5AHMA

Imp-bound form of the deltacbs mutant of impdh from pseudomonas aeruginosa
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
378
structure length
354
Chain Sequence
MLRISQEALTFDDVLLIPGYSEVLPKDVSLKTRLTRGIELNIPLVSAAMDTVTEARLAIAMAQEGGIGIIHKNMGIEQQAAEVRKVKKHETAKAKTYPLASKDEQGRLRVGAAVGTGADTGERVAALVAAGVDVVVVDTAHGHSKGVIERVRWVKQTFPDVQVIGGNIATAEAAKALAEAGADAVKVGIGPGSICTTRIVAGVGVPQISAIANVAAALEGTGVPLIADGGIRFSGDLAKAMVAGAYCVMMGSMFAGTEEAPGEIELFQGRSYKSYRGMGSLVPEGIEGRVPYKGALSAIVHQLMGGLRAAMGYTGSADIQQMRTQPQFVRITGAGMAESHVHDVQITKEAPNYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
publication title Crystallographic Studies of Two Variants of Pseudomonas Aeruginosa Impdh with Impaired Allosteric Regulation
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Oxidoreductase
total genus 112
structure length 354
sequence length 378
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5ahmA00
1KM3A 3G3DA 3RMJA 1FCBA 1N55A 1W37A 4LS2A 2VC6A 1JQXA 3GDTA 4OV4A 2DZXA 1TJRA 1FDZA 2YDAA 4CCCA 4DPQA 1K7XA 3LCIA 2PURA 3TV8A 4IX2A 4U28A 4Y9AA 4XTIA 1J2WA 2NUYA 1DQWA 3VI2A 3QFEA 2QUUA 3NEVA 4TO8A 1IXQA 4P2VA 2YYTA 1QMLA 1H1YA 1H51A 1FWNA 3W7DA 1XBXA 2GQ9A 2QKFA 2YW3A 1Z48A 2I1OA 3B05A 3QMRA 3G1AA 3PBWA 3VE7A 3I7SA 4EF9A 3EXTA 4N2YA 1QOPA 1XM3A 4GJ1A 5LHEA 3D0CA 3JRKA 1G4EA 1C8VA 5D04C 4ZVJA 4MUZA 1QPQA 1RV8A 3Q58A 1TPVA 4HSNA 4DF2A 3NQGA 4DPPA 4BI5A 1LCOA 4Y8FA 3GKAA 3PR2A 3CT7A 3W2UA 1YXDA 4O16A 3UWQA 2QJIA 3M47A 1XUUA 4MY9A 1GG1A 4FO4A 1VCGA 4FNUA 1QWGA 4RX0A 4RLIA 1I8JA 1F05A 5AHIA 3SW6A 3WK2A 1KFJA 1IF2A 1ONRA 1FCVA 3BK0A 4UC5A 2GUUA 3W23A 3W2JA 1EWEA 4MVAA 3S1XA 3W9ZA 4A2SA 1T99A 5D03A 1TO3A 4P61A 3NQDA 3F03K 3GAKA 2ZRUA 1K8YA 3LXAA 2CU0A 4HNTA 1QPRA 1LRQA 2X1UA 2VEMA 2KZHA 2Z6JA 4JR5A 4FNRA 2QF7A 3I7RA 3ZFHA 1AW2A 4UTTC 1XKYA 4JIQA 1GYNA 3S5OA 2VEKA 1DQXA 1A5BA 4UUIA 1PL9A 4AF0B 3E49A 4JY9A 2ZCGA 1VCVA 1L2UA 3ABOA 2PRLA 3NL5A 1LOQA 4N4PA 3R2GA 2YYUA 1R30A 3G24A 2DU2A 3DFTA 3G3MA 3HOJA 4LT9A 3OVPA 1VZWA 1H50A 4XKYA 5CGQA 5I3KA 4WX2A 3W1TA 3LM7A 4NNCA 3DI0A 3LCGA 1JCYA 3B06A 1TV7A 5LSMA 5AHMA 3LV5A 1W5NA 2LLEA 3DXIA 1D9EA 2NV2A 4GNJA 5EKYA 4YCOA 2DZPA 3BLFA 4RR4A 3C6CA 2NLIA 3OG3A 4MZYA 1F74A 4FEZA 3L0NA 4MY1A 1A5CA 3IEBA 3QSRA 1HTIA 5U4NA 5MHBA 4LVBA 1D3HA 1O60A 3QW3A 5D2XA 5TIMA 3O8AA 1R47A 2YW4A 3EX2A 3BV4A 2NXHA 3BW4A 4OU1A 1C9DA 4M6PA 4MKNA 4M5PA 4JD4A 1I2PA 3GZ3A 2O7QA 3KRZA 3CB8A 3GYEA 4YL2A 1TTJA 3PF3A 1IGSA 1V5XA 1T0OA 3ELFA 2ZYFA 4HKPA 3M44A 1AW5A 3ABQA 1KFKA 1EP2A 1YYAA 3BGJA 3NM3A 1ICPA 4UFKA 3W1NA 4WOZA 4JX5A 3W7PA 5KTLA 4FB7A 5H91A 1ZFJA 1KTBA 2QDGA 3MHFA 5LNRA 4RK8A 1JCJA 4U4MA 1J4EA 3FKRA 3O6DA 1RZMA 4K37A 4R34A 1W8SA 2ISVA 4MYXA 4K7YA 3PAJA 1FXPA 2J27A 1Q3NA 1OFRA 4DO6A 3W1QA 3W2NA 5LNWA 3INPA 4AMAA 1DKWA 2D73A 2A6NA 1I45A 2DJLA 4LTSA 2HTMA 2WQPA 4Y6GA 1P5BA 1NF0A 3LI0A 2FB2A 3S1UA 4MFEA 3DI1A 4LC8A 3B0VC 3EX1A 1K7FA 1LYXA 3MP5A 2VEPA 4I9AA 3OA3A 3AO0A 3TCEA 4HNUA 2QUVA 1S5VA 4X9SA 3GR7A 3TUUA 3O06A 5FF2A 1GPWA 3UXAA 1KM1A 1WV2A 2WNZA 5LGXA 4O11A 2NUXA 3GNDA 3P5YA 2JKAA 4WY0B 4WJEA 1T8XA 3FKKA 5EMUA 5FEXA 3LB0A 1A5AA 1QO5A 2W79A 3A23A 4JTKA 3NL2A 3QSTA 2WKJA 3U6WA 3M5VA 4QQ3A 1O4UA 4MYAA 5T26A 4FX6M 1VYRA 1QDSA 1SFJA 4JN6A 5G2IA 3PUOA 4IXHA 3SR7A 4K38A 3NQ7A 4O0ZA 3CHVA 1VRDA 4UTUA 2C19A 3HPSA 4WXZA 5HMSA 3GDLA 5LZLA 3C61A 5FEZA 3QH2A 1OHLA 2GOUA 4GXMA 2J9YA 4O53A 4O50A 1YPIA 4UTLA 1QCWA 4PA8A 4Q4KA 5K4ZA 4N4QA 1LM1A 3R89A 1F5ZA 3KX6A 5I3IA 1EPXA 3F1QA 3W7NA 2C6QA 1TV8A 4S1FA 4DO5A 3P8IA 1YDVA 3QM3A 1ZAJA 5CZJA 3UZJA 4Q32A 3C4UA 3NQFA 1PS9A 3NQVA 3LTPA 4Z1AA 3OVRA 1BWLA 1XBVA 3L0GA 3RNDA 5E1QA 4E2DA 3M5XA 4LY8A 1K02A 1LTDA 1SW3A 2FPVA 3S5YA 3UPWA 2EKCA 4JTGA 3W1MA 4Z0SA 3OEXA 1EEPA 1ZAHA 4JTHA 4IMDA 3QC3A 3UNDA 3B03A 4LV9A 1SPQA 1I2QA 4O8RA 3RLUA 4NNAA 4RXFA 4JX4A 3M41A 3GXNA 5AHFA 3IVTA 5J5RA 2X16A 3KVJA 1RQHA 3CWOX 2CZDA 3TJXA 4O13A 2I9EA 3DFSA 1KV8A 5DY3A 2B0MA 3EX4A 4ZQNA 2EAWA 4WQ6A 3IVUA 1WBHA 2GVLA 4K8HA 4JTTA 2BZNA 4UNKA 3W1UA 3ANYA 3MI3A 3QQ1A 4NZJA 2V30A 3HGSA 2VFEA 2Y7EA 5BOOA 1FY6A 4UTKA 3O1NA 4AHPA 1SO3A 1EIXA 3LTYA 1HFBA 5K2ZA 3O6CA 3PUEA 4ICNA 3A9IA 3P82A 1JULA 4A22A 2RFGA 1G4TA 4ALDA 3H54A 2F7FA 3L65A 5HUOA 3H55A 4UFJA 7TIMA 1TREA 4JDBA 5HWMA 5EY5A 2Z6IA 1PHQA 1PVNA 3G0SA 3NPUA 5DELA 2A2IA 4UTTA 2V9DA 4NQ1A 5EA9A 1I2OA 3LRLA 2ABBA 2ISWA 3S5ZA 4KFNA 4O57A 4WD0A 3EKZA 4WXYA 1KFEA 2BXVA 2Y88A 3G18A 2E6YA 1OFAA 4TR9A 1RD5A 2ZZ7A 4QNWA 3LCFA 4UIOA 2V81A 2Y70A 1F6PA 3TSMA 1SSDA 3C2OA 3QJAA 3HGOA 5K3VA 2DZWA 1GYLA 3MI6A 4M19A 3UZ5A 4MLRA 1JJKA 1E51A 1FDYA 3NQEA 1UB3A 4M6VA 3TK7A 5C54A 3S6DA 1TPEA 1A5SA 5LKYA 1XDLA 4EF8A 4MJMA 4A2RA 2RDUA 4JTEA 2FJKA 2CLFA 1ICSA 4NXSA 2Y61A 1B4EA 4GUHA 5D2TA 3IIOA 1OVDA 4TMCA 1QFEA 4UXDA 1KM6A 4LVFA 4O1CA 1K7EA 4I7UA 3M6YA 1IXOA 4LVAA 1KM4A 4XQ6A 3TDFA 4B5NA 5AYXA 3A5VA 4FNSA 4XTDA 3DFOA 2A0NA 4MIMA 4UFMA 4NXKA 1GTHA 2FIQA 4MOZA 5U7SA 3U2OA 5AOUA 2V2DA 3PSWA 2Y7FA 3V75A 1TIMA 5D09A 4M7SA 1HO1A 1OF6A 2BLEA 2NWRA 4XBSA 1OFBA 3MJYA 3EWXA 1T96A 2G5WA 3S42A 3C52A 3NPVA 4GRSA 1VHCA 4Q33A 4ML9A 3STCA 2VEIA 4OT7A 3C8FA 2X30A 5G2WA 4Z0JA 2A7RA 3LTSA 1SZGA 2HSAA 3MHGA 4ZQOA 3CWNA 4PL1A 2CZFA 4J9JA 2A7NA 2B4GA 1SO5A 3EXSA 3FOKA 5HQEA 3HG2A 3SGUA 2C3ZA 5DXYA 3VKJA 2NV1A 4N6FA 4ORMA 2E68A 3THQA 3SY5A 3C2VA 1HUVA 2YFNA 4HPJA 4JYEA 1PHWA 3QQ0A 4N6EA 1BEUA 1NF7A 2HS8A 4JYFA 1X1OA 5K9DA 3W75A 2WSRA 3O16A 2QCCA 1DJNA 1XDMA 2GQ8A 5CZSA 3O15A 4JXCA 1OFOA 3G1XA 4JTLA 5I3JA 5FESA 1Z42A 1TMHA 3W7EA 4UFLA 1S3HA 5I3FA 3ZWSA 1WX0A 2P1FA 1KW1A 4RKAA 1EP1A 3HPZA 4FF7A 2G96A 4ZQMA 1MZHA 2Y62A 3V1PA 4QM1A 3FYPA 3S5NA 2B7PA 1M5WA 4AF0A 3TIMA 1MEIA 2BSLA 2NX9A 1FWWA 3CIWA 3NQAA 1H7OA 3TAKA 3PC0A 1G4PA 5CSRA 3PVFA 5HWJA 4AH7A 4XWUA 3TSDA 1OK6A 4IPIA 4O28A 4N9DA 4DBEA 3LHVA 2G97A 2TMDA 5EYWA 3W76A 3DU0A 3LBMA 1ZY9A 3NR0A 3PBYA 1DBTA 3S0CA 3CPRA 3HG4A 3P67A 3HF3A 2QCEA 3GXPA 2A85A 2VFHA 3W1AA 4DF0A 5G1YA 3NQ2A 3GX9A 3TQVA 4BF9A 3LDVA 2YSWA 3DH7A 5CPLA 1R2SA 5E0KA 2X1SA 3NA8A 3P61A 3W7GA 4FIQA 1EP3A 1W56A 2OJPA 5CKSA 3DFNA 3JR2A 4RZ6A 3LLDA 4Z1BA 1VC4A 1YTKA 2WNQA 4NUWA 1UUOA 3CU2A 2Y7DA 3NQ8A 1YTDA 2V2CA 2ZA2A 3L0KA 4NNBA 1GVSA 2ZRVA 3FA5A 1H63A 2OCZA 4DQWA 1XCFA 2EHHA 3NNTA 2E6AA 1DORA 4DBDA 4BK9A 2FPYA 3WJWA 4IMEA 4YWIA 4UNLA 5FEWA 2H3DA 3ZS4A 4ORIA 4QSHA 3IIPA 2YPIA 1OG0A 3EWZA 4YCPA 4O1BA 3CIXA 4MZ8A 4UMAA 3CQ0A 2E5BA 1LOLA 4KWVA 1MEHA 1JUKA 4NJIA 4BWLA 4K36A 3NOEA 3NZ1A 1AG1O 1ZJIA 1OX4B 1H60A 2I14A 5CZTA 3GDMA 2V0TA 3W7MA 1OX5A 4RV8A 1XL9A 4IXXA 3SIZA 2PCQA 4TU1A 5LNUA 4RJEA 3EXRA 1EUNA 1LBLA 4FNPA 2C16A 1Q6LA 1W5QA 3NO5A 4H6KA 3HIJA 1G7UA 4UTWC 1SO6A 4LS0A 5KINA 3NL6A 4OHQA 1VPXA 2QR6A 3N73A 2CLIA 2ZFAA 4GFSA 5LGZA 3HGJA 3LX9A 4ZL1A 4NZFA 4FNTA 1KBJA 4UR7A 4BR1A 1YLVA 3SI9A 1K03A 2H3BA 3C2FA 2RDWA 1UUMA 2WJZA 3W70A 1WDWA 2ALDA 4WY0A 3RFAA 1MO0A 2AGKA 2DZUA 1IIGA 2CLLA 3W3OA 1MEWA 2OT1A 3G1SA 3LLFA 1JVNA 4NJHA 1NAL1 2XN1A 5SWUA 3LXBA 5D2VA 4DF1A 1FX6A 4CNOA 1LROA 2V5BA 3PY2A 4MJZA 4K7VA 2B7OA 4BI7A 2ZDRA 2WNNA 2E1DA 3NG3A 4QISA 3NAVA 3T40A 2JGQA 1D3GA 1JCXA 1TPUA 2VKZG 3HO8A 3P81A 3GNNA 1VH7A 5G5IA 1PV8A 3BG9A 5DCDA 1F76A 4IWWA 4NX0A 1W54A 1PE1A 3W1RA 4LUIA 4WY0F 4LW7A 2NX3A 3I6RA 5K9XA 2QAFA 2CLOA 5DCEA 4O4VA 4O10A 5IBXA 1W3TA 5K9CA 3I7QA 5BMWA 3TH6A 2A6LA 5HWNA 2AQWA 4NJKA 2X1RA 4LRTA 3QYQA 4QJ1A 4GUJA 1XC4A 3TJLA 4H4IA 4IMGA 3IV3A 3STEA 2PRMA 4JY8A 4LS1A 2QCHA 2QCDB 5C2XA 1L6YA 4IX0A 1NSJA 2ISSA 3TC6A 3KRUA 2ZRWA 3TQKA 1IXNA 2FPTA 5CG7A 3G1DA 4AXKA 4MPQA 2QJGA 4O12A 1LRNA 4JICA 4XZ9A 3UY8A 3E12A 3DGRA 1JCNA 4UMCA 1ZHAA 5AC6A 3HB9A 3FJLA 2FTPA 4UTJA 3HJZA 1ME8A 5H2ZA 5AHEA 2ZZ6A 2A1YA 4K39A 1JUBA 4S2BA 1P0KA 1WA3A 5TQLA 3MBFA 4BI6A 1THFD 3C2RA 1UBSA 4Z1CA 3TROA 1BWKA 3W07A 2YZRA 4JTJA 1DJQA 1N8FA 1FDJA 3TW7A 1K8XA 3DFQA 5D2YA 3H53A 2UV8G 4IQLA 1F2JA 4DXVA 3EX3A 1XBYA 1H7NA 4A21A 3C0JA 1YXCA 3DFPA 4AHOA 2FQIA 4IMFA 3A5FA 3LHUA 4EWND 3QZEA 4QAIA 1GVQA 4RCXA 4H3DA 5AC8A 3VNDA 3W7HA 2HMCA 4FIRA 3TX9A 5F2LA 4Z1DA 1YXYA 1GTEA 1GOXA 1XUZA 4AVFA 3QPZA 4MLJA 2J24A 2Y6ZA 3I65A 4PL2A 4E2BA 3GK0A 3U8GA 2J9ZA 3UWWA 4NX5A 3ATZA 3EEGA 5I3GA 3LCWA 1QR7A 1RQEA 1QPNA 4N9BA 2P10A 1L6WA 4BWLC 1JCMP 5D30A 2QAPA 4HIBA 5F2GA 3PSVA 1Z44A 4I7VA 3T78A 5E93A 2E5CA 2TRSA 3M1ZA 1GWJA 4PODA 5A5WA 3GKFA 2CLMA 1VCFA 4JTSA 2C14A 3B0UX 3N34A 1OFQA 1LBFA 2J9XA 2FFCA 2ATSA 1PIIA 3BO9A 5FF7A 2WO5A 2CWNA 4AB4A 3WFAA 3S9YA 4LV4A 4LUJA 4NJJA 5ABTA 1L6SA 2ZTKA 2Z1BA 4GUFA 1ZAIA 5KSWA 3SZ8A 4D2JA 3KXQA 2VFGA 2YGYA 1G6CA 1GVOA 1H7RA 1VLWA 3ABSA 3M5YA 3PB2A 1F73A 3LV6A 5AHNA 5K4XA 4K8EA 3P84A 5HR6A 1FWRA 3G0UA 2Q3RA 5BMXA 3M7WA 4E38A 4M6QA 3P7YA 5BRBA 3W7KA 5G4EA 2WSQA 3UWUA 1ZENA 2QCGA 1SW0A 4MY8A 1KFLA 3MWAA 3FEMA 2VOMA 1ADOA 4L4LA 3ZR4A 1X8FA 2EF9A 3UWVA 1SQ7A 4ONVA 3ZWTA 2JBMA 4OGZA 4GWEA 3Q2DA 3P8JA 5L6UA 3TSBA 4HHPA 5D33A 2F84A 5IM51 1CX9A 2FDSA 3QEZA 4UTWA 4AAJA 3W7RA 4JIPA 5C5YA 1PCWA 4TX9A 3L21A 4L4MA 5G1TA 1MSSA 3EWBX 4QNEA 3W84A 4DELA 3NM1A 3UPBA 5CPNA 2VELA 5IBXC 2BWGA 2Y85A 1TTQA 3OVQA 1KM2A 2EPHA 4NT0A 3IGSA 2R8WA 4FXRA 3G1VA 1IXPA 5F2MA 3B0PA 1EWDA 1P0NA 3UYCA 3W86A 4GE8A 3LERA 1AK5A 3W1LA 3F4WA 2VXNA 3MI2A 2CZEA 1I2RA 2OZ0A 3DBPA 3MHUA 3W74A 1SFLA 1TPWA 2QCMA 2G95A 1TRIA 3BGGA 1KTCA 4JGDA 3VCRA 3BARA 1OF8A 3WK3A 3GR8A 4LWWA 3LCHA 2OX1A 3MP4A 2E77A 1EX5A 4LNYA 3S8HA 3PG8A 1W5OA 5HJLA 3TU9A 2X2GA 4CQ8A 2A5HA 3VFLA 4FNQA 5AHLA 5CSSA 4UTMA 4HPXA 3P80A 2JKPA 1G7VA 4IJBA 4CQAA 3STGA 2GPTA 5G4WA 5F1VA 4ADTA 3WJXA 5DCBA 2OT0A 1XFBA 4M7TA 3DHFA 4LU0A 3TQ0A 2PC4A 3QW4B 1VYPX 1ME7A 3USBA 3LGEA 1SSGA 1HO4A 2YFOA 2Z2UA 1P4CA 3A24A 2YCEA 4O4WA 5BW6A 3GAYA 5F4SA 1TSIA 3BW3A 1TTIA 1LOSA 3B04A 1VYSX 1YDOA 3LHWA 3TFXA 3GVGA 1I4NA 3MBDA 3CEUA 4AWSA 4N02A 4CCEA 3W72A 1QOQA 2Q8LA 2Y89A 5AC7A 2W6RA 3FYOA 3L5AA 1TQJA 3W2KA 6ALDA 3VE9A 3PG9A 2YXGA 1M6JA 3HBLA 2E6DA 4IMCA 5LNVA 3M5ZA 1FWSA 1GQNA 1EB3A 1VHNA 3L5LA 1LORA 3LCLA 3G8RA 5HINA 3L68A 1DHPA 3IIVA 2JK2A 1JRCA 1NVMA 2A4AA 5C6MA 3E0IA 1VR6A 2ZZ2A 3CM4A 5AYZA 5DBTA 2ZZ5A 3PWAA 3G8EA 1JQVA 3NQMA 1KFCA 2A7PA 2NX1A 4KFPA 3O63A 1IIHA 2VFFA 1CW2A 1OX4A 2ZA1A 4CNPA 3T44A 2V2HA 3FJ6A 4GC4A 4RZ4A 2QDHA 3S1WA 1H7XA 4K6AA 4PH6A 3EWYA 1GJPA 1B4KA 3IRDA 1FBAA 3NZRA 3E9AA 4OBTA 1KA9F 4XBKA 3TAOA 5D37A 3TR2A 2VFIA 1OFDA 3LHYA 3FS2A 4C1LA 2EGZA 3W7CA 2QCFA 3B4UA 4AEOA 3GB6A 4KKXA 3JS3A 3UWZA 4LVGA 4X3ZA 1SZFA 3PBVA 1ALDA 4WOQA 2V8ZA 2WPBA 3Q37A 1DV7A 3FFSA 2YX0A 3QMTA 5KITA 3W7JA 1SUXA 1FXQA 4CLMA 3KVMA 3THAA 4GBUA 1KBIA 3YPIA 2C18A 3BPWA 3G22A 3BLIA 1ZCOA 4MFDA 4X2RA 1XI3A 3BW2A 3BVJA 5GVJA 5F2IA 2O7SA 3PS7A 1GT8A 2CLHA 4JDYA 1OX6A 3KAOA 3IVSA 2H8XA 5L9FA 5HUPA 3W2LA 1X7FA 3N2XA 1HL2A 3NPXA 4QIUA 3T55A 4ZZ9A 3F4NA 1VJIA 4KFOA 3UXDA 2R94A 3TW6A 3L2IA 3NDOA 1TPC1 4I7WA 3HG5A 1SU5A 5DY2A 5F4XA 3UY7A 1YPFA 5EL1A 3FLUA 2ZRYA 1GVRA 3TXVA 4EIVA 1W3NA 4UTIA 3KVKA 2H6RA 4QITA 2H8ZA 4UTHA 3W7IA 3G1FA 2CLEA 1TPFA 2GJNA 1GVFA 6TIMA 3C3NA 1SR9A 1TJPA 3GDKA 4EVZA 1CI1A 1AW1A 4UFHA 3TKFA 3LCXA 1G69A 2ZQ0A 1H62A 5BNKA 1Q6OA 4PCFA 3LHTA 4O1AA 4O19A 3PM6A 1KLZA 4O14A 4LVDA 1W5PA 5CZ0A 3N19B 4HNVA 2TSYA 2QCDA 4FXSA 4POCA 1TYGA 4AWTA 5D38A 1WOBA 2GVGA 1DVJA 3N2MA 3S1VA 1K8ZA 3RF9A 2BTMA 3L5MA 3W73A 4CNNA 4FHAA 3WJSA 4DEFA 2H90A 2NWSA 3P62A 2NXIA 5HR7A 2C0AA 1QO2A 3CLMA 3P60A 1FWTA 1RPXA 4ZQPA 2ZA3A 1Y0EA 1JR1A 1FCQA 5KZMA 3MO7A 4FX8A 1K3UA 1G67A 1OFPA 1Z41A 5EPDA 1WAUA 2IQTA 3TMLA 4IUOA 1X1ZA 2B7QA 1VS1A 3LOTA 5D32A 4CQ9A 5G2HA 3L67A 1F7BA 1M7PA 5D02A 4JTIA 3NYZA 5LNSA 1A53A 3GIYA 5AFDA 3DAQA 2ZRZA 2Y7GA 5DBUA 1DL3A 2DORA 1YADA 4IOTA 1LP6A 4IPJA 3R8RA 2E6FA 2PE4A 1SO4A 3SSJA 1Q6RA 3LRKA 4RXGA 3EB2A 1H61A 4XKYB 4O54A 2DZSA 1GEQA 1QNVA 5DLCA 3NGJA 1L9WA 1R46A 3MUXA 1AL7A 2DJXA 3MYOA 4O15A 1W3IA 3PUDA 3DKLA 3AJXA 3BG3A 2NXGA 5TBOA 1KV5A 4PC8A 1OYBA 2A21A 3M43A 1MXSA 2NUWA 3RU6A 3LI1A 1G4SA 3W71A 5LHFA 3DENA 3N9RA 3N9SA 1NEYA 1AL8A 1U83A 3MW7A 3LRMA 3OIXA 1KTNA 1SZNA 3TA6A 1QPOA 1DOSA 2FLIA 2YR1A 3B8DA 3A21A 3TC7A 1LDCA 3IIXA 4UCGA 5EBUA 4HT3A 4IGHA 2C1HA 3PBUA 4Y90A 1EA0A 4Z08A 3E96A 3STFA 1H1ZA 1WOAA 1W5MA 1B57A 2V82A 2Q3OA 1WYIA 1LRTA 5KZDA 3K30A 2R91A 3BLEA 4ADSA 4OV9A 4JTUA 4HNNA 3W85A 3GDRA 2ZZ3A 2B7NA 4GUIA 3IIZA 1ZALA 1O94A 1LZOA 4X22A 4O1DA 5CPOA 3FIGA 5D2WA 1M7OA 3ATYA 1JRBA 2WSYA 4N9CA 3NL3A 3P74A 4A29A 1R2TA 2DZTA 5FF0A 2QCNA 3W1XA 1KM5A 3W6YA 1GZGA 4ADUA 4JEQA 5FF4A 3W2MA 4YMZA 3NQ6A 1UCWA 3E02A 1JUEA 3W88A 3UWYA 1S5WA 2CFFA 4PTNA 2GQAA 3MP3A 2BX7A 1H7PA 4FX7A 1Q6QA 1P1XA 3L66A 1R2RA 1J5TA 4DO4A 4WZHA 1WXJA 4NU7A 1TV5A 5FF3A 2C13A 4PEKA 3EX6A 1TRDA 3DHDA 4E0CA 3TE9A 1JCLA 2RDTA 3RLVA 1SZEA 4HN4A 1FCUA 2CZ5A 3LBCA 4NVTA 4TIMA 4PFMA 4UR8A 3M0ZA 3TMQA 5AB3A 3I68A 2Q8ZA 3R13A 4LRSA 3SGZA 2ZTJA 1O5XA 2RKXA 2DZVA 5AN7A 3W7QA 2Z0IA 3LHZA 4OQVA 4N9EA 3GLCA 3HPXA 2ZBTA 3BG5A 3DKJA 1SW7A 5A8GA 3W7LA 3HQ1A 4OE7A 2R14A 3CTLA 1U5JA 5KMYA 3QPYA 3NPWA 1LBMA 4WUIA 3PULA 4ZQCA 1RQBA 2TPSA 2ZZ4A 3G1HA 1FQ0A 1ML1A 1TPH1 2W0UA 1BTMA 3M9YA 5KZEA 2J88A 2JGYA 3O05A 5HNRA 3W87A 2VFDA 1TCDA 2VENA 3N3MA 2ZZ1A 1W0MA 3QRHA 2Y63A 4JNMA 2CLKA 3KFTA 4G1KA 5K7JA 4NJGA 1H5YA 4MZ1A 1KFBA 1YTEA 2GVJA 2AAMA 4JTFA 1UJPA 1AMKA 3R5EA 3SECA 4YLWA 3MYPA 2DP3A 1VQTA 4UFIA 3L9CA 3NVTA 1OFEA 4JS3A 1QAPA 4JX6A 1O5KA 2XFWA 2P0OA 3TNOA 1RVGA 3MMTA 3O07A 3QF0A 3R12A 4O17A 2X1TA 2V5LA 1TQXA 3KRSA 1ME9A 1F6KA 4AWUA 2HS6A 1W31A 3WJZA 3SFKA 4R33A 3KVLA 1A50A 3CC1A 3LXCA 2ABAA 5HULA 3GXTA 1TPB1 4AHQA 3SJ3A 1V7YA 1N7KA 3EWUA 3M16A 5FEPA 2FB3A 4A3UA 4R7JA 1LLZA 2QEZA 1XBZA 1Q45A 4O18A 5C55A 3W7OA 1B3OA 3WK0A 3QMSA 3HGRA 2PRHA 5D05A 2QJHA 3UD6A 4ZMGA 4TMBA 5FI8A 1WBJA 4C1KA 3C56A 1TB3A 2WV8A 3ABRA 1OYCA 2TYSA 1OABA 2C15A 3WJYA 2E09A 3T4CA 8TIMA 1UASA 1OYAA 4GUGA 4O52A 2QCLA 3EWWA 4YXGA 1EUAA 2ZRXA 3TXZA 2RHGA 3KHJA 4S2CA 4KWWA 1C29A 4LOCA 3O6YX 1TTPA 3N14A 1O95A 1OJXA 1NFBA 1PCKA 4Y96A 3HG3A 1VGAA 1I2NA 1LLWA 3T7VA 3Q94A 4EOUA 1RR2A 3NXFA 3IGXA 2QUTA 1BKSA 4R53A 3G0XA 2NZLA 3TFCA 1KM0A 5AYYA 3W1PA 4BFAA 2CW6A 1OK4A 2ATMA 5I3HA 4W9TA 2GJLA 3W22A 1VLIA 4XUGA 1ZNNA 5DXXA 1W1ZA 3DZ1A 4OWGA 4LC6A 1KLYA 3EKLA 1X6UA 1H7WA 4HSOA 1XXXA 2E5DA 3C2EA 3KOFA 5F1UA 3IGUA 1YDNA 2J6XA 2XN0A 1FUYA 4UMBA 4RZ5A 1B9BA 3A22A 1WQ5A 5F4WA 3P5ZA 1S5TA 5CPMA 3WK1A 3UQNA 3W83A 1GG0A 3OHIA 4CCDA 3CEPA 1ICQA 5J5DA 2XN2A 3NQCA 3RK8A 4O0KA 3HMJG 2JKEA 2RH9A 5DN1A 4JYDA 1HG3A 2OMAA 3G1YA 1TPDA 2WOQA 3OBKA 3PB0A 4ZQRA
chains in the Genus database with same CATH superfamily
1UA7A 3UZWA 1PJ9A 1XYCA 1JQXA 1GORA 1VB9A 1JF5A 3U5UA 1FDZA 2WVUA 4DPQA 4D6JA 4U28A 3DG7A 2VX4A 2BP1A 1NOFA 2VCAA 1DQWA 5FJJA 3BMWA 3BAXA 4TVDA 1H1YA 1H51A 1S3TC 3W7DA 1XYLA 1XV8A 3KL3A 4L5ZA 5LHEA 3D0CA 3PNZA 3JRKA 2D3LA 4MUZA 1UQZA 1RV8A 3NQGA 4BI5A 4I8DA 4L6HA 3PR2A 1IYXA 3W2UA 3M47A 3CIVA 3TN3A 1GG1A 1Q6GA 4FO4A 4FNUA 1QWGA 4XAZA 3TJIA 5CBJA 3WK2A 1KFJA 2WVTA 1A5MC 1IF2A 2QYGA 1FCVA 2QJMA 3UESA 2Z1WA 4A2SA 4E2OA 4JQ4A 1TO3A 4P61A 3NQDA 2G8ZA 5BYWA 5IRPA 3LXAA 2A3LA 7ODCA 1QWKA 3ME3A 2VUNA 1EKOA 4PUWA 3ERPA 3I7RA 4XD4A 2PGWA 2BY3A 2EEXA 4C6OA 4UTTC 3B8UA 2PWUA 4E8GA 1W9UA 1A5BA 3GG8A 1BAGA 1H1NA 3WLRA 2QZRA 4J3XA 1XH2A 5EFDA 4AF0B 1OZMA 2PDHA 1WKEA 1X39A 1YBQA 1Q2SA 3R2GA 4NYYA 1KNWA 1R30A 3VGFA 3LZ3A 3E2SA 3GBEA 2GWNA 1V03A 2WMKA 3OVPA 1VZWA 4WX2A 2DSZA 2OR2A 4PTXA 5ABGA 1GYMA 2V5KA 4HK7A 3DI0A 2PODA 1JCYA 1O68A 1TV7A 1CGTA 1A5OC 4GNJA 2WCAA 4YCOA 3SCWA 4WGXA 4E8CA 4MY1A 1A5CA 1FHDA 2F9RA 3QSRA 1HTIA 5C9RA 4LVBA 1D3HA 4M29A 3QW3A 1PTDA 1YQ2A 3EX2A 4IIHA 1MVYA 3RGTA 3MTWA 1SYTA 4M5PA 1MW0A 2V63A 4NI3A 3S2LA 4DJFC 3GHRA 3FW6A 1AQFA 4RE2A 3GYEA 3FAXA 4YL2A 1IGSA 1V5XA 1OINA 3L4UA 2ZYFA 4HKPA 4NHVA 4REQB 1AW5A 3DUGA 4DJFD 3RJXA 3NM3A 1ICPA 1QI4A 4JX5A 2OGJA 1VBRA 3QOMA 3KL5A 5C7VA 1ZFJA 1KTBA 2QDGA 3QR3A 1JCJA 2I17A 4W7VA 1IT8A 4E6MA 2Z24A 1UD6A 1RZMA 1W8SA 2D23A 3BLDA 4CVUA 1FXPA 3W2NA 3INPA 4AMAA 1OC6A 1NDYA 4S3AA 2D73A 2CXEA 3IJLA 2BV9A 2DJLA 4LTSA 3UR7A 2HTMA 5CJNA 1P5BA 3LI0A 2FB2A 3TZFA 2GGGA 2FVMA 4MFEA 3CV2A 4RNJA 1JI2A 4LC8A 5EMMA 3B0VC 4CUCA 5AYBA 3FGCB 4IJRA 4URIA 2VEPA 4I9AA 2WJEA 1NOWA 1S5VA 3C3UA 3QZAA 3O06A 5FF2A 3HFTA 2W67A 4WKFA 4NZ3A 1BD0A 1X96A 3CXOA 3LB0A 3MV11 1QO5A 3CO4A 2QW5A 5G2IA 2QF8A 4IXHA 1WZMA 1TZ9A 4PBFA 4UZUA 5CLWA 3HPSA 2PS2A 5LZLA 2WHJA 1J0HA 4C1NA 2J9YA 4GO9A 4UTLA 2E4TA 2YZ5A 3L12A 3F5KA 5K4ZA 1MDLA 4N4QA 1F5ZA 4D9PA 3PJXA 3SCSA 4AZHA 1JI1A 1XCXA 3W7NA 4L6OA 1TV8A 4YN5A 1OCQA 4DO5A 4NKCA 1YDVA 3IK4A 2PDXA 5HNNA 3EAUA 1ZAJA 3QTGA 1C7SA 3UZJA 3RCYA 4GA8A 4MMWA 3MCNA 1PS9A 3NQVA 3LTPA 4Z1AA 1UWIA 3OVRA 1XBVA 4WRHA 1LQ2A 3R79A 1W2PA 1UKPA 4LY8A 1WXZA 2FPVA 4YPJA 4DIAA 3UJSA 1ZLPA 3K4AA 4ZB0A 2WC7A 3VC6A 3OEXA 1EEPA 3URQA 4IMDA 1KXQA 4GH1A 4LV9A 4NF7A 3NSNA 1I2QA 2CKSA 4JX4A 5RUBA 3MVIA 2VC9A 3FNDA 3P6LA 2GJXB 2HXTA 1EHNA 2YDQA 3DYMA 5AHFA 3IVTA 2X16A 2CZDA 1BF2A 1E0TA 2X40A 3BANA 3Q67A 2PZ0A 2QLYA 4XZHA 1E6PA 3F5JA 3IV8A 2J8FA 1FWEC 4RV3A 4WQ6A 1XH1A 3IVUA 2FH6A 2HVOA 2XGBA 4UNKA 3LQGA 1P6CA 3TJ4A 1QBAA 1XLLA 5JBEA 5A8PA 2B31A 5BOOA 4IPLA 1X8CA 4WSJA 4FXJA 1EC8A 3GTXA 4JQ3A 4ATDA 5K2ZA 1HL8A 3PUEA 3ITCA 3A9IA 1TUFA 1EL3A 2HV5A 1G4TA 3IUIA 3H54A 4I9MA 5FJRA 1MW3A 2F61A 2ESCA 4C90A 2VVSA 3L65A 5HUOA 3H55A 4FAMA 5HWMA 1Z69A 2WM0A 5EY5A 3KZPA 2HK1A 2OEJA 4JFWA 4R85A 3NPUA 5DELA 3EBVA 4Q8QA 1A47A 3VMPA 2ISWA 3S5ZA 3UJEA 4EACA 4HJWA 4WD0A 1VPQA 1UR9A 2OLHA 3ZLHA 2QPSA 2OYMA 4CVWA 1OFAA 4TR9A 1RD5A 4M80A 4QNWA 3R11A 3ZSSA 2V81A 3ZJ7A 1F6PA 3C2OA 5C9ZA 3NJ3A 2W92A 3HGOA 4L9XA 4WKHA 1RVKA 2AKMA 2YDRA 4JZ5A 2DT2A 1EYWA 2ACUA 3MI6A 1JJKA 5IOBA 4MTVA 1TPEA 4D6EA 1B30A 3IJDA 4LYQA 1XDLA 3GH5A 4FA3A 4JTEA 3GDBA 1ICSA 4NXSA 2Y2WA 4UXDA 1KM6A 3IAQA 5H8MA 1BYCA 2PDCA 4I7UA 3CHEA 3LY0A 4UCFA 5C0QA 5MF5A 4UFMA 4J3SA 4NXKA 3B0XA 5U7SA 3MS8A 3U5YA 1Z89A 1Q6FA 2Y7FA 4M7SA 1OF6A 1OFBA 3D3FA 3FY1A 6TAAA 2G5WA 3UU0A 3S42A 3FV9A 3T2PA 1VHCA 4Q33A 3UBPC 4J28A 1XISA 1NU5A 1DP0A 1VEPA 5G2WA 1XIFA 1SZGA 4QS5A 1J96A 5CBBA 3MHGA 3PAOA 2CZFA 2ZX7A 3KOWA 3VKJA 4L6DA 1Q65A 4ORMA 4AD2A 1HUVA 3VYLA 3CUJA 3PBMA 3EMQA 4P8UA 2WHKA 3W6MA 1CNVA 1IEIA 2Z28A 3CQHA 4JYFA 4H9MA 5K9DA 3S9ZA 1POJA 5CZSA 1QNQA 5HBFA 1BG9A 1Z42A 4GBDA 1EJVC 3OG2A 3XINA 4NP7A 5GJPA 1GOMA 1S3HA 2E9MA 4RKAA 1EP1A 3UEQA 4ZQMA 3S5SA 1MWOA 3V1PA 4PSRA 3FYPA 3UP8A 3TIMA 2FH8A 1FWHC 3EZ4A 1XRVA 3SQSA 3F4CA 2BSLA 5C8BB 3PC0A 1PWLA 5HWJA 4AD1A 4O28A 1NOUA 3H4XA 3CWHA 3LHVA 2TMDA 3LGDA 3R43A 3CAKA 1JF6A 3DU0A 3CAVA 3PBYA 3K46A 1ZBVA 3GXPA 2A85A 3IJQA 4CQDA 1J10A 3V36A 1KQZA 3TQVA 2WM1A 1KR1A 5CPLA 2BXZA 1XIGA 1R2SA 1CLVA 3NA8A 2RGMA 2Q8XA 1W56A 5BXTA 4RZ6A 3LLDA 1VC4A 2ZX6A 2GOKA 1EF3A 5AZ0A 1OSEA 5JXQA 2ZRVA 1UWAA 1M1BA 1MDRA 4RNFA 2Y8VA 3OZOA 2Z1SA 4DBDA 4WVXA 5AY7A 2PDKA 4AZ7A 4Z1YA 4UNLA 5FEWA 4DZIA 1XRSA 5I79A 3OBEA 4HU4A 4ORIA 1AJ2A 3WD0A 3VIIA 1M03A 1W1B1 2OSYA 2YPIA 3EWZA 2RJGA 3CIXA 1JPKA 2YXXA 1RXOB 1FWDC 4Q7NA 4KWVA 5ABFA 2GUBA 2YL6A 4R9XA 4YVVA 4XZLX 3NZ1A 1XLMA 2WB5A 3BUVA 1F3WA 1H60A 3TTQA 1MUCA 4B3LA 3W7MA 1OX5A 3CT2A 3E2QA 2VO5A 3B8IA 3EXRA 1OY0A 1FRBA 1LBLA 4R88A 3NO5A 4H9YA 4ECLA 1IZJA 3HIJA 4H6KA 1G7UA 2QR6A 3GW0A 3P0XA 4PGLA 2V3EA 3FVMA 4GFSA 5LGZA 3HGJA 3OZPA 4GVGA 2QV5A 3LX9A 3OLGA 7REQB 4E4FA 1KBJA 5HDRA 2C1IA 4DWSC 4QRNA 3WD3A 3QXBA 3C2FA 3SQMA 2EPOA 3UR2A 2WMIA 4G7EB 1WDWA 1R9XA 1Q4WA 3RFAA 4GH3A 2GGIA 1JDCA 1IIGA 2CLLA 3W3OA 1E0UA 1JL8A 2OT1A 2ZE0A 1TJ0A 1VIZA 4ZOBA 4FK9A 2AOSA 1NAL1 4DWSD 1RUSA 3LXBA 5FKYA 3V4BA 3ZSTA 4CNOA 1LROA 2V5BA 4MJZA 1AZ1A 4K7VA 2I57A 2ZDRA 2WNNA 4ICMA 2E1DA 3BSMA 3T40A 2VD9A 3SADA 2VKZG 4BF7A 1NQKA 2VURA 1PV8A 2DH3A 5HNTA 4MNLA 1F76A 2VGBA 4NX0A 1M53A 4KBXA 4M8UA 4WY0F 3NZGA 1MQQA 4GYPC 5E9AA 4MGGA 5K9XA 2OGYA 2QAFA 3MMDA 2DDXA 1W3TA 3IJ9A 3I7QA 3TH6A 3S46A 2E9BA 4IQEA 1AH0A 2UY4A 1PPIA 1TZZA 3STEA 2QCDB 5C2XA 1NSJA 1F6YA 1F61A 2PUZA 2ZRWA 1PYMA 3QR1A 1XICA 1IXNA 2PLCA 3TQKA 2FPTA 3R94A 5CG7A 1O5QA 3UF9A 1RALA 1YHTA 5JU6A 1O7AA 7A3HA 1ZHAA 5AC6A 3FJLA 2FTPA 4UTJA 3T05A 4HOXA 1JUBA 3TTYA 3CK5A 4XAPA 5TQLA 2BASA 4FMVA 4AD3A 1ISWA 3LLXA 4BI6A 5LIYX 2QV4A 2EJAA 3TROA 3U9IA 4WDUA 5BXSA 3TN5A 2DFAA 4AQLA 1JZ5A 3WQGA 4NAEA 4AD0A 3VTRA 4I5XA 1F2JA 3SIMA 3QV7A 3DFPA 3BSGA 4AHOA 3A5FA 3TYCA 3KOZA 1P0BA 2JIWA 4EWND 3QZEA 4QAIA 4XIMA 4H3DA 2BNJA 1H11A 4UQDA 3VNDA 4FIRA 1E0VA 1OCJA 4ZOEA 1OM0A 3TX9A 2OOFA 4PN2A 3B9DA 4ROPA 3CUHA 1GTEA 4L56A 4CNTA 2Z2AA 1H2JA 3I65A 4E2BA 4Q8VA 1QR7A 6CGTA 5TNVA 3AU2A 4O1FA 4WJXA 1E70M 4BWLC 4XISA 1TR9A 4IP4A 1W9VA 3FDKA 2WANA 4NY2A 3VNLA 3DECA 3CZ8A 3N3TA 4B4FA 2XPKA 3EOSA 4IIDA 3M1ZA 3SCPA 2R24A 2X2YA 1KR0A 3MDWA 5A5WA 3A9BA 2CLMA 1VCFA 4LX4A 3PJWA 1OFQA 3SRHA 1LBFA 2Z27A 3GC4A 3BV7A 3PJTA 2RDXA 3T81A 2IS7A 2QHAA 3S9YA 1MMFA 1FA2A 1B3VA 3CZJA 2ZTKA 3WEZA 1UWUA 4C6IA 4GUFA 1ZAIA 4JN8A 1V3KA 3BQ6A 3LZ5A 1JFXA 1VLWA 3ABSA 1PUDA 3M5YA 4UOZA 1M41A 3KBMA 5AHNA 5ABHA 1FH8A 1TR1A 3PPGA 4CU7A 1PX3A 1RY0A 3RLGA 3G0UA 4U31A 3M7WA 5FSDC 2V68A 1RCXB 3A64A 2QCGA 1SW0A 6A3HA 4MY8A 1KFLA 5BOFA 4LUSB 4D6IA 3VMNA 4L4LA 4LAUA 3ZR4A 3W82A 2D24A 1R3QA 4PMVA 1LG1A 3BCDA 1QRQA 5GNYA 1QASA 1KGWA 2JBMA 4GWEA 2DSKA 3TSBA 4ZXOA 1GOIA 2FGZA 2GDUA 4HHPA 5D33A 1TE1A 4LFYA 4PMZA 2OXNA 1PCWA 3L21A 7PTDA 3EWBX 3TEVA 4G56A 4DELA 3PZOA 3CH0A 3UPBA 1I0BA 5CPNA 2VELA 2Y85A 5MKGA 1A5UA 3IGSA 4PYSA 3RX3A 4LF1A 3EKGA 4HNCA 1XSIA 1Y7VA 1AK5A 3F4WA 2VXNA 2CZEA 1E1CB 3RXZA 3DBPA 1XSJA 3MHUA 3W74A 4GNKB 2ON3A 3WK3A 3AALA 2E28A 2CETA 1HKJA 3BOLA 2E77A 2VL4A 4AZ5A 1O12A 1BXBA 1V3LA 1W5OA 3S1GA 4MDPA 3P80A 3V7PA 2Z1XA 1G7VA 4IJBA 3CUZA 3WH6A 4C6JA 4EX4A 4ADTA 3GVVA 4DO7A 2IKGA 1XFBA 3AS1A 4LU0A 4Q7IA 2PC4A 3QW4B 1VYPX 1ME7A 1YEYA 4Y9OA 1SSGA 2AMXA 2YFOA 5T91A 4UQBA 2ZVIA 3WBWA 2YCEA 1OZQA 4O4WA 4S3BA 3M0XA 1XD1A 2OWXA 3FJ4A 5JVLA 3GH4A 1CDGA 1VYSX 3TFXA 1E73M 2XFRA 4ILSA 1I4NA 1GCYA 3MUY1 2EO7A 3MBDA 3GNRA 4N02A 1QOQA 3HPFA 3HMCA 5AC7A 2W6RA 4S3GA 4Q4SA 3KBVA 3PZVA 1B9ZA 6ALDA 3ENLA 3VE9A 1A4LA 3HBLA 2E6DA 4IMCA 4X0NA 5LNVA 4B2DD 3PPHA 4AVOA 1EB3A 2F6XA 5A69A 3AUJA 1VP5A 1FHUA 3E5PA 3ABZA 2HE5A 2OSWA 1W3JA 1V77A 1NTHA 4S38A 3L68A 1RJQA 2AL2B 3N11A 3VCCA 1Q6EA 2PGRA 3IPWA 2J66A 1VR6A 2OQHA 4OJYA 2NW0A 3UCCA 4GCAA 5HPOA 3TVAA 3O63A 4ROQA 2VFFA 3LNMA 1CW2A 2BGSA 4CNPA 4DJDA 4TOQA 2V2HA 4RZ4A 2QDHA 3W28A 3SN4A 5CSYA 4X0VA 3S1WA 4K6AA 1DHKA 4U2YA 3IJ7A 1V93A 1B4KA 3BH4A 3IRDA 3B3DA 4Q4PA 4XBKA 3TAOA 2VFIA 1OFDA 2UZ9A 2YLAA 3RCMA 3FS2A 4R5EA 4HA0A 2QCFA 3B4UA 1V3MA 3EGJA 2GL5A 3MMWA 2FFIA 3JS3A 2ASHA 2INEA 3P14A 1DV7A 4GHRA 1JDAA 1XPYA 1FHLA 3QMTA 5KITA 3W7JA 1I75A 2HPIA 1E5NA 4HYVA 4UBPC 3KVMA 2FHBA 3THAA 4GZEA 5I3DA 1KBIA 1MW2A 2C18A 4L80A 1KC7A 2SFPA 3AMLA 1OGBA 3UR5A 4X2RA 1DJGA 1XI3A 1YPXA 1SJBA 4HU3A 1GT8A 4JDYA 3NOYA 4GI4A 5HUPA 3W2LA 2PDJA 3N2XA 3T55A 4F0SA 1JZ3A 4HHHA 3TW6A 2F8QA 3L2IA 4NZCA 1N82A 1S2TA 3BMXA 1I60A 1OEPA 3SUUA 1XIJA 4GJJA 4DLMA 2Q01A 1ZU8A 2ISFA 3SCUA 4GIYA 3MZ2A 4H6QA 4A4AA 3KVKA 2H6RA 3QHMA 1W17A 3PHAA 3C3NA 1SR9A 1K1DA 1G69A 2C71A 4H9XA 2RJHA 1OIFA 5HMDA 4F79A 4PCFA 1J18A 3BCFA 1W5PA 5CZ0A 1JGMA 2TSYA 4POCA 4A35A 4A3RA 2ZX8A 1WUFA 2PTXA 4EAMA 3UZZA 3W73A 4FHAA 2YIHA 4G1NA 3CLMA 2P8CA 1XS2A 4GYJA 3UGRA 2ZA3A 4IFKA 1Y0EA 4JL1A 2VX6A 5AVHA 1DWGM 1G67A 4QS6A 5EPDA 4HHLA 1WAUA 2IQTA 3UGVA 3IWPA 2B7QA 3KUMA 3DG6A 4US5A 5CXPA 4GY7A 1GUVA 1PWMA 4CN4A 5CC6A 2ODOA 5D02A 4S3FA 5LNSA 1A53A 2ZRZA 2Y7GA 3AIRA 4PUEA 3WLOA 4PCPA 3R8RA 1DXIA 3LRKA 1O5RA 1QNVA 1HXJA 2DZBA 5DLCA 2QUNA 3MYOA 1S5NA 3DKLA 3BG3A 2ZC1A 1OYBA 3H22A 4MWAE 1EO7A 5KEZA 1MXSA 5A2CA 3QV6A 1FHVA 3N9RA 3WX7A 2GK1A 2PGEA 1E0XA 5IFPA 1QPOA 4F9DA 4XIAA 2FLIA 3B8DA 3A21A 4IG2A 1V6VA 2F2KA 2XGZA 3MZNA 3PTMA 3ITYA 2DSUA 4IGHA 3PBUA 4Y90A 1H1ZA 3KS5A 3AS3A 4DZ5A 2FKPA 2D2HA 3LK6A 5A6BA 3SCTA 3A4XA 4PMQA 4OV9A 4JTUA 3ZMRA 2WC4A 3W85A 2P0IA 2OEKA 4OTKA 2ZZ3A 2B7NA 2BDQA 2XIMA 3IIZA 1XG4A 1VBJA 3RLHA 1WDRA 1V6XA 4O1DA 2Q09A 4A8LA 1V3HA 4IH3A 3NL3A 2VX7A 3KDNA 2ZX5A 1TWDA 3W2MA 3M0LA 4ZFCA 3W88A 3VD3A 4E3VA 3WO8A 1KRAC 1UWRA 2BX7A 4FX7A 1R2RA 1DJIA 4DO4A 3RX4A 2R1NA 3LPOA 1VFMA 3WN6A 1HJQA 2C13A 4PEKA 1TRDA 3AS0A 4E0CA 1B90A 3TE9A 1Z3NA 1BSLA 2RDTA 2VYOA 3GC5A 1SZEA 3WDRA 3UZYA 4C6FA 2OKOA 2PTZA 1S1RA 3R13A 2ZXAA 1O5XA 1F3TA 2DZVA 2VZTA 5AN7A 3W7QA 3LHZA 2ZOXA 2HRWA 3GLCA 1JPMA 3AXHA 4AMCA 1R3WA 3W7LA 4FOJA 3HQ1A 2YCKX 1L2QA 1J0YA 3GXFA 2V38A 1OC7A 4C1NB 5HA7A 5KMYA 1ISXA 3QPYA 3SY8A 1EIBA 3REQA 1O66A 3A3WA 2ZZ4A 1PKYA 1FQ0A 4WDWA 2H9AA 6XIAA 2VENA 2XFFA 1JZ4A 2WCGA 4JIHA 5J04A 1YNQA 2CLKA 5E09A 3R6IA 1YNPA 4MZ1A 2WMJA 3G1RA 4CD6A 4KIRA 5DEZA 4DZAA 1M7XA 4XZWA 4IP5A 3TTOA 1QI0A 4JS3A 4Q3MA 3TN6A 3P2VA 1QAPA 4MAVA 3V3WA 2BY1A 2XFWA 2P0OA 3IJIA 2Z2BA 4O17A 3UG8A 4K2SA 5LIUX 4UQCA 1TQXA 3CQKA 1NWRA 3T0DA 3LXCA 3EYPA 4AHQA 3L4WA 1WP6A 1V7YA 4QXIA 3SGGA 3M16A 4QCEA 1R8LA 4A3UA 4R7JA 3QHNA 2I5IA 2OYKA 4I3GA 2VZVA 4O18A 1KXVA 1VJSA 2Z7KA 2PRHA 5CC3A 1TVLA 3H6OA 4H8HA 4KESA 4UWMA 4C1KA 4GZ7A 1UMYA 3AWNA 1IQ8A 2WV8A 3ABRA 2VTFA 3RAOA 5C2CA 3PJUA 5D9OA 4PB4A 2J7DA 3TYAA 2VRQA 2NQZA 3T4CA 1OYAA 4O52A 4YXGA 2MNRA 4KWWA 4LOCA 5C9UA 2VR2A 2Y4SA 4DJFA 4B9ZA 1OJXA 1L8PA 1VGAA 3NXFA 2QUTA 4R53A 3G0XA 2QGYA 3KOXA 4PB5A 1DE5A 2GJLA 2VP8A 4K3ZA 1W1ZA 1U33A 1DJYA 2HK0A 1VAHA 1YKWA 5I06A 3EKLA 3BAJA 4HSOA 5F1UA 3IGUA 3ZVIA 2XN0A 3KWSA 4LJ3A 1UW9A 2I56A 1B9BA 1WQ5A 1IE7C 3VD7A 4HYRA 2WJDA 5F4WA 3WK1A 4TXEA 1UJQA 1GG0A 4CCDA 4S3JA 3CEPA 3C2YA 5BZAA 1OGGA 4O0KA 4Y9PA 1HG3A 1LL4A 3PB0A 4QLKA 1R85A 1KM3A 3RMJA 1FCBA 4LS2A 1EGZA 4OV4A 2DZXA 2YDAA 3U3HA 2DVTA 4HB7A 3LCIA 2PURA 4YYFA 5J8LA 3K8MA 4Y9AA 1HKVA 1GKPA 4PMRA 2X41A 3QV9A 2DPEA 3NSMA 1IXQA 4P2VA 1QMLA 1PZ1A 4P8VA 3KEHA 2YW3A 3B05A 3QMRA 3G1AA 1LF1A 3CZKA 1XIHA 4EF9A 2PP3A 4ZCWA 4N2YA 3H7VA 4BEQA 4AZ6A 3N18A 1VENA 1G4EA 4C7FA 5A3HA 5D04C 4ZVJA 2PSNA 1QPQA 3Q58A 4DF2A 2XU2A 3CO8A 1UHVA 4J3WA 4UQ9A 4MWAC 4ZSTA 1FWBC 2HPMA 3E0WA 1YXDA 4BY3A 3VILA 2XWEA 1VCGA 4RX0A 4C6MA 5AHIA 3T4WA 3IRSA 2Y8KA 1KQYA 4MWAD 2DSVA 2E67A 1T99A 5D03A 1JNDA 4KIEA 1CB2A 1PKMA 1JPHA 3GAKA 2ZRUA 3AQUA 3VDBA 3VIOA 4YNGA 1QPRA 3C86A 2VEMA 1TMQA 3G5EA 3IUHA 1C8QA 4JR5A 3ZFHA 1V8EA 2IMRA 3KDOA 8XIAA 1R7OA 4JIQA 1GYNA 1DIEA 2VEKA 1DQXA 2FGBA 4QHRA 1PL9A 4RPPA 2ZCGA 4JPGA 4YIWA 2IW0A 3NL5A 1LOQA 4G6CA 2YYUA 4J1OA 3VGBA 3G24A 1UC5A 2QPUA 3NQBA 3MO4A 1PXGA 4A6GA 5I3KA 2FZ9A 4GZJA 3W1TA 4NNCA 1EOMA 4CQCA 3E3HA 3FDGA 3PTDA 5LSMA 5AHMA 1W5NA 3DXIA 1YRRA 3WDIA 5HMFA 2DZPA 3BLFA 2YBVA 4J27A 3H2MA 1F74A 5M1TA 1J0JA 3L0NA 2XH7A 1P6BA 4WDXA 3FXYA 5U4NA 1IR2A 1F3EA 1O60A 1OT2A 2GFTA 3BV4A 3BW4A 2PU1A 5A8OA 5FD0A 4MKNA 4JD4A 3ID7A 2IKJA 1I2PA 3NTYA 3A47A 4AZGA 3GO2A 2YCLB 4PR4A 1L0PA 1V3IA 4DXKA 1TCMA 1OT1A 4PUDA 1NWUA 3AI0A 1H09A 4UFKA 3W7PA 5KTLA 1K9TA 1UG6A 5LNRA 4CEUC 4RK8A 4H6EA 4U4MA 5ABFB 1Q6CA 5CSUA 2A3AA 3LUTA 2ISVA 3WLJA 4K7YA 3PAJA 1BPLB 4N0RA 5LNWA 1DKWA 4W93A 1KO0A 3CGTA 1KCXA 1BYDA 1NF0A 1AA1B 1X38A 4CD8A 4HPHA 3EX1A 3RPMA 3MP5A 1B3XA 3WD4A 4AIBA 2GUYA 1HKKA 4FS9A 2PI6A 3GR7A 4KS0A 4MNKA 5EU9A 3V0UA 1Q5MA 1BVZA 3S2JA 4LCRA 3M07A 3UXAA 4O11A 2VUYA 2WMIB 2QPXA 4WJEA 4KEMA 2Y1HA 2PP0A 4C65A 1DJHA 4JHZA 2W79A 1B54A 4B5WA 2WKJA 2Z26A 4MYAA 3OGVA 1IGWA 3F5LA 1VYRA 1QDSA 4QCFA 4JN6A 1Q7QA 1NARA 3SR7A 3NQ7A 4UTUA 3O0KA 9XIMA 4Z2KA 3GDLA 3NGFA 4ACZA 2VGGA 2PPGA 2GOUA 4QROA 3M4HA 2W63A 2R9RA 2EPNA 5I09A 4PA8A 4PTVA 3ARRA 4Q4KA 4ZFMA 3R89A 3KX6A 5H6HA 1E40A 4EKJA 3N15A 2DW6A 4S1FA 1E9IA 3P8IA 4WSHA 2CBJA 4K1WA 3M64A 3AJ7A 1BXCA 1K9FA 3IK2A 5CZJA 1FKXA 3N04A 3TN4A 1UOKA 2V5JA 3L2LA 3NQFA 3WCZA 1UH3A 1CXIA 3L0GA 1Q4NX 1XWYA 1GKQA 2XZ7A 3L4YA 2MANA 4E2DA 1IWPA 4ZEPA 2XSBA 1L6FA 3S5YA 4JTHA 3B03A 1SPQA 3GYCA 4NNAA 1E1EA 1JYWA 3UZXA 3UCQA 1VFTA 4LB3A 3VIJA 4JFVA 3R10A 3GFXA 2I9EA 1DWJM 1QHZA 2JQXA 5DY3A 3TYZA 2JF7A 1VKFA 2YA1A 2C91A 2Y5EA 1WBHA 4JTTA 2BZNA 3ANYA 3HGSA 2YL8A 2Y7EA 4NAEB 1YE4A 4EWJA 1AH3A 3VMOA 4L1WA 3ARUA 3KTXA 1FY6A 4UTKA 1BRLA 4AHPA 1SO3A 4A3QA 4XK2A 3TW9A 1HFBA 3A13A 3O6CA 1DEDA 4A22A 4D71A 1U2YA 4MG4A 5BRQA 1Y5XA 4PSPA 1ISYA 4UFJA 4AU0A 1TREA 3RR1A 1PHQA 2BVTA 4GJIA 1UH4A 4D6DA 3LRLA 1J6OA 1AQMA 1N8IA 1W1PA 1SJAA 1SMAA 3EEZA 3EKZA 1GEHA 4X2PA 1Q66A 4WXYA 4TTGA 2E6YA 4CD4A 1AH4A 2NVCA 3RX2A 2ZZ7A 1JIBA 2R82A 3ZJ8A 4LPCA 1SSDA 5K3VA 5LYRA 2PDWA 3R25A 5JBDA 2J7GA 3UZ5A 4MLRA 1XPGA 3BCJA 3GSMA 1FDYA 5AC4A 1UR4A 4M6VA 3IJ6A 3KRBA 3TK7A 4U2ZA 3BOFA 2RDUA 4WKAA 2CLFA 4KW2A 4HA1A 4XD6A 2Y61A 4AX7A 3ANUA 4GUHA 4KGLA 5D2TA 1MXDA 1V79A 1OVDA 1NFGA 3DCPA 1VFHA 4C6PA 1Q8JA 5G1MA 1K7EA 4DWSA 4I9JA 3T09A 4AZBA 3TDFA 3A5VA 2D3NA 1WKYA 3DFOA 1MUMA 4JCMA 2FIQA 3U2OA 5AOUA 2J7HA 4RW5A 4D8LA 2BLEA 3EOEA 2XVNA 1JYXA 1CXHA 2EKGA 3K2GA 5XINA 1MQPA 4GRSA 2OODA 4ML9A 4OT7A 2X30A 2BOEX 4Z0JA 2A7RA 2P88A 1B0IA 2OEMA 3DX5A 3M0VA 2ACQA 4QJ4B 1XYMA 4J40A 4PL1A 2ZXBA 3LMZA 4J9JA 5H8UA 3EMCA 4IMAA 4JTDA 2NV1A 1KKRA 4N6FA 4IGMA 4GYPA 2E68A 3Q45A 3R0DA 4V28A 3B8SA 3QQ0A 4N6EA 3NDYA 5MKGB 4IF2A 2HCVA 4B5UA 3GIQA 1NF7A 3ITGA 3LENA 5BWAA 4WGHA 2WSRA 4UZSA 3O16A 4TQTA 4KMQA 4DI9A 1DJNA 5CC7A 3APTA 1V0KA 4JXCA 1OGSA 5FESA 1TMHA 4XVDA 3B8TA 3VIHA 2BODX 3RM8A 3ZWSA 2P1FA 1KW1A 3EDDA 3PZTA 4FF7A 2G96A 1MZHA 4IFOA 4AWEA 4JHOA 2O9TA 1XIIA 3NQAA 5FJPA 4F2BA 3ZYZA 5CSRA 3PVFA 3S6OA 2WHLA 4OUEA 4DBEA 1ZY9A 3JW7A 3TC3A 3HF3A 1F9CA 3AISA 1CPUA 1UP0A 3AZRA 2XISA 1R3SA 4AG0A 3NQ2A 3QR0A 3LDVA 3A4WA 4RUBA 2V3FA 2PLMA 3W7GA 3P61A 3VDAA 4FIQA 4KRTA 1UD3A 1YTKA 4OECA 2Y7DA 1YTDA 2ZA2A 4NNBA 1GVSA 1P1MA 4GABA 2OCZA 3NIYA 4LCQA 1JDDA 2EHHA 3WQEA 1C93A 2E6AA 3WDJA 2OZ3A 2R1LA 4ZA0A 3IAPA 4AIOA 1CTNA 4NL1A 2YA0A 3B9EA 1A5KC 1FWFC 3EA2A 2D0GA 1WCGA 3E0FA 4QSHA 1QHOA 3RRXA 3CV7A 2X05A 3IIPA 3LPPA 3T8QA 4YCPA 4ZE4A 4J3UA 4O1BA 3CQ0A 3OGSA 4BQ5A 1LOLA 3NWRA 2X8RA 4BWLA 3NOEA 1PX8A 2PDBA 2V6AA 1AG1O 1VPYA 3VZYA 3CUXA 2XIQA 4P8WA 1I6NA 2PCQA 4TU1A 4RJEA 4I6VA 5I6SA 1W5QA 3F7JA 2Y0FA 2ZUMA 3MJMA 1SGJA 4LS0A 2CKRA 4OHQA 1R3TA 1VPXA 4L4OA 2PBGA 2WK2A 4TVUA 1V08A 2ZFAA 4L9YA 5PTDA 2E9LA 4NZFA 4UR7A 3SI9A 2WZTA 1V3JA 1NQ6A 4LUYA 4F0MA 2RUSA 4JTAA 2ALDA 5AYIA 4QDPA 4XAYA 4MJ4A 3K13A 1MEWA 1I9CB 1TJ1A 3LLFA 1EQPA 3FN9A 4PMNA 1XIDA 4A8RA 2XN1A 1FX6A 5HXMA 2A79A 3N29A 3PY2A 3AOFA 2B7OA 5B7YA 2CC0A 3WLPA 3AXXA 3HO8A 1V6UA 1B31A 3M0JA 2NQJA 4AEFA 3BG9A 5DCDA 1KBLA 5LIXX 5DO8A 4IWWA 1CGYA 3S2NA 3B9NA 3AIQA 1UKQA 2ZWYA 4Y9MA 4O4VA 4O10A 1E3ZA 1H0IA 3WH9A 1ITQA 5BMWA 2A6LA 1UD8A 4QJ1A 4GUJA 4PMYA 5CPQA 4JY8A 1WDSA 1EDGA 2NQ5A 2W62A 4Q22A 4ERGA 2ISSA 3WH5A 1LWHA 4M6UA 4AXKA 3B4YA 1P7TA 4AIUA 4IFKB 3UY8A 2EQDA 3TWBA 3HJZA 3COTA 2XFYA 4GI9A 1W2VA 1EO5A 5E70A 1XIMA 3SO7A 1YDYA 3SY1A 4O0QA 4Z1CA 4GQ0A 2V67A 3O2LA 1EYEA 2YZRA 1EJSC 1XYBA 4JTJA 1K8XA 1K9EA 3FA3A 3DFQA 3WYZA 2ZWZA 5D2YA 5JUVA 3H53A 4XZNX 3WH8A 1A0CA 4DXVA 3EX3A 4JKKA 1H7NA 4B2DA 2NQHA 4LAZA 2FQIA 4C6KA 3FA4A 3LHUA 4JAWA 1GVYA 4AYGA 4HMCA 2GK1B 3M0YA 3P0WA 1VBHA 1J5SA 1P0DA 1YXYA 3UR8A 2GVEA 4IG2B 1XUZA 3QPZA 1MFVA 2PCEA 1B3ZA 2Y6ZA 1CGWA 1US3A 2J9ZA 4B3ZA 4HYWA 4RW3A 5EB8A 4NX5A 3LCWA 3TLQA 1UKSA 4NRSA 5CH9A 2ADAA 1L6WA 3ZM8A 3FXGA 7CGTA 4D8ZA 3ARWA 3PSVA 5EGRA 4I7VA 4L4PA 1RA0A 3AFBA 3UA3A 2TRSA 4MUPA 2QIIA 2VDGA 3L4XA 4Q8PA 4W8BA 1W9XA 3B0UX 2GSEA 2XSAA 2FFCA 2ATSA 1Z32X 3AYRA 3WFAA 1XQLA 4LV4A 3RCNA 4TX8A 3VC5A 4FXFA 3VDCA 1QK2A 4AY7A 5KSWA 3KXQA 2VFGA 2YGYA 1G6CA 1SJDA 1F73A 1GW9A 4OBRA 3U4AA 2GWGA 2OFJA 1NFPA 2J7CA 4M6QA 1BQGA 3MKKA 3W7KA 5G4EA 2HDJA 3E2VA 3L7RA 1ZENA 2HROA 4J3TA 2KX9A 3JZEA 3TTSA 4QEHA 1BTCA 1E6NA 1UZ1A 2EF9A 2VGFA 1G1YA 3VKBA 4ONVA 4FLRA 5LA1A 2INZA 4HZ7A 2OO0A 2I9UA 3Q2DA 4C7GA 3FAWA 1BGAA 3WLQA 2F84A 3LQLA 5A6MA 2FDSA 2WZMA 3VDHA 2J77A 3AMGA 4UTWA 3UW6A 4JIPA 4GI6A 2HJPA 2PDPA 4QNEA 4AY1A 4JL2A 3GTFA 1QNOA 4F2TA 5IBXC 2BWGA 1KM2A 2EPHA 1PTAA 2H9AB 5TF0A 3DYOA 5F2MA 3ITTA 4GE8A 3EOLA 5XIMA 4QG8A 2OZ0A 4V33A 4CN6A 1SFLA 2VR5A 1TPWA 2G95A 3GR8A 3DERA 1R87A 4H7VA 5GNZA 1W91A 1FWIC 2FMNA 2O9RA 2OX1A 1EX5A 4LNYA 1GZ1A 3PG8A 3VA8A 1QVBA 2X2GA 4WHBA 4CQ8A 3VFLA 5AHLA 3ARSA 4Q4MA 4HPXA 4CQAA 1M7JA 3W24A 2DT1A 2CCRA 1TX0A 4W88A 4M7TA 4PEEA 1BG4A 3DHFA 2XSXA 4AISA 3L4ZA 3TQ0A 1A0EA 3KM8A 3LGEA 2DIKA 2Z2UA 1P4CA 2FZ8A 5BW6A 4RE4A 5F4SA 3ZJKA 2JF6A 1U1JA 3B04A 2OLSA 1M65A 1YDOA 4MNJA 3GVGA 2FYMA 3FSTA 1HJWA 1Y65A 4M24A 3VKAA 4J4KA 3W72A 4DAIA 3UFYA 2WBKA 4WEVX 3L5AA 4HU8A 1EBHA 3W2KA 1HN1A 5FA5A 3PG9A 5CGMA 3PN8A 1M6JA 2QIWA 1RLDA 1I1XA 3NCOA 4EAYA 3C0SA 1JXKA 1VHNA 3L5LA 1KKOA 4MKVA 2Y5SA 1PTGA 1UIOA 1LORA 3MUAA 1X1NA 1HGYA 4A8IA 3MVTA 4NI8A 4R27A 5HINA 3OW1A 4KF1A 3U0HA 4M51A 3WQOA 4FP1A 1JEZA 4JIEA 4CU8A 4PRRA 2ZZ2A 1Y8BA 5BU9A 5DBTA 3G8EA 4RL3A 1XKJA 3NQMA 2V3DA 1IZKA 2PDQA 2AKZA 1I1WA 3VGEA 4JNYA 1RA5A 2VCBA 2XUCA 2XM2A 4PH6A 3GU2A 4OBTA 2PF0A 2J75A 1ITUA 3WUEA 2EGZA 3W7CA 1RH9A 4NYUA 2WWDA 3WLKX 4RPQA 1EH9A 3UWZA 4X3ZA 3GE7A 3WY1A 4Q8UA 3VAVA 4IZGA 3Q37A 2DUZA 2YX0A 2FTYA 1SUXA 3QY7A 1XRFA 2D2OA 5A8MA 5B80A 1EBGA 1REQA 3CLWA 1XLEA 4UOJA 3G22A 1ZCOA 4MFDA 5GVJA 5DANA 2O7SA 4W5ZA 2CLHA 1OX6A 3KAOA 3IVSA 4AYSA 2H8XA 1ECQA 5L9FA 4AZCB 3QN3A 5CPSA 1HL2A 3NPXA 4I90A 4XD5A 3I3DA 2DV0A 3F4NA 1B2YA 4KFOA 1C92A 3IANA 3I4KA 4RZBA 4MAZA 1K9DA 4I7WA 1AJ0A 3KLKA 1ESWA 5F4XA 3B97A 4MHBA 3UY7A 4M3PA 3OLDA 4KWSA 1OC5A 3TXVA 4QITA 2GLKA 3W7IA 2D1ZA 1GOWA 1LUCA 4ZO9A 4US6A 1TJPA 4EVZA 3WF1A 1AW1A 1XG3A 2ZQ0A 1H62A 3OJGA 2BOGX 1Q6OA 2REQA 2EPKX 5CJ5A 4ZTYA 4O19A 4IP7A 1KRBC 4FXSA 4GZIA 1TYGA 4CQBA 2QGHA 4KWUA 3N2MA 3S1VA 1K8ZA 2QULA 2BTMA 3K1GA 3L5MA 4PMOA 4CNNA 3WJSA 4DEFA 2P50A 2NWSA 2IPGA 4U3AA 5BROA 1GVEA 2XIIA 4HCHA 2DVXA 3GUGA 3MO7A 1CBGA 3QGKC 2WNWA 4FF5A 1CWYA 1OFPA 1Z41A 1LQAA 2DT0A 4M81A 2ACSA 1KXHA 4F4RA 1QBBA 3TZNA 4CQ9A 2F2HA 4E4UA 4MNMA 3AIUA 3ZVHA 3DIPA 5DBUA 1DL3A 4IOTA 4QSFA 2J7FA 4YTQA 3VGGA 3SSJA 1SO4A 1Q6RA 4RXGA 3EB2A 1ONWA 1W1YA 1GEQA 3SCNA 2EBNA 3WENA 2GJRA 4HA3A 5FL0A 1W1VA 1AL7A 2O55A 5LXEA 3JU2A 3PUDA 3T07A 2VVNA 1C9WA 2JFEX 4H41A 3AJXA 4MF4A 1UOZA 4NILA 4AEEA 2NUWA 3WNLA 2ZXQA 3GTHA 2NSOA 3QQWA 3R0KA 4C7DA 1U83A 1E15A 4W89A 2P3EA 5HJXA 1KTNA 4CEXC 3TA6A 2YR1A 3W00A 3TC7A 1LDCA 2OELA 4WIWA 4H6RA 4XSMA 4CGTA 2C1HA 3HQPA 3E96A 3MCMA 2Z1KA 1WOAA 5I07A 1HL9A 3GVWA 2CITA 1LRTA 4F0KA 3S47A 1VFSA 4HNNA 4V15A 4EXAA 3TONA 5E0FA 1KWGA 3HV8A 5CCZA 4QG6A 3WUGA 1LZOA 3NSXA 4X22A 3THDA 2OWCA 2FZDA 3ABXA 3BLPX 5D2WA 3OO2A 1H49A 3ATYA 2WSYA 1CGXA 4A29A 1KM5A 4GX9A 3W6YA 1GZGA 3JUGA 4ADUA 5HMEA 2DZAA 4JEQA 5FF4A 5I03A 5I78A 5M5DA 3E02A 3UWYA 1A3XA 1S5WA 3PUGA 4AD5A 4PTNA 2GQAA 1HW6A 2ISDA 1H7PA 1WNOA 3OB8A 1J5TA 3PTKA 4WZHA 1WXJA 2VZOA 3OIHA 1UR3M 2QUMA 1A80A 3DHDA 2EXOA 1JCLA 1SFSA 4H9VA 3QVQA 2CZ5A 4TIMA 4PFMA 4UR8A 3OP2A 4C5YA 2EG6A 3M0ZA 3VZXA 2J74A 1Q7ZA 2WKGA 2Q02A 1HVQA 4ES4A 2Q8ZA 2RKXA 3BICA 4OQVA 4N9EA 3CPGA 3Q4DA 3BG5A 3RO8A 1ZGDA 2R14A 4ACZB 1EOKA 9XIAA 1XFCA 4XX6A 4KCUA 3ITXA 3VOGA 4GGBA 3UG5A 4HZ8A 4TV5A 4MWAA 3GHUA 4C6EA 5CZKA 1M3UA 3PULA 4KCVA 5CAHA 1RQBA 4QE4A 4KT2A 1LLOA 4FALA 2JGYA 4AY8A 5HNRA 2NLYA 1J79A 3W87A 1W0MA 4G1KA 5K7JA 1YTEA 4DHGA 1LQ0A 1EXBA 1AMKA 3CHFA 3A4AA 3APYA 4CNSA 1E9LA 5JIPA 3WL0A 4YTUA 4ZO8A 3WFLA 2PWDA 1GOOA 2WAGA 2ZVRA 1VQTA 3CBWA 1MQRA 3BLLA 3K4WA 1F8MA 3WQ5A 3T2QA 1EC7A 4JX6A 3NZPA 4J2MA 4JIIX 3MMTA 3ARQA 4RE0A 3WH7A 2G3FA 5FCZA 1W31A 3WJZA 4R33A 1H0GA 3T1GA 3CC1A 3QY6A 3GXTA 1TPB1 1CXEA 5FJTA 3EWUA 3WQCA 2XWDA 1U30A 1R5YA 4C6NA 3UVAA 4XG1A 1KRMA 2E25A 5C55A 1B3OA 3VOCA 3HGRA 1KFWA 5D05A 4WSKA 3UD6A 5ECUA 2PB1A 5FI8A 2PLJA 3B9OA 4S3CA 1GZJA 3XIMA 1BRLB 2ZKMX 1YIXA 4YVXA 2C15A 3WJYA 2E09A 3KBSA 2ZRXA 1XLIA 2RHGA 4S2CA 4X60A 1X98A 3O6YX 4FR1A 1UC4A 4HTBA 1TTPA 3MSDA 7ENLA 1O95A 1V4YA 1GQLA 3D3AA 4WF7A 1PCKA 1KCZA 2JE8A 1I2NA 1RR2A 3IGXA 4AZIA 2NZLA 1KM0A 5AYYA 2CLPA 2GVYA 1BF6A 2G3NA 4W9TA 1F07A 1PDYA 1M04A 1ZNNA 5DXXA 1EXPA 3N9KA 1I0DA 1QATA 3DZ1A 4LC6A 3DN5A 1NDWA 5E9XA 3KOFA 3CQIA 1BGGA 1PYFA 5HJYA 1JCTA 4I6KA 5DF0A 5C71A 4F0HA 3UQNA 5CLTA 3SBFA 3GU9A 1ICQA 5J5DA 1RD6A 3N2TA 3NQCA 3CHDA 4AFYA 4J2PA 3WF4A 1BYAA 2RH9A 4D6CA 1MYRA 4P7QA 1WE5A 1TPDA 4GQGA 2HZGA 2PD5A 4ZQRA 1X6NA 3EWDA 1BWVA 4DWSB 4B4HA 3GDTA 1UROA 1K7XA 5EMJA 2YJQA 3VI2A 3QFEA 2QUUA 3AIEA 3NEVA 1ONEA 4LGXA 2YYTA 3CUGA 4L65A 4PBEA 4NAFA 1EJ7L 1HKIA 3KOYA 3PBWA 1GKRA 3I7SA 3EXTA 4HP5A 1QOPA 1FKWA 1XM3A 3IJ8A 2O0TA 3QKEA 2VDIA 2WZEA 4EXBA 4HSNA 4ZB2A 1FFRA 1LCOA 1HJSA 3H70A 3L4TA 4QQUA 3A4JA 4O16A 5DRCA 3BMVA 7REQA 4V2XA 1I8JA 1F05A 3SW6A 2IPFA 3NYDA 2WXDM 1E9YB 2IPJA 5I02A 1ONRA 1R3RA 2HEJA 3BJSA 1U5HA 4UC5A 2GUUA 1FP9A 2V5DA 2XIBA 2IXVA 3W2JA 4KH2A 1EWEA 3W9ZA 6REQA 3WD1A 4JKMA 4OZOA 1K8YA 1UR8A 3O0FA 1CEOA 4FI4A 4HNTA 1LRQA 2X1UA 2PWHA 2KZHA 2Z6JA 4FNRA 1CZ1A 1XJBA 3VINA 4M1BA 4MB1A 4IM4A 1JGIA 1JAKA 4OVXA 1E3XA 4UUIA 2W9MA 3E49A 4JY9A 4GOAA 1WZLA 3ABOA 4KRZA 4N4PA 1YE6A 2DU2A 3DFTA 1A0DA 3HOJA 4LT9A 4W8LA 4XKYA 3TOYA 3LYEA 3TR9A 3B06A 2KAUC 2LLEA 1D9EA 2NV2A 5IDZA 3TYUA 4RR4A 2NLIA 3OG3A 2AQVA 4N7QA 2PP1A 1UZHA 1HNYA 1J01A 3IEBA 4GNVA 3LMYA 5MHBA 4KETA 4W4QA 3GC2A 1UQYA 1R47A 3O8AA 5CPTA 5A6TC 4M6PA 4HNOA 3MY9A 4CCZA 4JQ1A 3VABA 1V7AA 2ZUUA 1RHCA 3ZLGA 2O7QA 1QXLA 3CB8A 3DOPA 3PF3A 2BHZA 2HVNA 3ELFA 1OB0A 2F6UA 3M44A 3ABQA 2D22A 2YXOA 1KFKA 1EP2A 2HNHA 3WQWA 1TV2A 4K1GA 4WOZA 3EOUA 2FHFA 5H91A 5FJOA 3MHFA 1J4EA 2WZIA 3PZ9A 4K37A 4R34A 4NZ4A 4DUOA 3WNMA 3GXDA 1US2A 2J27A 1Q3NA 3W1QA 1MZRA 2OQYA 2A6NA 1I45A 4BA0A 4QP0A 3U2CA 2OZ8A 2DVUA 4KCTA 4KCWA 1K7FA 2Z25A 4C5ZA 4QE5A 3OA3A 2GGEA 4X9SA 1WKDA 1UZDA 3VD5A 1WV2A 1E0WA 5LGXA 4GO8A 1TV3A 3MCOA 3P5YA 3LS9A 5FJIA 5EMUA 4S3DA 3SUVA 5FEXA 1EC9A 4E2VA 5DX7A 4AXNA 3QSTA 4PTDA 1UR0A 4PTWA 1D7KA 2OSXA 5T26A 4FX6M 1SFJA 3BJTA 3HJEA 2DUXA 3CHVA 4WXZA 3S6TA 3C61A 4XSLA 3W81A 1BYBA 1OHLA 4BZYA 2Z1VA 4O50A 3PZMA 1YPIA 4KQNA 1DXFA 4Z42C 1QCWA 5A8NA 2QMKA 1LM1A 5I3IA 2V3GA 3PWGA 3S3GA 3F1QA 2C6QA 1U1UA 1R9ZA 3M0KA 2X0HA 1EGVA 4FLQA 5E6ZA 3C4UA 1F4HA 2VM8A 1JZ2A 1TWWA 2WMGA 4R3UA 1BWLA 3H12A 4GQRA 3RNDA 1JNEA 2XH4A 4PMXA 1MW1A 4MJ2A 3M7SA 3M5XA 1LTDA 4A8NA 4TV6A 3WQVA 3UPWA 1CLKA 2EKCA 4JTGA 3T0AA 3FCPA 1ZAHA 3UNDA 3V1HA 1GONA 3DC8A 3DFHA 4O8RA 3RLUA 4R7OA 4RXFA 4JTRA 3WEMA 2XYLA 4BEUA 3MDUA 1F4AA 1IEXA 4F8XA 1AQHA 1TFVA 3KVJA 3MUZ1 1XX1A 5D9PA 4O13A 4EXQA 1KV8A 4P7NA 1KRCC 4Q8OA 2PWEA 4J3VA 4V1XA 2I5QA 4YS1A 4HBKA 3TLLA 1SJCA 2B0MA 3ZZ1A 3EX4A 4ZQNA 2BHYA 3PPFA 2WLZA 2GVLA 1E4IA 3SB0A 3GNXA 4K8HA 3W1UA 1QPKA 3MI3A 3QGVA 4NZJA 2DW7A 2R6OA 4HZ6A 5DT5A 3CH9A 5M03A 4L64A 2YKKA 1JD7A 3WMBA 1UWQA 3HTWA 3O1NA 3LN3A 4QR6A 1EIXA 3RR4A 1B1YA 3A3HA 3LTYA 4XKMA 4ICNA 3B0YA 2RFGA 4ALDA 2F7FA 4JDBA 1JZ7A 4X61A 3UVIA 3EDJA 3G0SA 2A2IA 1EHAA 1RBOB 2V9DA 5XIAA 4NQ1A 1I2OA 1LG2A 2ABBA 4KFNA 2DH2A 5C7HA 1QI3A 3RILA 3GVRA 2W4XA 3CL8A 2YBTA 2BXVA 2Y88A 4F3HA 3LCFA 1HQTA 5AKQA 1E6XM 4UIOA 3R8HA 2WW5A 2Y70A 4Y8EA 1A3WA 3QJAA 4ZXLA 1S2VA 1H41A 3AMCA 3MQTA 4ACYA 4DI8A 2W91A 4M19A 4PMUA 1RSCA 1F3XA 1E51A 3LNPA 3NQEA 1DPMA 1SM9A 1UB3A 4XZIA 3UG4A 5C54A 1A5SA 3VM5A 5LKYA 4GKLA 5DMYA 1KBKA 2GJPA 2FJKA 2FVKA 3CJPA 1QU4A 2WWCA 3IIOA 3WMCA 4TMCA 2FJUB 4LVFA 4O1CA 1IXOA 4CU6A 1KM4A 4XQ6A 4X9YA 4FNSA 1P43A 2A0NA 4MIMA 4MOZA 3PSWA 1E9ZB 3V75A 1TIMA 1ADDA 1HO1A 1L6GA 3BTNA 3MJYA 3EA1A 5CGTA 4DBWA 2FMOA 3LGGA 3C52A 3NPVA 1FWGC 3STCA 3QHOA 3EMZA 1XLFA 5FAJA 4RDWA 2WPGA 3FSUA 3CWNA 1OIMA 4JFTA 2BVWA 5FIPA 1OD8A 1AMYA 2A7NA 2J78A 2XVGA 2B4GA 3FOKA 3HG2A 4M1RA 3DFYA 5DXYA 1UD2A 3VOFA 3SY5A 4BCEA 4QEEA 4AC1X 1AD1A 4HOWA 2JEQA 4HPJA 3N4EA 1S5MA 1MUWA 1UP2A 2BY2A 1BEUA 2FVLA 1JYVA 3AUOA 2WZHA 1VBGA 1Q2RA 4LYKA 2HS8A 2HWGA 5I77A 3W75A 7TAAA 4ML4A 2ICSA 2GQ8A 1K6WA 3SN1A 3O15A 3VD4A 1DE6A 1OFOA 5B7ZA 5A94A 4F0RA 2YLLA 2Y5JA 3S83A 4PRTA 4L7ZA 5I3FA 1WX0A 3LEPA 3M46A 2I7GA 5DT7A 3QOKA 4H04A 4QM1A 4GQQA 3S5NA 2B7PA 2OO6A 4GINA 1M5WA 1W8GA 4JBRA 1MEIA 1NJJA 2Z29A 2NX9A 3TAKA 3BZGA 2VZSA 3UJFA 3FK4A 5BOEA 4FR6A 3C0QA 4XWUA 4IPIA 3AXIA 2GDVA 3SUTA 5E0CA 4C6DA 2G97A 5EYWA 3OZMA 3NR0A 3S0CA 3HG4A 3OYZA 2QS8A 3NZQA 1KCKA 3W1AA 4IJCA 3V5FA 3GX9A 3ITOA 4BF9A 2YSWA 5M2FX 3WQ4A 1XR2A 4KEUA 3UWEA 3WQDA 1ZP3A 1HX0A 2QNEA 5E0KA 3GU1A 3WDHA 1R9YA 1EQCA 1EP3A 2X0YA 3AC0A 5A6AA 3DFNA 3JR2A 2WNQA 3EDFA 1UUOA 4NUWA 3NQ8A 3L0KA 2FGLA 1IEWA 3FA5A 1SZRA 2G3MA 4DRSA 3N1AA 1XCFA 1DORA 4INFA 4NSBA 2YL5A 1BXNA 3GHSA 1T7LA 3EWCA 3WJWA 2Q6ZA 4IMEA 2H3DA 1ITCA 2A3CA 4IT1A 3WD2A 4M0XA 3H7RA 1OG0A 3QY8A 3WMLA 1IEVA 3ARVA 1NM9A 1BHGA 1ZJIA 4O8AA 3R58A 3V18A 2I14A 5CZTA 3EPNA 3GDMA 3CS2A 4P5UA 3AROA 4RV8A 1XL9A 1OCBA 3TQPA 3IGHX 2D69A 1ZL1A 2HBVA 3OBAA 3FHQA 1SFTA 5LNUA 1EUNA 4FNPA 1HF6A 2C16A 2ZIDA 8CGTA 3CAQA 3MV01 4UTWC 2BFGA 5KINA 3NL6A 3N73A 1GNXA 2CLIA 2UY2A 2F38A 4O1EA 5D4YA 4BR1A 1V0NA 3G6MA 1YLVA 1EZ2A 1K03A 1GOKA 2H3BA 4EPDC 1UUMA 4H8UA 4WY0A 3ALFA 2PLKA 2DZUA 5HANA 1VFLA 3G1SA 1D7FA 1REQB 1WDDA 1JVNA 3N25A 4NG3A 5SWUA 3EB3A 5D2VA 4DF1A 1UH2A 3KS6A 3BAIA 4E4PA 3L23A 1PKNA 1ISZA 3NAVA 2GDQA 2JGQA 1D3GA 4LF2A 3GNNA 1B3WA 1OQFA 3O9NA 1E4NA 3BC9A 1QW8A 5G5IA 4JHMA 2VHLA 1J0KA 1JZ6A 1YBQB 3HN3A 1OCNA 5REQA 1HZYA 1XSKA 1MRAA 5GQBA 6XIMA 1PE1A 3T9PA 2E8ZA 3W1RA 4LUIA 2NX3A 3E1F1 1LUCB 2CERA 2CLOA 5DCEA 1J11A 3QGAC 5IBXA 5K9CA 5HAOA 2A3EA 3RHGA 3SN0A 5HWNA 2AQWA 4PUMA 2REQB 4TX6A 4FLOA 4V1YA 2FDMA 1XC4A 4H4IA 3H21A 4IMGA 4Z2LA 2PRMA 1ONXA 1WDPA 3U48A 2QCHA 1W9PA 5DMNA 3TC6A 1NDVA 3M0HA 1QOXA 4Q7BA 3D5HA 4O12A 1LRNA 4XZ9A 2PWVA 3E12A 1JCNA 4UMCA 3DG3A