ5A 4JD4A 3A12A 3HQ1A 4ZGYA 1E1CA 1OHLA 3ZYZA 2Q3OA 4QR6A 1FHUA 1TQJA 3I3EA 3O63A 3LCXA 1VHNA 2GQ9A 2HJPA 1F4AA 3A22A 1FWNA 3GTNA 2J7EA 3WCZA 1JVNA 3UY7A 3KBMA 2VFIA 3UYIA 2FZDA 4YIWA 2J7BA 4DVOA 5IDIA 1TSIA 2XVPA 2ATMA 3U0HA 3AYRA 4DF0A 4G56A 1MEIA 1QT1A 3F4WA 1KLYA 3NPXA 4AD2A 3DENA 1PKLA 2GDQA 1XLGA 1A49A 2GUYA 1LORA 5AN7A 1S2AA 3GVGA 2WKJA 4AC7C 1RJRA 4LC6A 3ZT6A 3D6NA 1XQLA 3WJWA 3CEPA 3GE7A 1W1PA 1I4NA 3QR3A 1QMLA 1QPNA 7ODCA 3CQIA 4LV9A 3SJ3A 3N2OA 5HMDA 3V5CA 3GQYA 4ZO8A 9CGTA 4PR4A 1JUEA 4XKMA 1XFCA 3DDMA 4DUOA 4Z2LA 4CNUA 4O0ZA 3A6OA 1TZZA 4QQ3A 4FIRA 1C90A 3USZA 1GHSA 5FJIA 1SQ7A 4J4KA 3A21A 2Y63A 2DP3A 5AZ0A 1MEHA 5HWNA 1ZB5A 4J2MA 1BAGA 4N42A 4RPQA 3LCGA 2NZLA 3VPLA 3TMLA 5HJLA 4KKXA 1GCYA 3VGGA 3II1A 5MF5A 4IP4A 1Z48A 2NLIA 3KHJA 4KBXA 1FCQA 2W61A 3G1DA 3TVAA 2XZ9A 4OV9A 1E6XM 2QMJA 3GKAA 2VZOA 3H26A 3TTQA 1ISZA 2V5DA 5BYWA 3B8TA 3I6TA 3MYOA 3QTPA 1PVNA 1GVYA 3G6MA 3SZ8A 5LA2A 1XC6A 3TDFA 1H7RA 2GJLA 2FVKA 4S3EA 4ML4A 1FHVA 1PKYA 3N6QA 3QVQA 3O3RA 4PMNA 1EX1A 3MB9A 1T8XA 4LUTA 3B0VC 4UNLA 1PTGA 3SCPA 4TUFA 2BGQA 1KCLA 3TJXA 3BLPX 4N9CA 1JQVA 1AG1O 5FAGA 3FDGA 5FD0A 1RP8A 3U5UA 1Q7MA 1ICSA 4CD6A 1VPQA 2QS8A 4DELA 2X0SA 2JIWA 4EAMA 4G9PA 3ZFHA 4S3CA 3SFWA 1SZGA 1E4IA 4D8ZA 1TFVA 1Y5VA 4DWSD 4ZTYA 3BAKA 5F2IA 2CYGA 1J5TA 3REQB 3K5XA 3ZM8A 4AZHA 3EWYA 3WJXA 3TNBA 5DF0A 3CHFA 4D6DA 3Q4DA 3ES8A 4O1BA 3TZNA 4W5UA 4HZMA 1KM6A 1YPFA 1XBXA 2OKOA 4G1NA 3WBAA 1PZ1A 4IGMA 2OR2A 3N13A 4BEUA 3LN3A 1V03A 3AU2A 3QJAA 4AD1A 1NOFA 3DIPA 5DQPA 4GKLA 2XVNA 1RCOB 1X1ZA 4YPJA 4Q4SA 3R8GA 3TSDA 1E15A 1D3GA 4RPPA 2QCGA 3M5YA 5A8NA 1EP2A 1FVPA 4H7ZA 1JUBA 1E0XA 3FJNA 5KMYA 3DU0A 1W5QA 4JTSA 4XZHA 1PIGA 3E0FA 4HYRA 4Z42C 1A53A 2J24A 1ISVA 5E09A 4KS0A 1W6TA 3T2QA 3BCJA 3LY0A 1W1ZA 1FH9A 3AXHA 3FNDA 2HDJA 2WWDA 1P0EA 1ZBWA 4D1JA 1OC6A 2FB3A 2YA2A 4DWSC 3G8EA 1W17A 1YNYA 3PR2A 2DJXA 3TROA 2NXHA 1CB7B 4IIFA 4ZL1A 4HTBA 2AMGA 4J7RA 4S3FA 1Q2SA 5FEXA 2DGAA 2VCAA 3FKKA 3LB0A 1KFJA 3AMDA 3H4XA 2P0OA 3WEOA 4GACA 3EXTA 1JD9A 2QIIA 3R11A 2CHNA 2OFJA 1U5VA 2EBNA 2I5QA 4DJFD 3MBDA 3OJGA 3VYLA 4RXGA 2WC4A 3S5ZA 1V0KA 3QHMA 3WO8A 4NU7A 2NWRA 2V30A 2ZADA 2F38A 3C0LA 1ZS2A 3N2XA 1R2SA 3GIPA 4DJDD 2OX4A 2YCLB 4XBKA 2WW5A 1BSLA 2YFOA 1K9DA 3AALA 3WQCA 3PUEA 3N9KA 3W2JA 4Z17A 2QYGA 3IUIA 4LUYA 1LRNA 4M56A 3EB3A 1XYBA 3S42A 4B5WA 5GJMA 1FWGC 4C6IA 2NUXA 1UR1A 4U5KA 1O12A 5CSUA 2ZVRA 2Y8KA 5EGRA 2XFFA 1Z41A 4Q3MA 3WH7A 3GO2A 4IP5A 1IXQA 3WLKX 3PWGA 5A8QA 2CBVA 4ZO6A 5L9FA 1HJUA 2CU0A 3F2DA 1CGVA 3AS0A 3IACA 4ADUA 3A3XA 2ZZ4A 1U1HA 4HJFA 2R14A 3VGDA 3ECQA 2Y8UA 1IT0A 2DJLA 1IEVA 3W7QA 3NVDA 3REQA 2ZRVA 1J0HA 4GXPA 4GCXA 4D6GA 2FIQA 2D2HA 3W2UA 3LYEA 4RZ6A 1RBAA 1XRTA 3IAPA 1X6UA 4PSPA 1RZMA 3PB2A 2PAJA 4O0KA 4OFCA 4UR8A 5HWJA 1MZRA 2IXVA 2WO5A 3FJ6A 3GR4A 2QF8A 4U2ZA 3IUDA 2X7VA 3VD4A 3TW6A 4UB9A 5CSRA 1NOUA 1V3JA 4DJDC 4DF1A 3CL7A 1FWFC 2FVLA 1N2VA 4ICMA 3UERA 4PMYA 1M7OA 5BMWA 3TEVA 3T78A 3TJLA 4PUMA 7PTDA 3GIYA 1PV8A 2NW0A 1LT7A 3R5EA 1GVFA 5I79A 3GU9A 2GGEA 1TJ1A 4H6RA 1LYXA 2VX7A 1V79A 3LQGA 4HNLA 6TAAA 4KCVA 3QW4B 1PTDA 4LH8A 3PBUA 2HROA 3EMQA 2ZZ1A 1HKMA 2O56A 1SW7A 2V5KA 5A6LA 4PODA 1GQJA 4A21A 3VD7A 4WY0F 1UWTA 3MA8A 1HKWA 3CQ0A 4W9TA 3QY7A 4YN5A 3C0QA 1P0DA 3LI0A 3OU8A 4RDWA 2F6XA 1E3XA 3JZUA 1R3RA 1W3IA 2JBMA 2WC3A 3CLMA 3B97A 4UFLA 3M9YA 5PTDA 4P8XA 1WUEA 3M6DA 1ODUA 4W84A 3W7EA 5FL0A 2R9RA 1KO0A 3G1RA 3V75A 3WL1A 4AWUA 3F03K 2ZX6A 1EPXA 4GJJA 3NZQA 1IZKA 1FH7A 4QS6A 4AC1X 3TCEA 2C1IA 2F6UA 2YCLA 2OT0A 4H8VA 1WO2A 3G18A 1VBJA 3HGRA 2ACUA 2ONEA 3PTDA 1YXYA 2XSBA 2WVVB 4UMCA 3SI9A 1ESWA 3LBMA 1JCTA 2PGEA 5KTLA 3LGGA 3HA1A 4RDYA 1I45A 1I8JA 5I78A 1FHLA 4YYCA 4O1CA 3WBWA 3HB9A 4JQ3A 5HNRA 4FNPA 1O60A 1GVRA 1UD3A 1UBSA 1OT1A 3PTQA 3QBUA 3TFXA 2YB4A 2L5HA 1WAUA 2PBGA 3N4AA 1FBAA 1GVSA 3RDKA 3T2OA 4B91A 2WZTA 1JAEA 4FF7A 4AY7A 4ICNA 1UD2A 3L4ZA 1VJSA 2J9XA 4Q32A 4GQRA 3WD3A 1HQTA 3S2CA 1HNYA 3WF0A 1CT5A 3ZZ1A 1AD4A 3NQCA 3VKDA 3I3BA 3QZEA 3NOEA 5G1TA 3UF9A 2HRWA 3GIQA 1XYMA 3PS7A 1AZ1A 3WMCA 5LIKX 3WQGA 5DMLA 4C91A 4O14A 1YPXA 2MUCA 3CIWA 2FGBA 2WBKA 1B1YA 2F8QA 4J3VA 1ALDA 2WM0A 4TQTA 3U2EA 1C92A 1I1XA 4O50A 1XBVA 1TE1A 3GBDA 3I6EA 3QQ0A 2Z2UA 3B0XA 1WDRA 1T99A 4QG6A 3OIHA 3VAVA 1SUXA 3F5KA 2V6AA 2Z1KA 3EB4A 3CYVA 3VCRA 1I2PA 1UC5A 4RJEA 3AJXA 4GUIA 4X3ZA 2POZA 2NUYA 1XIEA 3OVQA 3CHEA 3BSGA 1Q6GA 4X0VA 4ONVA 3ABSA 1BG9A 3R6IA 3OYZA 4H4IA 2A7NA 2VURA 3RHGA 4ENLA 1SFLA 4PZVA 2VEKA 3VMPA 2VMFA 4A3YA 4XTIA 2HPMA 1Q6LA 4LFYA 1L6YA 2QJIA 5HUOA 3TZFA 4O13A 1Z32X 3GS6A 2F61A 3KBWA 3KTSA 4A8IA 4RCXA 4Q7IA 5JXQA 1EQCA 1QOPA 4GUJA 1XPYA 3NL6A 4B2DA 5GPRA 2VI0A 1O1ZA 3WK3A 4XO6A 2D23A 2VELA 4UCGA 3SBFA 4UQ9A 1RXOB 2PP0A 3U2CA 1UMLA 3V0UA 2X2YA 3W1MA 3G1YA 3QPYA 4EVZA 3HV9A 4ZO7A 2WHJA 3N11A 1E3ZA 3DFSA 2EPMX 2YCKX 2G4JA 4BQ3A 3LV5A 2PZNA 1EEPA 1VAHA 3QY8A 1WDQA 2PF0A 4CEUC 3WQOA 1TV4A 3NL2A 3DOPA 4HA0A 2O55A 2DH3A 4IUGA 2A7PA 1A5NC 1JDDA 4P2VA 4JKMA 3GXIA 4MDOA 5HNUA 3WD4A 3DYOA 3KWSA 3OVRA 2OSYA 4H9ZA 1HKJA 2QDGA 1EXPA 4NKCA 1VCFA 4WOZA 4PCTA 1EP3A 4OUIA 1WKDA 5I3DA 3T0CA 3A24A 1UH2A 3CMFA 3MSDA 4AB4A 4XUYA 3PZUA 2BV9A 3OZOA 3VKCA 3NZPA 1XM3A 2WKGA 4C65A 4R33A 2CETA 3TX9A 5ABHA 4XSLA 1CWYA 3CHVA 4K3ZA 1K77A 3BH4A 3W7GA 2RAGA 5CH9A 3TV8A 1QATA 3W7OA 4M51A 4AZCB 2XGIA 2IQ0A 3FLUA 4Q8QA 1J4EA 2X41A 2GGJA 1POJA 1NDZA 4U31A 1DE5A 1M01A 3GBEA 3MPGA 1LRQA 4ZQNA 1UUOA 2F6KA 4O54A 4JOMA 5DANA 4L4MA 2P53A 1G0CA 2B81A 4M3PA 4Q4OA 2R6OA 1RPXA 3UR5A 4AZIA 3V18A 3DFPA 3LPPA 3CV2A 2I5GA 4GI4A 5JH1A 3KTCA 4RNIA 3OG3A 2XM1A 3RX2A 4N6FA 2Y89A 1TZ9A 2CERA 3AFBA 3E96A 3QC3A 3ARXA 4LGXA 1ZLPA 2BOEX 3QXBA 3B8UA 5GJNA 2ZZ3A 2W27A 1GG1A 3D46A 2DSVA 1S38A 5H91A 5C71A 1VCGA 4ZQCA 4NZ1A 4B15A 3WLNA 3L0GA 1E0VA 1G1YA 4EOUA 1Q6QA 3SIZA 2FDSA 4QHRA 4E38A 5A1AA 4REQB 1BGAA 3R25A 1K4HA 8RUCA 1PZ3A 2ZC1A 3D47A 2QCFA 6REQB 1TTQA 1KXVA 2E77A 4PUNA 3RYSA 3WSUA 2NV2A 3UA4A 5AC8A 3P6LA 1UD4A 3P67A 3TC6A 1UZ1A 5HR7A 4K7VA 1LP6A 4G8TA 3RPMA 3D3AA 1TV7A 3OGRA 4OGZA 4BEQA 4BI6A 2RDXA 2V38A 3ARVA 1XPGA 1CXHA 3DBPA 1JI2A 1JG9A 4GWEA 4ZVJA 2A3CA 3ALGA 4NUWA 3MZNA 2XUCA 3LHTA 1EOKA 2CKRA 3MUAA 3PBGA 1ICQA 4L1WA 2XINA 1VBRA 1CX9A 4NX0A 3NQVA 3KE0A 3AMKA 1IIHA 4LXFA 1OCJA 1PX8A 4N9EA 5BWAA 2GSHA 4MM1A 1KCXA 1TPUA 2NV9A 2A79A 4PUJA 3XISA 4OUEA 2Y0FA 5LNUA 2HEJA 2O4QA 3L4UA 1KM0A 2DIJA 4O1AA 4RUBA 3EOLA 1V7AA 5BZAA 1TUXA 1A5AA 4HOXA 1LG2A 2YSWA 1G67A 2E6FA 2TSYA 1Q66A 3NQFA 4OKDA 4LEQA 3EX3A 3A4JA 2WVTA 4YTUA 4ERAA 2RHGA 1TPWA 4N4QA 1FKWA 2Q01A 4HB7A 1F6KA 3W25A 4C6KA 1LLOA 3BLEA 4WD0A 3BG3A 5ABTA 1IXPA 3GFZA 2ABBA 1KBIA 5K9CA 4AZCA 1QFEA 3ME3A 3D3FA 5K7JA 3VZYA 1EHAA 3H70A 3CH0A 4FP1A 4UFHA 1EJWC 2ZYFA 3TUUA 3W28A 3VIHA 1Y0EA 3K13A 2QUUA 2WMHA 2OO0A 4OJYA