5AHNA

Imp-bound form of the d199n mutant of impdh from pseudomonas aeruginosa
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
467
structure length
297
Chain Sequence
MLRISQEALTFDDVLLIPGYSEVLPKDVSLKTRLTRGIELNIPLVSAAMDTVTEARLAIAMAQEGGIGIIHKNMGIEQQAAEVRKVKKHTYPLASKDEQGRLRVGAAVGTGADTGERVAALVAAGVDVVVVDTAHGHSKGVIERVRWVKQTFPDVQVIGGNIATAEAAKALAEAGADAVKVGIGPGSICTTRIVAGVGVPQISAIANVAAALEGTGVPLIADGGIRFSGDLAKAMVAGAYCVMMGSMFAGTEEAPGGALSAIVHQLMGGLRAAMGYTGSADIQQMRTQPQFVRITGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
publication title Crystallographic Studies of Two Variants of Pseudomonas Aeruginosa Impdh with Impaired Allosteric Regulation
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Oxidoreductase
total genus 102
structure length 297
sequence length 467
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5ahnA00
1MXSA 1KM2A 4IXHA 2V5LA 3RLVA 1GTEA 3EWZA 4ORIA 5BMWA 2A4AA 4UCGA 2BWGA 2ABAA 5HWJA 4HNUA 4MUZA 2NX1A 4BFAA 1QPOA 4RZ6A 3B06A 2VFIA 1XBZA 1H61A 1JQVA 3H55A 4ZQNA 1JCMP 5AC7A 2WJZA 1YPIA 2CLFA 1KFBA 3HGOA 3MHFA 4IMDA 2RDUA 3B8DA 4JICA 4Z1DA 3NPUA 4FIRA 4JYEA 3GNNA 3EXRA 2CZ5A 3NQ2A 1GYLA 5D33A 2G96A 4JDYA 1JQXA 1VRDA 5D38A 3GB6A 3GK0A 2Z6IA 1K7EA 5EMUA 2H3BA 1FXPA 4OGZA 1LROA 3GLCA 3I7SA 3NR0A 3O63A 4CCCA 3W7CA 2ZZ1A 3EX3A 5KZEA 2QCCA 3U2OA 4BK9A 1TYGA 3EWYA 1BWKA 2WNQA 3W7KA 1M5WA 1W54A 1KM3A 1JVNA 2FJKA 1XXXA 3E9AA 2TRSA 4L4LA 4N4PA 4IMEA 3S6DA 1NAL1 5D37A 2OJPA 1MZHA 3GYEA 2Q8LA 4HNNA 3W86A 4MY1A 4MPQA 1DJNA 4GC4A 2X16A 3S5NA 4BI6A 1NF7A 3LCWA 3FLUA 4GNJA 3SY5A 2NUXA 3BW4A 4OBTA 4A2RA 5L9FA 1HO4A 3M44A 2GJLA 1IGSA 3DI1A 2PRMA 2WOQA 1L2UA 1EEPA 4HIBA 4LRTA 2OMAA 5HWMA 1OK6A 3USBA 2RFGA 1SSDA 3ZWTA 5D30A 3PUDA 4O15A 4O50A 1PHWA 4N4QA 1FDYA 3W2JA 5F1VA 3HMJG 4M7SA 2XN1A 3P8JA 3M1ZA 5DCDA 4CCDA 1I2QA 2VFEA 4LVDA 4LW7A 1S5VA 1FXQA 2HS6A 1YXCA 3UWVA 3ABSA 3O1NA 4FF7A 4MFEA 1OF8A 1EX5A 2O7QA 3NQGA 4XBSA 3S1WA 2Q3RA 1TB3A 3EKZA 2WQPA 3KVKA 1IXOA 1XM3A 3C6CA 4TMCA 4NX5A 4JIPA 2CLKA 3EXTA 3W23A 3I65A 3TQ0A 3W75A 3P60A 5CZTA 4FHAA 2DORA 3T44A 1H7PA 1GVRA 3EEGA 3SR7A 4DF1A 4BI5A 3Q58A 2C14A 5AHEA 3N9SA 4KFNA 4POCA 5LSMA 2WSRA 3KRUA 1PL9A 3NQMA 3B05A 5D2TA 1AG1O 5AN7A 3NL6A 1H7RA 1XUUA 1W3NA 3GAKA 3L2IA 3TJXA 5IBXA 5KZMA 5LNRA 5BOOA 1F76A 3S1VA 3QPYA 5FI8A 3OEXA 1GJPA 2CZDA 3QFEA 5EY5A 3WFAA 5LZLA 4OT7A 2NXIA 1MEHA 4TU1A 4NX0A 3QH2A 1IIHA 3W88A 3UZ5A 5C55A 3Q94A 2PURA 2C16A 3V75A 3BG5A 3ATZA 4MY9A 2E6YA 5C6MA 4UFLA 3HPZA 4HKPA 2QDHA 1TV5A 4WZHA 3WK2A 1WAUA 4YWIA 3A24A 5FEXA 2ZQ0A 3R12A 4GUFA 1B9BA 5AB3A 2ZFAA 1J4EA 4UTHA 2AGKA 1IXNA 4GFSA 4UTJA 3G1XA 1SO3A 4W9TA 2UV8G 4RCXA 2J6XA 1EA0A 4ADUA 2VFGA 1Z42A 4WJEA 5AOUA 3UPWA 5K2ZA 3W7QA 1DORA 1JUBA 3GXTA 1Q3NA 2ZRYA 3UZJA 3WK0A 3L66A 3ABRA 3R13A 4UXDA 4K7YA 1I4NA 1DHPA 4NXSA 4O57A 4CQAA 3NQVA 4YLWA 2CLEA 2CLLA 2QCNA 3L68A 3LHWA 3TAKA 3E49A 4MYAA 1A5SA 3BV4A 5DLCA 4A21A 6ALDA 5AHFA 1W5QA 3RF9A 2FQIA 3DGRA 2VEIA 3NPWA 4H4IA 3GDLA 1X1ZA 2QDGA 4UFKA 1A5CA 1TRDA 1P5BA 5CZJA 4DO6A 2OCZA 1VHNA 5LKYA 4I7VA 1UASA 1G4EA 4HNTA 1VS1A 3G3DA 4N02A 4IGHA 2ZA3A 1PHQA 2ISVA 2H8ZA 3Q2DA 1FQ0A 2FFCA 2ZTJA 4AHOA 3LHZA 4XUGA 2VXNA 4I9AA 1OABA 3NVTA 4OHQA 3HQ1A 4UTTA 3S5OA 1TRIA 2C13A 2Z2UA 4ADSA 3NPVA 2C15A 2W0UA 2ZRXA 1ICPA 2NWRA 1K02A 3GR8A 4LS1A 2DZXA 1P0NA 5U4NA 5HINA 1QO5A 5IM51 4O19A 2JKEA 1OFRA 3EX4A 4P2VA 4M6QA 5AYZA 4J9JA 3E12A 4NJHA 1AW5A 3IGXA 2CZEA 2LLEA 1F5ZA 5IBXC 1O5KA 4JY9A 5HR6A 1K7FA 4YCOA 1JUEA 1KBIA 3BW3A 2WO5A 3P81A 2H8XA 3C52A 4JDBA 1KFEA 4DPPA 2YW4A 4NJKA 3EX2A 3P84A 4EIVA 2Y88A 3CU2A 1PS9A 4LUIA 5TIMA 3MYPA 3W84A 2A7PA 3M7WA 4ONVA 1SZNA 1OX6A 4IMCA 4WX2A 3W1AA 1VR6A 4S2CA 2RDWA 5I3KA 4AAJA 4KFOA 3L0KA 1SPQA 1IIGA 2GVLA 4LC6A 3QJAA 3SFKA 2B7OA 3M43A 4L4MA 4TMBA 3HF3A 3DFPA 1QR7A 2QCDB 2JK2A 1O4UA 1OX5A 3NEVA 2HTMA 5D09A 3F03K 3QRHA 4LVBA 5F4SA 4RR4A 3WK1A 4UFMA 3CT7A 2E68A 4K7VA 1ML1A 3TFCA 5HUOA 2ZTKA 3LCGA 3GKAA 1KA9F 2NZLA 4OV4A 1JCLA 3KVMA 2X1SA 1ZALA 3R5EA 3DI0A 4UTUA 3HPXA 4IJBA 1KM1A 4ZL1A 3G24A 3A9IA 3DHDA 3PF3A 1ONRA 1TTQA 5HUPA 3EWBX 3W1RA 3HB9A 4G1KA 3IIZA 4O28A 5CKSA 3VKJA 1Q6OA 4BWLA 3A21A 3CC1A 4CQ8A 4C1LA 2EHHA 1MEIA 1TPUA 1YDNA 2QCEA 3M5YA 3PB2A 3CTLA 1N55A 3T55A 2R14A 1OX4A 4FIQA 3FOKA 3DZ1A 1KV5A 4UTTC 4WOZA 3FYPA 4LV9A 2YGYA 5K9XA 3B0UX 2H90A 1AW2A 2F84A 4YMZA 3FFSA 5FF3A 4Y96A 3G0XA 5HR7A 1X8FA 3ZWSA 1LRNA 3CIXA 3UY7A 2ZZ4A 1LCOA 3W76A 1EIXA 2GQ8A 3NYZA 2PRLA 2FPTA 1H1YA 4JN6A 2A6LA 3CIWA 4LVAA 4WY0A 4DEFA 3VNDA 1O94A 4P61A 1FCUA 1WX0A 1W3TA 4QAIA 2WSQA 2QEZA 3TC7A 1OK4A 3B4UA 3P62A 5DY3A 3LHUA 4ZMGA 5D02A 2X1UA 4WUIA 3L0NA 5CPNA 1GVQA 2NV1A 3HGSA 4UR7A 1GVSA 3W22A 4AWUA 6TIMA 3HGRA 2ATSA 5T26A 2V9DA 3W1UA 1RD5A 1TTJA 1HUVA 1VH7A 4IQLA 3O06A 4DPQA 1GQNA 3W7HA 4HPXA 2NXGA 1QNVA 3K30A 3KVLA 1K7XA 1I2RA 1YYAA 2ZZ2A 3PSWA 5BMXA 1XCFA 2ZCGA 1EP1A 3N9RA 3B04A 4N9BA 3JR2A 3ZR4A 5EYWA 2NUYA 3GIYA 4E38A 5DN1A 3OVPA 3QMTA 5DBUA 3OHIA 3BW2A 5H91A 3NQFA 4XTIA 3QF0A 3QC3A 3NPXA 3QMSA 5D04C 1SW0A 3DAQA 3C2OA 3M16A 3TROA 1HFBA 4ZQMA 4QNEA 1KLZA 2QJHA 1QOQA 5G5IA 3LOTA 3W1MA 1V7YA 4LV4A 2V82A 2A1YA 3TJLA 3T4CA 2BZNA 2P10A 4JGDA 1CX9A 3SIZA 2TMDA 4R53A 1G69A 1JCYA 1LOQA 4C1KA 4Z0SA 3HG5A 3KAOA 1ZAIA 3N73A 3LXBA 3M6YA 4BWLC 4JS3A 5F2MA 1OJXA 3HPSA 5U7SA 4O1AA 3MP5A 2H3DA 2QCGA 3QEZA 4FX8A 1TPVA 1OG0A 1TPEA 1RQEA 1YXYA 1PCWA 5LNSA 3TV8A 1K03A 3CHVA 3LCIA 1ME7A 4UTIA 5D2WA 1XI3A 4FEZA 2I1OA 3A5VA 1RR2A 3OVRA 3STGA 3THAA 2NX9A 5GVJA 5J5DA 3SGZA 3I7RA 4XTDA 7TIMA 1PVNA 1C9DA 5FF7A 1WXJA 1RVGA 4LNYA 3HOJA 2Z1BA 3S1UA 3W2UA 1B4KA 1TPC1 1WBJA 3F4NA 3G1DA 2PCQA 3L0GA 4K39A 2VOMA 4IMGA 3TW6A 2V8ZA 3IEBA 2VC6A 3VCRA 5DELA 4WXYA 3PR2A 1YADA 3CB8A 5BNKA 2VFFA 4FNQA 4N6FA 2O7SA 4S2BA 4YL2A 1ADOA 4RV8A 1T8XA 4LVFA 4JIQA 4X3ZA 2JGYA 3L65A 3PBYA 1Q45A 2DU2A 2QUVA 2E6DA 2XN2A 3LM7A 4UIOA 1KTCA 4NNCA 4JTIA 4GBUA 4Q33A 5G4EA 3NL5A 2DJLA 1K8ZA 2GJNA 4AEOA 2CLHA 1I2OA 2VELA 5G2HA 3P7YA 3HG4A 1G6CA 3W7RA 1VPXA 2EAWA 3UY8A 4JX6A 3QMRA 1SFLA 5AHNA 4UTLA 3KOFA 1GYNA 3FS2A 3STEA 1EUNA 1H62A 1TJRA 1W37A 3UXDA 5G4WA 2BLEA 3G8RA 1XC4A 5FEWA 1ZY9A 3LBMA 3PAJA 2A85A 1A5BA 3W87A 1WBHA 2E6AA 2QAPA 3UXAA 4EF9A 2X1TA 1EWEA 3DFTA 2B0MA 3MP4A 4X2RA 1OYCA 5FESA 3Q37A 2E1DA 3NM1A 1N7KA 5D05A 2G5WA 1Y0EA 3ELFA 3BLIA 3G1FA 3TSMA 3W2MA 1H7WA 3BVJA 1O95A 4KKXA 2E5DA 3UWQA 1GEQA 2DZVA 4A29A 3LERA 4LUJA 4UTWA 2YW3A 3NZ1A 4FO4A 3IVSA 2Y70A 1KFLA 2I9EA 1NVMA 1LM1A 2DZWA 2E6FA 4DBDA 1D9EA 3G1SA 3G1VA 3PUEA 3PBVA 3SSJA 2A6NA 4JTKA 3IV3A 4WY0F 4LC8A 2QCLA 4IX0A 2ZYFA 4O1DA 3BO9A 3D0CA 5EBUA 1TIMA 1F2JA 2ZA1A 2Y7GA 4DO5A 5CZSA 5F4XA 1G4PA 4K6AA 1GVFA 3PB0A 4ZQPA 1AMKA 1GT8A 3QM3A 5E1QA 4UFIA 3TQKA 4PODA 1TSIA 3NAVA 3G18A 1Z41A 2DZPA 1TPB1 1PIIA 3STFA 2VKZG 3PS7A 1SU5A 4AF0A 4AHQA 4QNWA 3LRMA 4GRSA 1J2WA 3BG9A 3JRKA 2ZZ3A 1R2SA 1TCDA 4X9SA 2A2IA 3BLFA 1OFAA 4A22A 1QPQA 1N8FA 3C2RA 3WJYA 1X1OA 3TXZA 4E2BA 3U8GA 1TJPA 3CEUA 1M6JA 3UPBA 1S3HA 1VLWA 2R94A 2NX3A 3DU0A 2FTPA 3GR7A 5J5RA 2GQ9A 1TV7A 1ZFJA 4AWSA 3CWOX 1LTDA 4IXXA 1DL3A 4GUIA 5C54A 3LB0A 3KXQA 5MHBA 3DKLA 2YYUA 3WJZA 3IVUA 4Y9AA 3FIGA 1XFBA 1Z44A 4IUOA 4XKYA 1VZWA 3NOEA 1SUXA 4JYFA 1WOBA 3M5XA 3W9ZA 4ICNA 3CPRA 3HBLA 1G4TA 3LHTA 5K9DA 3EX1A 1VQTA 3I6RA 2J24A 3FEMA 3EKLA 5D2VA 3W7MA 1JCJA 1FCVA 3W2KA 1T0OA 1ICQA 5LGXA 1DJQA 1W1ZA 3YPIA 3OBKA 1ALDA 2IQTA 3QSTA 2ATMA 3IIPA 2KZHA 4LVGA 1YLVA 2DP3A 3DH7A 4JTLA 2ZZ6A 4UTKA 4NVTA 1O60A 1GZGA 3LCXA 1OX4B 2V2HA 5AYXA 1Z48A 1OFDA 3NQCA 1V5XA 1FUYA 1EWDA 2RKXA 4OQVA 4NUWA 1B57A 1RQBA 3C4UA 2DZTA 3C8FA 3PBWA 2EF9A 5TQLA 3W7NA 2A5HA 3VE7A 2BX7A 4UUIA 3QQ1A 3IIXA 2HSAA 3QW3A 3PSVA 4HNVA 1MO0A 4LOCA 4ZVJA 1Q6LA 3W6YA 2YCEA 3W3OA 4FXRA 4E2DA 1R46A 4KWVA 3VI2A 4O11A 2QR6A 5CZ0A 1WDWA 1OFBA 1EP2A 3SI9A 3M5VA 2Z0IA 3C2VA 2JBMA 4OWGA 2XN0A 2E5BA 3TMQA 4XWUA 4LRSA 5KMYA 4UC5A 5LHFA 3BG3A 3M41A 4IWWA 3O8AA 3TSBA 1H7XA 2CU0A 1TREA 1L6SA 4RJEA 1TPWA 3DFSA 5CPMA 3STCA 3BGJA 1YTEA 4IPIA 3UWYA 2Y61A 2CLMA 2HS8A 2EPHA 1XBYA 2OT0A 4RX0A 5D2XA 4CCEA 4H6KA 3LTPA 2A21A 3R89A 1G7VA 3V1PA 1TMHA 1F74A 4RLIA 2QCMA 3TDFA 3DBPA 3GDTA 1LRQA 4MZ8A 4MFDA 3NQ8A 3O6YX 1PV8A 1WQ5A 3G8EA 3NGJA 1LYXA 4FXSA 3NQDA 2YXGA 2Q8ZA 4O1CA 3DENA 2BSLA 2WSYA 2ZZ7A 4NU7A 2J9ZA 4GXMA 1H51A 1UUOA 3LXAA 2B7QA 3W1XA 4ZQOA 4N2YA 1KM6A 5CGQA 5H2ZA 3TCEA 1KM0A 4N9CA 5EPDA 5KSWA 3LTSA 4KFPA 1YTDA 1QFEA 4JTHA 3ZS4A 3L5LA 3OIXA 1GWJA 1A5AA 2GPTA 4LTSA 3RNDA 4ORMA 1XDMA 4O16A 1SO4A 4AXKA 3A5FA 3LDVA 3E96A 5A8GA 4PFMA 3LI1A 3DKJA 5F4WA 1AW1A 4FNRA 1KM5A 5CPLA 1KFCA 4EOUA 2YYTA 3TU9A 4PL1A 4NXKA 5FF4A 3H54A 4Z1CA 1THFD 5K9CA 3OVQA 4IMFA 1VJIA 1AK5A 3UQNA 1RQHA 3NL3A 3M0ZA 3EWXA 3B0VC 3C2FA 4NZJA 5SWUA 3S42A 2YFOA 3C3NA 1K8YA 3QW4B 3MW7A 5E0KA 4ML9A 3UNDA 3FJLA 2C0AA 3MI2A 4ZZ9A 2QUTA 4GUHA 1NFBA 3TXVA 4TR9A 3W1PA 2AQWA 1ZNNA 3ABQA 2R91A 1F7BA 5DXXA 1NEYA 4R33A 5AHIA 1Q6RA 1D3GA 3ATYA 5E93A 2ZDRA 5HMSA 2PC4A 4NJIA 3CLMA 3KX6A 3P80A 3IGUA 2OZ0A 3F4WA 3G3MA 3VE9A 4UMCA 3MO7A 2Y85A 4JTSA 5EL1A 4UNKA 1R30A 2B4GA 3P61A 2QAFA 3FKRA 1GVOA 1TV8A 2NWSA 4I7UA 2YDAA 3N3MA 4MJMA 4CNOA 3UYCA 3IIOA 3O6CA 3TX9A 2Y7EA 2W6RA 5CPOA 4YXGA 1QDSA 4B5NA 2DZSA 2E5CA 5HNRA 3GXNA 1DOSA 4HSOA 1JJKA 1FCQA 3LHVA 3LCLA 3TE9A 3P74A 4DO4A 4M5PA 5BW6A 1ME9A 8TIMA 3LRLA 2RDTA 1TTPA 3T7VA 4JTJA 3TW7A 1GG0A 4UFJA 4PEKA 2GOUA 2A7NA 4JY8A 1R2RA 1AL8A 1QPRA 5CSRA 4NT0A 3P82A 1WYIA 1XBVA 5KINA 2G97A 3KVJA 3P8IA 2YFNA 3IIVA 4N9EA 4IOTA 2I14A 3EB2A 4EVZA 3IVTA 1I8JA 1K3UA 1QWGA 1ZJIA 2BTMA 4JTEA 4OV9A 5AHMA 3DFNA 1J5TA 5G1YA 1OYBA 4Z1BA 1TPFA 4O12A 3INPA 4R7JA 4OU1A 4IPJA 3MBDA 3W85A 1UJPA 3FYOA 2VEKA 5CG7A 1BKSA 1G7UA 3RFAA 2Y62A 4QJ1A 1EUAA 3F1QA 3MHUA 1IXPA 1KTNA 1SSGA 1TPDA 1TQXA 2VEPA 2Y6ZA 3W1LA 4DQWA 1KFKA 1DQWA 5DCEA 1UBSA 4CNPA 4I7WA 1GPWA 3G0UA 2VFDA 4GUGA 1QO2A 4QQ3A 3NL2A 1FBAA 1OFQA 1QCWA 1R2TA 3W7IA 3LHYA 1JCNA 1DBTA 1WA3A 2FB2A 4NNBA 4CLMA 1VGAA 2X30A 1F6KA 1C29A 4JEQA 2C19A 2FLIA 2V30A 2WNZA 3W70A 3RLUA 3PC0A 4JTTA 4WD0A 2Y7DA 2CWNA 1VYRA 5FF2A 1BWLA 1H50A 2GQAA 1OFEA 5DY2A 4BF9A 4JX5A 1PCKA 3CQ0A 1CW2A 1T99A 4DF2A 4DXVA 4PH6A 1VYSX 1S5TA 4M19A 2QF7A 4DBEA 5LNUA 2FB3A 2NV2A 1SFJA 1JULA 2XFWA 4AF0B 1DKWA 4O53A 3KHJA 4EWND 4N9DA 3L21A 2C3ZA 4A3UA 1HTIA 3TA6A 2WPBA 2ABBA 3NQEA 5EA9A 3L5AA 3W7LA 1LLWA 1IXQA 1ICSA 4UFHA 4HSNA 5DBTA 2FPVA 1A53A 3ANYA 5F2IA 4MJZA 2TPSA 3TC6A 2CZFA 1PE1A 4NQ1A 1U5JA 2ZRVA 3HO8A 2QCHA 1QPNA 3A22A 5K7JA 1W56A 1KV8A 3NQ6A 1U83A 1JR1A 3OG3A 4N6EA 4PA8A 2WV8A 3LX9A 4JX4A 4XKYB 3RK8A 3TMLA 1WV2A 3W1QA 2QCFA 1DVJA 1SW3A 3DFOA 1OFPA 4LS2A 3TAOA 3QQ0A 1UUMA 3H53A 1M7OA 1QOPA 3WJSA 4EF8A 3WJXA 1W8SA 1FWNA 4ZQCA 4KWWA 3BARA 2A0NA 1W5PA 4RZ5A 5I3GA 1BTMA 2CW6A 2P1FA 5I3HA 4JTGA 4UMBA 1YDOA 3LBCA 4JR5A 3MP3A 4TIMA 2CLIA 1FWTA 3IGSA 5L6UA 1E51A 1YTKA 3M5ZA 1XL9A 2TSYA 3T40A 1OFOA 4NNAA 3W7OA 4LT9A 3B0PA 4HT3A 2W79A 1TO3A 1FDZA 1LLZA 1X6UA 2F7FA 3KRSA 3NQ7A 3E02A 4O52A 2CLOA 1OYAA 2HMCA 4FNSA 1SR9A 1XBXA 4FNTA 2BXVA 4AMAA 4AH7A 4M7TA 3KRZA 1LBFA 4RZ4A 2H6RA 2ZRWA 1RPXA 1A50A 3TKFA 2OT1A 4R34A 1LP6A 2GVJA 1I2NA 5HULA 1FWWA 1KFJA 2ISWA 3LLDA 4AB4A 2QUUA 4H3DA 2YX0A 3LLFA 2NLIA 4MVAA 4QIUA 3C56A 3E0IA 4AWTA 5CSSA 3W1NA 4O0ZA 4K37A 1X7FA 2EGZA 2R8WA 4E0CA 1SW7A 2B7PA 2GVGA 3O05A 5KITA 3P5YA 1G4SA 1XUZA 4Y6GA 3PWAA 4LY8A 4ZQRA 3AJXA 3TIMA 3TUUA 1W3IA 4S1FA 5F1UA 1T96A 3LCFA 3NM3A 1W5MA 2ZA2A 1LBMA 2RH9A 3O07A 3I7QA 1OVDA 4TO8A 3HG2A 1W5OA 4UR8A 3O15A 4QM1A 1UB3A 4MKNA 2X1RA 3GAYA 2PRHA 4FX7A 3W1TA 5G2IA 1P4CA 3L9CA 3C0JA 3MUXA 4AVFA 5TBOA 2DJXA 3QZEA 3S5ZA 2ALDA 5D03A 3PUOA 1BEUA 1GTHA 5AC6A 1CI1A 1VCGA 2WNNA 1P1XA 1H7NA 3R2GA 1JUKA 1VCVA 4O4WA 3W7DA 1IF2A 4XQ6A 3FA5A 4UTMA 4PTNA 5F2GA 3GKFA 3BLEA 3W72A 2YR1A 1L9WA 4Y8FA 3SZ8A 2B7NA 3I68A 5DXYA 1Q6QA 1H1ZA 5K3VA 5HJLA 5I3JA 1SZGA 3ZFHA 1WOAA 3P5ZA 5I3IA 3L5MA 4GE8A 4K38A 1H7OA 2Y63A 3RMJA 5LGZA 3SW6A 1QMLA 1D3HA 2YSWA 1K8XA 1VC4A 4X22A 4O0KA 4NJJA 4WQ6A 1SO6A 4O8RA 1FCBA 4JTFA 5LHEA 2PE4A 1OF6A 2D73A 5LNVA 1OHLA 1LZOA 3UD6A 3NDOA 1LDCA 2VFHA 5FF0A 1R47A 3G1HA 2J9YA 5KTLA 1HG3A 1EPXA 1RZMA 3VFLA 4QSHA 3W2LA 4FB7A 4UTWC 5ABTA 4RK8A 1FX6A 4GUJA 3LRKA 1HO1A 2E09A 3WK3A 3AO0A 3BK0A 3NXFA 4DF0A 1LOLA 4Z1AA 5HWNA 3TNOA 2ZRZA 3MWAA 2FDSA 4BR1A 1MEWA 4RXGA 3W71A 4U28A 1W0MA 4MYXA 3TSDA 1H5YA 4BI7A 4JD4A 3G0SA 1ZAJA 1TPH1 4NZFA 4Q32A 1TQJA 1W5NA 4O13A 3SJ3A 4ADTA 3M47A 2FIQA 4WY0B 4FNUA 3LV6A 3NNTA 4RKAA 2J9XA 5HQEA 3NO5A 3LCHA 3LGEA 3HIJA 2ISSA 3GVGA 1B4EA 1UCWA 1EB3A 3W07A 4A2SA 4HPJA 3O6DA 1S5WA 3S8HA 3GNDA 1L6YA 4ALDA 3FJ6A 4JTUA 3GZ3A 3PULA 1H63A 3W7PA 5I3FA 2NUWA 1VYPX 3N2MA 2V0TA 4O54A 2A7RA 4JNMA 4O4VA 5K4ZA 1ZENA 1MSSA 1JRCA 4MZ1A 2Y89A 4O14A 1XKYA 4MY8A 1JRBA 2P0OA 1NSJA 2V2CA 4IX2A 3UWZA 3ABOA 3IRDA 4O1BA 3QYQA 3UWWA 1GOXA 3S1XA 1NF0A 2J27A 2V81A 3UWUA 2TYSA 3W73A 1SZEA 3G1AA 4K8HA 2QJIA 4PL2A 5BRBA 4LWWA 1O5XA 1ZAHA 3CWNA 1LRTA 4OE7A 1RV8A 4PC8A 3HG3A 2G95A 2C1HA 1JCXA 2ZBTA 3EX6A 1TTIA 1ZCOA 3MI6A 1I2PA 3MJYA 2J88A 3QPZA 1VCFA 3GDKA 2Q3OA 2QJGA 3C2EA 3BPWA 2QKFA 1YPFA 4FNPA 1KM4A 5A5WA 3TH6A 3MI3A 3EWUA 3PVFA 5AC8A 3DFQA 3W7EA 1FWSA 1YXDA 3NQAA 3KFTA 5AFDA 3LXCA 2C6QA 1GG1A 1H60A 4MIMA 5C5YA 3WJWA 2E77A 4GJ1A 3FKKA 4Z08A 4HN4A 2VEMA 1EP3A 1I45A 5FEPA 3DHFA 3A23A 2NXHA 1ZHAA 5K4XA 3PG9A 2YZRA 4LS0A 5DCBA 2GUUA 3C61A 4UNLA 4NJGA 3PM6A 3LI0A 4M6VA 4Q4KA 5C2XA 4O10A 5AYYA 4XZ9A 4JYDA 3MHGA 4QITA 1B3OA 2Y7FA 1F6PA 3PY2A 4QISA 3U6WA 3TK7A 5FEZA 1G67A 5AHLA 4GWEA 3GXPA 2EKCA 3W7GA 2V5BA 4MOZA 4MLJA 5G2WA 3S0CA 2CFFA 1KBJA 3GX9A 4FX6M 4DELA 1LORA 4Y90A 1W31A 2FPYA 4XBKA 2JGQA 3S5YA 4PCFA 3DXIA 3BGGA 1FDJA 3MYOA 3T78A 1C8VA 1KTBA 3P67A 4AHPA 3L67A 3CEPA 1KLYA 1SQ7A 4TX9A 4CQ9A 5G1TA 3NG3A 4M6PA 3R8RA 1QAPA 3M9YA 3TR2A 5LNWA 3EXSA 1SZFA 4RXFA 3RU6A 3SGUA 3TFXA 3N34A 1HL2A 3W7JA 1LOSA 3GDMA 4Z0JA 4D2JA 3B03A 3G1YA 4K36A 3GDRA 1FWRA 3LV5A 1XDLA 3NZRA 4WOQA 4O18A 3W74A 3W83A 1SO5A 5EKYA 3PG8A 2JKPA 2RHGA 4LU0A 3SECA 4U4MA 3JS3A 2QCDA 1DV7A 2DZUA 2X2GA 4MZYA 1F73A 2C18A 3N19B 5D2YA 5F2LA 1ME8A 3MBFA 2WKJA 2V2DA 3PBUA 3EWWA 1FY6A 1F05A 2AAMA 3HJZA 1DQXA 2OX1A 2JKAA 5D32A 2ZZ5A 3THQA 3O16A 1M7PA 3CM4A 4WXZA 1YDVA 1P0KA 1VHCA 1AL7A 2VENA 3TQVA 1LBLA 2Z6JA 4JXCA 1L6WA 4O17A 4YCPA 3G22A 3MMTA 3N14A 1VLIA 3S9YA 4MLRA 3W2NA 3HGJA 2YPIA 3N2XA 5KZDA 4HHPA 4K8EA 4UMAA 3QSRA 3NA8A 3OA3A 4CNNA 1KW1A 3LTYA 2ZRUA
chains in the Genus database with same CATH superfamily
2DSWA 3W82A 1RY8A 1AQ0A 3LK6A 2PWHA 1GTEA 3EWZA 1Q8JA 4ORIA 1S2UA 1EHNA 3FGCA 2ABAA 4HA0A 5HWJA 4L80A 2NX1A 5LIUX 3EB4A 1V0KA 3QTPA 4ZQNA 1JCMP 2CLFA 3OW1A 4GXWA 4B4FA 4IMDA 2RDUA 4HTBA 3B8DA 2DFAA 1T6MA 2CZ5A 4GVIA 1KWGA 4CD4A 3RIKA 5D33A 2I5IA 3WQOA 1E5NA 3QY7A 3U5YA 1VFSA 5EMUA 4H6QA 4OGZA 3S2LA 4WHBA 2VEGA 1XPYA 5E70A 3CBWA 4CCCA 2O4MA 2ZZ1A 3EX3A 4QG9A 3U2OA 3EWYA 2WNQA 4JTRA 1W54A 2PWGA 3MPGA 1CCWB 2Z1VA 2CZVA 3TOPA 1XLHA 4U2ZA 1AUSL 5D37A 2FHCA 5HK4A 2OJPA 1MZHA 3GYEA 2Q8LA 3URQA 3QLLA 4MY1A 3T0CA 5CBBA 1DJNA 1ZU8A 1NF7A 3LCWA 5EFFA 3FLUA 2VCAA 3SY5A 4MSSA 4DO7A 1EXPA 3M44A 4JFTA 1IGSA 3DI1A 3S2CA 3SDOA 2DSKA 2XINA 4JCLA 1EEPA 3UCCA 2OMAA 3WFLA 1IWAA 1SSDA 2Y5SA 4N4QA 4NAFA 3HMJG 1XLCA 2XN1A 3UP8A 3ZZ1A 1E6QM 2E25A 4LVDA 4LW7A 1YXCA 1R3SA 3ABSA 1UOKA 1NQ6A 4FF7A 1WB0A 1EX5A 4HYVA 1E9ZB 4CVUA 4DYEA 5FKYA 3KVKA 4TMCA 1JPDX 4NX5A 4P7RA 3RN6A 3ZSSA 5C71A 1JF5A 3EXTA 3I4EA 1XLIA 4W7WA 3R25A 3TQ0A 4D6DA 3W75A 5HNTA 2FVLA 4Q6XA 3CHDA 3AI0A 5HQMA 3H2AA 3HV8A 1GVRA 1SMAA 4POCA 1S1PA 5LSMA 2EO7A 3VXGA 1EKOA 5AN7A 4ACYA 4Q8OA 4GCXA 4GZIA 5ABFB 5LNRA 4LUSA 2Y8UA 4UQEA 3QPYA 3QFEA 3WFAA 5LZLA 2PU1A 2NXIA 4TU1A 1IIHA 3UZ5A 3LSCA 2PURA 5FIPA 3BG5A 4L61A 3BZJA 1DIDA 2HZGA 4XK2A 4YYCA 1Q2SA 2QDHA 1VFHA 4IQEA 3KDOA 3MCMA 1QT1A 1KR0A 3TN6A 1TVLA 2IKJA 4YWIA 3HPFA 2GDUA 3VKCA 1J4EA 3EAUA 2AGKA 3GM8A 3ITVA 4UTJA 2UV8G 2J6XA 1EA0A 1TVNA 1ZPTA 1CGUA 1LUCA 1EJVC 1H11A 1EO7A 3K8KA 3NQVA 4DUVA 3L68A 3E49A 5I07A 1C90A 4MYAA 4LB3A 4A21A 5AC4A 4KW2A 4US6A 3ZT6A 3VU2A 4XO7A 2AOSA 1D7FA 3ZT5A 2VEIA 3NPWA 1RY0A 1VFLA 4LNCA 4PUUA 3TEVA 5CZJA 4AX7A 4S38A 4DUWA 3JW7A 3B97A 2AAAA 4EWJA 3L4WA 1G4EA 4HNTA 3HTWA 4EPEC 1XIBA 3WQPA 4MDOA 1CECA 3WBXA 4LBSA 1K9EA 3TYCA 4OBSA 3KZSA 4L56A 4M1RA 2DVTA 2UBPC 4XUGA 2HE8A 1OABA 4UTTA 3SQLA 1TRIA 2W0UA 5I09A 3EOOA 1UR9A 4YVVA 3WG6A 2ZUMA 2JKEA 3EX4A 4P2VA 4CEUC 4UOJA 3QGKC 3VOFA 4NJHA 2CZEA 2PUZA 4US5A 1AZ2A 3TYAA 4RE3A 4YCOA 1JUEA 4HCHA 2QGYA 5FJRA 2WO5A 3VIJA 3P81A 2O55A 2IS7A 4IGMA 4KWUA 2NLYA 4L5ZA 1PYFA 3VKDA 3CU2A 4LUIA 1EC9A 3RILA 3MYPA 3W84A 2A7PA 2FZDA 2OLSA 5B80A 2HXTA 1OX6A 3CHCA 2XFFA 4JQAA 1HP4A 1VR6A 3UCDA 3ZO9A 3UF9A 2RDWA 3OZOA 4AAJA 2I7GA 2GGHA 4DYKA 1SPQA 2R6OA 4MDPA 5EMLA 4LC6A 3NURA 1XLKA 2YLLA 5E0FA 3UR2A 4KERA 4EXQA 2CBUA 1Q7QA 2QCDB 1O4UA 3NEVA 3F03K 5E9XA 3WK1A 3QZAA 1EC8A 2G8ZA 2WMKA 1A4LA 1R3QA 1ML1A 2AQVA 1O5RA 4LUTB 2ZTKA 4GYPA 4MB4A 2R82A 3SRDA 2X1SA 3AISA 4C1NA 3R5EA 2ZWZA 1V8EA 1ODZA 4QLLA 4ZL1A 1JFHA 3E6EA 3FJ4A 1P7TA 4KETA 2HBVA 1K9DA 3VD9A 4ICMA 5CKSA 2R1MA 4BWLA 4YTSA 5B7ZA 3E2RA 1PAMA 4CQ8A 3CC1A 4GACA 4C1LA 3MUCA 4A3YA 4PRRA 3ITOA 1P0DA 3IAPA 3F4CA 5JXQA 2OYLA 1T40A 4Y2WA 1OX4A 3FOKA 2PDLA 1AA1B 3DZ1A 4J1OA 3FYPA 1GOIA 3WLKX 2YGYA 2H90A 1AW2A 4NAEA 5FF3A 3ITTA 1EJRC 1KFWA 3VILA 1XRSA 1LRNA 2VZOA 1LCOA 3WLPA 1TZZA 2GQ8A 2PRLA 4Z42C 2YCKX 4HA1A 3CIWA 4LVAA 4D1JA 4WY0A 4QX4A 3TYBA 3VD4A 1UKQA 1PWMA 1W1A1 2B81A 4P61A 4DJEA 2QEZA 3EDJA 3TC7A 2YL6A 5A8NA 4NZCA 3MC5A 1DIEA 2NV1A 3AIQA 1GVSA 9CGTA 1JZ3A 3FEQA 4MGGA 1RD5A 4RNFA 2E4TA 3O06A 4DPQA 4HPXA 4DN1A 3WQFA 4NP7A 3AIRA 1I2RA 3D3AA 2ZZ2A 3PSWA 1XCFA 3BC9A 3VD3A 4GVGA 1V0LA 1WAWA 3QMTA 4JFVA 3QF0A 4AC1X 3OLGA 5D04C 3QVQA 4K8GA 1BYCA 1E4MM 1YPXA 3M16A 3SN0A 4QNEA 3F5JA 3WQ8A 1BVNP 1KD0A 2O9OA 1V7YA 4LV4A 7ENLA 2PA6A 2OVLA 5ABGA 3NJ3A 1EJXC 2TMDA 4AZBA 1G69A 1JCYA 4C1KA 2PLCA 1LLOA 3L7RA 3LXBA 1XLLA 1Q2RA 4EK7A 5F2MA 3QHNA 3SN4A 3CUXA 3MP5A 2KX9A 2H3DA 4GISA 4Y9MA 1B3VA 1EIBA 1TPEA 4TVCA 3UETA 3H2MA 4DNMA 1TA3A 3TV8A 2VUNA 3CHVA 2NT0A 1HN1A 2BHUA 1ME7A 4IJRA 3AIVA 3QKZA 1D8WA 2PDNA 3A5VA 3NDZA 2NQ5A 5H6HA 4Q8VA 4MWAB 4B2DD 3U4AA 2Y5EA 1C9DA 5I3DA 4MB5A 1RVGA 4HZ6A 4LNYA 4JKMA 1A4MA 1BQCA 1K70A 2PDMA 3F4NA 4Z2HA 2PCQA 3RO6A 4B9YA 1XYFA 2VC6A 3VCRA 4HN8A 3H2OA 5DELA 5I6SA 2VC9A 3GE7A 1XRFA 1JDAA 2NQHA 4KEZA 2O7SA 4LGXA 1T8XA 1LQ2A 1OZMA 3O0KA 1CGYA 2X40A 2HISA 2QYGA 4GLEA 1Q6DA 1B3YA 3L65A 4GJIA 3PBYA 2DU2A 2XN2A 4UIOA 4FOUA 4NNCA 4JTIA 4GBUA 2DJLA 1HJWA 1I2OA 3PZOA 1WKDA 1RPKA 3SM0A 3SURA 4GXPA 3ABZA 3QMRA 1BFNA 1SFLA 4F0KA 4UTLA 5AYBA 1Z89A 3KOFA 3FS2A 1JGIA 2D3LA 3H2NA 1EUNA 1KGXA 3H26A 4LSBA 1WUFA 2BLEA 5G4WA 1XC4A 2YL5A 1ZY9A 1ZBCA 3PAJA 3WLOA 1DWGM 3G77A 1WBHA 3H7VA 4QEEA 2F6XA 2E6AA 3UXAA 4IFOA 1EWEA 5AYIA 1OC7A 5FESA 3Q37A 2E1DA 1XYAA 1OZQA 1CGTA 3IJDA 2FH6A 4HHLA 3BLIA 1WDRA 3G1FA 1GKRA 3TSMA 3LS9A 4LALA 3BVJA 4RNJA 3KCOA 2FMNA 2G3IA 4A29A 5D9MA 3NZ1A 4FO4A 1KFLA 1NVMA 1P0EA 1UQZA 2DZWA 4Z1YA 4AMCA 1B3ZA 3G1SA 4H7CA 3TR9A 3SSJA 3B9AA 4A8RA 1TCMA 4AUBA 4O1DA 4AVOA 1W32A 4A35A 4DO5A 5FA5A 4QRNA 5CZSA 4K6AA 1AMKA 1GT8A 2XIBA 4HNOA 3QM3A 1Z7AA 3TQKA 2VM8A 4DZIA 4PODA 2A3HA 4PMRA 3C0LA 3PS7A 1E70M 3ES8A 4GRSA 1T41A 3JRKA 3FSUA 5IHRA 2EJ1A 3C2RA 3WJYA 1X1OA 4C6DA 3VKBA 3AIEA 3RMEA 3REQA 3QLDA 1M6JA 3CV2A 2W27A 1VLWA 4R9XA 3L4VA 1E4IA 1UKOA 3CNYA 3OHMB 3KWXA 4GHRA 3N15A 5HMFA 3LU2A 4H9ZA 5C54A 3L4UA 4M29A 3WLLA 1XFBA 1Z44A 3EOUA 3MMUA 4MTVA 1C9WA 4J5NA 4Q8UA 5E6YA 3NZGA 1XJBA 2IKIA 3M5XA 1QUMA 3CAWA 3W9ZA 2J8FA 5HNNA 3APYA 1K9TA 4WSKA 5D2VA 3WNLA 1E71M 1FCVA 1EZWA 1TMQA 1JZ5A 4AC7C 4F9DA 3YPIA 3OBKA 1ALDA 3KDNA 1CB2A 2E8YA 2BGNE 4LVGA 1YLVA 2WHLA 3TCSA 2VNCA 4IIGA 1GZGA 3LCXA 3VM5A 5AYXA 1J12A 4X60A 3WYZA 4RDZA 1XINA 3R4IA 2OO6A 3ZLFA 4GI9A 3VGBA 3F2DA 3MU7A 2OQYA 4L1GA 1J0ZA 1ENUA 3W27A 2XGIA 4FLRA 4KEUA 3RLGA 2Z4GA 4UUIA 4C6MA 3ZMRA 2HSAA 2ZX7A 3QW3A 3WQVA 2BFGA 2PCEA 2BY3A 4B9ZA 3OVGA 1MW1A 3T2OA 3O2LA 3SCUA 4AZHA 4NRRA 1JZ7A 2CEQA 1L2QA 4OWGA 2XN0A 2XG9A 4BF7A 5LHFA 3M41A 1RJQA 3O8AA 5JH1A 2CU0A 3OZYA 1L6SA 3SCTA 4RJEA 1JD9A 2VX5A 1NH6A 1YTEA 3AXHA 4KRZA 2Y61A 2CLMA 3F2BA 2EPHA 2OT0A 4M81A 2EG6A 3WMCA 4CCEA 2A21A 1G7VA 5ABFA 4LYKA 3ERPA 3PNUA 4XAZA 3VOIA 4FOKA 1W1YA 3O6YX 3WLSA 3NGJA 4HCLA 3BXWA 4Q8NA 3QOMA 2Q8ZA 3DENA 4H7VA 2ZZ7A 3PPHA 3EPMA 3ITXA 3WQ5A 3W1XA 5LIYX 1KM6A 7PTDA 3WD4A 5H2ZA 3KE0A 1MNZA 4N9CA 1DPMA 4KFPA 1DE5A 4JTHA 3ZS4A 5AZ0A 4C6EA 3ZQ9A 4FAMA 4LTSA 9XIAA 2OQHA 3U4FA 1S5MA 5I00A 5H8UA 4AXKA 4OECA 4IH3A 3A4AA 3UEQA 2XVLA 3LI1A 4IT1A 3DKJA 5F4WA 1AW1A 4FNRA 4DI8A 5FACA 1WO2A 1NWTA 2V3EA 1KFCA 4EOUA 5HNUA 2O0TA 3K8LA 4B91A 1XR2A 1XYMA 1THFD 1WP6A 3QV9A 1E6SM 2XVGA 5HJYA 3S42A 2YFOA 1K8YA 4W5ZA 1GOMA 2HRWA 3MI2A 2GJXB 4WSHA 3BWWA 1DWJM 3TXVA 1VEMA 4TR9A 1S5NA 3LM3A 1V4YA 3QYSA 5AHIA 1D3GA 4X63A 5E93A 4P5UA 4KCTA 5HMSA 1PDYA 4NJIA 4NL1A 4JQ2A 4WF7A 3G3MA 4PMYA 3V1HA 4GA8A 2Y85A 4JTSA 1R30A 1DJGA 2B4GA 4DY1A 2QAFA 2NWSA 3CAKA 4I7UA 4JFSA 2YDAA 4MJMA 1I75A 3VUPA 3GBEA 4ENLA 2ZICA 1BD0A 1R86A 3HURA 4IZGA 4ES4A 4GGHA 5A6BA 2QVHA 3UA3A 5HNRA 3GXNA 3P2VA 1JJKA 3LHVA 6XIAA 3RPDA 1XGZA 1ITXA 4HBKA 5BW6A 5D9NA 3QV6A 2RGLA 2OKTA 1XDJA 2RDTA 1TTPA 2BVWA 4JTJA 2GWGA 3T7VA 3TW7A 5LA1A 2I16A 4PEKA 3ARTA 5BZAA 1SVDA 4NF7A 4WIWA 1OSEA 3NSXA 1WYIA 3KVJA 1NELA 3E2VA 2AGTA 4NILA 3IIVA 4N9EA 3FY1A 4DM2A 4IOTA 4GYPC 3IK4A 4XO6A 4J3UA 5HMEA 1DXIA 1K3UA 2VT0A 1QWGA 1E1CB 4OV9A 1OYBA 1NY1A 3MVTA 4O12A 3INPA 2BY0A 2X1IA 4XBJA 3W85A 3FYOA 3RFAA 4QJ1A 3A12A 1UHVA 1EUAA 4LUTA 3LLXA 3ZOAA 2PF0A 3CS2A 4HK6A 4DQWA 1UBSA 3ZM8A 4CNPA 1OD8A 4LBUA 1FWDC 2QHAA 3NQBA 3WNOA 5CEWA 1CXLA 3WH5A 4AD5A 1FRBA 1R2TA 4AY8A 3W7IA 2EPMX 1JCNA 1WA3A 3W00A 3W70A 2WNZA 2FMOA 1M01A 3U0HA 4JTTA 2WMGA 3THCA 2WQDA 1TWZA 2TAAA 2YCJA 4LXFA 2FZ9A 1XP3A 3CQ0A 4Q7NA 4DJEC 4ECLA 3RG6A 5PTDA 4M19A 4DBEA 2ACQA 2NV2A 1EPVA 3AMCA 2OFJA 1JULA 4A6GA 4EWND 2XM2A 4J2PA 3L21A 2Z26A 3TA6A 3S9IA 2VO5A 2WPBA 3DCPA 4JHMA 1UOZA 1A5UA 3GVQA 1YBQA 1R9YA 5BCAA 4QXIA 3TC6A 3U3HA 1PE1A 3AXXA 2ZRVA 1HJUA 1GOQA 2QCHA 3R0KA 4PUNA 2INZA 3A22A 3UR5A 4GG9A 5K7JA 3R1ZA 2XUCA 3NQ6A 5AY7A 4PA8A 1EXBA 3RPTA 1R87A 5HDRA 1SW3A 3DFOA 4LS2A 4D9PA 1ONXA 4N7QA 3QQ0A 4IMAA 1S2CA 1WXYA 4GJJA 7XIMA 4KCUA 4QJ4B 4J27A 1M7OA 1ZLPA 1MNSA 1EBGA 3SFWA 2O9RA 1W5PA 1BTMA 1C8XA 5I3HA 2Z00A 3KOZA 4YJ5A 2CXGA 2DGAA 4JR5A 2WMJA 4L65A 5L6UA 4XX6A 1UP3A 3SO7A 1XL9A 1HKIA 5FJJA 3T40A 5A1AA 4E2OA 2F7FA 1LLZA 3E02A 3GNOA 4S3BA 1YDYA 2G4FA 1NFGA 3UBPC 1UYQA 2BXVA 3KOWA 4AMAA 4AH7A 4M7TA 2W62A 3AOFA 3GU1A 1H1NA 2H6RA 4RZ4A 3ZJKA 3M64A 3B9DA 2WZTA 2QGHA 1LP6A 2VR4A 2EQDA 1XYBA 4QQUA 2GGJA 3NDYA 1UD6A 2ISWA 2E9BA 2QUUA 2YX0A 3AS2A 2NLIA 1Q6FA 3B40A 3C56A 4RPPA 3SBFA 4PSRA 3A9BA 3W1NA 1JDEA 4KEMA 2YDSA 4MPKA 1G4SA 4IPPA 3LZ5A 3PWAA 3AJXA 3KOXA 4RNHA 5F1UA 3LCFA 5A6AA 1W5MA 1LBMA 3A64A 3O07A 2OEJA 3GG8A 4MKNA 3MKCA 3N11A 4FX7A 4GABA 3MTWA 3UESA 8RUCA 3MUXA 4AVFA 4MWAE 4IGSA 2DH2A 3CYVA 4K68A 4KCWA 3S5ZA 1W2VA 2CHNA 4AIBA 2TODA 1MMFA 4OOZA 5AC6A 2NQZA 1EF3A 5A6TC 1P1XA 3R2GA 1JUKA 3QKEA 3UZYA 1ZL1A 3I4KA 3KBMA 4PTNA 3W72A 2E7FA 2YR1A 3CUIA 1WKYA 1Q6QA 3THDA 5K3VA 1B90A 3ZFHA 2YB4A 3VIMA 1ZBVA 3CAVA 4GE8A 1H7OA 4U2YA 1UA3A 4BEUA 3GNXA 3RMJA 4E5TA 5LGZA 3WDIA 1QMLA 4CNSA 1SO6A 1FCBA 2PE4A 1H4PA 1UWRA 2D73A 1LZOA 3NDOA 2DT2A 1IZKA 3LQGA 1PPIA 1JF6A 3HJEA 4URIA 5CCZA 1RZMA 4FB7A 1RJPA 2SFPA 3VINA 4WDTA 3EOLA 4WR3A 3LRKA 3F7JA 4ZE5A 3TTYA 4PUKA 3AO0A 3VIHA 4PULA 2XDFA 4GK8A 3SCWA 3TTOA 1E3ZA 1W0MA 1ZBWA 1PTGA 3G0SA 1ZAJA 4P8WA 4Q32A 4JTQA 4O13A 2NQJA 1ITUA 2FIQA 3SCNA 3UNTA 2J9XA 3RRXA 4FOJA 2V5CA 5I03A 4EPBC 5ABHA 3HIJA 2WHKA 3RCMA 3U7VA 1XQKA 1UCWA 1B5TA 4HCDA 3W07A 1UR2A 3DESA 3AXIA 2CXEA 3OIHA 3W24A 2YXXA 4HHMA 1E6NA 3T6CA 2OLAA 2OWWA 3GZ3A 4IIHA 4UQAA 2EG8A 3E38A 1NDVA 2V5DA 3KCLA 1VYPX 1R9ZA 4H8HA 4ZENA 4PMDA 4FS9A 2A7RA 4U5IA 5K4ZA 1ZENA 5FL0A 4MZ1A 1BYAA 2V5JA 2XISA 4Y8EA 2P0OA 4W86A 3UWZA 2DQWA 3I3DA 4MG4A 3UWWA 1GOXA 3TN4A 4B5TA 1VRXA 2V81A 4HSHA 1KR1A 3LA4A 1O5XA 2MNRA 3CWNA 3R8GA 4JQ1A 2VD9A 3EX6A 4J28A 1HGYA 5G1MA 2J88A 5A95A 2P76A 3EMCA 1FWHC 3U57A 2QJGA 3FSTA 3C2EA 4GNKB 1RBLA 1DE6A 1F4AA 4S3FA 1YPFA 3TH6A 2A3CA 1DWIM 4F40A 5AC8A 3DFQA 1FWSA 5AFDA 3LXCA 2ZC8A 1GNXA 2VTFA 5C5YA 3R7MA 3WJWA 2E77A 4M51A 3H22A 1ZJAA 1JYVA 3VKKA 4C7FA 4RNIA 2VEMA 1I45A 1PZ2A 1TV4A 3S46A 1J6OA 3A23A 1SFTA 4LS0A 2BASA 7REQA 4I9JA 2OYKA 1W1PA 4UNLA 3PM6A 3LI0A 1YEYA 3BZGA 1Q7ZA 5AYYA 3DGBA 1FP9A 3IS4A 1KCKA 1KXQA 1OD0A 2Y7FA 1F6PA 4QISA 1R85A 4ZB5A 2EPKX 2ZX9A 4F3HA 2VUYA 3GXPA 1SGJA 3PTQA 3ONBA 1HXJA 1HL8A 3CQJA 2X7VA 4DELA 4Y90A 4XBKA 2WWCA 3OGRA 1CXIA 5D9OA 1FDJA 3F4VA 4ERIA 1C8VA 4D6EA 3VFCA 3C0SA 4HJFA 2P50A 3CEPA 3W26A 1TFVA 1O12A 3GTFA 4E4UA 5LIXX 2W67A 1XS2A 1JGMA 3NG3A 3CUHA 1EL3A 1ODUA 4LYPA 1REQB 3TR2A 2WVVB 2C8NA 4H6RA 2IPGA 3N34A 3GDMA 4OUIA 1Q4WA 3B03A 2CLPA 3TWAA 3VTRA 1JDFA 1W91A 1AJZA 1FWRA 3EA3A 1AH3A 3H7RA 4PUEA 2I9UA 3W74A 2CHOA 2Z1XA 1SO5A 3H70A 2E3ZA 4XAYA 3PG8A 1OINA 3NO1A 4UQCA 2V68A 2CPUA 4HA4A 3SECA 4I9TA 4U4MA 3UJRA 4ACZB 1U1HA 1UWTA 1DV7A 4ERAA 3VDCA 3RLHA 3N19B 3EOSA 4XKMA 5F2LA 1GK8A 1OIMA 1W1IE 3GC4A 3MBFA 3EPOA 1NP2A 1PX4A 2W91A 1GVEA 3EB3A 2ZX8A 1DQXA 5CQ1A 2OX1A 2W66A 2G37A 3G6LA 5D32A 3UGVA 4GCAA 2XIQA 3CM4A 4B3LA 2V5KA 1P6CA 1CXKA 1NTHA 3GC2A 1YQ2A 4ZBCA 4CQCA 1C7TA 1GVIA 1P0KA 2DEPA 4R7OA 2Z6JA 3ZJ8A 1IYXA 3LPGA 4JXCA 5C70A 4O17A 3AS1A 2XJ7A 3N14A 4HU4A 3HGJA 2A3LA 4J3SA 5KZDA 5HQLA 4XB3A 1M53A 3VIFA 4FALA 3B0YA 4NKCA 3NA8A 2WVTA 5CAKA 4IXHA 1IEVA 1KM2A 1X7IA 2V5LA 3C3UA 3OQEA 3RLVA 2GUBA 2X0HA 1KQYA 5BMWA 1OCBA 2O56A 1IZCA 4MUZA 1EJWC 1QPOA 4RZ6A 1PO9A 5KZ6A 2DUAA 3WNKA 3HGOA 2QIIA 3VNJA 4JYEA 1Q6CA 3NQ2A 2ZADA 1QI3A 1EJSC 1V6YA 5D38A 4GVFA 1E4NA 1AQHA 3I7SA 3O63A 5KZEA 3W7CA 2J25A 3SCSA 3RGTA 4DZAA 3GRIA 2WANA 1HT6A 5AECA 2J66A 3FW6A 4CNUA 1V6XA 2FZBA 3ARPA 4GY0A 2O92A 3E9AA 2DH3A 1EQCA 5I5RA 4L1XA 1ONWA 4HNNA 4BI6A 1W9VA 1S2WA 1W3JA 4F0HA 2NUXA 3P0WA 3BW4A 4A2RA 5L9FA 3PJUA 2O9PA 4DXKA 3OLIA 4R9OA 3DIPA 2VQTA 1E1CA 2WZEA 3OGVA 4HIBA 3UERA 2DIJA 3VPLA 1OK6A 2GSHA 3CV6A 3USBA 2XSAA 5D30A 3GHSA 3FCPA 3ZIZA 1PHWA 1B54A 1FDYA 5F1VA 1ADSA 1YW1A 4M7SA 4OZOA 5BU6A 4CCDA 1I2QA 2VFEA 1S5VA 1K77A 4S3JA 3VA8A 4HNCA 3ZLHA 4HK5A 2PODA 3SQSA 4HPNA 1OF8A 3S1WA 2Q3RA 5ENLA 1TB3A 3EKZA 2WQPA 1ECEA 3BQ5A 3HA1A 1XM3A 3C6CA 5EGRA 4JIPA 5I0DA 3W23A 3I65A 5CBJA 3WDPP 2BOFX 1QI4A 3GIPA 4PFHA 3CIVA 2NVCA 2WSPA 4QG8A 2Z24A 3T44A 4G7FA 1CTNA 1JZ2A 4DF1A 1XD0A 3Q58A 2H9AA 3N9SA 2INEA 2WSRA 4PYSA 3UA4A 5XIAA 3KRUA 3NQMA 3B05A 3NL6A 1T8QA 1H7RA 1YMYA 1W3NA 5I2UA 5GNYA 3L2IA 5KZMA 3R79A 4MADA 4OT7A 3OQ8A 1D2KA 2ODOA 1UWAA 4GI8A 3ATZA 4MY9A 5C6MA 3GR4A 2WCSA 4IIBA 2Z2BA 4HKPA 3HPZA 1RVKA 1TV5A 3CL6A 3HFTA 4UFLA 4WZHA 3WK2A 1WAUA 2BBFA 2ZQ0A 3R12A 4CEXC 2VGFA 4GUFA 1B9BA 1LWHA 3N17A 2ZFAA 4UTHA 5DRCA 1IXNA 3ID7A 3K46A 1Z42A 5AOUA 5K2ZA 1B30A 3GXTA 7TAAA 3UZJA 1OC6A 3L66A 4UXDA 5DX7A 3SUWA 4K7YA 1I1XA 1I4NA 4O57A 1EDQA 4GQ0A 1QK0A 4WGHA 2WHMA 5DQPA 3K5XA 3VOJA 1V3MA 4Q4OA 3TAKA 2PDHA 4J3TA 1VFTA 5DLCA 6ALDA 1MWOA 2FQIA 1L0PA 3DGRA 2BV9A 4RW5A 4GD0A 3GDLA 4KGLA 1X1ZA 3RDKA 4UFKA 1A5CA 4AD0A 1TRDA 3QTGA 3GXIA 4WSJA 5E0CA 5EMYA 2OCZA 1NDYA 2R24A 4PTXA 4I7VA 6XIMA 4AZ6A 2J75A 2YCLB 4I5RA 1P43A 4AHOA 2X7WA 4GO9A 4MWAC 3LHZA 3PZUA 4Q8MA 4W8BA 4JTDA 3R43A 2VXNA 4I9AA 2W5FA 1FP8A 2C13A 1YKWA 1HJXA 2OWCA 3WSUA 3MDUA 1P0NA 1C92A 1EYWA 5HINA 2B31A 1VD6A 1CEOA 1WNOA 1OFRA 4M6QA 1FH9A 4J9JA 4HPHA 3IGXA 5IBXC 1O5KA 4Z2KA 4HZ8A 2AKMA 1UZ1A 3VIPA 3H23A 3KBWA 3USZA 3BW3A 4HD5A 5LA0A 4Z17A 2H8XA 1JPHA 2YW4A 4NJKA 4IFRA 5CJ5A 3M0JA 3P84A 2E8ZA 2Y88A 1PS9A 3B0XA 1UD2A 5MKGB 1DTUA 1RBAA 1SZNA 1MW3A 3W1AA 2OU4A 4KFOA 3N4FA 3MDWA 2GVLA 3W53A 3QJAA 4JPGA 4RZBA 2B7OA 4TMBA 1W1VA 3DFPA 3PAOA 1QR7A 3FAXA 5D09A 3M0VA 1SM9A 3QRHA 4U31A 4RR4A 1IHIA 4UFMA 4GIAA 5HUOA 1ZQ5A 1DXEA 4L1WA 3GUWA 1VP5A 4QAWA 3RUBL 4XD5A 1VBHA 1ZALA 2WZMA 4U33A 1RJRA 3UW6A 1V3IA 4H2HA 3DI0A 4FLSA 1KM1A 2J13A 3CT2A 1RUSA 3M6DA 3PF3A 3W1RA 2ZXBA 4Z2IA 4K3ZA 4B92A 1ZSXA 4O28A 1QI0A 1AVAA 1XH0A 1YE6A 3VKJA 1AMYA 1CXEA 4X2PA 4PGLA 1TPUA 1OCNA 3M5YA 3CMJA 4H8UA 3CTLA 3SUTA 1N55A 1NU5A 3T55A 4C91A 2R14A 1J11A 4HYRA 3DECA 1TJ2A 3N12A 1KV5A 3W01A 3B0UX 3G5EA 2WAGA 4ZEPA 3FFSA 2JALA 5LA2A 4Y96A 5HR7A 1RSCA 1LF1A 3ZWSA 3UY7A 4UOZA 1EIXA 3FGCB 4FLQA 4XVEA 1MQQA 3R8HA 4PCPA 1G01A 4GX8A 4JN6A 2CNCA 5AVNA 3RR4A 5A8QA 4DEFA 4P7NA 4HPGA 4I8DA 1V08A 5HBFA 3M0YA 1WX0A 1BG9A 4E8GA 3UGRA 3KL3A 2WSQA 3P62A 4IPLA 2X1UA 3GZAA 4WUIA 4M56A 3T1GA 2W63A 5FD0A 3HGSA 3I6TA 3Q4DA 1YRRA 4IQLA 4LANA 3KZPA 3VCCA 1C91A 2ISFA 3W7HA 3KP1A 3S1GA 5HXMA 3KVLA 2P0IA 3W81A 5JIPA 2HK0A 3LPOA 4JTCA 1QNQA 4H9XA 3JR2A 3ZR4A 4MKSA 3GIYA 3WFZA 5FSEC 3I3BA 5DBUA 3OHIA 5H91A 3NQFA 4XTIA 4CD8A 1XCXA 1M41A 3UVAA 1JFXA 3ZYZA 1OGGA 4HNLA 4Q7IA 3DAQA 4AD4A 5EU9A 5HA7A 4KPLA 2YBTA 1S38A 3WF4A 1EJ7L 1FKXA 1HFBA 1FA2A 4CNTA 1QOQA 3W1MA 1XLMA 2VC7A 3T4CA 3QR1A 2YCIX 1JPIA 2P10A 4JGDA 3CV7A 1CX9A 2PP3A 3O0FA 1KWKA 5GNZA 1MRQA 1JYWA 2D20A 4QGCA 4Z0SA 4C90A 3KAOA 3BQ6A 1FHDA 2WMFA 1A0DA 1KBBA 1R6WA 4JS3A 1FWIC 4FX8A 1OG0A 1YXYA 2CBJA 6REQA 5GPRA 3N3TA 4Y9OA 4FLOA 4UTIA 2O4QA 5D2WA 4C6BA 3HQNA 4FK9A 3WUBA 1R7OA 4FEZA 3OBEA 4W5UA 3GHUA 3MB9A 4PBEA 1T7LA 4H9VA 5DEZA 5J5DA 3MKKA 1PVNA 4F8XA 1BXNA 2VL4A 5FF7A 3RX2A 1O5QA 5D8ZA 3ECQA 2PWFA 3CLWA 3S1UA 3ARXA 3G1DA 4W89A 2QPSA 4LYQA 1Q7MA 3SADA 1YADA 1E72M 3QHOA 4AISA 5BRPA 4S2BA 2GJPA 3WEZA 4LVFA 5IFPA 4JIQA 4FI4A 1WPCA 3H8AA 4AVNA 2QUVA 3LM7A 1KTCA 4Q33A 3NL5A 5IFTA 2GJNA 4YVPA 4AEOA 2CLHA 4TX8A 4B3KA 5DMMA 1ISVA 3FYYA 4PMXA 4DWSD 1JAKA 1G6CA 1UIOA 1MDRA 2EG7A 5C9WA 2D23A 2WVVA 4NZ5A 4PSPA 3UY8A 1R9XA 3LNMA 1MI3A 2XFYA 1PZ0A 4XV0A 1GYNA 9XIMA 5JBFA 4GH1A 1W37A 5FEWA 3WF2A 4IM4A 3ICJA 3R0DA 4BZYA 4C6NA 4QS5A 2QAPA 1MRAA 4K1GA 2X1TA 3AZSA 4ACZA 2B0MA 1MW0A 3MP4A 1EFZA 4ASTA 2QW5A 3TC3A 3N6JA 5D05A 2G5WA 1Y0EA 3G1RA 3S6OA 3W2MA 1UKSA 4CU8A 2XU2A 3PK7A 3OJGA 5FSDC 3WLNA 2REQB 4KKXA 2ZOXA 3VNZA 4LUJA 4F0MA 3FXYA 2HPMA 4DBDA 3QFWA 2Y8VA 3PUEA 4C6FA 2AMGA 1BGGA 1PB0A 2HV5A 3LGDA 2QCLA 8CGTA 4EACA 1QNOA 1E0TA 3D0CA 1PIFA 2ZA1A 1B31A 2BP1A 3VDBA 3O7UA 1M7XA 3V35A 2HDJA 2OLHA 3NYDA 1XRVA 2PDQA 1GVFA 2V3GA 4UFIA 1WDPA 1CWYA 3N6QA 3G18A 2F2HA 3ZSTA 1PIIA 2VKZG 3JZEA 1C3FA 4AF0A 2BOEX 2VDHA 4YHGA 4AZCA 3BG9A 1R2SA 3C0QA 1WCGA 4A22A 4AD2A 1FWJC 5CPSA 1TJPA 2BS9A 2JEQA 4UNIA 3UU0A 2X41A 3BLDA 3QPEA 3BAIA 2NX3A 3S83A 2VWSA 3GR7A 5J5RA 1XYZA 2GQ9A 2GLKA 1TV7A 1R38A 1ZFJA 3CUZA 4E3VA 5A6BD 1XIMA 1R3TA 4AFYA 4WKHA 1DL3A 3V5FA 3LB0A 3DKLA 3UZXA 2QMKA 3IVUA 3S4TA 3ZJ6A 3RCYA 4XKYA 1VZWA 2FGBA 1SUXA 3QY6A 4JYFA 3AMLA 4DJFA 3DHUA 4ICNA 1DJZA 1KCLA 1RCOB 2ESCA 4NYYA 3EX1A 3EPNA 1VQTA 3I6RA 3R6IA 4LJ3A 2J24A 4W93A 3EKLA 5ECUA 4C1NB 3W7MA 4MB1A 1KXTA 1ZB5A 1ELSA 1T0OA 3VGEA 5CAHA 4YIWA 3SIMA 4CGTA 3VIGA 5CH9A 4E4PA 3CGTA 3WBEA 3PWIA 3OLEA 3DG7A 3E0VA 1U2YA 3MVIA 1J0YA 4QDMA 4GMEA 2KZHA 5DMNA 3IAQA 4JTLA 3DH7A 1UD4A 1V51A 1GQLA 4NVTA 3KTCA 1L6FA 1OX4B 2W61A 4UBPC 1V3JA 1JNEA 1JYXA 1V5XA 1FUYA 2OOFA 1XLFA 3MSYA 3AXKA 3E2SA 1IE7C 1TKKA 3EMQA 4NUWA 1R3WA 3C4UA 4QE1A 2DZTA 5TQLA 2A5HA 3URNA 1CGXA 1E9LA 2BX7A 3IIXA 1E9IA 4IF2A 3PSVA 4QSFA 1OC5A 1EOMA 1Q6LA 4FXRA 4E2DA 4PBFA 4O11A 4YVXA 4NSBA 1ONEA 2OTDA 2Z0IA 1E56A 3PTMA 1J5SA 1X6LA 4FF5A 5GQBA 3TMQA 4DXXA 1IT7A 4MNLA 4LRSA 3FV9A 5A6KA 1QW8A 4PUJA 1AODA 4QR6A 1J0KA 1F9CA 4IWWA 4OJYA 4BQ5A 1XIEA 1WDDA 1TREA 1KKRA 1TPWA 1L6GA 4IPIA 2HS8A 5JH2A 4F2UA 5D2XA 4AYGA 1POKA 3TYUA 5I02A 3V1PA 3AUJA 2ZUTA 1PXGA 2QUNA 1A5OC 3TDFA 5C9XA 3GDTA 1LRQA 4MZ8A 4R5EA 3CZGA 3IJ7A 4YN5A 2OODA 3NQDA 1J93A 4D8ZA 2IKHA 4O1CA 1Y5XA 3DYMA 4WKAA 1U30A 4GXMA 1H51A 2CHRA 2P53A 3F2CA 1UUOA 3LXAA 2B7QA 3FN9A 3VMOA 1KM0A 1XYCA 2I5GA 3LTSA 1YTDA 1UQYA 3VM7A 4AZ5A 3EEZA 4IL2A 3ZVIA 3RNDA 1XDMA 2QVNA 1SO4A 4PEEA 4PMZA 3A5FA 4NZ4A 4PMOA 1Q85A 4LAUA 4U3AA 1KM5A 2Z27A 2FH8A 3GNPA 1V6TA 2YYTA 3TU9A 2UY2A 2Y1HA 4PL1A 4NXKA 5FF4A 3H54A 4Z1CA 4J35A 1W9PA 1VJIA 3NL3A 3SCRA 2FKPA 3NFUA 5SWUA 5CZKA 3CZKA 3N6HA 2J47A 2WBKA 4ZZ9A 3W1PA 2AQWA 4J7RA 4Q8WA 2EXOA 2YCLA 3BSMA 1FWBC 3ATYA 2ZDRA 2HK1A 2PC4A 3OO2A 3CLMA 2YJQA 3KUMA 1XIJA 3VE9A 4HVXA 1NIUA 5EL1A 4PR4A 1M1BA 2D2OA 3BLPX 3FKRA 4RE2A 2POZA 3TX9A 1QDSA 2E5CA 1X98A 4TTUA 5IHSA 1DOSA 4Q8PA 1FCQA 2D2HA 3TE9A 3AWNA 1KGWA 3ZT7A 4GY7A 3V0SA 3APTA 3CPUA 2GOUA 3WLJA 3MV11 1QPRA 4NT0A 1SJCA 3P82A 1XBVA 4IL0A 5MKGA 1TUFA 3PP7A 2OWXA 3EB2A 1ZJIA 1Q4NX 3PBGA 5G1YA 4S3GA 1TPFA 4R7JA 1BRLA 4OU1A 4G6CA 2JFEX 1UJPA 1R3RA 1A5KC 3L2MA 1MUCA 3CH0A 2PLJA 3RJYA 3F1QA 3V4BA 3GXFA 3VC5A 1TPDA 2VEPA 3T0AA 3DHPA 1KFKA 3SCVA 5DCEA 1ZGDA 3HV9A 4FXFA 1QO2A 4HU0A 5CC6A 2PF8A 3NL2A 3MUZ1 3WQGA 2DIEA 2A3AA 2QDDA 1EDTA 3B8UA 2BGSA 3IGHX 4L9ZA 4J3VA 4YHEA 4GQBA 3ANUA 3LHYA 2UZ9A 2OYMA 2X30A 1BF6A 1C29A 2C19A 4ZOCA 3RLUA 3PC0A 2CWNA 5FOOA 1EBHA 3DG6A 1OFEA 4UZSA 1PCKA 2YBVA 4DXVA 4PH6A 1VYSX 1AD1A 5LNUA 5C7VA 2FZMA 4W4QA 3VDGA 5DO8A 3KHJA 4N9DA 5ECVA 4DNHA 4OIFA 2BGQA 3IUIA 3NQEA 5EA9A 3W7LA 3L5AA 3GVVA 4KQNA 3REQB 2MANA 1IXQA 3PNZA 4UFHA 1A5LC 3ARQA 3BAKA 1A53A 3ANYA 2QZRA 3OU8A 1QK2A 2TPSA 4HMEA 1OB0A 1BXBA 4NQ1A 2CC0A 3KW3A 3HO8A 1QPNA 1B9ZA 2P8CA 4S3EA 2WV8A 3LX9A 3RK8A 4UCFA 2XWDA 3W1QA 5TNVA 3TQPA 2OZ8A 1UR0A 4P7OA 4TXEA 1UUMA 3R11A 3ZR6A 3N2CA 1A5NC 4GO8A 3WJSA 3P3BA 3WJXA 1KNWA 4KIRA 4ML4A 4ZQCA 3T0DA 1OBAA 3MSGA 1FWAC 4D71A 1DJYA 3KOYA 2CW6A 2P1FA 4JTGA 3FHQA 1H5VA 1NOFA 2XSBA 4CUCA 3IGSA 1E51A 3M5ZA 2OZ3A 2TSYA 4GINA 4NNAA 1TWIA 1TO3A 1BWVA 1GHRA 3NQ7A 4AXNA 1HGWA 2HMCA 4FNSA 4XZIA 3K1DA 2P8BA 1UP2A 1JDCA 3CHFA 5CC5A 5HPCA 3UJFA 1LBFA 2WVUA 2ZRWA 1TR9A 1UC4A 3TKFA 5A3HA 3DFYA 1FHUA 1XRTA 3FXGA 5HULA 2X2YA 5H8MA 5FCZA 3MO4A 2BVYA 2RUSA 3LLFA 2VEFA 3JVAA 1LL4A 5CPQA 3NIYA 4AWTA 5CSSA 4K37A 1OEPA 2EGZA 2XIJA 2HROA 2R1PA 3VIOA 4XVDA 1XUZA 3KTSA 4MNMA 4RDWA 1QNRA 4ZQRA 2P5NA 4I8YA 3TIMA 1W3IA 3AQUA 1KXHA 4LPCA 4TO8A 4BQ3A 2X0SA 4UR8A 3M07A 4DWSB 4QM1A 4TX6A 2NV9A 2A79A 1GKPA 3W1TA 4HOWA 4PBGA 1P4CA 3WIJA 3C0JA 4QJ5B 2XH4A 1DEDA 5TBOA 2ALDA 3K13A 3PUOA 1GTHA 3BLKA 5I06A 3RX4A 3BOXA 3JUGA 1FH7A 4M3PA 1GPFA 4I90A 1BG4A 3U9IA 1LL6A 2XZ9A 4AX6A 4Z2GA 2WMIB 2HEJA 4M80A 5I3JA 1HX0A 1NP0A 3P5ZA 4V27A 5IXEA 2CIPA 2Y63A 4W7VA 1K8XA 1VC4A 4C5ZA 4WQ6A 4JTFA 3DEQA 3TW9A 4KS0A 1OHLA 4AD3A 3UD6A 2GGGA 1XPGA 3JZUA 1BPLB 1QWKA 3V5OA 2E1WA 1X1NA 2WZHA 1V7AA 2Q02A 3CZJA 3T07A 2J9YA 5KTLA 1GGOA 4QSHA 2OG9A 1EGZA 1VJSA 1HKVA 1FX6A 1V3LA 1WUEA 2E09A 4DF0A 3WLTA 2ZRZA 4BR1A 3W71A 3OZPA 4U28A 4NASA 4MYXA 6CGTA 3TSDA 2REQA 2GDVA 4JD4A 4NZFA 2PWDA 1CB7B 2VX7A 1TQJA 1W5NA 3SJ3A 4ADTA 1M04A 2WNWA 3LV6A 4RKAA 5HQEA 3NO5A 1FWEC 3LCHA 1GKQA 1XC6A 3PZVA 1PBGA 2ISSA 3ARYA 5RUBA 3GVGA 1B4EA 5C0QA 1EB3A 1I6NA 1W17A 1V02A 3S8HA 3PZQA 5M17A 2QV4A 1EGVA 2Z1KA 4ALDA 4PZVA 3W02A 4JIHA 3QN3A 1H63A 3W7PA 2VWTA 2ISDA 1JI1A 4JKKA 3N2MA 1D7KA 3CH9A 4A3HA 4O54A 4CN6A 4HP5A 4O4VA 4O14A 1JRCA 3V7PA 2GZXA 4MY8A 4G7EA 4DBUA 4F0LA 1PZ1A 3ABOA 2D22A 2F61A 1NF0A 3UWUA 2TYSA 2WSKA 3G1AA 4WDWA 1CENA 1JL8A 1Y5VA 1UKTA 3DYOA 1ZBKA 3L4XA 1N2VA 3GY1A 1ZAHA 4TTGA 2R1NA 1TVPA 1LRTA 4Q6JA 2G95A 2C1HA 3G2GA 2IPJA 2ZBTA 4DJDA 4R88A 3AYVA 1ZCOA 3MI6A 1I2PA 3QPZA 4KRTA 5E09A 1KRMA 4YPJA 2HXUA 2PBGA 2YLAA 1H41A 4IHCA 3EWUA 3L12A 4J40A 1YXDA 3BLOA 1XCWA 4PTVA 1GG1A 1H60A 2PFHA 2HCVA 4GJ1A 4Z08A 3E0LA 1EP3A 2GJRA 3DHFA 2NXHA 1ZHAA 5K4XA 3OYZA 2YZRA 5DCBA 4MHBA 3LYEA 1WZMA 3XIMA 3C61A 4BQ2A 4Q4KA 4WK9A 1MXGA 3LMZA 4JYDA 4M0XA 3MHGA 3MQTA 1RK5A 2ZXQA 4AY7A 2ANUA 1MZRA 3K2GA 1G67A 3E1F1 1YIXA 5T9BG 1DTNA 4S39A 3IACA 1HJQA 2EKCA 1IQ8A 4ZOAA 3UG3A 1Q63A 4MOZA 2DV0A 2W4XA 4O8AA 4OUEA 4MLJA 3S0CA 3GX9A 3VD7A 2BMBA 9RUBA 1LORA 4JN7A 4UQDA 2FPYA 3MMWA 3T81A 3P67A 4AHPA 4WDUA 3L67A 3W4RA 1S2TA 3RCNA 1KLYA 1YBQB 3VOHA 1SQ7A 1OT2A 3KS6A 3LPPA 3RU8X 5M5DA 4TV6A 4M6PA 1QAPA 2BB0A 2YDRA 4A8IA 1SZFA 1GUVA 8A3HA 1XFCA 3TJ4A 1ZP3A 1K8CA 3CWHA 1HL2A 5KEZA 3W7JA 4D2JA 3N18A 1LT7A 4K36A 3GDRA 3NZRA 1PKNA 2JKPA 4PCTA 3WMSA 2VVSA 2XHYA 1A47A 3M0IA 2ZVIA 1QHPA 2C18A 4PMUA 1YNYA 3KL5A 3WLMA 1WKFA 3HMCA 3KS5A 3AHYA 2IW0A 5JU6A 1UR1A 3THQA 4GZEA 1KB3A 1EDGA 4RPQA 4B5UA 2C91A 1DJIA 3BMXA 1AL7A 3WUEA 4QTGA 1LBLA 2QJNA 2PGEA 3ARUA 4YCPA 1IR1A 3G22A 3S9YA 1VLIA 4MLRA 3QZ6A 1RH9A 4DM1A 4ZFCA 4HHPA 2VD8A 3MMDA 3A3HA 1PIGA 4K8EA 2ZKMX 3H7UA 3OA3A 1KW1A 5GJNA 3STPA 2ZRUA 2J6VA 3SB0A 1MXSA 3S9ZA 3LEPA 4JNYA 3ARZA 2A4AA 2VGBA 4HNUA 3CASA 3GG7A 3WQEA 3V0TA 4YS1A 2DVUA 1XBZA 1H61A 2CBIA 3KCJA 2WJZA 1PTDA 1KFBA 2PS2A 2VRQA 1EZ2A 3N04A 1J0JA 3EXRA 2G96A 4JDYA 1VRDA 3GB6A 3GK0A 1K7EA 4LCSA 1J8VA 1LROA 1WZAA 3IANA 2GGIA 4UQBA 3VNLA 1KBKA 4D6FA 2QCCA 4IJCA 1W2PA 1V3KA 4S3CA 3W7KA 3HU7A 1QTWA 3TLQA 1KM3A 3FDKA 1JVNA 1S39A 2UY3A 5DT5A 1XSJA 2FJKA 4DWDA 1XXXA 1GOWA 2TRSA 1QJWA 5GJMA 4L4LA 3WUFA 2YA2A 1UKPA 1Q5MA 3W86A 4MPQA 3V18A 4GYFA 2X16A 3S5NA 4QFUA 1QI2A 4NYUA 2UY5A 4GNJA 3KBNA 1HO4A 1A0CA 2GJLA 3N2OA 5FJUA 3M0HA 1M9HA 2YL9A 3F5LA 1W3LA 4ILSA 2PRMA 2WOQA 1L2UA 1PX8A 1UZ4A 2UY4A 2ZUWA 3NZPA 3NSNA 1XLDA 3ZWTA 4B5SA 1G1YA 4O50A 4O15A 1QI5A 3W2JA 4I5XA 1YE4A 4ZOEA 3SN1A 3P8JA 4IFKA 2EPNA 5DCDA 2PTDA 1K9FA 1FXQA 2NT1A 3AMDA 3UWVA 3O1NA 4R85A 4MFEA 1SJDA 3ABXA 2DVXA 2O7QA 3NQGA 3QC0A 4XBSA 2JQXA 2E40A 4ZCWA 3D3FA 4ZR8A 4B5WA 2CLKA 3S6TA 3L4ZA 5CZTA 4F9JA 4FHAA 1XKJA 4LCRA 4NI8A 3GUGA 1Z32X 1H7PA 1BQGA 3SR7A 1GW9A 1JXKA 2C14A 5AHEA 3IUHA 4KFNA 2WZIA 7A3HA 3EZ4A 3N29A 1QNSA 5D2TA 1DP0A 1XUUA 4E2VA 5EB8A 3GAKA 3TJXA 4I6VA 5BOOA 1F76A 2Q8XA 4X61A 3RO8A 1O68A 3T0TA 3OEXA 1GJPA 2CZDA 4JTAA 5EY5A 4O0QA 4NX0A 3W88A 2C16A 4FSAA 1FOBA 5BXPA 1P6BA 4O1EA 4C7GA 1WKEA 4L9XA 5AB3A 3CQHA 4GFSA 4O1FA 1SO3A 4H8NA 4W9TA 3VOCA 4L4PA 1F61A 2VFGA 4YTTA 4WJEA 3UPWA 3SUSA 5GJPA 3W7QA 1DORA 1JUBA 2ZRYA 3GNRA 4A3QA 2OSXA 3ABRA 1TR1A 1U22A 1DHPA 4NXSA 3CMFA 4M6UA 3J7HA 1H0IA 3C86A 4GZJA 3LHWA 3EOEA 2WJFA 2VDIA 4V2XA 1A5SA 1Y65A 2Z25A 3WLHA 5AHFA 2F38A 2WHJA 3AIBA 3GW0A 1I0DA 4H4IA 4B15A 1JG9A 1NQKA 1Y8BA 7REQB 1P5BA 4TVDA 4DO6A 2BY1A 1VHNA 4S3KA 1A49A 1UASA 3G3DA 1MUMA 4N02A 4IGHA 1PHQA 2ISVA 2H8ZA 4MB3A 1TJ0A 2FFCA 3URAA 2Q01A 1TJ1A 2X8RA 1P6WA 4L6OA 5REQB 3NVTA 4OHQA 2XYLA 1JPMA 1NM9A 4D6JA 2Z2UA 1GEHA 1SZRA 1HVXA 3NPVA 2C15A 2YL8A 4ERGA 1K02A 3GR8A 5XIMA 3AYTA 4PTMA 4ROQA 1QO5A 2FFIA 4NZ1A 1XHGA 2HVNA 2D0GA 1HKMA 3AC0A 1F5ZA 4JY9A 5HR6A 1R8LA 2VR2A 4OOUA 1KBIA 1HJSA 1GVYA 1PTAA 2JE8A 4N0RA 3DBNA 1V3HA 4JDBA 1TWWA 4DWSA 4EIVA 4KWSA 4QCFA 3TP4A 4ONVA 3PBMA 4IMCA 3PJTA 4WX2A 3UZZA 2WJEA 5I3KA 1D3CA 1PJ9A 3R10A 3FVDA 1IIGA 2Z29A 2HVOA 2QPUA 3SFKA 4L4MA 1BVZA 3HF3A 3MUY1 1E3XA 3TN5A 3QGVA 1QHOA 3CYJA 2VZTA 5DT7A 3ALFA 3CT7A 2E68A 4W8LA 3UJ2A 3TFCA 2GYIA 3A6OA 3GKAA 1LL7A 1KA9F 2NZLA 2FHBA 2WMIA 3H6OA 4OV4A 1JCLA 3D6NA 3KVMA 4HU3A 4LFYA 1AD4A 3WD0A 5BROA 2GSJA 2NSOA 3A9IA 2V3DA 1ONRA 1TTQA 5HUPA 3EWBX 1O6IA 3HB9A 4G1KA 4QCEA 3VGGA 1S2VA 1J10A 1Q6OA 1QXLA 1GHSA 1RALA 2EHHA 1MEIA 1YDNA 4ZO7A 1ADDA 4HHHA 2ZX5A 4B90A 5FAGA 3SQMA 4UTTC 4WOZA 4V1XA 3AAMA 1ISYA 3PANA 4PMJA 2IMRA 1B2YA 3WLIA 2ZZ4A 3W76A 3MY9A 3GSMA 4EE9A 1BYBA 3UT0A 3VNDA 3W29A 1QHZA 1FCUA 3WL0A 1EYEA 1JAEA 1W3TA 1EH9A 4C65A 4QAIA 2WXDM 1OK4A 3N2TA 4ZMGA 3LHUA 3L4YA 1RCQA 5D02A 2FTWA 3BE7A 3L0NA 3CB3A 1GVQA 2VZUA 1XD1A 4UR7A 4AWUA 1SJBA 3WQ4A 3GH4A 3HGRA 1VH7A 5C9RA 1V6VA 4I3GA 1ISWA 1GQNA 2VI0A 1VFUA 4AZ7A 2V6AA 1S2AA 5CG0A 1YYAA 5A6LA 1XIDA 1F07A 2ZCGA 3H21A 3ALGA 3N9RA 4DJDC 1BTCA 1S46A 1TE6A 3RITA 3WH7A 4DHGA 3QMSA 1SW0A 3C2OA 1JEZA 2P3ZA 3TROA 4GQRA 2QJHA 3PTDA 4D6HA 5G5IA 3LOTA 3LSBA 2A1YA 4DJFD 2D0FA 4E3TA 3TJLA 2VC5A 1J6PA 1Q6EA 2RDXA 3QV7A 3SIZA 3H2CA 1LOQA 5IRPA 3HG5A 2XZ7A 2OO0A 1ZAIA 3DN5A 1J0HA 4J3WA 4BWLC 2GK1A 2D3NA 1Z6KA 3SCQA 3RM9A 1ISZA 2QCGA 3QEZA 3NXLA 2ONEA 3K4AA 4JQ4A 3Q45A 3LG3A 1GORA 4JQ3A 1QOXA 4REQB 1K03A 2PGWA 2PDKA 5CC7A 1GW1A 4Z2LA 3KRBA 2J79A 1XI3A 2F6KA 4E8DA 2QS8A 3P6LA 5BYWA 1JZ8A 1XIGA 2I1OA 1RR2A 2NVDA 4TUFA 4LYRA 3STGA 3THUA 1CLVA 3P14A 3GD6A 3BAXA 3B8TA 3VCNA 1Q8AA 4PMNA 1OGSA 1WXJA 4CD6A 2PSNA 4ZGYA 2H9AB 3IV8A 1B4KA 4C6CA 5DRIA 3L0GA 4IMGA 4YTRA 2X05A 4I5UA 5EBAA 3PR2A 3CB8A 1XX1A 2DZAA 3SEPA 2WC4A 3AYRA 4JOMA 3IK2A 1ADOA 2WKGA 4G2DA 3ARWA 3WMLA 2ACRA 4X3ZA 2W92A 4Q8QA 3TYEA 1M65A 1CLXA 3ZR5A 4NG3A 3GU9A 3CZLA 3MT1A 3MCOA 1ZJHA 3OPSA 4LAZA 5G2HA 3VX0A 1F4HA 4IIDA 3SRHA 4A8NA 4X9YA 3T2QA 2EAWA 1RHCA 1UH4A 1XLBA 1QASA 3STEA 2PDFA 3A13A 4J3ZA 1H62A 3CL7A 3UXDA 3G8RA 1KRCC 3H4WA 3LBMA 3AHXA 3LY0A 3NOYA 4JBRA 1DWFM 2QXWA 4J4KA 3IJ9A 3DFTA 1HKWA 3DERA 1WZLA 2F6UA 4A3RA 4X2RA 4DVOA 2BNJA 1N7KA 1UBPC 5J04A 3BANA 3ELFA 3B9NA 4XIMA 1VFOA 4QHRA 4A4AA 2E5DA 2DZVA 2CCRA 2YW3A 4PUMA 4PRTA 3UXIA 2I9EA 1LM1A 5M1TA 1UPMB 2WM1A 5AVHA 1D9EA 1V93A 5C8BB 1FVPA 3PBVA 3RRAA 2A6NA 4JTKA 3IV3A 1CGWA 4EKJA 2J7CA 1SMDA 3TLLA 4IX0A 2ZYFA 2PDXA 1ZCCA 3FAWA 2Y7GA 5F7UA 1HW6A 2V3FA 1G4PA 3PB0A 5E1QA 3ARVA 1TSIA 4F4RA 1Z41A 2DZPA 1TPB1 3STFA 1JDDA 1SU5A 3LRMA 1J2WA 2ZZ3A 1TCDA 4X9SA 3A4XA 2A2IA 1OFAA 1QPQA 1N8FA 3AALA 2GDQA 2VRKA 3U8GA 4ICCX 3E3HA 1VAHA 3N4EA 4L6HA 3UPBA 2R94A 4QDWA 2FTPA 3WD1A 2E67A 2XGZA 3KM8A 3CWOX 1LTDA 2BVDA 4GUIA 2QV5A 3KXQA 5MHBA 1JPKA 1V6UA 2YYUA 3AHZA 3HPAA 3WJZA 4Y9AA 3XISA 1XYLA 3FIGA 2CITA 3P0XA 1ITQA