5AHNA

Imp-bound form of the d199n mutant of impdh from pseudomonas aeruginosa
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
467
structure length
297
Chain Sequence
MLRISQEALTFDDVLLIPGYSEVLPKDVSLKTRLTRGIELNIPLVSAAMDTVTEARLAIAMAQEGGIGIIHKNMGIEQQAAEVRKVKKHTYPLASKDEQGRLRVGAAVGTGADTGERVAALVAAGVDVVVVDTAHGHSKGVIERVRWVKQTFPDVQVIGGNIATAEAAKALAEAGADAVKVGIGPGSICTTRIVAGVGVPQISAIANVAAALEGTGVPLIADGGIRFSGDLAKAMVAGAYCVMMGSMFAGTEEAPGGALSAIVHQLMGGLRAAMGYTGSADIQQMRTQPQFVRITGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Studies of Two Variants of Pseudomonas Aeruginosa Impdh with Impaired Allosteric Regulation
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Oxidoreductase
molecule keywords INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
total genus 102
structure length 297
sequence length 467
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5ahnA00
4AAJA 1VYPX 1H7WA 2ISVA 2XFWA 3EWXA 4FIQA 5EBUA 1W8SA 3MP4A 1JCJA 4I7WA 3L9CA 1A5SA 4NX0A 3HPXA 1B4EA 3BW4A 3RMJA 3C2VA 3LI0A 3CHVA 1KV5A 3OVPA 1LLZA 2Y63A 2BSLA 1LOLA 3P8IA 2Y85A 3L0KA 5CG7A 1R30A 5K2ZA 3SW6A 2X1RA 5DN1A 4X9SA 3FKKA 3PY2A 4PEKA 4DBDA 2HSAA 1SZFA 5D30A 3MHGA 4UMBA 2H90A 2W79A 3IGXA 4OE7A 2B7PA 3M5XA 2XN1A 3AJXA 3L65A 4UTHA 1XFBA 2NWRA 1KV8A 2GOUA 3LV6A 3M41A 2VFGA 4ZMGA 4Y8FA 2HS6A 4JTTA 4R53A 2VFHA 3VE9A 3B04A 1XI3A 5BW6A 3MJYA 5AHIA 3N14A 1D3HA 1QDSA 1F2JA 1W37A 3E96A 3UWWA 1ZY9A 5HUPA 1IXPA 5F2MA 1IIGA 4GC4A 4JX4A 1HG3A 3R13A 3VKJA 1MXSA 1QPOA 1UCWA 4AVFA 1B3OA 2ZTKA 4ZQOA 1TPC1 3UD6A 4LVGA 3CIWA 5HWNA 2H6RA 4JTHA 4HKPA 4ZZ9A 1OABA 3G24A 5F2IA 3GXTA 3MO7A 5L6UA 4N9DA 3W2LA 3UWUA 4JX6A 1FY6A 4LVBA 1QNVA 1O95A 4M7SA 5FF7A 1NVMA 3CWNA 1I8JA 2Z0IA 5CKSA 2V82A 3LCXA 1H7XA 3SGUA 4N9EA 2J9YA 3RNDA 3G8EA 3TJLA 2TYSA 1V5XA 3UY8A 4OV4A 3S1VA 4DO6A 1Q6RA 3AO0A 1W3IA 4KFOA 2XN2A 4KWVA 5HQEA 4NJIA 2QKFA 2YFNA 1OF8A 5BOOA 1M6JA 3QMRA 3HJZA 3KFTA 1VR6A 6TIMA 5LNVA 4A2SA 3C0JA 3G22A 1OX4A 1LBLA 3FYPA 1KM5A 4S2CA 1AW5A 2RH9A 3GNDA 1QPRA 1C8VA 3BO9A 3GZ3A 3UWZA 3QJAA 3NDOA 1QPQA 2XN0A 1GJPA 2Z2UA 4FNTA 1U83A 3KRUA 2ZFAA 2GJNA 3L0NA 1P0KA 2HS8A 1FCVA 4O57A 5AB3A 3O6CA 5C2XA 3LCGA 4O12A 1WXJA 3KXQA 3L2IA 4RV8A 1DORA 4KKXA 1RD5A 1ZJIA 2AQWA 3HG3A 3W1LA 2WV8A 4UFLA 4RZ4A 1J5TA 1H7RA 5HNRA 3W86A 2ZZ2A 4DF0A 3TUUA 4ORIA 4BWLA 3TAKA 5CPLA 2ZRYA 1FWTA 3ZWTA 2DZVA 3NA8A 1ADOA 4MOZA 3R8RA 2A4AA 3LCIA 3C6CA 3MHFA 1I2QA 4PA8A 1DKWA 3W2JA 4XUGA 3OVRA 3EWBX 1FX6A 2A0NA 3NR0A 1YXYA 1SW7A 2CW6A 1X7FA 2YW4A 2EGZA 4UNKA 5FF3A 4AWUA 4UTLA 2O7QA 5F4XA 3QF0A 1G4PA 1YTEA 4O1BA 3W7OA 4NNBA 3OBKA 4BI7A 1I2OA 1SSDA 1IXQA 3CB8A 1OHLA 2Q8ZA 3H55A 3I6RA 4M5PA 3G1FA 1YDVA 1XBZA 3TKFA 4IMDA 1Q6LA 4UUIA 1W1ZA 5HJLA 3QPZA 3W7KA 2VOMA 4HN4A 4IQLA 4M6PA 4MYXA 4UTTC 2PC4A 4UFMA 1I2PA 1T8XA 1W0MA 3TX9A 1NAL1 3FYOA 4IMGA 2PURA 1PE1A 3GNNA 1OFEA 3N19B 1H7OA 1OYAA 3G1SA 3MI3A 2V2HA 3NPXA 4LOCA 4WXYA 3SY5A 2J24A 1JQXA 3TDFA 3USBA 1XUUA 4CCCA 2Q3RA 2YR1A 2V0TA 4FXSA 1WBHA 3NQVA 4MFEA 4ORMA 3NPVA 1P1XA 5HWMA 5K3VA 1TJRA 1VCGA 3LHWA 1JUKA 2OJPA 3M1ZA 4UCGA 1S3HA 2J6XA 3W88A 2YW3A 5C6MA 3O07A 1OX5A 2DP3A 2PRHA 3UXAA 4FHAA 3W7GA 4JTFA 4X22A 1FDJA 4D2JA 3UYCA 2CLKA 4TMBA 4QISA 1EB3A 3P8JA 1VZWA 2A1YA 4Y96A 4RR4A 2AAMA 1KTNA 3EKLA 3RFAA 3W7IA 4AB4A 3MP5A 1JUBA 3STEA 1XKYA 5G1YA 3GYEA 4IXXA 3GDMA 1H61A 3MI2A 1P0NA 3PB0A 4WX2A 1G4EA 2V5BA 3KHJA 4LT9A 3GIYA 4FEZA 3NQ6A 3GDLA 1UUMA 4O54A 4X3ZA 1A5CA 1J4EA 4S2BA 3EXSA 3OHIA 3EX1A 1TIMA 2QCEA 2V81A 3W7PA 4DEFA 3FS2A 1ZFJA 1W5MA 3BLIA 5EA9A 5K4ZA 3P61A 4P2VA 3NPUA 1D9EA 4JIPA 4K8HA 3P74A 4YCOA 1S5VA 2FPVA 3M6YA 4EIVA 3LCLA 4LVAA 3I7SA 3TXZA 2QJHA 3QYQA 3TSBA 2E68A 4RXGA 4MZ1A 3B0PA 3KVKA 4E2DA 1PIIA 1YLVA 5CZJA 2OZ0A 1UBSA 4UTWA 1KA9F 1THFD 4XZ9A 3NL5A 3HGRA 3NQ8A 2KZHA 1J2WA 1X1ZA 5AHEA 5KZDA 5TIMA 1F74A 3QFEA 5AC6A 1B4KA 5I3JA 5FI8A 1Q6QA 4CQAA 3W85A 4JY8A 5F2LA 1GYNA 4H4IA 3W76A 3W1UA 3IVTA 1QAPA 3BPWA 4FF7A 1SQ7A 1ZAHA 5CZSA 3JS3A 3STCA 2CZFA 2QCFA 4Z1BA 1XM3A 1ZAJA 2NV2A 3QMSA 2ZTJA 3G1XA 4LC8A 2HMCA 1NF7A 2QJGA 2V9DA 3TA6A 5FESA 4DO4A 1OG0A 5I3KA 2VFIA 4JD4A 3MYOA 5IBXA 1W56A 2FB3A 3EWYA 4MFDA 3TC6A 3THAA 1S5WA 4O13A 3GR7A 5D37A 4JEQA 3PBVA 4G1KA 1SU5A 1K7FA 1G4TA 1WAUA 4WZHA 4K36A 2YPIA 4CCEA 1VS1A 4JY9A 2VXNA 4Z0SA 1VC4A 2YZRA 1TRIA 3WJYA 2CFFA 2ZRVA 1LRQA 1S5TA 2B4GA 4ZQCA 2ZRWA 4LNYA 2VC6A 1ME7A 2GUUA 4QNWA 4UTJA 4RX0A 4MY1A 4Q32A 2ISWA 2JGYA 4R7JA 5G4EA 1LP6A 3RLUA 3C56A 3ZWSA 2GPTA 5KSWA 3P67A 1KM1A 2P10A 3A5FA 4Y90A 3LXBA 4M7TA 1M7OA 2BZNA 4XQ6A 1MEIA 3STFA 4Z1CA 3LRMA 1GQNA 4HNTA 5LHEA 4JICA 4O0KA 5DCEA 3S6DA 3ZR4A 1TQJA 4YCPA 2WNZA 3UPWA 3ELFA 3IIVA 3FLUA 1CX9A 2H3BA 4CLMA 4NVTA 1BWKA 2X16A 2A85A 4NUWA 3NYZA 4Q33A 4XWUA 2B7QA 2QR6A 3S5ZA 1KFEA 3KVJA 3LLDA 5BMXA 4QNEA 1KM6A 2DORA 3W7MA 2ZBTA 3PB2A 2DZWA 1K8ZA 3HOJA 2YDAA 5KMYA 5D02A 1PL9A 3P84A 1RPXA 1TPWA 2ZQ0A 4KFNA 1PVNA 4K7VA 4E0CA 2G95A 4FNPA 3RLVA 1KBJA 3EEGA 3QSTA 1OF6A 2NUWA 3MP3A 4ONVA 4NZFA 4JS3A 3GR8A 3LERA 4JR5A 5KITA 4AWTA 2ZZ4A 3TW7A 1EP1A 3W7QA 3K30A 1JJKA 3FEMA 1KW1A 4M19A 4WQ6A 1EP2A 2F7FA 1IIHA 3NQ7A 3LB0A 2C3ZA 1K03A 3S1WA 2YXGA 2J27A 1TPB1 3LRLA 3TJXA 4NXSA 2PRMA 4Q4KA 5LGXA 3IV3A 4LVFA 3UZ5A 1VHCA 1XDMA 1WX0A 2J9XA 3HG4A 2CLFA 4BFAA 4YMZA 3NM3A 1BWLA 1L2UA 2OCZA 1DV7A 2FPYA 2JBMA 2CU0A 4JTSA 2O7SA 4O11A 1SZGA 1B9BA 1BKSA 3P5YA 1TPH1 4IMCA 1FXQA 1H51A 4UFHA 4FNRA 1RQHA 3H53A 5F1VA 3W2NA 3PF3A 3FKRA 4CNNA 3G8RA 1P5BA 5GVJA 4QIUA 3G1YA 1KM4A 3WJWA 3EKZA 2WNNA 4UTKA 3SIZA 1TPFA 3N34A 4IJBA 5FEZA 2EHHA 5SWUA 2OX1A 5AHMA 4JN6A 1JR1A 2CZDA 2R8WA 3UWYA 4HNUA 4DF2A 4E2BA 5CPNA 1LYXA 2EAWA 3QW3A 2CLMA 1L6WA 5HWJA 1F73A 4NJKA 2R91A 3T7VA 3F03K 5FEXA 4MJZA 2R14A 2CWNA 4Z0JA 4DF1A 1FWNA 3NEVA 4CNPA 3W1NA 1Y0EA 3EX3A 1MEHA 3M5VA 1EPXA 3GB6A 1Z48A 2ZYFA 1HL2A 1KTCA 3BARA 2ABBA 4YWIA 4TU1A 4QAIA 3E0IA 1GT8A 3O16A 3TMLA 1PCWA 1GZGA 3ABOA 4OHQA 2Y6ZA 3G1AA 2WQPA 3VI2A 3RF9A 4ADTA 1VCVA 3MHUA 3BG3A 2FQIA 3DFPA 1QWGA 1JCYA 3OEXA 4LWWA 3L66A 2ZDRA 4HIBA 4TX9A 3NAVA 1SFLA 1A5BA 4PFMA 3DFTA 3PC0A 2Y62A 3NVTA 4LUJA 3A9IA 4LS2A 4FO4A 1YPIA 3B06A 3Q37A 3FOKA 3U8GA 5E93A 2I9EA 1PHWA 1O5XA 4MKNA 3W7DA 4QSHA 4H6KA 1YTKA 1SW0A 2EPHA 5F4SA 1LROA 2FB2A 2A21A 1EWDA 1VYSX 4OV9A 5D05A 3G3MA 1MZHA 3SFKA 3GKFA 1F76A 2QCDB 4DELA 3CM4A 4IWWA 3HGJA 3C2EA 5D2YA 2ZZ5A 3LCFA 3DAQA 2GQ9A 1HO4A 3N2MA 2V2CA 3SZ8A 4O19A 1OVDA 1H62A 2VENA 3G1HA 3A23A 3IRDA 2RFGA 3M9YA 3F1QA 3W23A 3ABQA 4BI6A 4JXCA 4JYDA 1FCUA 1Z42A 3HQ1A 4NJGA 3W70A 4IGHA 4JYFA 4RKAA 1LOQA 2GJLA 4N6FA 5A5WA 3GAYA 4N9CA 3QM3A 1OFAA 3NO5A 5AFDA 4UC5A 3NZ1A 4ZQPA 3NQEA 5G2HA 4QQ3A 5AYXA 3V75A 3GDKA 3TQ0A 1EIXA 2NWSA 1YADA 2WOQA 1VGAA 1KLYA 2VFFA 3BW2A 3GDTA 1V7YA 4LRSA 3I7QA 1R2RA 1K7EA 4JIQA 4I9AA 5DCBA 1TB3A 3TK7A 3W1MA 4DPPA 3W7CA 3LXAA 5EYWA 3ZFHA 3E49A 1K8YA 4GUHA 4UFIA 3TU9A 2BXVA 4KWWA 3JRKA 2LLEA 3S42A 2QUTA 3VNDA 3NPWA 4O1CA 3M7WA 2C6QA 3HO8A 4L4LA 4GRSA 3PUEA 3IVUA 3O06A 1GWJA 1ZALA 3S5NA 3TAOA 3W7NA 4AEOA 2VFDA 2Q3OA 3S9YA 3LHUA 1A53A 2FIQA 1BEUA 5EY5A 2JKPA 2OT0A 1G7VA 1NEYA 3TC7A 1Q45A 1FWRA 5AYZA 4M6QA 5CZ0A 1QMLA 4DQWA 1JRCA 1K7XA 3FJ6A 4DPQA 1DBTA 5KTLA 1NSJA 1H5YA 3OIXA 5DLCA 2H8XA 3Q2DA 3UPBA 4BI5A 4PODA 2ISSA 3O05A 1IXOA 2QAPA 1L6YA 3BGGA 2A7PA 2RDWA 4WUIA 3W2MA 3LBCA 1LDCA 1ZHAA 4TO8A 4ZQNA 1GYLA 2ZZ1A 4FX8A 1LBFA 1TMHA 5AC8A 4O1DA 3C3NA 3PG9A 1K8XA 4MLRA 4NNAA 3CEUA 1VLWA 1OX6A 1UJPA 2FJKA 2RHGA 2YX0A 1I2NA 4MYAA 2P0OA 4O15A 1LRNA 5K9CA 2NV1A 3WK3A 1AK5A 5G2WA 1FUYA 3C2RA 3CQ0A 4PL1A 5AN7A 3ZS4A 4O53A 4P61A 1JQVA 2ALDA 5G1TA 1EUNA 1P4CA 3TH6A 5C55A 3M47A 4EOUA 3LHTA 3N3MA 3NL6A 1TRDA 5CPOA 4LY8A 1CW2A 2RDTA 3EWZA 1ME9A 3CT7A 3LGEA 4WXZA 4PTNA 2UV8G 1SO4A 3MMTA 4UXDA 1A50A 1N8FA 1K02A 1SZNA 5ABTA 4O8RA 3W74A 2H3DA 1EX5A 3WJZA 2V5LA 1DJQA 1GVRA 3W83A 1U5JA 3KOFA 1XXXA 2Y7EA 2YFOA 3E9AA 4EWND 3O6DA 2V30A 2ABAA 4AHPA 5CSSA 3PG8A 3QPYA 3DENA 3DGRA 5I3GA 3LI1A 1G67A 1H1ZA 1OFQA 1VH7A 4XBKA 4K38A 1ZAIA 2DZXA 4OT7A 5E0KA 1KM0A 1RR2A 4HNVA 2VELA 4IMEA 3GX9A 2QF7A 3G0XA 1WOAA 3ATYA 2A2IA 4KFPA 2GQAA 2A6LA 4ALDA 7TIMA 2VEKA 3LCWA 1M5WA 1KM2A 4BWLC 3MI6A 3W07A 1H63A 2ZZ6A 4FNUA 2WPBA 3PS7A 3QH2A 2PCQA 3IGSA 1YPFA 3S5YA 4CCDA 1H7PA 4LV4A 1PHQA 4BR1A 2X1TA 3FA5A 1ML1A 3TXVA 5D2WA 3FJLA 1UUOA 4MZYA 1Z44A 3LOTA 3N73A 4FX7A 2Z6JA 1TTQA 5LNUA 2E5CA 2QCHA 1XUZA 1KM3A 5AYYA 8TIMA 3NG3A 5LHFA 5G2IA 4UIOA 3TR2A 2NUXA 3UZJA 3W3OA 4QJ1A 4O14A 4A22A 4A2RA 2PRLA 3TW6A 3YPIA 5MHBA 4NT0A 5IM51 3TCEA 4J9JA 1TQXA 4AHOA 3E02A 4MPQA 4LS1A 3DHFA 4FNSA 4OU1A 1OFPA 2V2DA 2E6DA 4AH7A 4UFKA 3DFOA 3W87A 5I3FA 4GUGA 2ATMA 1SFJA 2PE4A 4Y9AA 5G4WA 3BG5A 5FF0A 1RVGA 2E09A 1L6SA 2HTMA 1ZENA 1SO3A 4FB7A 3W7EA 5EMUA 2YCEA 4NNCA 1E51A 3HBLA 5KZEA 3R5EA 1KBIA 2NX3A 4RK8A 4ADSA 1NFBA 1FWSA 2D73A 1OK6A 1H7NA 4GWEA 3EWWA 5D33A 1T99A 2ZRUA 3TROA 1W3NA 1XC4A 3EXTA 1AL8A 4QITA 3QEZA 1L9WA 1O5KA 3LX9A 1F6KA 3QQ0A 3SGZA 3B4UA 5D2TA 3ATZA 4RZ6A 5BRBA 4ZL1A 1OYCA 3MYPA 4Z08A 3MBFA 3KVLA 1UB3A 5HR7A 4GBUA 1N7KA 4ZQMA 2ZZ7A 3UWQA 1YTDA 1DVJA 4GUIA 3A22A 2E1DA 1ALDA 2CLHA 1FXPA 1XL9A 4MJMA 1GTEA 3MUXA 4IXHA 3SJ3A 3M16A 1GOXA 1R47A 1AW2A 3CIXA 2Y70A 3WJSA 5D2XA 1VRDA 1F6PA 3HPSA 4RXFA 1DOSA 1AG1O 3A24A 2JKAA 3QQ1A 4GE8A 3G0UA 3WK1A 5I3IA 4WD0A 1B57A 3SR7A 1RQEA 4UTTA 1MO0A 2E6FA 1O94A 3FFSA 3T40A 3W6YA 5EKYA 1OJXA 2A7NA 2DZPA 3SI9A 5DXXA 2ZRXA 5A8GA 1TPDA 4POCA 1XCFA 2R94A 3TE9A 5AHFA 4IX2A 5F1UA 3MBDA 1QOQA 1W54A 4JNMA 1TTIA 5HR6A 1WA3A 4OWGA 2EF9A 4XKYB 3KVMA 3EB2A 3PUOA 4JTLA 3F4NA 4JDBA 2QCNA 5CPMA 2CLOA 1SO5A 1VPXA 3W2KA 3TFXA 1JCLA 2A5HA 1DQWA 3GDRA 3W7LA 1TSIA 1KFKA 4XBSA 4UNLA 4K8EA 2ZCGA 4MVAA 3EX2A 3NZRA 2WSQA 2TSYA 5CGQA 4O4VA 1N55A 2FPTA 4GJ1A 3LTSA 3MWAA 4JYEA 5K7JA 3W1PA 3S1XA 4IX0A 3IIXA 2J9ZA 4UFJA 4UTIA 2NX1A 5TQLA 1TCDA 4H3DA 4K7YA 1C9DA 1HO1A 5FF2A 2BLEA 1GTHA 5LSMA 4XKYA 3GKAA 1X6UA 3GLCA 4RZ5A 4Y6GA 1DL3A 4NJJA 4WOQA 1EA0A 4U4MA 3V1PA 2JKEA 1ONRA 4HNNA 3RU6A 2E5BA 3TFCA 4NJHA 2BX7A 1WV2A 4R34A 6ALDA 2WO5A 4GUJA 2FFCA 3WK0A 2NLIA 5U7SA 3W1TA 5K9DA 2OMAA 4O28A 5U4NA 4IUOA 1I2RA 1IGSA 3NQFA 1PS9A 5CSRA 3LLFA 1IXNA 3Q94A 4O1AA 4XTIA 3EXRA 3PR2A 1WBJA 3P5ZA 3T55A 3A5VA 4O4WA 3W7JA 1ICPA 3P60A 5D09A 3FIGA 2WJZA 4NQ1A 2QUUA 3O63A 3TNOA 1FCBA 2OT1A 3DFSA 3PBYA 3RK8A 2JK2A 5J5DA 1YXCA 2ZA3A 1EEPA 3B03A 3LTYA 1YDOA 1WQ5A 3LRKA 4W9TA 2E5DA 3M44A 5AHLA 1MEWA 1WOBA 3KAOA 2A6NA 4WJEA 2C18A 3UXDA 1W3TA 3LHVA 4B5NA 4MY8A 1OFRA 5D2VA 3T78A 3HMJG 1I45A 1W5PA 3QRHA 3A21A 3N9RA 3BK0A 2QDGA 2FDSA 1TV7A 4K6AA 5C5YA 2WSYA 4HHPA 4NXKA 3UWVA 1FDZA 3WK2A 1KFCA 1HTIA 1ME8A 2C19A 3DXIA 3INPA 2E77A 1KFLA 3GVGA 1RV8A 3C61A 3VFLA 2A7RA 4AXKA 4RJEA 5D32A 3P82A 1OK4A 1I4NA 2FTPA 3ABRA 3NQCA 4HPXA 2NXGA 4NX5A 2ZA1A 1LZOA 5AOUA 4WY0A 3DHDA 3CWOX 2TMDA 3TQVA 1H60A 4S1FA 3NQGA 1HFBA 1TYGA 3CPRA 2X1SA 4GNJA 3ANYA 3KRSA 3CTLA 2B0MA 4Z1DA 2DJLA 2YGYA 2QCCA 2C13A 3NM1A 3PUDA 4BK9A 1TPUA 4ICNA 4R33A 1JUEA 2C1HA 4UTWC 2BTMA 2GVLA 3L5AA 3TV8A 4WY0F 3S0CA 3LM7A 3L5MA 1GEQA 2GVJA 3G0SA 1FBAA 3W73A 2G97A 3NOEA 3PSWA 3TSDA 1JRBA 2YSWA 1LBMA 1QO2A 3GXPA 4FNQA 4DXVA 3LHZA 3P80A 1ZCOA 2DZTA 4UR7A 2VEPA 3BLFA 1TTJA 2DZUA 5KINA 3W84A 3L21A 3G3DA 5DBUA 4PL2A 5HULA 3C2FA 1GVOA 5H91A 3P7YA 1NF0A 5FEWA 2VEMA 4YXGA 3DI1A 3BW3A 4CQ8A 4BF9A 4K37A 1QOPA 3GK0A 1VJIA 4MY9A 3G1DA 4RCXA 5HINA 3W2UA 1KFJA 2ZRZA 2ZZ3A 3O6YX 5LZLA 4Z1AA 1FWWA 5D38A 1HUVA 1RQBA 4L4MA 2Y7DA 3U2OA 3S8HA 1OX4B 1XBYA 4UMCA 3IIZA 4O50A 2F84A 5HUOA 2NXIA 2QDHA 4TIMA 3IEBA 3N9SA 3C8FA 1XBVA 3BGJA 2P1FA 3HGOA 4LRTA 3IGUA 4LVDA 1G7UA 4C1LA 2YYUA 3DI0A 2QJIA 1AW1A 4LC6A 5AHNA 3UNDA 2J88A 1LM1A 4EF9A 4ZQRA 2CLLA 2QAFA 3QZEA 3WJXA 3VE7A 4WOZA 1YXDA 1RZMA 3B0VC 1QFEA 3BVJA 4A21A 3W72A 3NQAA 1JCNA 4N9BA 4O52A 3T4CA 4EVZA 2QUVA 2QCGA 3C2OA 3UY7A 2W6RA 4LW7A 3DBPA 1SO6A 3QSRA 3W1RA 1KLZA 2VEIA 3NL3A 4FX6M 4X2RA 1YYAA 3ABSA 4JTIA 3IIPA 4LV9A 2B7OA 4I7UA 1H50A 3W7HA 2QEZA 1F7BA 2G96A 4GFSA 4WY0B 4OGZA 3W75A 1O60A 1TV8A 3DFNA 1TV5A 2Z1BA 3G1VA 2CLIA 3GAKA 3WFAA 3W22A 2G5WA 3I65A 1IF2A 4HSNA 3P62A 1GVQA 3W1QA 5DBTA 2VKZG 1O4UA 3M5ZA 1G4SA 1X1OA 2RKXA 3HIJA 5LGZA 1TO3A 1K3UA 3PVFA 5DXYA 3HGSA 5J5RA 5K9XA 2C16A 1R2SA 2Z6IA 3NXFA 4N6EA 3TIMA 4MUZA 4PC8A 1TPVA 2I14A 1FQ0A 2DZSA 3NGJA 4CNOA 4HSOA 5C54A 4IOTA 5BNKA 3I7RA 3W9ZA 4JTKA 3OG3A 1FDYA 3DH7A 4A3UA 3NQDA 4UTUA 3L67A 3LXCA 3DU0A 3KX6A 1R46A 2TPSA 4U28A 2Y7FA 1Q3NA 3L68A 1TJPA 3NQMA 2NX9A 1Z41A 5G5IA 3NL2A 4LS0A 3BV4A 3TSMA 1W5OA 2WSRA 4CQ9A 3TQKA 1LCOA 3PBWA 3DFQA 3LDVA 3G18A 4K39A 2C0AA 3R12A 4NZJA 1X8FA 4JTGA 5T26A 1JCMP 2CZ5A 5DY3A 4N02A 1TTPA 5LNRA 1XBXA 1ICSA 1OFDA 3DKJA 3BLEA 4N4PA 3NQ2A 3HB9A 2QCLA 1T96A 2WNQA 3CEPA 1DHPA 3U6WA 1GG0A 5DCDA 1WDWA 5F2GA 3W71A 3S5OA 2E6AA 4GXMA 4N4QA 1SZEA 2CZEA 1OYBA 1VHNA 5HMSA 2GVGA 3CU2A 1YDNA 2ZA2A 4O18A 1QO5A 4TMCA 3B8DA 3UQNA 3SECA 4UR8A 4OQVA 3R2GA 4OBTA 3F4WA 1JVNA 4MZ8A 2H8ZA 3QW4B 3VCRA 1SSGA 4AF0B 3N2XA 1SUXA 1LORA 2GQ8A 4LUIA 3C4UA 1QPNA 2BWGA 3PSVA 4YL2A 4A29A 5FEPA 5F4WA 4DBEA 1A5AA 5BMWA 5TBOA 3EWUA 3LHYA 4IPIA 4C1KA 2IQTA 3PAJA 5D03A 3W7RA 5H2ZA 4I7VA 1QCWA 4E38A 5LNSA 1DQXA 2JGQA 4GUFA 1Q6OA 4O0ZA 3LTPA 3QMTA 1G6CA 4UTMA 1EWEA 1R2TA 3MW7A 1TREA 5CZTA 1GVFA 1AL7A 1LRTA 3H54A 1C29A 1W5QA 3T44A 1LLWA 3OVQA 2B7NA 5D04C 4XTDA 4JDYA 5IBXC 1GVSA 4JTUA 2Y88A 1KTBA 4LTSA 1OFBA 1SR9A 2Y61A 3R89A 2CLEA 3L0GA 1W5NA 1FCQA 1VYRA 4PCFA 4ML9A 4EF8A 3HPZA 4AMAA 2W0UA 1F05A 3M5YA 3PBUA 5E1QA 5K4XA 2C15A 4N2YA 2I1OA 1DJNA 4PH6A 5FF4A 3LCHA 2NUYA 3DKLA 1BTMA 3LBMA 3SSJA 1G69A 1SW3A 2EKCA 3W1AA 4AWSA 1OFOA 2QCMA 2V8ZA 2E6YA 1ZNNA 1JCXA 1VQTA 3EX6A 4MIMA 1W31A 2YYTA 1TPEA 3GXNA 3P81A 4IPJA 1JULA 3HG5A 3STGA 4NU7A 4FXRA 1GPWA 1LOSA 3Q58A 2VFEA 4M6VA 2AGKA 3M43A 4MLJA 3S1UA 5AC7A 1EUAA 2X2GA 1MSSA 1PCKA 4JGDA 1UASA 2RDUA 2DU2A 2ATSA 4ADUA 4LU0A 1WYIA 1LTDA 4UMAA 1VLIA 5EL1A 3PULA 1AMKA 3O15A 3BG9A 5KZMA 2NZLA 3NNTA 4JX5A 4ZVJA 3C52A 3DZ1A 1CI1A 1KFBA 4O10A 2TRSA 3CLMA 4AHQA 5LNWA 1ICQA 4JTEA 4TR9A 1EP3A 1M7PA 1PV8A 3IIOA 3HG2A 1GG1A 1QR7A 5L9FA 4RLIA 2X1UA 3W1XA 1T0OA 2DJXA 3LV5A 4AF0A 3THQA 2C14A 3QC3A 3L5LA 2X30A 3OA3A 3TMQA 1SPQA 2Y89A 3E12A 3IVSA 4JTJA 5DY2A 4HPJA 3B0UX 4IMFA 3O8AA 4YLWA 3M0ZA 1XDLA 5EPDA 1F5ZA 3PWAA 2FLIA 3I68A 3HF3A 2WKJA 2Q8LA 3D0CA 3CC1A 4O16A 2NXHA 4HT3A 3JR2A 5DELA 4DO5A 3PM6A 4FIRA 3B05A 4O17A 5I3HA 2QCDA 2Y7GA 5LKYA 3EX4A 3O1NA 3KRZA 1D3GA 4QM1A 1H1YA 1VCFA
chains in the Genus database with same CATH superfamily
5HJXA 3QXBA 3SUVA 1MFVA 3DUGA 4GABA 1UKTA 3HPFA 3UCDA 5GNYA 2ISVA 3EWXA 1PDZA 5EBUA 3MP4A 1J11A 3BW4A 2FYMA 3CQJA 3IJ7A 2HPIA 4QRNA 4M24A 3LI0A 1NQ6A 3OGSA 3OVPA 2Y63A 3P8IA 4AVOA 4J3TA 5CG7A 5LIYX 3V5CA 1OD8A 1EJWC 1JD7A 2AMGA 3FKKA 1XD0A 3WQ4A 1KBLA 1P7TB 4KWUA 1BVNP 1NDZA 2W79A 2B7PA 2XN1A 1JZ7A 1KD0A 3AHTA 5HNNA 2OO0A 2YCLA 5ABFB 1F61A 3M41A 2HK0A 2NVDA 2VFGA 4Y8FA 2VFHA 1VFSA 1S3TC 3B04A 4GO9A 1XYCA 3JVAA 4HU3A 1QDSA 4Q8UA 4TTGA 1YQ2A 2ACUA 4Z2IA 3VOGA 3E2SA 2YBUA 2BDQA 2OFJA 1ZBCA 4P8UA 5LIKX 3GUWA 1UCWA 1QPOA 4AVFA 2UY5A 3S2NA 3SY8A 2XTKA 1CDGA 4LVGA 3PFRA 2H6RA 4MG4A 2D0GA 1XPGA 1OABA 5F2IA 2VO5A 3MO7A 3PBMA 4N9DA 1J93A 2G4JA 4LVBA 3PJXA 2GSHA 1NVMA 2Z0IA 5CKSA 2V82A 3ARPA 4WSJA 4JBRA 3RNDA 4L1GA 4OV4A 3W81A 4DO6A 3NFUA 3AO0A 2J7DA 4KWVA 1DTUA 5HQEA 3E0LA 5I06A 1L8NA 1KKOA 3WD4A 5D9MA 1W1PA 1IHIA 2QKFA 1HL8A 5HMEA 5BOOA 1M6JA 2VEFA 5CAKA 4DUWA 1GOIA 3KFTA 6TIMA 1XINA 4A2SA 3VIHA 3G22A 1KM5A 1AW5A 2Z1WA 2RH9A 2PLMA 3B8TA 3GNDA 4QP0A 1E0XA 1R5YA 4N42A 3CUIA 3CV7A 2VL4A 4B5UA 5D9OA 2OZ3A 3NDOA 1CENA 3TQPA 3TR9A 1JPIA 3WBXA 4FNTA 1QPKA 3KRUA 3AIVA 1P0KA 4MM1A 2JE8A 2HS8A 5G1MA 3OZYA 1VBHA 3O6CA 4CKQA 4J3SA 1EJ7L 3NWRA 3KXQA 3O2LA 3VNLA 2QPUA 1DORA 4PMNA 2I56A 4DN1A 1UWRA 4QJ4B 1J10A 3CYJA 1J5TA 3EOLA 2BVTA 2GUYA 3W86A 2ZZ2A 1YEYA 4BWLA 2V3DA 5CPLA 3ZWTA 3S2MA 2DZVA 3NA8A 4NP7A 4UOQA 5FJOA 2Z1XA 1Q2RA 2J66A 3LCIA 3R58A 1OQFA 3OU8A 3W2JA 3LK6A 4ERIA 3O7UA 2W4XA 1FX6A 1EA9C 2PBOA 2CW6A 4H2HA 2EGZA 2GGHA 2O7QA 3QF0A 2YA1A 1MVYA 4Q8QA 3W7OA 4NNBA 3UETA 4R7WA 2V63A 1MFUA 4R88A 4J3WA 2FVLA 1IXQA 1N8IA 1X6NA 1EKOA 4Z2KA 4PMXA 3ES7A 3U2EA 5C7VA 4PMRA 1W1ZA 4FLOA 3GBDA 4IQLA 2TAAA 4UTTC 5MKGB 3J7HA 1I2PA 2PURA 2XIOA 1PE1A 2XIIA 3TTEA 1RBOB 3N19B 1H7OA 4GY1A 3G1SA 3MI3A 2V2HA 4LY4A 4WXYA 3SY5A 2JF7A 3TDFA 1O12A 4DJFD 5EFFA 3USBA 2YR1A 1E56A 4TOQA 4MFEA 5HWMA 4GXWA 1VCGA 2JQXA 3LN3A 3M1ZA 2J6XA 3BMWA 1EXPA 2YW3A 1KBKA 3MKVA 3O07A 3LYEA 2DW6A 3K4WA 3UXAA 1XRFA 3ZLHA 4WDXA 2NQ9A 2CLKA 3AHZA 4TMBA 4L65A 4QISA 5LA2A 4RR4A 2OYMA 4XAPA 2XYLA 4H6RA 4FF5A 1U30A 4IFKA 4WRHA 3BURA 3OYXA 3STEA 1XKYA 4GNVA 1JNDA 4IXXA 4PRTA 3GS6A 2J7GA 4MHBA 4ATLA 2Z2AA 2O56A 3U0HA 2HZGA 5BXRA 5A2CA 1OEPA 3OPSA 2ACQA 3FHQA 3UR2A 1XISA 2QCEA 2C71A 2CKSA 3QLLA 1ZFJA 5EA9A 3FJNA 1PIFA 1XYLA 3P61A 1HP5A 2XVKA 4M3PA 1D9EA 4Q8WA 4B2DA 4YCOA 4EIVA 4LQ1A 2IKHA 3TXZA 4E4UA 2QJHA 2E68A 3BE7A 1P6CA 1YLVA 5CZJA 1MI3A 4UTWA 4F0RA 3K1DA 1KA9F 1XGDA 3NL5A 3HGRA 3ERPA 1FTXA 5AHEA 2OR2A 3EMZA 4OVXA 2REQA 3QHNA 4AZ5A 5I3JA 4GQBA 3W85A 1GYNA 4ZTXA 1KFWA 1SQ7A 2F38A 5IHRA 3STCA 3SCPA 3KOWA 1ZAJA 2NV2A 3C0SA 3WD3A 4W8BA 1HVQA 5A8OA 3O0KA 3KS6A 4HMNA 5I3KA 3MYOA 1JFHA 2FB3A 4MFDA 4ACZB 3THAA 4C65A 3GR7A 3QVQA 4JEQA 2HNHA 4MWAE 2XWDA 4DWSD 1SU5A 1GYMA 4WZHA 4GYJA 2VXNA 1VD6A 1FFQA 1SFSA 4G6CA 2QIWA 4L9ZA 2PP3A 1LRQA 2ZRVA 3EDKA 3UJEA 2B4GA 3F5KA 3A64A 3MSDA 2ZRWA 4LNYA 3R8GA 1PYMA 4OBSA 1MUMA 5E5CA 1UWQA 9RUBA 4RX0A 3GC4A 3RM9A 3PAOA 1CBGA 3SJNA 2GWGA 4LBUA 1JI2A 1EH9A 4LYKA 4Y90A 1X1NA 3RR1A 2CWXA 3U2CA 5LHEA 4JICA 1TQJA 1WKFA 4FP1A 3RPTA 4WKHA 3SADA 1TV4A 3T07A 3QV7A 4WK9A 4AISA 4CLMA 4NVTA 2WHKA 4KCUA 4B5VA 3UESA 4Q33A 4XWUA 3WQFA 1FKXA 2QR6A 3S5ZA 2GL5A 2VQUA 1XLCA 1V6VA 2E0PA 4M82A 4V27A 3H2NA 5D02A 3P84A 1RPXA 4KFNA 1PVNA 4K7VA 4IFKB 4RE2A 3RLVA 3FHAA 2IQ0A 4KEMA 1H49A 1HZYA 3MP3A 3LERA 5T8GA 4AWTA 2ZZ4A 2JEPA 3CPUA 1AD1A 4OUEA 3OO2A 5EMLA 1EP1A 4LYRA 3K30A 1VFOA 3FEMA 3SCSA 3LB0A 3QN3A 1W8GA 3F5LA 3VMNA 4HYWA 2PRMA 3UZ5A 3N29A 4BFAA 1P1MA 1CGVA 4LUSA 1B5TA 4DY1A 3RITA 3NM3A 1BWLA 2OCZA 3WDHA 3T42A 4HTYA 1BKSA 3OBEA 4LYPA 1TPH1 3PWGA 4IMCA 1LL6A 1H51A 1MQRA 4FNRA 3W2NA 3PF3A 3FKRA 2CBUA 1N2VA 2PDXA 2QZRA 1IEXA 1S1RA 4QIUA 5A6LA 3SN4A 4AX6A 1KM4A 4TVDA 3SIZA 1TPFA 2EHHA 5AHMA 3E3HA 1S5MA 4JN6A 4LJ3A 1W1VA 1E4MM 4H9UA 4I8YA 4HNUA 4DF2A 2CLMA 3W28A 1ZRQA 3N2BA 4RDWA 3VA8A 3F03K 4Z0JA 2QW5A 4DF1A 4D8AA 4CNPA 3QGKC 4F0LA 1XV8A 4Q4OA 1HL2A 3UG5A 4I5XA 4AD0A 4QAIA 1W9PA 5IRPA 3WELA 2JFEX 4Y7EA 2PGEA 1M1BA 3CMGA 2Y6ZA 2WQPA 3VI2A 3AHYA 3RF9A 2YB4A 1VCVA 2P50A 1J6PA 3DFPA 1JCYA 1QWGA 3ITLA 1R9XA 3L66A 2ZDRA 3VZXA 3LS9A 1MQQA 4EXQA 2VX6A 1VIWA 1UR2A 5TF0A 3F2CA 2OG9A 3UJRA 3NVTA 3GU1A 1YPIA 3AIEA 1EIBA 3Q37A 2ZE3A 2RGLA 2X0YA 3M64A 4QSHA 4H6KA 4O8AA 2FB2A 2ZC8A 2A21A 5AZ1A 1VPQA 5D9NA 4R85A 3WKZA 1XLIA 3EZ4A 3SFKA 3GKFA 1F76A 4TTUA 4DELA 4IWWA 3BH4A 4MDPA 3C2EA 4ECLA 2E4TA 5LA1A 1MRAA 1HO4A 2V2CA 1H62A 1K9EA 3G1HA 3IRDA 3MWCA 3VKKA 3W23A 3ABQA 1K9FA 2BMBA 3G2GA 3S47A 1BHGA 4JYDA 5CAHA 1Z42A 3W70A 3H8AA 3CH9A 3QR0A 4N6FA 2OOFA 4N9CA 1QTWA 3W38A 3NQEA 4CVUA 5FL1A 3W02A 4QQ3A 2CIPA 5AYXA 4TX8A 4GBDA 3V75A 1Z3NA 1TZ9A 5M1TA 2H9AA 3TQ0A 1CCWB 2R1LA 3P0WA 2NWSA 1YADA 2PLCA 2WOQA 3TYUA 4H00A 3VCCA 3O0FA 5JBFA 3H7UA 2V3EA 3CZJA 3QR3A 4Y9OA 3SRHA 5EFDA 3LGDA 2EPMX 3T2OA 2ZUSA 4UFIA 4HJFA 4KWWA 3JRKA 5FAJA 5DMNA 2QUTA 3VNDA 4O1CA 1DXFA 2NV9A 4XKMA 4L4LA 3IVUA 1ZBVA 3W7NA 1UQYA 3NIYA 4HA4A 1H4PA 4AXNA 2VX5A 3LHUA 2WCGA 1JYXA 1A53A 1P0DA 3T05A 1DPMA 3ISIX 3I6EA 1UD6A 2OQLA 4RDYA 2Q8XA 3A47A 1HQTA 5JXQA 4Q4QA 2ZADA 5CZ0A 4DWSA 1H5YA 1UJQA 3CLWA 4ILSA 2X09A 4J3VA 3IS4A 2QAPA 2CCRA 2A7PA 2YJQA 4JIHA 4IM4A 1GYLA 4DYKA 2WWDA 3N12A 4CD4A 4Y8EA 2C91A 3CEUA 3L12A 1UJPA 2FJKA 2RHGA 2J8TA 2P0OA 4O15A 3BANA 4J1OA 3TJIA 1VB9A 4DIAA 3H6OA 1FUYA 3C2RA 3CQ0A 3ZS4A 4O53A 4P61A 4L1WA 3CZKA 1P4CA 1XIHA 2ZWZA 3N3MA 2CPUA 5T91A 4LY8A 1A0CA 6A3HA 2DZBA 3CT7A 2FMOA 1GZ1A 1Q6EA 4UXDA 3W24A 4URIA 4F4RA 1K02A 4DB7A 5ABTA 2D2GA 4O8RA 4KEVA 4ZO7A 1DJQA 4NI8A 1WKYA 4FXJA 1GVRA 1DWFM 1U5JA 1GKPA 2Y7EA 4MWAC 1I60A 3UXLA 2DUXA 4J35A 3RX3A 3QPYA 3LI1A 3RRAA 4KRUA 4K38A 1WKEA 1KM0A 5BRPA 3ALGA 2QF7A 2OOGA 3ATYA 4CQDA 2A6LA 4ALDA 2CEQA 1KM2A 3ZLGA 3C2YA 3LPGA 2WPBA 3PS7A 4FNUA 4GGBA 3V0SA 1W9XA 3GVWA 3M0XA 4LEFA 4ZGYA 1YPFA 1UC5A 1YNPA 4CCDA 3G1RA 3QKZA 3I3BA 2CYGA 2PGWA 2IUZA 1U22A 4TV6A 1WDQA 2Z26A 3B9AA 4MZYA 4AX7A 3AAMA 4V1YA 2D3LA 2E5CA 1WDPA 2QCHA 2VGBA 3TR2A 4HNOA 3ZYZA 2NUXA 3UZJA 2Y4SA 2PF8A 4FZIA 3W3OA 3ZOAA 3W82A 4A22A 1C91A 3OQ8A 5MHBA 3KWSA 3M0IA 1GOKA 4AHOA 2X8RA 3AZTA 3L23A 3DHFA 1BVZA 1RY0A 3RYSA 1DJWA 2XH0A 2VEGA 1ISXA 3RHGA 2WMHA 5G4WA 3CHFA 4GH1A 2PDGA 4PCTA 2E09A 4PZVA 1ZENA 4FB7A 2EQDA 1XLGA 1JPHA 3AOFA 3QTGA 4ADSA 1WUFA 2OEJA 1OK6A 3EWWA 4LCSA 2ZRUA 4K2SA 3SY1A 4IHCA 2CHRA 7CGTA 1AL8A 4QITA 4D72A 3LMZA 1F6KA 1MXDA 4GIRA 3B4UA 3VIKA 5D2TA 4Z2LA 4JQ4A 4ZL1A 2HV5A 3KEHA 3MBFA 1DIEA 2P5NA 1UB3A 5HR7A 1N7KA 2GK1B 3WQEA 2PTDA 3GVVA 1PYFA 3A3XA 2E1WA 3KCOA 4GUIA 3A22A 4UR9A 1UR0A 1SFTA 3V3WA 4ZOAA 5FAGA 3RRXA 1FXPA 1E0TA 3ENLA 4QFUA 4RW5A 3CIXA 4RZBA 1F6PA 1TJ2A 3HPSA 4RXFA 1F3EA 3SCWA 4HZ8A 3VZZA 3QQ1A 4Q22A 3GDBA 3LUTA 3DG6A 2Z4GA 4A8NA 3WNLA 4HA0A 3W6YA 1GJUA 3LQGA 2AKMA 1A5KC 1Q4WA 1QOXA 3WDPP 1IR2A 2BY3A 4POCA 1EGMA 3EMCA 2R94A 4HMCA 2OWXA 5DT7A 5A6MA 1QOQA 3NO1A 1LQ2A 4JNMA 1FP8A 2RJHA 4ZB5A 1S39A 3WDRA 1ITUA 2EF9A 3GO2A 1OC7A 3OB8A 4GI8A 2CLOA 1GORA 3BLPX 4TXEA 1HN1A 4GQ0A 1ZBWA 3H22A 3NZRA 4W86A 5CGQA 1TWWA 2F61A 3B0YA 2PFHA 4Q8MA 3W1PA 1V6WA 1IEVA 3HV8A 4UFJA 3T6CA 2E8YA 3W6MA 1VF8A 4C6LA 3CL6A 1POJA 3GKAA 1UR1A 1QW8A 1E9LA 1R3VA 4RZ5A 3M0YA 2ZIDA 1DL3A 3V1PA 1NOUA 1DJGA 3TFCA 4AIEA 5A8MA 4GFIA 5I02A 3UJSA 4R34A 3UW6A 5U7SA 5U4NA 5D8WA 3NQFA 1ZU8A 4PUEA 1FWIC 2VZUA 1IXNA 3Q94A 4O1AA 4XTIA 3PR2A 3P5ZA 3PHAA 4O4WA 5D09A 3FIGA 4NQ1A 1MNZA 1JI1A 1HJUA 3O63A 1ZUAX 2YA2A 3DFSA 2HE5A 3EA1A 4ML4A 3B03A 3LTYA 3HA1A 4CD6A 1S2VA 3G5EA 4UZUA 1L6GA 3RM4A 4WJEA 1LL7A 2C18A 4EANA 2DT1A 3LHVA 4B5NA 4MY8A 1OFRA 4XZMX 4H01A 2ODOA 4MPKA 1W5PA 4ES4A 3A21A 3VIIA 2QDGA 2UBPC 4LCRA 2FDSA 4K6AA 1PXGA 1FDZA 3WK2A 3ZJKA 2YOCA 3VOJA 4WKAA 1KFLA 4MNJA 2QJJA 2FTPA 2HBXA 5JU6A 4HPXA 5JIWA 4F2BA 4EPBC 3CWOX 4U33A 2TMDA 3DIPA 1H60A 3HV9A 3NQGA 4JN7A 1KC7A 4PTMA 3CPRA 3HPAA 2MNRA 1NOFA 3EOSA 3PNUA 5HJYA 4PMDA 2C1IA 2GJXA 1RHCA 1QWKA 4IP5A 1PZ3A 1AVAA 3WG6A 3U2ZA 2BVWA 1KQYA 2Y5JA 2WVVB 1GEQA 3GH7A 1ISYA 3LLXA 2G97A 3KCJA 1MW2A 2PZ0A 3NOEA 3PSWA 1QO2A 2YDRA 4FNQA 4DXVA 3P80A 1ZCOA 3VNIA 1JFXA 2DZTA 2QVHA 1FHUA 3GG0A 1JF5A 3C86A 3II1A 3WLQA 4G56A 4AG0A 4K1WA 3K8MA 3BZJA 4PL2A 3WFLA 5HULA 9CGTA 1K4HA 3IPWA 1EFZA 2VEMA 4Q7BA 4UNIA 1JEZA 4PEEA 2WSPA 4CEXC 3TJ4A 2JIEA 3O6YX 4YVXA 1FWWA 3N9KA 4JZ5A 4AZ6A 4MGGA 4X63A 2XH7A 2Y7DA 3U2OA 4JFTA 1KKRA 1H1NA 3H4GA 1NOWA 3FXYA 5AC4A 3ARUA 1L2QA 1XBVA 4E3VA 3HGOA 1E4NA 1G7UA 4C1LA 1W9BM 5JQ9A 2J7CA 1AW1A 3FW6A 5AHNA 3VCNA 4GVGA 1ZSXA 4EACA 3WSUA 4KH2A 2O9TA 2VRKA 3FA3A 3NSXA 3CHCA 3RDKA 2XGIA 3NQAA 4DLMA 3BOLA 3VD9A 4PFHA 2VZTA 4E8GA 1TMQA 3FVMA 1KLZA 4FX6M 1YYAA 3ABSA 1ISZA 4JTIA 3VNMA 1FP9A 3G77A 3KOZA 3TTSA 1ADSA 3V0UA 4D6JA 3L4XA 1YBQB 1O60A 3ZXWA 2OGJA 3GAKA 3WFAA 2FH8A 5C9WA 4KMQA 1XIJA 2VKZG 1EF3A 3M5ZA 4A3RA 4HK5A 3B9OA 1CB7B 3PVFA 2R1KA 1CYGA 5DXYA 2PDMA 3DESA 1Z69A 2C16A 2Z6IA 3TIMA 2IPGA 2I14A 5CC3A 3NEHA 1UA3A 4CNOA 3CAWA 1CXLA 5C2GA 3I7RA 3GHUA 1FDYA 3ZMRA 3DH7A 2PDHA 1J96A 3WH9A 1LG1A 4UTUA 3UT0A 4G7FA 5HQMA 3AIUA 2PC8A 3CV6A 3BMVA 3PZVA 3TSMA 2IQDA 2XU2A 2PZNA 3TQKA 2VZOA 3LDVA 3RU8X 3ZT6A 2OKTA 2OZTA 1GW1A 4NZJA 4JTGA 2VVSA 1JCMP 3D3FA 1TTPA 3AI0A 3BAIA 3AXIA 4LSBA 1WZLA 1Y8BA 1T96A 3F4CA 1K77A 3SN1A 1GG0A 1WDWA 2DVUA 4GXMA 3BCJA 1ONXA 5HMSA 1VRXA 2BVDA 3K1GA 1YDNA 1QO5A 1WCGA 4HZMA 3SECA 5I24A 1LT8A 5JIPA 3F4WA 4MZ8A 1AJ0A 4HZ6A 2MANA 5REQA 3N2XA 1QPNA 3T0BA 2IXVA 2V3FA 2FKPA 5F4WA 2YLLA 3OVGA 4DBEA 1A5AA 1H11A 5A6TC 3TTYA 5TBOA 1QI2A 1IZJA 3VOHA 3WUBA 3BAJA 1LWIA 3S83A 3D47A 1QCWA 3CS2A 3GY1A 4IGMA 1V6YA 1DQXA 2CZVA 4MADA 3MUIA 2V69A 1E71M 2GUBA 2OWWA 4DHGA 1GVFA 1S2WA 4MDOA 2O92A 3AJ7A 3WD1A 3AS1A 3OVQA 1IT0A 5D04C 1MMFA 1GVSA 2Y88A 4HGXA 3MV11 3VD3A 2CHOA 3L0GA 3EDJA 1FCQA 2ADAA 4PCFA 4AMAA 3TP4A 2W0UA 1F05A 3M5YA 1WUEA 2QIIA 2I1OA 1DHKA 3ITGA 3DKLA 4R3UA 3SSJA 3CMFA 1G69A 1GZJA 1SW3A 2EKCA 1ECEA 2ZX8A 3E1F1 5LXXA 1NWSA 1VFFA 2O9OA 2WLZA 3I4KA 1CGTA 1JULA 3EGJA 2YBTA 4LANA 3KS5A 2VFEA 3TTOA 3S1UA 3M43A 3U5YA 1PCKA 2RAGA 2G8ZA 2RDUA 2DU2A 2WANA 2ATSA 4ADUA 2YCKX 1J0JA 1WYIA 1LTDA 1E9YB 4UMAA 3VGFA 3F2DA 2YCJA 4JKMA 3L4ZA 3BV7A 4JX5A 4ZVJA 2TRSA 3CLMA 1ICQA 2FHCA 3VGGA 1EP3A 1P6WA 5F7UA 1XRVA 3ARTA 3OBAA 1RJRA 3I4EA 4D71A 1XH1A 3GW0A 4GC3A 3ME3A 1T0OA 2DJXA 5I2UA 1M9HA 5REQB 2C14A 2MUCA 1SPQA 3GRIA 1BPLB 3GR4A 3MANA 1M7JA 4Q7NA 5DY2A 4XIMA 3B0UX 4IMFA 4YLWA 1XDLA 5EPDA 1F5ZA 3VIPA 1F6YA 2WKJA 3U48A 1FRBA 3D0CA 3CC1A 2NXHA 3QHMA 3JR2A 5ABEA 4DO5A 4C7FA 1UD4A 3B05A 5CC6A 4OTKA 5FJRA 4FR6A 3SUSA 4CEUC 5E70A 1B0IA 2EPLX 4WSHA 3QTPA 2J13A 1HF6A 1W8SA 5I0DA 1JCJA 4I7WA 4QQUA 1RJQA 3HPXA 1B4EA 3C2VA 4HYVA 1CTNA 5HPCA 1BLIA 1S5NA 1O6IA 4INFA 1Y5VA 3AFBA 4CN4A 2BHUA 4XVDA 2D1ZA 3SW6A 5DN1A 5EMKA 4PEKA 4HNLA 4DBDA 1O5RA 2F2KA 3MC5A 4A4AA 4IFRA 3RGTA 1MUCA 2H90A 1DWGM 1LJYA 3L65A 3MQTA 3T0TA 1GQJA 1Q6FA 4UTHA 1L8PA 1V03A 3LV6A 3QR1A 3T4WA 4ZMGA 2HS6A 4R53A 3WH5A 1FWGC 1J0YA 3MJYA 5BW6A 3MA8A 3N14A 1CXKA 4PUJA 1D3HA 1W37A 2VJXA 3GHRA 3TN6A 1ZY9A 7A3HA 1V02A 4Z2JA 1Q2SA 4GC4A 4JX4A 4RW3A 4P7NA 1MRQA 3WDJA 2PWGA 3PANA 3R13A 3VKJA 6XIMA 4B4FA 3GE7A 3QGAC 1B3OA 2ZTKA 4ZQOA 3LG3A 3L4UA 4UTFA 2PDIA 2WB5A 4HCDA 3H21A 4R9OA 3UWUA 2DSUA 5FACA 1DYSA 1O95A 5FF7A 4Q4MA 3CWNA 3RIKA 3TYDA 1H7XA 4F8XA 2J7FA 1JZ5A 4XAFA 3F2BA 2TYSA 3UY8A 2I5GA 4DO7A 1T8QA 1Q6RA 4KFOA 5I09A 4U3CA 3WYZA 3VFCA 4NJIA 7REQA 1SVDA 4LAUA 4W7VA 1PX3A 4XSMA 2PWDA 1VR6A 1E3XA 4W7WA 2DY3A 1LBLA 2PDLA 1J0KA 4YTUA 1UIOA 1HJSA 1C8VA 1TELA 1O68A 3BO9A 3NGFA 1SMDA 3GZ3A 3QJAA 4JTCA 1QPQA 1GJPA 1G5AA 1PKNA 1O7AA 4DNHA 2ZFAA 1ONEA 2GJNA 3R1ZA 1QHZA 5C2XA 1VBGA 1DTNA 4O12A 4P8WA 3L2IA 4RV8A 5CJNA 2W92A 4IICA 4UFLA 1LUCB 1JXKA 1H7RA 5HNRA 2J6VA 1TG7A 1D3CA 4ORIA 4I90A 1BQGA 3LGGA 2ZRYA 1ADOA 2GYIA 3R8RA 4GYKA 3C6CA 2QQ6A 2FZBA 1I2QA 4H8VA 7ODCA 1DKWA 1X8CA 1VBJA 4QDMA 2A0NA 3F7JA 1M65A 4UNKA 5FF3A 2XIBA 1GVEA 2Z00A 3W53A 4O1BA 1TE1A 3LZ5A 3VK5A 1KXTA 1T7LA 1PKLA 1EJVC 2WPGA 2Q8ZA 2C1GA 1R3TA 3I6RA 4M5PA 1YDVA 1Q6LA 1RSCA 5HJLA 3W7KA 2VOMA 4DLFA 4F66A 1LWJA 4HPHA 3T1GA 2P8CA 4GZIA 5GPRA 5C2CA 4P7RA 2GK1A 1OT2A 3AISA 3KBJA 3FJ4A 4AC1X 3NPXA 3V5OA 2ASHA 4DUVA 3WH8A 5CSYA 2Q3RA 3VIJA 3ITOA 4HYRA 3LD5A 4ORMA 4OOZA 3NPVA 1BGGA 4DUOA 1TJRA 4NI3A 3LHWA 1JUKA 2OJPA 4QLKA 2BY1A 2WZIA 1UIPA 2VX4A 3MZNA 3W88A 4C5YA 1PKYA 4BEUA 1OX5A 4S38A 3R4IA 3W7GA 4JTFA 4X22A 2YB1A 4L61A 3APGA 5BU9A 3UYCA 3LNPA 2ACRA 4KW2A 3P8JA 2VX7A 2QV5A 2A1YA 4Y96A 3BSMA 1KTNA 3K4DA 2I17A 2HROA 3NURA 3UA3A 4AB4A 2KX9A 1JUBA 3WF3A 3V4BA 1Q5MA 3WD0A 3B40A 4XZWA 4BA0A 3UXKA 2WBKA 4XZIA 3RO6A 3UBPC 4X3ZA 3A3HA 4DEFA 2V81A 4UQAA 1VPYA 1X6LA 3FS2A 1EC8A 1Q7ZA 5K4ZA 3KW3A 3CZ8A 1TKKA 3PZTA 4P2VA 2PWEA 3GTXA 4K8HA 3P74A 2FPVA 3VO0A 3M6YA 2J7HA 3I7SA 4KEZA 3GNPA 1HKKA 4RXGA 4MZ1A 3B0PA 3KVKA 4E2DA 1PIIA 1UG6A 1UBSA 2DUZA 1Q63A 2D2OA 3NQ8A 2KZHA 1X1ZA 2E28A 4YHEA 4HZ7A 2WKGA 5KZDA 2D20A 4PUKA 3PN8A 5AC6A 4L56A 3N11A 5HATA 4CQAA 2YLAA 4PMVA 5F2LA 3BLDA 5DO8A 4F40A 4U5KA 3W1UA 1XWYA 2VYOA 4FF7A 1ZAHA 3RR4A 3JS3A 1OB0A 2F9RA 2QCFA 2HISA 4HNCA 1XM3A 2INZA 4NAEB 4PYSA 4LC8A 1E0VA 2V5KA 4S3FA 2HMCA 1UWTA 2XFYA 2QJGA 4WDUA 4AZCB 1UHVA 3ARRA 3TA6A 2WNWA 4J5NA 5ENLA 1W56A 3GZAA 3EWYA 2XZ7A 1U5VA 3BDKA 2NVCA 1AFSA 3MSYA 1BXNA 1G4TA 2DVTA 3CL8A 3QQWA 3VNYA 4JY9A 1VC4A 2YZRA 4QHRA 4I8DA 4E5TA 1E73M 2CFFA 3KOYA 1S5TA 1F3XA 1GOMA 5IDIA 4H1ZA 5FKYA 3PZ9A 5CZKA 1JDFA 1XIEA 4QNWA 4MY1A 2ISWA 4X60A 3LY0A 2ZXDA 2XIJA 2DUAA 3RLUA 3C56A 1CPUA 1FVPA 2GPTA 3GVRA 3P67A 3VNZA 1DXIA 1VENA 3A5FA 1E15A 3AIQA 4MWAD 1MEIA 4Z1CA 1GQNA 4KETA 1KQZA 1Z8AA 4TVUA 4YCPA 2XFFA 1C9WA 2J7EA 1A49A 2XINA 3MSGA 5C9UA 3MVTA 2Z1VA 1SJAA 2GGEA 1UZHA 1G9HA 1CX9A 4DWDA 1P0BA 2X16A 4NUWA 2B7QA 3GXDA 4DZ5A 3LLDA 3GVQA 2I16A 4H9YA 3WDIA 2DORA 2VMFA 4JQAA 1W9UA 2DZWA 4PCSA 1K8ZA 1XYFA 2C0HA 3T09A 1PL9A 3CNYA 1TPWA 1KRAC 4JTDA 4S3DA 4E0CA 4I3GA 2BP1A 4FNPA 3WBAA 3WH6A 3FA4A 4Q8VA 1OF6A 1MW0A 3WLRA 4ONVA 4CQBA 9XIAA 3GR8A 4JR5A 5KITA 4PMOA 4BQ2A 1DE5A 5A6SA 4PMJA 3L4WA 3VIOA 1JZ3A 1K9DA 2ZUVA 1KW1A 3UGRA 4H7VA 1YE6A 2DV0A 4H9MA 3WBWA 3TA9A 4FLQA 4B92A 3WMLA 2WBGA 4LVFA 3SFWA 1EBHA 1WX0A 3HG4A 2BASA 4A35A 3BOFA 1L2UA 3H4XA 2G37A 3EMQA 3WL0A 4LFYA 1K6WA 2O7SA 4O11A 2HPMA 2E9LA 3REQB 3UEQA 1FXQA 5CPTA 3AMCA 3L7RA 1CXFA 3ITCA 3VZYA 1BXBA 3MMUA 3PTDA 3CXOA 2DQXA 3G8RA 3OIHA 1FKWA 1P5BA 2BS9A 1AODA 4AD3A 3UP8A 3RCNA 3M0LA 3WJWA 4QG8A 2ZICA 4PSRA 4UTKA 4LH8A 3LPPA 1ZS2A 3M0KA 3AMDA 2BB0A 4DUXA 4D1IA 1A4MA 3AXMA 2CZDA 2NQ5A 1R3SA 1P6BA 3WF2A 3QW3A 2Y8UA 1L6WA 4NJKA 4EKJA 4MJZA 2R14A 2CWNA 2XG9A 3Q45A 3IWPA 2GSJA 3EX3A 1QT1A 2A3LA 4REQA 1AQHA 3M5VA 2FVMA 2R1PA 1Z48A 2GFTA 1HGWA 4BJHA 1KCKA 2EJAA 2NW0A 3EB3A 4YWIA 3GW3A 3MU7A 3E0IA 5AYIA 4DZIA 5ECVA 3AALA 2XGBA 3G1AA 3SAZA 1RCOB 4ADTA 1U1UA 3MHUA 3BG3A 1E6XM 3OEXA 4LWWA 1XG4A 4PUMA 4TX9A 1SFLA 3GQYA 5I6SA 4W87A 4D8ZA 1V02E 3DFTA 2AKZA 3B4YA 2ZX7A 3HJEA 4LUJA 4W4QA 2QULA 1QI3A 3B06A 3ZVHB 3U8GA 3WENA 4V33A 4PB3A 4MKNA 1SW0A 2EPHA 1US3A 3TCSA 4OV9A 1QU4A 3G3MA 1W6TA 1PBGA 1XLLA 4BQ5A 4XZLX 1I0BA 5D2YA 3FCPA 3PPCA 3LCFA 2NLYA 3N15A 2GQ9A 4Q8TA 1ELSA 4O19A 4XD6A 3NSNA 5FD0A 2RFGA 3M9YA 1KXQA 4BI6A 4C1NA 1KCXA 1EGVA 4HSHA 1PDYA 3S3GA 4HHLA 3M7SA 1VEPA 3KZSA 3CT2A 1UP3A 1C7SA 4F2TA 1RUSA 1A3HA 1V0LA 4JL1A 3QM3A 5AFDA 1RY8A 4ZQPA 3IAQA 4GYPA 1TVLA 1VP5A 3DYOA 3GC2A 3LA4A 1QVBA 5CCZA 4LRSA 1DP0A 1K7EA 3LPOA 2V68A 2NVAA 5DCBA 1JPMA 1TB3A 3W1MA 5EYWA 4NZ4A 3ZFHA 4MB4A 3E49A 5D8ZA 4PUWA 2BXVA 3S42A 3H12A 5H6HA 3PUEA 3O06A 1GWJA 3TAOA 1QI0A 3VM7A 2Q3OA 3HN3A 3S9YA 4IUGA 4NZCA 1QI4A 5B80A 3APYA 2X1IA 1BEUA 2RGMA 3CUHA 4YWSA 2Z7KA 1VBRA 3TC7A 4KRTA 3CPGA 1DQUA 4DBUA 1R0MA 1ZJHA 5CC7A 5AYZA 4M6QA 3VPLA 4Q4RA 1U33A 1DWIM 1QMLA 3RUBL 4DQWA 1JRCA 2E25A 4DXXA 1NSJA 3OIXA 2WC4A 2H8XA 4BI5A 3R0KA 1UKPA 2Z1KA 2RDWA 5CQ1A 4ZA0A 3EPMA 2VDGA 1XRTA 1LBFA 1AZ2A 3RAOA 2GOKA 5EMMA 1K8XA 4MLRA 4NNAA 1VLWA 1UD3A 1I2NA 2VUNA 3MT1A 3H2MA 5LYRA 1LRNA 2JEQA 4NHVA 3WK3A 1AK5A 5G2WA 4PL1A 5AN7A 3ANUA 3WQGA 3S9IA 1TA3A 1F8MA 1JQVA 3I3EA 3I10A 3MV01 2ALDA 3AXXA 5C55A 3M47A 4LNCA 1XIDA 3LHTA 4KF1A 1HT6A 4EPKA 1E4IA 3D6NA 4WHBA 2W3ZA 4LUTB 1HP4A 3LGEA 3ITXA 3L2MA 3N25A 3HFYA 4Q8PA 2UV8G 3CTTA 1JZ2A 3AHVA 1SZNA 1EX5A 3WJZA 2V5LA 3ZQ9A 3W83A 3S9ZA 4KCTA 1L6FA 4EWND 3O6DA 1W1B1 3WNPA 5E6YA 2ABAA 5BROA 1VEOA 3DGRA 4C6JA 3K2GA 4F48A 1G67A 3OG2A 5FJUA 1FWAC 4YN5A 2W5FA 1VH7A 1YMYA 1ZAIA 4OT7A 1B3YA 1RR2A 3LENA 3GTIA 3K13A 2C8NA 3GX9A 2FGLA 1WOAA 3B8VA 1R9YA 4NIRA 3P2VA 3A6OA 1M3UA 2DGAA 3LCWA 2OYKA 1M5WA 2E40A 4GY7A 1H63A 3QH2A 5GNZA 2NQJA 2VRQA 4IPPA 4MUPA 4O0QA 2QHAA 2V5DA 1EPVA 3TTQA 3R6IA 5I03A 3S5YA 1WXZA 3WBYA 2WWCA 1GOWA 4C6MA 3HURA 1MUWA 4C6QA 1ML1A 3FJLA 1UUOA 2XSXA 1Z44A 2Z6JA 3MUCA 1WZAA 1BYCA 3ICJA 1JG9A 3NTYA 2DW7A 3NG3A 1EC7A 3FNDA 4UIOA 3VAVA 2X0SA 3DX5A 4O14A 1DWJM 1UR4A 3KL5A 4NT0A 3WF0A 1TQXA 3GXFA 3IJIA 3MCOA 1OFPA 3ARXA 5IFPA 1E0WA 1ZJAA 3EBVA 4AH7A 1TA3B 1YPXA 3HMCA 2PDUA 4UFKA 3BLLA 2ATMA 3IUHA 4Y9AA 3THUA 3DC8A 4BQ4A 2D2JA 3WNOA 3SO7A 3F4DA 1L6SA 5FSEC 2VC9A 2PWFA 3W7EA 2F6KA 4H8HA 1GKRA 5I7GA 1E51A 4IJRA 2NX3A 3USZA 3UG8A 2QPSA 1K6AA 4GWEA 4AYSA 1H7NA 3VGDA 4CGTA 5A6JA 4MB5A 5D33A 1US0A 3WLHA 5I23A 1W3NA 1XC4A 1SM9A 3QEZA 4PMZA 1OIMA 3E5BA 3SGZA 5KETA 4RZ6A 2PDKA 4NYYA 4E2OA 3N04A 2YDQA 2FHBA 4HA1A 4MWAB 1MWOA 4GBUA 1YTDA 1E6ZA 1DVJA 1E43A 2ZUTA 1ALDA 1XKJA 1XL9A 4MNKA 4WJ8A 1R47A 1AW2A 3UJFA 2WMJA 3ID7A 5D2XA 3H7RA 1DOSA 3CV1A 1AG1O 1BF2A 2VR4A 4KWOA 3VXGA 4E2VA 1W17A 1B57A 2PD9A 4ZODA 3UG3A 1S2UA 1RQEA 3ZT7A 1J79A 4UTTA 2NQHA 1MO0A 1AQFA 1M03A 4KERA 1Z7AA 1O94A 2XVLA 3BXWA 1K8CA 1UR9A 4RDZA 4DYEA 1OJXA 2A7NA 4JTQA 4ZO9A 2ZRXA 3C8NA 3N4FA 4FPSA 3V5FA 4L4PA 1PX4A 1XCFA 4IX2A 4MAVA 1W54A 1ITQA 1P48A 4C7DA 1TTIA 5HR6A 3GIQA 2O9RA 3QC0A 1CECA 2ZKMX 3IJQA 1E72M 5B7ZA 4IIDA 3ZLFA 1NARA 3CB3A 4KQNA 4H19A 1VIZA 3EB2A 2C7FA 4L1XA 4JDBA 4QEEA 3PZIA 4BS0A 3NDYA 1SO5A 4AW7A 3TFXA 1KGWA 3GDRA 2VQTA 4XBSA 3P3BA 4UNLA 2ZCGA 4M29A 3ARVA 4DWSB 3EX2A 3URBA 3OZOA 2WSQA 2PU0A 4O4VA 3BQ5A 2G3FA 2XDFA 4GJ1A 3MWAA 4JYEA 4QE5A 5K7JA 1KGUA 1E6QM 3S1XA 3TW9A 1V3IA 4IX0A 2J9ZA 5TQLA 4UTIA 1TCDA 2WVTA 4GQGA 2JIWA 1C9DA 1HO1A 2I9UA 2BLEA 5LSMA 4AZIA 4W84A 1X6UA 1R6WA 2OWCA 4U4MA 2OYLA 4DZHA 5AY7A 4HNNA 2E5BA 1XH2A 4YIWA 3QZAA 2BX7A 5I79A 3UZXA 3ZO9A 3SRKA 6ALDA 4F0HA 2WO5A 2J7BA 2HVOA 4H41A 2NLIA 3F4VA 1S46A 1BSLA 1H3GA 2OMAA 1J18A 5TD4A 3DHUA 1PS9A 5CSRA 3XISA 5C7HA 3KP1A 3GTFA 3WEOA 3T55A 3A5VA 3P60A 4Q7IA 1ZP3A 1U1JA 2QUUA 3VD7A 3FV9A 1W1A1 3PBYA 3RK8A 1YXCA 3NCOA 1U1HA 2E3ZA 2WKLA 1TX0A 4PRRA 4LCQA 4NSBA 5DQPA 1WQ5A 3LRKA 2X0HA 4W9TA 2E5DA 3M44A 2J8GA 3KAOA 5A1AA 3TLLA 2A6NA 4AMCA 1W3TA 2EO7A 4I5RA 1XICA 2OXNA 3ANVA 4UWMA 5D2VA 3OTRA 3T78A 3FX4A 2HQAA 1LT7A 4AIBA 4YVPA 1DE6A 1A5OC 4OUIA 4J3ZA 1BD0A 1TV7A 2V5CA 3MS8A 5C5YA 2ZUNA 4NXKA 4IF2A 2A3EA 4B3LA 1KFCA 1NWUA 1J9YA 2C19A 2WHMA 1HL9A 3DXIA 5IXEA 3RMEA 2E77A 4AXKA 4RJEA 5D32A 4QDWA 5DMLA 1OK4A 3ABRA 2WC7A 1R7OA 5AOUA 2O55A 3FGCA 1LZOA 4QROA 3TQVA 4TVCA 4B3ZA 4EXAA 3POHA 2XZ9A 4WR3A 1HFBA 5EMYA 3KRSA 4HOWA 3CTLA 1UR8A 3IJLA 2DSWA 2ZC1A 3NM1A 2JALA 4GLEA 3PUDA 4PR4A 5KZ6A 1JUEA 1Z6KA 2C1HA 1Y7VA 2BTMA 1AH4A 4KIRA 4S3KA 2WSKA 1OC5A 3LM7A 3ECQA 3L5MA 4GX9A 1VFUA 1FBAA 4PRWA 3KL0A 4QAWA 3W73A 1EJTC 1NFGA 5GJNA 1JRBA 4CD5A 2IPWA 3VDGA 1FWBC 3VDHA 2VR5A 2EPOA 1NP0A 1HJVA 4ZE5A 2PPGA 3GU9A 1TTJA 1B2YA 3DG3A 1QBAA 1TWZA 1NDWA 3W84A 1S2AA 5BRQA 3A12A 3G3DA 5EGRA 4OKDA 1XFCA 4IFOA 5CBJA 3IUIA 3DHPA 1GVOA 4Z2HA 5H91A 3P7YA 1V3MA 4LALA 4DRSA 5CBIA 1X39A 4YXGA 1B9ZA 7PTDA 3BW3A 3GH4A 3JU2A 1QOPA 3GK0A 1VJIA 4MY9A 3UFYA 1B1YA 1KFJA 2ZZ3A 3RXZA 5D38A 4RPPA 3VIFA 4QXIA 1E5JA 4L4MA 1UMLA 1V0KA 3CHEA 1OX4B 4BCEA 3IIZA 4E8DA 1YDYA 2FH6A 5A95A 3IGUA 3FDGA 1G1YA 3DI0A 3IANA 3QY7A 1A47A 4LC6A 3SUWA 2QAFA 1VEMA 1RJPA 1A3WA 1UP2A 3K4AA 1RZMA 3WMCA 1ENUA 1V3HA 4A21A 4RPQA 4O52A 4H9ZA 3QZ6A 3T4CA 1E6PA 2QUVA 3P93A 3C2OA 1XSIA 1SO6A 3QSRA 3Q67A 4S3GA 3LU2A 2VD9A 3UYIA 4B15A 1TWDA 4I7UA 1H50A 3W7HA 1DIKA 2QEZA 1TZZA 1F7BA 3ALFA 5HAOA 2G96A 4GFSA 4PTWA 4OGZA 3G6LA 2YL6A 3SCQA 1UD2A 3SEPA 3DFNA 2Z1BA 3G1VA 3WQOA 3WQ6A 4M1RA 3WF1A 3W22A 4S39A 3W1QA 1GVQA 1G4SA 1X1OA 3OGVA 2FGBA 3HIJA 4MJ2A 5LGZA 3AMKA 4GG9A 1R2SA 4DM2A 3ORWA 4JQ2A 1SZRA 1RK6A 2HRWA 1IE7C 3ES8A 1TPVA 4Y9NA 4KPLA 1FQ0A 2DZSA 3JW7A 3NGJA 4HSOA 4CVWA 4IOTA 1FHVA 2A79A 3GU2A 5BNKA 4EAMA 4JTKA 3OG3A 2WK2A 2EJ1A 1BQCA 3E0VA 3VILA 4YHGA 3L67A 3ZM8A 4F0KA 4BHYA 3PZGA 3KX6A 1Q3NA 1Z32X 1RLDA 1TJPA 1MNSA 4J3UA 1Z41A 5G5IA 1PWLA 2ALRA 2E8ZA 3BV4A 1UKOA 2DZAA 3GWQA 4CQ9A 3IV8A 2P0IA 3DFQA 3WMBA 1FWCC 1ZQ5A 4K39A 3BL3A 5T26A 2CZ5A 3H26A 2ZXBA 3CZGA 3UGVA 4KGLA 1XBXA 2G3JA 3DKJA 3BLEA 3V7PA 2AGTA 4PUUA 1JL8A 2QCLA 1DHPA 2HDJA 3WQPA 3QV6A 3W71A 2FFIA 1RBLA 1OYBA 2GVGA 2WXDM 2AQVA 3CYVA 3SRDA 4EP8C 4F3HA 3B8DA 3TN3A 3KZPA 1J8VA 4OQVA 3R2GA 4AEFA 4OBTA 1JVNA 2FTWA 4JHOA 4UQ9A 2OKOA 3DC0A 4LUIA 1I1WA 4XAGA 4YL2A 1LWHA 2DT3A 3M0VA 5FEPA 1NDYA 1BSIA 4PCPA 1IEWA 4GI9A 4C1KA 4NG3A 3EAUA 3LSBA 5CGTA 2XISA 4XAYA 3A13A 4E38A 2V67A 2JGQA 1Q6OA 2HVNA 5BXPA 3QMTA 1G6CA 4ASTA 1R2TA 3B3DA 4AFYA 1W5QA 1EYWA 4QCEA 4DJFA 2F6UA 2YCIX 1E55A 3U4AA 2D0FA 1KTBA 2XJ7A 3R11A 1W5NA 4GX8A 7TAAA 2VGIA 3PK7A 2QDEA 3OLEA 4JCLA 3PBUA 4P7QA 5K4XA 5FF4A 3LCHA 2Z25A 1BYAA 3IGHX 3O6AA 3WL1A 2V8ZA 3NZQA 3AROA 3R0DA 4M81A 1TR1A 1W31A 3GTHA 1TPEA 3P81A 4MTVA 1JF6A 3HG5A 3KE0A 3STGA 4NU7A 1EXBA 1Q7MA 4FXRA 2ZE0A 1GPWA 1LOSA 1LUCA 3OA5A 4M6VA 4MLJA 1XS2A 3UNTA 1LQ0A 4JGDA 4HP5A 3T0CA 3LPFA 5ABGA 4BZYA 2Q71A 2NSOA 2P76A 4LUSB 5EL1A 2XGZA 3PULA 5KZMA 3TN5A 4JOMA 1FOBA 2YA0A 2WVSA 2NZLA 4IIFA 3V1HA 4GK8A 1J01A 3VVGA 4O10A 3S2CA 4AHQA 5LNWA 1JDAA 3B0XA 1US2A 2XSBA 2AL2B 4MJ4A 1PV8A 1KRCC 3AS2A 3SUTA 2GDVA 4GIAA 4LAKA 2D69A 1ZLPA 3BZGA 3E5PA 4RLIA 1XRSA 2X1UA 2ZX6A 3LV5A 1NWRA 1PUDA 2IKJA 4L6OA 3THQA 3QC3A 1NIUA 4GXPA 1PZ0A 1CGWA 4UBPC 3R25A 2Z28A 4Q8OA 4W85A 1G0CA 3E12A 3IACA 4HPJA 3O8AA 3M0ZA 1R7AA 3PWAA 1V6TA 1UWSA 4O16A 4HT3A 5DELA 3KP0A 5I3HA 2QCDA 2Y7GA 3UZZA 3EX4A 4JIEA 1HKMA 4ZOCA 3O1NA 1D3GA 3W1RA 1U2YA 2PWHA 6ENLA 1ODUA 1FH9A 4GI4A 4NZ5A 4HU4A 1VYPX 4V1XA 4ZSUA 3AIWA 1A5SA 1XHGA 3OLDA 2VR2A 2ZVIA 3CHVA 4OIFA 1X97A 2BSLA 4LAMA 3L0KA 1YKWA 1R30A 2F2HA 4X9SA 5C71A 3AUOA 3CL7A 3M0MA 1GVIA 5D30A 3MHGA 4UMBA 3RLGA 3HFTA 4OE7A 3M4HA 3AJXA 3Q4DA 1R3RA 1XFBA 2NWRA 4NRRA 1KV8A 2GOUA 1HNYA 1V79A 3TYBA 4JTTA 1UKSA 2WYSA 3VE9A 1XI3A 2AL1A 3NZGA 2BY2A 3SURA 3QOKA 4AY7A 3E96A 3UWWA 1PKMA 5C9XA 5HK4A 1IWPA 3WIJA 5HUPA 4HMDA 3OP2A 1BG4A 4C60A 2FZNA 1JZ4A 4NZ1A 1EOKA 3V35A 1EDGA 1XJBA 2XIQA 4JTHA 4F0MA 1YRRA 2OEKA 4RDVA 4YTSA 3TONA 4ZZ9A 1XLBA 2XWEA 4TV5A 4DJDC 1XIIA 4HU0A 5L6UA 3B8UA 3K46A 4JX6A 1FY6A 2DSKA 2FHFA 4FLSA 4XK2A 4KWSA 4LBRA 1AA1B 3CUFA 1I8JA 1T41A 3H4WA 3SGUA 4N9EA 3FAWA 5DFAA 3WLOA 2E7FA 1V5XA 4QGCA 1VAHA 1TVNA 6TAAA 2XN2A 4A8RA 5A69A 2G3MA 3MO4A 3U4FA 1E3ZA 1V8EA 2YFNA 3SSZA 3QMRA 4C6FA 3HJZA 4IJCA 4M56A 1A3XA 4US5D 2POTA 4RV3A 2QGYA 3U57A 2FJUB 3FYPA 4S2CA 1QPRA 1TFVA 2WCAA 5CPQA 1IEIA 2XN0A 3E0FA 3UERA 3LEPA 1U83A 4M80A 1EDTA 1F8IA 1PEZA 5MKGA 4B91A 3QGVA 1ZCCA 4P7LA 2HWGA 5AB3A 2BFGA 1K1DA 4QE1A 1ZB5A 2WC3A 3LSCA 3VM5A 1XP3A 2PDJA 3VOCA 1AH0A 4Q6XA 1ZJIA 3W37A 2R9RA 2AQWA 3HG3A 2VDHA 4HPNA 2WV8A 4H8UA 4RZ4A 3TAKA 4ZO8A 1W3JA 2YL9A 4Q4SA 1YX1A 1FWTA 2PDNA 4MOZA 4M6UA 2A4AA 3TOYA 8A3HA 2Z7GA 1JIBA 1AQ0A 4HB7A 1S2CA 3EWBX 5B7YA 3L4YA 1SW7A 1X7FA 2YW4A 4AWUA 1UOKA 3OZPA 3WX7A 5F4XA 3N18A 1G4PA 3E0WA 1YTEA 1ODZA 1I2OA 4JN8A 1VBUA 4HA3A 1QK2A 3N2OA 2QMKA 3SQLA 1V3JA 4IMDA 3TKFA 2EKGA 4HN4A 2CITA 1DEDA 4MYXA 2X7VA 2NT0A 2PC4A 4UOJA 4K1GA 1T8XA 4PN2A 5A2AA 4LX4A 1FHDA 4FAMA 1W0MA 2W66A 3TX9A 1NAL1 1S2TA 4C6DA 3GNNA 4OOUA 1XW8A 1OFEA 3PPFA 2J24A 1JQXA 2X05A 1RALA 1XUUA 4GZEA 1Z89A 2V0TA 4FXSA 1FH7A 3DERA 2WQDA 4H9TA 3VD5A 4LBSA 1JNEA 1VFTA 1KBBA 5C6MA 1EGZA 2PRHA 1HKIA 4FHAA 1AJZA 2OELA 4JCMA 1FDJA 4D2JA 3AZSA 3W27A 4GMEA 1VZWA 2AAMA 2CBJA 3RFAA 3W7IA 3ZR6A 4C6IA 1HIZA 1ZPTA 4OZOA 4NASA 5LIUX 5C9ZA 3GYEA 3BAKA 4S23A 1HJXA 1KO0A 3MI2A 1P0NA 3SCRA 1I75A 3KHJA 4FEZA 4LT9A 3VYLA 2DIEA 3E2RA 4Y2WA 4REQB 1AUSL 1BGAA 2BXYA 4JAWA 3GDLA 3GG7A 3EXSA 3EX1A 3VOFA 1AJ2A 1W5MA 1IQ8A 2WW5A 1QATA 1ESWA 3FVDA 2HEJA 1ZP4A 1VJSA 4JIPA 3R94A 3EDFA 1MXGA 3RLHA 1S5VA 1XLFA 3RX2A 2X41A 3LCLA 4LVAA 3HTWA 3RCMA 3TSBA 1Q13A 2IXUA 5LA0A 2HJPA 4JIRA 4H04A 4XZ9A 1THFD 3PZUA 4PMYA 4JFWA 3A4AA 5GQBA 5M2FX 1F74A 3VKDA 2DH3A 1Q6QA 2ONEA 4LB4A 3IVTA 2WVUA 1QAPA 1DJHA 3SB0A 4FA3A 3EPNA 1UA7A 5AVNA 2CZFA 4V15A 3N4AA 3ZZ1A 3N13A 4L9YA 3QMSA 2ZTJA 3G1XA 3CQHA 1IR1A 5I78A 1OG6A 5FL0A 4C91A 3T8LA 4UQBA 2VFIA 3VX1A 4HHHA 1MDRA 5IBXA 3RJXA 4X0VA 1S5WA 3WNKA 5D37A 3PBVA 4QLLA 4G1KA 5HXMA 1UH2A 1WAUA 4CCEA 1VS1A 5D9PA 5CPSA 1WPCA 4Z0SA 2ZX5A 2ZOXA 3WJYA 4MB3A 4AD1A 2GVYA 3KL3A 3N6HA 3PPHA 4Q32A 3V36A 2F8QA 4B5XA 2BGSA 4DBWA 1KM1A 4RNJA 5GJPA 3MKKA 5C9RA 1A5LC 2CBIA 4W5ZA 1JXJA 3LXBA 1M7OA 2DT2A 3STFA 4HNTA 3LRMA 2L5HA 1GONA 3ZR4A 4G9PA 2WNZA 1JPDX 3IIVA 4EAYA 4HD5A 1EJUC 1XCWA 4H6QA 1RVKA 1CGUA 4G7EA 1VFHA 2DDXA 2AAAA 2A85A 3NYZA 4K8GA 1KFEA 3KVJA 5BMXA 4QNEA 3AIRA 1UOZA 3W7MA 2DIKA 3PB2A 3SUUA 3S4TA 1WDSA 1CXHA 1HKVA 4PB4A 4GH3A 1XIFA 4A8LA 2ZQ0A 1TVPA 2G95A 1KBJA 3EEGA 2NUWA 1H0GA 4JS3A 1DJIA 2P3EA 3W7QA 1C3FA 2WMIB 1JJKA 4M19A 1PZ2A 3SGGA 1EP2A 1KWKA 1IIHA 1I1XA 1BRLA 2WM1A 3W00A 2C3ZA 4JFSA 3LRLA 4Q4KA 1XYZA 5LGXA 3IV3A 2E9MA 2J4GA 2CLFA 1XGZA 4IMAA 4YMZA 4FR1A 3ABZA 4QLJA 4IL0A 4RNFA 1A0EA 2FPYA 1SJBA 2DEPA 1BTCA 2CU0A 4QTGA 4NF7A 1B9BA 3P5YA 4IZGA 4RE4A 1RQHA 5F1VA 5FOOA 3MMWA 5E0CA 4AZBA 4CNNA 5GVJA 1C8QA 3ZSSA 3AICA 3G1YA 5CEWA 2GSEA 4B5SA 2WNNA 5FEZA 5SWUA 2OX1A 2R8WA 3WFZA 3M07A 4E2BA 1XYMA 4FOKA 5HWJA 3ARZA 1F73A 1V08A 2R91A 3T7VA 3IAPA 2QT3A 2BGQA 1PO9A 5FEXA 4AD5A 1FWNA 3W1NA 1Y0EA 1EPXA 3E2QA 1KTCA 2J25A 1E70M 5MF5A 1GT8A 3W25A 1GZGA 3VABA 3DGBA 2CETA 1D8WA 5XINA 1OGGA 1XSJA 1NDVA 3K8LA 3NAVA 1A5BA 3BJTA 3BUVA 4PFMA 1QW7A 3PC0A 2Y62A 1UYQA 3H23A 4FOJA 3UWEA 3FOKA 1G94A 4UCFA 2QUMA 5E93A 2I9EA 1PHWA 3W7DA 3T9PA 3RO8A 3KRBA 1EWDA 1VYSX 1UC4A 2XIMA 2QCDB 4JFUA 4UQDA 1CZ1A 1JGIA 4GQQA 4V2XA 3HGJA 1CWYA 1DWAM 4W8LA 4AY8A 4CN1A 3DAQA 3N2MA 3SZ8A 2PUZA 2VENA 2Y8VA 5TNVA 3BQ6A 4JXCA 3VIGA 4XV0A 5J8LA 1YHTA 4IGHA 4JYFA 5A5WA 1XPYA 3KLLA 1OFAA 3JZUA 3NO5A 4RE3A 4UC5A 3BJSA 1JDCA 1GHRA 4IL2A 5EU9A 3T0AA 1E1CA 1CGXA 4DJEC 5AYBA 1V0MA 4NYUA 2VFFA 3GDTA 3BW2A 3AU6A 1FWFC 3I7QA 4A3YA 8CGTA 4JIQA 1GCYA 2RDXA 5ABHA 4DPPA 3LXAA 2HE8A 1ZGDA 1NJJA 1A80A 2LLEA 2PDPA 3NPWA 3M7WA 3HO8A 4LUYA 3SIMA 3CAKA 3U5UA 4X61A 1QBBA 2WMFA 4CD8A 2OT0A 3E6EA 1OC6A 1G7VA 3MSRA 1WDRA 3ZR5A 5DMYA 1FWRA 1TE6A 4DJFC 3A4WA 4DVOA 1LQAA 3GNRA 2OO6A 1JD9A 1E5NA 5DLCA 2GVEA 3Q2DA 3H2EA 4XVEA 4PODA 4XO7A 2HCVA 3KBNA 1JAEA 1L6YA 3BGGA