5AHNA

Imp-bound form of the d199n mutant of impdh from pseudomonas aeruginosa
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
467
structure length
297
Chain Sequence
MLRISQEALTFDDVLLIPGYSEVLPKDVSLKTRLTRGIELNIPLVSAAMDTVTEARLAIAMAQEGGIGIIHKNMGIEQQAAEVRKVKKHTYPLASKDEQGRLRVGAAVGTGADTGERVAALVAAGVDVVVVDTAHGHSKGVIERVRWVKQTFPDVQVIGGNIATAEAAKALAEAGADAVKVGIGPGSICTTRIVAGVGVPQISAIANVAAALEGTGVPLIADGGIRFSGDLAKAMVAGAYCVMMGSMFAGTEEAPGGALSAIVHQLMGGLRAAMGYTGSADIQQMRTQPQFVRITGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Studies of Two Variants of Pseudomonas Aeruginosa Impdh with Impaired Allosteric Regulation
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Oxidoreductase
molecule keywords INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
total genus 102
structure length 297
sequence length 467
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5ahnA00
2P10A 3BLFA 1AW5A 1KFJA 5HULA 2H90A 3IIZA 3S0CA 3ANYA 3GNNA 1F6KA 3QYQA 2VEMA 3N3MA 1DKWA 1SZFA 1VGAA 3QFEA 4JTEA 1W5QA 1XL9A 2PCQA 4IJBA 1B4KA 3KVKA 2FB3A 1AMKA 4OV4A 3F03K 1FWSA 4L4MA 1PVNA 3DZ1A 3HOJA 3MI6A 5CGQA 1SZGA 2YGYA 3B0PA 3EWYA 4LVBA 1P4CA 1RQHA 3HO8A 1XFBA 2EF9A 2JBMA 1KM0A 5EY5A 4KWWA 3O16A 4M6QA 2WJZA 2E6DA 4Y9AA 5D33A 2JKEA 4O18A 5FF3A 3I7SA 1TIMA 5K3VA 2ZZ5A 4Q4KA 4ZL1A 3NQGA 4ZVJA 5KZDA 5BNKA 3VNDA 3SY5A 3MW7A 3IIXA 1XUZA 3KRZA 4UR8A 5FESA 2GVGA 1R46A 3BW4A 2UV8G 1LYXA 4CNPA 2ATMA 4O53A 1UJPA 3W7HA 1YDVA 3P81A 1KM2A 4UFLA 3W83A 4N9CA 4JYEA 1B9BA 2QUTA 3R13A 1SZNA 2NXIA 1K3UA 2Y6ZA 1SUXA 2CZEA 3QSTA 3KFTA 4ORIA 2VKZG 1XDMA 5TBOA 2YX0A 3TFCA 4O50A 3W23A 3N2XA 4UFIA 4LUIA 2FJKA 3W7EA 1TPC1 3PB2A 2CW6A 5D2TA 1B57A 3QW4B 3Q58A 1DV7A 1GVSA 2ZA2A 4HNNA 5KZMA 3W1UA 4GWEA 4MYXA 3MYPA 3W7NA 4LS0A 4YWIA 3TJXA 2V2HA 5CZ0A 1NSJA 1OHLA 1N7KA 1QNVA 3MHGA 1KM5A 4JDYA 3M6YA 1W3NA 3W1TA 3G1XA 2PURA 4JTGA 1SO3A 3B0UX 3W2KA 1D3GA 1GQNA 2YW4A 1PIIA 2FDSA 1KA9F 1L6SA 1H62A 2V30A 1U5JA 3GXPA 4XTIA 1GVOA 5D09A 3G1AA 2VEPA 1PS9A 3NQEA 3NPUA 4AWUA 1EEPA 3G3MA 4LWWA 1EB3A 4XKYA 2PC4A 4YL2A 4CCCA 2V82A 2WSQA 4UTLA 3THAA 1XM3A 5BW6A 1NEYA 2X1SA 3TK7A 4N9BA 4NUWA 2H3BA 3DHDA 2CLHA 1N55A 2CLMA 2NV1A 2JGYA 3L65A 4I7UA 5K4ZA 1TJRA 3THQA 3EEGA 4O13A 4UTWC 3AO0A 1WBHA 3NGJA 1G4PA 2E5DA 4JEQA 1QO5A 1VYRA 2ZCGA 3W2UA 2WOQA 2DORA 3HG5A 4UCGA 1CW2A 1O5KA 2YPIA 2OX1A 3W85A 4PC8A 4PODA 5FF7A 3TSBA 1H7PA 5DELA 4XBSA 1OFAA 4IXHA 1Z41A 4HSNA 1DL3A 5EPDA 3HGOA 1M6JA 4UTMA 1YXYA 5G5IA 2ZA1A 3O06A 1A5BA 1KFBA 1ICQA 2G95A 4DF1A 4JICA 1JRBA 4JXCA 3UWYA 4LV4A 2PRMA 2OCZA 2VFDA 1Z44A 1YDOA 4TMCA 3DH7A 2RKXA 2ABBA 4NX0A 4NJKA 1VYPX 2WPBA 2Q8LA 1LROA 4OU1A 1TTQA 1UASA 3TMQA 1DOSA 3GR7A 5GVJA 1QMLA 1OFOA 5KINA 3NL5A 3YPIA 4OGZA 2RDTA 2CLIA 2QCMA 4WOQA 1GYLA 5I3FA 1OK4A 3HB9A 3W72A 1O94A 3OG3A 3CHVA 1UB3A 3P67A 3SGZA 4AHQA 4Z1AA 2V5LA 3NPXA 4HIBA 1W1ZA 4MY8A 2X1RA 3QMRA 4MLJA 3KRUA 2YZRA 4GE8A 4JIPA 2VFIA 2A5HA 1TMHA 2FTPA 3L21A 5AOUA 3GXTA 2BTMA 3PVFA 1VHNA 4N6FA 4FNQA 1TV7A 3G1YA 2IQTA 1BEUA 2Q8ZA 2NXHA 3JS3A 3PM6A 2EPHA 4K8EA 1I8JA 3W7MA 3Q94A 2V81A 2Z6JA 4LRTA 4Y6GA 3BW2A 5AYYA 4LC6A 2GQ9A 1L2UA 3TAOA 1K02A 3SZ8A 2WNQA 4IMDA 3W7LA 4DBDA 3NQVA 4BF9A 5AHIA 4HNVA 1S3HA 1TV5A 2B7NA 2YFNA 1HG3A 5F4XA 3N34A 1H63A 4UTTC 4UMCA 1XI3A 1H7XA 5TIMA 3ZFHA 1XBVA 3S1VA 4S2CA 4WY0B 3M1ZA 3KVMA 4CNOA 3PG9A 4FX8A 3LI0A 3OBKA 2HSAA 3N73A 5LZLA 4MIMA 5DY2A 1VPXA 1X8FA 4JX4A 2TSYA 1O4UA 3UXAA 1SW3A 2Y7GA 3EWBX 4AVFA 3TAKA 3U8GA 1SFLA 1FDZA 3HGJA 4OQVA 2AQWA 4FX7A 1DHPA 1WAUA 4DPQA 4M5PA 4FXRA 4RK8A 1BTMA 3E9AA 4GNJA 3G1HA 3N9SA 3PAJA 3VE9A 3BVJA 5DXYA 3L9CA 3MUXA 3CM4A 4ZQNA 1JCLA 3W74A 3T44A 3GLCA 2G96A 3LERA 1TV8A 4Z1CA 4KFNA 3KAOA 3G1FA 4EWND 1ADOA 1Q3NA 3OA3A 3LCWA 1OYBA 1EPXA 1VC4A 1A5CA 3NEVA 3NYZA 4N2YA 4U28A 3G1DA 1CI1A 4BI5A 5LNSA 4Q32A 2Q3OA 4IXXA 3L5MA 3LGEA 3M9YA 3PY2A 3O05A 4UTIA 4ADUA 4GRSA 5A8GA 2CLOA 1ZAHA 1C8VA 1T99A 3LCLA 5AHNA 4NQ1A 5AN7A 1UUOA 4JY9A 4LV9A 1D9EA 2X2GA 1H50A 2H6RA 1W37A 2FFCA 4LW7A 1FDYA 1VJIA 4NX5A 3LHZA 3P8JA 3PWAA 4M6VA 1W5MA 5D2WA 4MZ8A 1T8XA 4FIRA 2Y88A 2DJXA 3NM1A 5F2LA 2W79A 5K9CA 1GVFA 3C2OA 4HNTA 3TROA 2Y7DA 1EIXA 2ZA3A 2BXVA 1Z48A 5D30A 4H4IA 4BI7A 4LTSA 3WJYA 4MUZA 2TYSA 4UC5A 2VXNA 4ORMA 3LHTA 2XN0A 3I6RA 2NV2A 4O4WA 3MMTA 1RD5A 1LRTA 2ZZ7A 2R8WA 2Z0IA 3W22A 2HTMA 1SW7A 3UD6A 1C29A 3S5ZA 4UFKA 3PR2A 3WK2A 1VCGA 3LXAA 1X1OA 3W2JA 3W1XA 3WK3A 3E49A 3QW3A 3LRMA 1MXSA 1VH7A 1VR6A 3T78A 2GVJA 4GJ1A 4GUIA 3H53A 3S1XA 4IGHA 4E38A 1TRIA 1F05A 3TR2A 3W76A 2VFGA 1LBFA 5I3GA 3L0KA 3NA8A 4JN6A 3L0GA 3W88A 4AHOA 1TCDA 3B8DA 5F2GA 4PEKA 3STEA 5LNVA 4MJMA 1GWJA 4LC8A 1H51A 5KITA 3FLUA 4X3ZA 2CLEA 3GDMA 4BWLA 4LS1A 5D2VA 4XBKA 3LTYA 3Q37A 1ALDA 3W84A 2CLFA 1RR2A 4TU1A 3K30A 3W2MA 5K4XA 4N4PA 4RX0A 4X22A 4Z0JA 1YTKA 3F4NA 4Y90A 2ZQ0A 3M5VA 4JTUA 2EHHA 3QZEA 1EWDA 4MY9A 4ZMGA 6ALDA 1G7UA 2W6RA 4WQ6A 3BW3A 2GVLA 5CSRA 4LRSA 1LRQA 3CIWA 2QJIA 4Q33A 1EUAA 4NJGA 3FEMA 4RZ5A 4FXSA 4P61A 3MBFA 1TPUA 3G8EA 3UWUA 2XN1A 4A22A 5C5YA 3W9ZA 3FIGA 3NAVA 4N4QA 1VQTA 3P60A 1KFLA 1F6PA 2CZFA 5G2HA 1OF6A 2V5BA 1JUEA 3PSVA 2YYUA 5AC7A 4O1CA 3M7WA 3MO7A 3W2LA 3G8RA 1DJQA 4JYDA 2DZUA 2Y61A 3U6WA 1RZMA 5HWMA 5AYZA 3O1NA 3W7IA 4HN4A 1UCWA 5U7SA 4FB7A 2ZRZA 1PCKA 2R91A 3LCGA 4NU7A 2DZPA 2FB2A 3T55A 4MFDA 1BWKA 3NO5A 1P1XA 4CCEA 3KOFA 5K9XA 4LT9A 3EKZA 2OJPA 2A21A 3O8AA 2V8ZA 3P61A 3SFKA 3C4UA 3G1SA 1ZNNA 3FKKA 1X7FA 4O28A 3M41A 3I7RA 2BX7A 1VYSX 1XKYA 1OX4B 1OX5A 3TH6A 3MJYA 3M5YA 4AHPA 3PC0A 4ZQCA 3BG3A 3QPYA 1QPNA 1NAL1 2WNZA 4FEZA 5D02A 1OABA 3WJWA 2A6LA 3NL6A 3W7DA 4E2BA 1AL8A 4RLIA 3WJXA 1AK5A 2ZZ1A 2CZDA 4JYFA 2WKJA 5D32A 2VFEA 4QITA 1HUVA 1Q45A 4KWVA 3L0NA 3PS7A 3IIVA 4WY0F 3WK0A 5J5RA 5EKYA 3EKLA 2GQAA 5KSWA 2Y70A 4O11A 3W87A 4DO4A 1JCXA 3G3DA 1YXDA 3A22A 1JJKA 1R2TA 3UQNA 4NJIA 1TPB1 4PCFA 4MVAA 5G2WA 2RHGA 2J9XA 4QNWA 5C54A 3EXTA 4FHAA 2C15A 1OFPA 4ML9A 3G1VA 1R2SA 3TC6A 4E2DA 4N6EA 1THFD 1DVJA 1W8SA 5EBUA 3TFXA 1FQ0A 3RF9A 3QQ0A 3QPZA 4K8HA 4UNKA 5E0KA 4R7JA 4L4LA 1YDNA 4BWLC 1QDSA 4K37A 3W73A 4A3UA 1FWRA 1PCWA 3ABOA 3GZ3A 4ADSA 2RDWA 3LCHA 3W1AA 3IIOA 2YCEA 3NQFA 2FPYA 5EYWA 5D37A 5HR7A 3C61A 5D04C 1OF8A 2EGZA 1M5WA 3JRKA 1HFBA 2R94A 3OHIA 1TB3A 1T96A 4G1KA 1F2JA 4IMFA 1VZWA 3A21A 1TYGA 3PULA 2A2IA 1KM3A 1Q6OA 1QWGA 3F1QA 1Z42A 1QR7A 3SSJA 4QAIA 4JGDA 4LVDA 2XFWA 4WZHA 3M44A 3VFLA 3PUDA 3MP5A 1W0MA 3GIYA 2VC6A 4Z1BA 3WJSA 1VLIA 4GC4A 5KTLA 3TA6A 5HWJA 4QQ3A 3UXDA 4M19A 3OVRA 1C9DA 2NWRA 1WDWA 5HR6A 1TQXA 4Y8FA 3FJLA 1JQVA 1H7NA 1B4EA 2C16A 1F76A 3HG3A 3L5AA 1O5XA 3I65A 4IMGA 1ICSA 1XUUA 3NZ1A 5HNRA 2AGKA 3UNDA 3RMJA 1G69A 4LY8A 4D2JA 5D03A 4UTUA 4WD0A 4NZJA 4XZ9A 2B7QA 3DFOA 5FI8A 2QJGA 3EWXA 1T0OA 3UPBA 3KHJA 2ISVA 2QCDA 1HO1A 3HQ1A 4E0CA 4CNNA 3A5VA 3QM3A 3LCXA 4PH6A 2O7SA 3P84A 4JTKA 3GDLA 3L68A 1GPWA 5D2YA 3HGRA 3GDRA 1HTIA 1KTBA 5LNWA 2J27A 1FCVA 3TQVA 5LSMA 1FXPA 3MWAA 2ZRYA 1W31A 3C2FA 3UWWA 5LKYA 3IVUA 4RV8A 1IXNA 4DO6A 1DQXA 3IRDA 2C13A 1SQ7A 3OIXA 4HPJA 3WJZA 4GUHA 1ME7A 3NQMA 1SO5A 2NUYA 3M0ZA 3OVPA 4A2SA 2NUWA 1WBJA 3P8IA 2F84A 3OVQA 4MJZA 3GR8A 1GYNA 1I4NA 2E6AA 5AFDA 5C2XA 2E1DA 4XKYB 4RXFA 1OFQA 3FYPA 4NJJA 5U4NA 4MLRA 2DJLA 1IGSA 1ZALA 3CWNA 4IPIA 1TTIA 5I3HA 1G67A 5F4WA 4KFOA 4QM1A 1I2OA 2NLIA 3P7YA 4JTSA 5A5WA 3HJZA 1Q6LA 4X9SA 4IWWA 3EB2A 2J6XA 2A85A 1JUBA 4LUJA 2FPTA 1I2QA 1M7OA 1FCBA 5G2IA 5D05A 5F1VA 3DU0A 2FIQA 4R33A 3V75A 5I3JA 2A7PA 3P62A 1W5OA 3TV8A 1OG0A 3TSDA 4ZQOA 1SU5A 1I2NA 5G4WA 3IVTA 2Y7FA 4AB4A 5L9FA 1FX6A 3ZWSA 3HMJG 4LNYA 1TTPA 2WSYA 3T4CA 2QCFA 2PRLA 4PA8A 4UMBA 5FEZA 3HPZA 4AWTA 2V2DA 1A5SA 2NX3A 3MHUA 4K36A 2DZXA 1OYAA 2J24A 3ABSA 3C6CA 3TKFA 3P74A 4NNAA 3VCRA 4FIQA 1YYAA 2NX9A 4FNTA 4LS2A 5BMWA 1DORA 2QCGA 3LB0A 3W75A 4DELA 2LLEA 3LHYA 3NNTA 1JR1A 3CPRA 1K8YA 1SPQA 3GKAA 2A6NA 1OVDA 1LORA 1NF0A 4O1BA 3E12A 3CLMA 1QAPA 3EX2A 1WOAA 4GUJA 4NZFA 3BARA 4QNEA 5CPOA 1MEIA 1KLYA 1H5YA 4JR5A 3NQ2A 1JCMP 5G1TA 4Y96A 1GT8A 2Z2UA 4OV9A 3SIZA 4JY8A 3IVSA 3C3NA 3EWUA 3W7QA 3GAKA 4NNBA 1H7RA 2WO5A 4YCPA 4GBUA 2Y7EA 4NXSA 4TO8A 4JTTA 4LOCA 2ZFAA 1H61A 3L2IA 4IX0A 5CSSA 1WYIA 3PG8A 5I3IA 3W1MA 4YCOA 4TIMA 4AMAA 5D2XA 3QC3A 2YSWA 4DO5A 3CQ0A 1W3TA 1X6UA 2BSLA 3STFA 8TIMA 4CCDA 2C14A 2A4AA 3FYOA 4UFMA 1F74A 3W07A 3NXFA 1RVGA 3S42A 1XCFA 4XWUA 3KXQA 1KFEA 4DXVA 1KLZA 1NFBA 1O95A 1V7YA 4HHPA 4O8RA 2E68A 3BK0A 4WXYA 1W56A 1ZJIA 1G4TA 1KFKA 1WXJA 4OWGA 2A1YA 3O63A 5BRBA 4Z08A 2EKCA 2VEKA 1LP6A 3STGA 3W1LA 1TPVA 1W54A 2J9ZA 3TCEA 3PBWA 4O57A 1DJNA 4O52A 4DF0A 4FX6M 3G24A 3DKLA 3IGXA 1QFEA 4DEFA 3UYCA 3LLDA 3PF3A 1TSIA 3NZRA 4GFSA 1GOXA 2HS8A 1YXCA 1G4EA 3DFTA 3STCA 1IXPA 1YPIA 1EP3A 1H7WA 3M5XA 3P80A 3OEXA 5AYXA 3W6YA 3CC1A 1FUYA 2G5WA 1G6CA 3LV5A 3M16A 5DCBA 2YR1A 1MEWA 2QCHA 3ELFA 3LRLA 2QF7A 4EF9A 3S9YA 2QJHA 1Q6QA 2NUXA 4RKAA 3W7OA 1OX4A 4HKPA 3UY7A 3NQDA 3W3OA 1SSGA 3BLEA 1J5TA 4EVZA 5CPNA 1WQ5A 2BZNA 2YDAA 1HO4A 1Y0EA 4CQ9A 1OYCA 3LTPA 3GYEA 5F4SA 4RXGA 5IM51 3PBUA 3CEUA 1OFRA 2ZRWA 3S5YA 2B4GA 3A5FA 2CLKA 4MKNA 4DF2A 2FPVA 2PRHA 2Y63A 4I9AA 4ONVA 5H91A 4FNPA 1NF7A 7TIMA 5CKSA 3G0XA 2YYTA 2GOUA 4A2RA 3SJ3A 1L6YA 1QPRA 5BOOA 3D0CA 1LCOA 3TQ0A 4O17A 2H8XA 1UBSA 1XBYA 2B7PA 3QJAA 3T40A 4O14A 4RCXA 5AHEA 2H8ZA 4KFPA 1SR9A 5AHMA 2GJLA 4FNSA 2QCDB 3LLFA 3FKRA 4JTFA 2E6YA 1W5PA 4ZQPA 2YFOA 1PL9A 3HIJA 3CU2A 3C52A 3GB6A 3NG3A 3VKJA 1DBTA 3DXIA 3L67A 3GKFA 1VHCA 3BG9A 3IIPA 3GVGA 1GJPA 4M6PA 1LRNA 1G4SA 3M47A 3BV4A 4DBEA 3B03A 2ISWA 1N8FA 3U2OA 3GXNA 3HBLA 1MO0A 5LHEA 1Q6RA 1EA0A 5FEXA 5BMXA 3MP4A 1X1ZA 5DXXA 3CWOX 3W7JA 2FLIA 1TPDA 3QF0A 5F1UA 3L66A 3N2MA 4AXKA 4UFJA 3TDFA 1R2RA 4MOZA 1RQBA 3KX6A 1P0KA 3NM3A 2EAWA 4QSHA 2CZ5A 4JTIA 4NJHA 1PHQA 3NQAA 1K8ZA 1OFEA 3DAQA 1U83A 3E96A 1BWLA 2D73A 3W1QA 4PL2A 5AC8A 3SI9A 1TTJA 4PTNA 2X1TA 4JX6A 3KVJA 4O16A 1H1YA 2WSRA 4RR4A 3DBPA 1YTDA 1QOQA 3NDOA 3SR7A 1MEHA 3W1PA 3R12A 3W70A 4GUGA 1R47A 4YLWA 5HUOA 3DFSA 1KBIA 1AG1O 1M7PA 4QIUA 2VEIA 4QISA 5SWUA 3DHFA 1KM1A 2QUVA 2R14A 4JIQA 3W7CA 4BK9A 4FO4A 5EL1A 3UZ5A 4UR7A 3RNDA 2WNNA 1SO4A 1GEQA 3GDTA 2ZZ2A 1LLZA 2ZDRA 3I68A 4K39A 3TIMA 1RPXA 2YW3A 3ATZA 5H2ZA 2CU0A 1PE1A 2G97A 3C56A 5HQEA 1ME8A 1O60A 1XBZA 4NNCA 3EX4A 4QJ1A 3CT7A 3M43A 5DCEA 3F4WA 4AEOA 4EIVA 2Y85A 1MSSA 3WFAA 2Z6IA 1JUKA 4ALDA 3CEPA 4IMCA 3TXZA 4UMAA 2W0UA 1IIGA 5DBUA 3NQ6A 3LHWA 1LM1A 1ZAJA 4RZ4A 3BGJA 2QAFA 4J9JA 2ZRUA 5L6UA 3RU6A 3IGUA 3ZWTA 3USBA 5EMUA 3JR2A 3PUEA 5F2IA 2P0OA 2HS6A 3E0IA 3NL3A 5HINA 1SSDA 2VFFA 1OK6A 3EWWA 3HF3A 4O54A 1GG0A 1QO2A 2ZYFA 3A23A 3S1UA 5DBTA 5J5DA 3QSRA 5CZSA 2OMAA 4N9EA 2C0AA 4WX2A 5AHLA 3TUUA 5LGZA 3G0UA 1YLVA 3C2RA 1ZHAA 3CIXA 4K6AA 6TIMA 4O1DA 2QCCA 1JCJA 3EWZA 4S2BA 3GAYA 1W3IA 4PFMA 1FBAA 4LU0A 1IF2A 4O0ZA 5FEWA 3NQ8A 2C3ZA 2QR6A 3DFQA 5T26A 1L6WA 3FJ6A 1SW0A 5LHFA 3LXBA 3RLUA 4M7SA 4WJEA 3M5ZA 1TJPA 1RQEA 2CLLA 4N9DA 1QOPA 4JTJA 5DN1A 5KMYA 3N14A 1JQXA 4XQ6A 1TO3A 3ZR4A 1WOBA 2E5BA 4UNLA 4CQAA 1LBLA 3HG4A 2B0MA 3SGUA 4BR1A 2E77A 2QDGA 3W2NA 3VI2A 4MZ1A 3INPA 5FF2A 3NQCA 4WY0A 4B5NA 2TPSA 2QEZA 3DFPA 3I7QA 1IXQA 3R89A 3RK8A 4PL1A 4DQWA 1EWEA 3W7GA 3W1RA 1EP2A 3R2GA 1ZY9A 3VE7A 1KM4A 3UPWA 5LNUA 1DQWA 3B05A 1JCYA 4O1AA 3LX9A 5DCDA 5FF0A 4OHQA 4DPPA 4UXDA 3TU9A 3DENA 4R34A 3TQKA 3UWVA 1KTCA 3H54A 2ZBTA 4YXGA 4UTWA 5E1QA 3RLVA 1AL7A 1LTDA 3E02A 4RJEA 2J88A 1ZCOA 3MI3A 5K2ZA 4HNUA 1OJXA 1A50A 3LCFA 2DP3A 4JTLA 4OE7A 2CFFA 3EX6A 2I1OA 4N02A 4BFAA 3HGSA 4LVGA 3Q2DA 3PSWA 3CTLA 1OX6A 2JKPA 4YMZA 1XC4A 3S5NA 3LTSA 4H3DA 5K7JA 2BWGA 1JRCA 5K9DA 4FF7A 2ZZ6A 3BPWA 4HT3A 4O0KA 4RZ6A 5FF4A 2ZTKA 4X2RA 3UWZA 4AF0A 5AC6A 2OZ0A 3G18A 4M7TA 3TNOA 2ZZ4A 3S1WA 2ZZ3A 1VLWA 3BGGA 2E09A 4EF8A 3NR0A 3S8HA 1ZENA 2DZWA 2GUUA 4A29A 3O15A 2QCNA 2X16A 4UTJA 4K7YA 1AW1A 4Z0SA 3LCIA 1EX5A 4JNMA 1XBXA 3TMLA 3LV6A 1FDJA 4O15A 2JK2A 1A5AA 1H7OA 3W86A 1WA3A 1LOQA 4MY1A 4C1KA 1QPQA 3DFNA 1PHWA 2A0NA 2RDUA 2CWNA 5D38A 2YXGA 1KV8A 3UY8A 5AB3A 1I2RA 1K7FA 3L5LA 5KZEA 2C18A 4CLMA 1CX9A 3B04A 3TW7A 5CZJA 3S6DA 2ZRXA 1LDCA 1J4EA 1LOLA 2QCEA 4NXKA 4TX9A 3W7RA 3GNDA 3HG2A 3LXCA 3LBCA 1KV5A 3PBYA 4O10A 3H55A 5FEPA 1JVNA 3UWQA 1TQJA 3RFAA 4AWSA 1AW2A 3O6DA 3LHVA 3MBDA 2XN2A 2GPTA 3G0SA 3TSMA 1ICPA 4OT7A 5CPMA 1LOSA 3TXVA 1TPEA 3TC7A 2A7RA 3QRHA 3DGRA 4K38A 4GXMA 5I3KA 5ABTA 5CZTA 4BI6A 3O6YX 1VRDA 1A53A 3IEBA 5HMSA 2ZRVA 4W9TA 3QEZA 1D3HA 1P0NA 4IOTA 3GK0A 4LVAA 4NT0A 1KFCA 3C2EA 1F73A 2A7NA 3B0VC 1KW1A 3B4UA 3QQ1A 4U4MA 5HUPA 3SECA 4AF0B 3QH2A 5IBXC 2E5CA 4MYAA 1K03A 1GVRA 2F7FA 4H6KA 5G4EA 1TPH1 4ZQMA 1WX0A 1VS1A 3PUOA 3TX9A 3IGSA 1I45A 2C19A 3N19B 2Y62A 3R8RA 3A24A 3ABQA 4JDBA 2ALDA 3A9IA 4UTTA 2AAMA 1I2PA 4HPXA 5HJLA 1YPFA 2DZTA 1FWWA 3MI2A 4AAJA 4XUGA 4OBTA 4IX2A 3UZJA 1OFBA 5G1YA 4UIOA 1GTEA 2RH9A 4UFHA 3CB8A 3EX1A 3O07A 1QCWA 5HWNA 3G22A 1SFJA 1LLWA 1L9WA 5EA9A 1PV8A 4C1LA 3W71A 3HPSA 1FWTA 1RV8A 2VELA 3TE9A 3PB0A 5AHFA 2OT0A 2TRSA 5CG7A 3ABRA 4JX5A 4S1FA 1ME9A 3W7KA 2E6FA 2X1UA 2GJNA 2V2CA 3IV3A 2NX1A 4O19A 1EP1A 1FXQA 4JTHA 2QKFA 1VCVA 5LNRA 3NL2A 3NVTA 3LM7A 3LDVA 4HSOA 3MHFA 1JCNA 1F5ZA 2J9YA 1ONRA 2ATSA 3C2VA 1BKSA 3KRSA 4I7WA 2OT1A 5TQLA 4ADTA 1K7EA 4JS3A 3P5ZA 5LGXA 1FCQA 1YADA 3AJXA 5C55A 1MZHA 3FA5A 1VCFA 1FCUA 2JKAA 4ZQRA 3BO9A 5CPLA 3DI0A 3FS2A 1LBMA 1S5TA 2VENA 4TR9A 1H60A 5DLCA 1KTNA 3QMSA 1HL2A 3NQ7A 3FFSA 2TMDA 4FNUA 4KKXA 3P5YA 4UUIA 1F7BA 2ZTJA 3LRKA 4IMEA 2C6QA 1S5VA 2FQIA 3R5EA 3WK1A 2V9DA 3LHUA 3NPVA 1JULA 3W7PA 4XTDA 1EUNA 4UTHA 2BLEA 2NZLA 4P2VA 3HPXA 1IIHA 2VFHA 2I9EA 1GTHA 3MP3A 1GVQA 4R53A 3O6CA 1S5WA 4LVFA 1XXXA 1ML1A 4O12A 2QDHA 1TPFA 3C8FA 4NVTA 3GDKA 3LI1A 3LBMA 3TW6A 4K7VA 2RFGA 1P5BA 2ABAA 4A21A 4WXZA 3MYOA 4TMBA 3P82A 5DY3A 2O7QA 2JGQA 1B3OA 1NVMA 2X30A 3W1NA 1KBJA 2H3DA 5IBXA 4WOZA 3DI1A 3GX9A 2HMCA 4ZZ9A 2GQ8A 1QPOA 1ZAIA 1IXOA 3FOKA 1GG1A 4GUFA 1G7VA 4IPJA 1SO6A 1WV2A 3SW6A 4MPQA 1TRDA 3BG5A 2VOMA 2Y89A 1KM6A 1XDLA 2ISSA 1J2WA 4ICNA 3T7VA 3NOEA 4O4VA 1V5XA 2QAPA 4IQLA 4WUIA 1SZEA 3LOTA 2Q3RA 2WQPA 4JD4A 3ZS4A 3V1PA 3EXRA 3QMTA 2QUUA 3TJLA 3ATYA 1OFDA 4FNRA 2V0TA 2NWSA 2Z1BA 1H1ZA 1TPWA 3DKJA 5E93A 4EOUA 4POCA 2KZHA 2QCLA 3S5OA 1K7XA 3C0JA 3EXSA 2WV8A 5MHBA 2P1FA 2PE4A 2DZSA 4IUOA 3NPWA 4Z1DA 3KVLA 3PBVA 2DU2A 4MFEA 3B06A 1UUMA 1YTEA 2I14A 2C1HA 2NXGA 1ZFJA 5C6MA 1W5NA 4CQ8A 1K8XA 4MZYA 2B7OA 4I7VA 1GZGA 4UTKA 1TREA 4AH7A 1FWNA 3BLIA 1E51A 5F2MA 1R30A 3N9RA 1FY6A 2DZVA 3EX3A 1LZOA
chains in the Genus database with same CATH superfamily
2P10A 3AMCA 2ACQA 2HROA 1TR9A 3C0LA 4YTUA 2ZVIA 4F8XA 2OG9A 3UR5A 5E0FA 2Y0FA 1LL4A 5A6LA 5D9OA 2VC7A 3TA9A 2W5FA 4HA4A 1XL9A 4IJBA 2AAAA 4BCEA 1KR1A 4L4MA 3WL0A 3S2MA 1HIZA 2F6XA 3DZ1A 3EWYA 3B0PA 2CETA 4L5ZA 2WLZA 3L4TA 4KWWA 2JF6A 2WJZA 1KKRA 2CWXA 3UZXA 2YL5A 3SCWA 2CHNA 3ARTA 2ZZ5A 2RGLA 1TV3A 1PAMA 4ZL1A 4DJED 4HZ6A 1EF2A 2QV5A 3I3BA 5CH9A 2O0TA 3V18A 2B81A 3TW9A 1Q4NX 1YNQA 3KZSA 3BAXA 3KRZA 4DXXA 3SCUA 4UR8A 1R46A 4GFIA 1GQLA 1V3JA 3MSDA 4GCXA 1YE6A 3WBWA 2QUTA 4BKNA 1SZNA 3HZ3A 2Y6ZA 1ITXA 4MWAE 3CK5A 2CZEA 4RL3A 3OB8A 5TBOA 2YX0A 1XPGA 1TJ2A 3W7EA 4PMVA 4AZHA 2C1IA 2YJQA 5D2TA 3QW4B 3Q58A 1DV7A 1GVSA 3BQ6A 2A3EA 1TZ9A 3W1UA 2BB0A 2AKZA 2BVDA 4GWEA 4MYXA 3FGCB 3W7NA 1V3MA 3VXGA 3TJXA 3UEQA 4H00A 1OHLA 1DP0A 4LEQA 1IEQA 1CXIA 4QAWA 3VOIA 2P8CA 3KOWA 1M53A 1SO3A 1LL7A 1XSIA 3GHRA 3WD0A 1PIIA 4FLSA 1KA9F 4YTTA 2V30A 1U5JA 3DECA 4B4HA 2PBGA 4PUWA 3TYCA 4D8ZA 1UBPC 2HBVA 2YCJA 4K1WA 3DC0A 5C7VA 4Z2KA 1EEPA 2WVSA 1EB3A 2BDQA 2QDEA 3THAA 5BW6A 1XM3A 2E25A 2XFFA 2X1SA 4DBWA 2H3BA 3DHDA 3AMGA 3VFCA 1N55A 3ARPA 3L65A 1XLBA 2WBKA 3EEGA 3AO0A 4WDUA 4Z2LA 4ATDA 1G4PA 2E5DA 4UQCA 3CUJA 3UT0A 2IKJA 1US3A 1OIFA 3SRFA 4AFYA 1J11A 1V0MA 1CW2A 2YPIA 4LANA 2VD8A 3MKVA 3WD3A 3I3EA 4PC8A 4PODA 3EWCA 1AJ2A 3PFMA 5BYWA 4HU8A 1Z41A 1DL3A 5DEZA 4IQEA 1L8NA 2WMIA 2X0YA 3PBMA 2ZA1A 1KFBA 1ICQA 4BF5A 1JRBA 4JXCA 4U33A 5JBEA 1JZ8A 1RLCL 1Z44A 3PTQA 2RKXA 3ZLFA 1M3UA 2Q8LA 4OU1A 3VGBA 3TYZA 2WHLA 1TTQA 3L7RA 4V33A 1TV4A 3NL5A 5GNYA 4OGZA 2CLIA 4CU8A 1WNOA 2ZKMX 1E6NA 1C8XA 2EJ1A 3W72A 1QNQA 3OG3A 3XINA 3CHVA 3SGZA 4Z1AA 3L23A 4J3WA 3PTMA 4KRZA 2R6OA 4MLJA 3GO2A 4GE8A 5FJIA 1TMHA 5MF5A 1AJ0A 3GXTA 5CBBA 3FSTA 3PVFA 3KTXA 3PN8A 4LNCA 3N4EA 3NEHA 2IQTA 3GBEA 3JS3A 4PMRA 3W7MA 1XLIA 2VCCA 4GY1A 1HP5A 4CQBA 3SZ8A 3RITA 5M5DA 1B2YA 3W7LA 3WNLA 3NQVA 4HNVA 4UBPC 4JNZA 4TVDA 3AIBA 3AXKA 1POJA 4PSPA 3L4WA 3GUGA 1UP3A 2YA2A 3PG9A 3LI0A 3QN3A 1U5VA 3VGGA 4BHYA 1ZS2A 5HXMA 1UR9A 3GVRA 4HB7A 1KR0A 4WEVX 2C79A 3VIFA 2L5HA 2O55A 4FPSA 4ROQA 1OIMA 4OQVA 4DJEC 3LENA 1I0DA 2UY2A 4FXRA 1BTMA 1ISZA 4ATWA 3BMWA 4GNJA 3PAJA 2PDIA 1W17A 4J5NA 1L6FA 5DXYA 3MUXA 1GHRA 4D6CA 3P0WA 1JCLA 3UVAA 4D6GA 3W38A 1H5VA 1NH6A 1VAHA 3LERA 1EDGA 4EAYA 1UD4A 3KAOA 3RCNA 3G1FA 1ZRQA 1ADOA 4EWND 3H4GA 4HNOA 3CXOA 1VC4A 1XQLA 2QJJA 5ABGA 1WXYA 1WKDA 1GPFA 3M9YA 2F38A 3VC6A 3P6LA 4LX4A 1PIFA 3EDFA 2MUCA 2G3FA 2OTDA 2W66A 4JY9A 3B8IA 1H50A 3BL3A 4QCFA 3F5JA 4L6DA 3AIQA 4HYRA 4M81A 3EMCA 3LHZA 3P8JA 4L4OA 1NOWA 1WZAA 2Y88A 1EA9C 3D47A 2X7WA 3IARA 3RIKA 4IGSA 5CBIA 2VO5A 3HV8A 1KBKA 4Y7EA 4KPLA 1Z48A 3MUY1 4TX8A 4BI7A 3WJYA 3VD9A 3QR1A 4MTVA 3USZA 3KEHA 3QGAC 3APGA 1RD5A 3QV7A 3MU7A 2HTMA 4X61A 1C29A 2J7FA 5HA7A 3D6NA 4UFKA 1V3HA 3W2JA 3OG2A 3W1XA 3E49A 2Y5EA 1QATA 3S4TA 1MXSA 1U1JA 4GJ1A 2ON3A 1UW9A 3S1XA 4Q3MA 3SDOA 5AZ1A 1J0JA 3TR2A 1F05A 4E38A 1FHLA 1BHGA 1KC7A 1LBFA 5I3GA 4W8LA 3NA8A 3L0GA 3W88A 3CUXA 3VD3A 3U0HA 1CZ1A 4R85A 5I24A 1TCDA 5F2GA 2G37A 4OOZA 1GW9A 3STEA 3WLQA 5LNVA 3ITOA 2FVLA 4LC8A 3FLUA 1TX2A 2CLEA 3WDPP 5CAKA 4XBKA 3AZTA 3Q37A 1JF5A 4MM1A 4AISA 3CV7A 2DSWA 3W2MA 5BXRA 4RX0A 4Z0JA 1S1RA 3U5UA 4DJEA 1CPUA 1E1CB 3F4NA 3M5VA 4JTUA 2EHHA 4IGMA 4Q8VA 2Z2AA 1JXJA 6ALDA 4D6HA 1K1DA 3ITVA 4WQ6A 5CSRA 4Q33A 4RZ5A 3A12A 4P61A 3G8EA 3UWUA 1HZYA 4RE0A 1FWCC 1VQTA 3GNRA 4ROPA 1KFLA 4D8LA 1F6PA 1MW0A 3N15A 3MV11 1HJWA 1DJQA 2XUCA 1W1VA 4JYDA 1BWVA 2DZUA 2FZDA 3O1NA 4CD6A 3W7IA 1X7IA 1EBGA 3CUGA 2VHLA 4PUNA 1FFRA 5U7SA 4FB7A 3BJSA 5D8WA 2GJXB 5DMYA 3APYA 4NU7A 1VBRA 3T55A 3ABZA 3NO5A 3WDRA 4F48A 2FJUB 1YEYA 5AYBA 2ICSA 2GVYA 3O8AA 4CN4A 1OZMA 1XRSA 3SFKA 3EA3A 1X7FA 2I17A 4H83A 2BX7A 5IHSA 1VYSX 1XKYA 1JZ5A 1OX5A 4C6FA 3BTNA 3MJYA 2NV9A 3PC0A 2WNZA 4YHEA 2CBIA 4UQDA 3G5EA 4DJDC 4E2BA 3MVTA 3WJXA 1AK5A 3NGFA 3KOXA 2VM8A 4KWVA 3L0NA 3IIVA 4WY0F 1DE6A 1KNWA 3HM7A 1HJUA 3W87A 1BQGA 5A2AA 3G3DA 1KRAC 1JJKA 1R2TA 3ZXWA 4MVAA 2ZXAA 3WQ4A 1NOUA 3UA3A 3BOXA 3NSNA 3GYCA 4PUUA 1B9ZA 4R9XA 1W8SA 3URQA 3E5BA 3QQ0A 4LAUA 3WQVA 4UNKA 1HVQA 1YDNA 4ZO9A 1QT1A 1CYGA 4K37A 4LB3A 2RGMA 1R7AA 4ADSA 1DYSA 2V63A 3NQFA 2FPYA 4S3KA 3VD7A 2J62A 1MQQA 1HFBA 2R94A 4Q6XA 3OHIA 3LYEA 4G1KA 4IMFA 4BF7A 4L6HA 3A21A 3EA1A 3EPMA 3E2SA 3PULA 5FA5A 4ZSTA 2CNCA 2PWVA 1RHCA 2Y1HA 3CAKA 3SSJA 4WKHA 3LD5A 4AZCB 3CYVA 1AQ0A 4DZAA 3SCNA 3OZYA 3WFZA 1PDZA 4Z1BA 1UR3M 3WJSA 4QQ3A 2JEPA 3UXDA 5CLTA 1ADDA 1WDWA 3MMUA 1TQXA 4ZO6A 2PP3A 5RUBA 1XH2A 3CQIA 4KETA 3PBGA 3L5AA 5FJUA 3I65A 1GKQA 1DIOA 4WR3A 1LWIA 3RMJA 3SBFA 4D2JA 5D03A 3MCNA 3SRDA 2BP1A 3THUA 3L4XA 3TN4A 2HZGA 1PWMA 2ISVA 5A2CA 2EG8A 1L8PA 4CNNA 4PN2A 2POZA 3LCXA 6REQA 4JTKA 2PB1A 1UG6A 2PGWA 2DSKA 3GDRA 1KTBA 3MKKA 5FJRA 5H6HA 3TQVA 4O1EA 5LSMA 1Y8BA 1C7TA 3QBUA 1AH3A 3IVUA 2XVKA 4GACA 3GH4A 2C13A 1DXFA 4HPJA 5TNVA 2A3AA 3O6AA 5CBJA 3NQMA 4QX4A 4F2BA 4EKJA 3QXBA 4AW7A 1WBJA 3P8IA 3GR8A 3GE7A 1GYNA 1XG4A 4PMQA 5AFDA 4RDYA 1HNYA 2E1DA 3GRIA 3VC5A 1EKOA 4RXFA 1E9IA 1OFQA 4NRSA 2WMFA 4AG0A 3JVAA 4F0RA 1TA3B 5I3HA 1GUVA 4KFOA 2DIJA 2NLIA 4IFKB 3N9KA 3EB2A 5XIMA 3E0FA 3UG8A 5LIKX 1A3XA 4C65A 4LUJA 4G7EA 4W7UA 1OD8A 5D05A 1BYAA 3VIOA 3V35A 2FIQA 3VMOA 3GVVA 2P5NA 1LJYA 3QKEA 3J7HA 1UOZA 4EX4A 1M01A 1J96A 4UZUA 1RD6A 2Y7FA 3ZWSA 3B0XA 1ZLPA 3HPZA 4S23A 2Z24A 4K36A 3ABSA 3LPPA 4KEVA 3P74A 3VCRA 5C8BB 2FH6A 1EF3A 1DQUA 2FH8A 2QVNA 4HMCA 1EGMA 1S3TC 3O0KA 4FNTA 3SCPA 4QE1A 5CSYA 2NQJA 1XICA 2QCGA 3REQA 1PUDA 3RHGA 4I8DA 3UJEA 3C0QA 1GNXA 1OVDA 1S5MA 1QAPA 4GUJA 3R79A 2OGJA 2FTYA 5H1WA 1Q2SA 4JR5A 3NQ2A 3IS4A 3SUTA 3GU9A 5G1TA 4Y96A 3IAPA 2FHBA 5IFPA 1HGYA 4AYGA 3C3NA 1V0NA 4FR1A 2WO5A 3U7VA 1TMQA 4TQTA 3ITTA 1H61A 4IX0A 1WYIA 3MT1A 3PG8A 5I3IA 2QIIA 2PU1A 2E40A 3DN5A 2P88A 1R3YA 3W26A 3CQ0A 4DO5A 4FF5A 1W3TA 2W4XA 1X6UA 1S46A 3STFA 8TIMA 4HBKA 4C5ZA 2QJMA 2A4AA 4QEHA 4UFMA 1F74A 3GHUA 3SCTA 5A95A 4IICA 1KFEA 3IJDA 4Y8EA 4DWSC 2INEA 1NFBA 4NZ5A 2GK1A 3N1AA 2OXNA 1BLIA 1CLKA 3BSHA 1IZKA 1XIFA 1E1FA 3VYLA 1W56A 1WXJA 3N11A 1LT8A 2FHCA 1XDJA 1FWGC 2R1LA 2YKKA 1LP6A 3STGA 3RGTA 1W54A 3WEZA 3TCEA 3FAXA 4AIUA 4EPBC 4JIEA 4O57A 5FIPA 3WDIA 1RH9A 3SJNA 2VQUA 3AZSA 1W91A 3LLDA 4ECLA 3GG1A 5FJTA 2VOTA 3OLEA 1YXCA 4ZA0A 2GSHA 5FL1A 3LSBA 2W62A 1EJXC 2IQDA 1OT1A 3DFTA 3TTYA 3T2PA 1EP3A 3P80A 4C6QA 3PANA 3CC1A 3SQSA 1PXGA 3PZOA 3LV5A 3RU8X 1UR1A 2QCHA 3ELFA 3WSUA 4RKAA 2NUXA 3W7OA 5IHRA 4LAMA 5A94A 2NVCA 1E9ZB 5C7HA 3BLEA 5JVLA 4EVZA 1BSIA 1ISXA 3E0LA 3KCOA 3T4WA 4UR9A 4Q8OA 3F2CA 4B3KA 2OYKA 1OFRA 4GD0A 4CD8A 3M0IA 3S2LA 3A5FA 2CLKA 2XIBA 2J7CA 4ONVA 3VKDA 5H91A 3R1ZA 3GC2A 1QPRA 3RG6A 1F8MA 3D0CA 3FA4A 5I07A 4JFSA 1UBSA 2B7PA 4J27A 1ISYA 3C2YA 4O14A 5AHEA 3ZVHA 2PWFA 3MJMA 3V0UA 1QI5A 5I03A 5AHMA 1P6CA 3GC5A 1X6LA 1XX1A 1W5PA 1KB3A 1IHIA 2ZADA 3DXIA 1SFTA 2AGTA 4J4KA 3CQKA 1UKQA 4HNLA 1CGUA 3BG9A 3B0YA 3V7PA 4M6PA 1LRNA 5I06A 4MNKA 2V5DA 3GFYA 1S2VA 2ISWA 2WB5A 3HBLA 1MO0A 2AL2B 3KW3A 4TTUA 5I0DA 3VM5A 1TPDA 3N2MA 1MNSA 4DWSA 2DUXA 2P8BA 3KX6A 1P0KA 1XH1A 2R9RA 4X0VA 3OA5A 2CZ5A 2O9PA 2IPJA 1IR2A 3NQAA 1YNYA 2Y8VA 1U83A 3ARXA 3RO6A 2D73A 2QYGA 3W1QA 2NQ9A 5AC8A 3SI9A 4PTNA 3KVJA 4RZBA 2WBGA 1TFVA 1W8GA 4RR4A 3DBPA 1YTDA 5C2GA 3NDOA 1C8YA 3CH0A 4TV6A 2E0PA 1KBIA 4NYUA 4I9TA 3NDYA 1D8CA 1TVNA 1E72M 1J93A 3OW1A 1MUCA 4BK9A 3UZ5A 4UR7A 4IP5A 3QY6A 3RNDA 3GDTA 2ZZ2A 1LLZA 4IPPA 2ZDRA 2HK0A 4K39A 1KCLA 3TIMA 1VF8A 3ATZA 5GJMA 4IIGA 5HQEA 1ME8A 3EX4A 3WH6A 4WDWA 3CT7A 5D8ZA 4L56A 3M64A 1MQPA 3WFAA 2Z6IA 4Q4MA 4QP0A 3KP0A 3DBNA 9XIAA 3NURA 4JQAA 1IIGA 1GKRA 1NU5A 5AZ0A 2JFEX 1H11A 4J2MA 1W3JA 4RZ4A 1XIIA 3OGVA 4J9JA 1BRLB 3MV01 3BMVA 2E9LA 3BZGA 2ACRA 3RU6A 3USBA 1RJRA 2XVNA 4CQDA 4IHCA 3QHOA 3KDNA 3UNTA 5HINA 1SSDA 2WCGA 3RPMA 2QPXA 3HF3A 4O54A 2O4MA 1QO2A 3A23A 2OB3A 3T8LA 1DWFM 3MCMA 4N9EA 2J25A 3TUUA 4E4FA 3RO8A 6TIMA 3GTXA 2PU0A 3UVIA 3LMYA 2DIKA 3EWZA 4ML4A 2NLYA 4P7LA 4D8AA 4S2BA 1MNZA 4GVGA 1FBAA 1MI3A 3UR8A 1R9ZA 4LU0A 1ZSXA 4O0ZA 1R6WA 3ITGA 2VZUA 4MWAA 4S38A 2WCAA 4LCRA 2JALA 2PTZA 2XGIA 1PYMA 3UJFA 1FH9A 4JTJA 5DN1A 1YIXA 2XTKA 4XQ6A 1WOBA 2E5BA 3DCPA 3T09A 5FAJA 3H22A 1BYBA 3CMJA 2F6UA 4HZ8A 4UQ9A 4WY0A 3MKCA 1UPMB 1N82A 3M0JA 2PD5A 2Q8XA 2QEZA 3I7QA 3R89A 1EGVA 3SO7A 1S2AA 3RPTA 1M03A 1NDYA 4DQWA 3AS1A 1EWEA 3W7GA 1ZUAX 3UGRA 1QVBA 1TUXA 4HNCA 3LZ3A 1WB0A 3UPWA 5LNUA 1XR2A 2ZX8A 3LX9A 3NZGA 5FF0A 4WSHA 4XZNX 3VIGA 3TQKA 1KTCA 4LF1A 2ZBTA 5JH1A 3N4FA 4YXGA 3WBYA 4M51A 2DVTA 2NQLA 1MWOA 2J88A 4FI4A 3MI3A 1A50A 4JTLA 3EX6A 1IEWA 2I1OA 2Z27A 4BFAA 2GDQA 3ZVIA 4W7WA 4DUOA 1HL9A 2RDXA 3WLMA 3CTLA 1BGAA 3UF9A 3LTSA 5K7JA 2ZZ6A 4HT3A 1FHVA 2QXWA 5AC6A 1O12A 4M7TA 3GUWA 4D72A 2ZZ3A 4AU0A 1VLWA 1NDVA 2E09A 2PTYA 3OLGA 2ZUSA 4EF8A 2DT1A 4KBXA 2I57A 2FZBA 3IPWA 5HANA 3VOCA 2I56A 1EX5A 4GZJA 4ZB5A 4XD3A 4F40A 2D2HA 2WJFA 2W3ZA 3LV6A 2JK2A 1H7OA 3W86A 3BXWA 1WA3A 2EPMX 4XZWA 3U5YA 1NFGA 4C1KA 3URBA 2A0NA 2RDUA 4DI9A 3AAMA 4GC3A 4CLMA 4CU7A 3TW7A 1OEPA 3S6DA 1RBOB 4PBGA 1XGEA 1TWDA 4TX9A 1IT0A 3GNDA 3LXCA 4RE2A 3QVQA 4P7RA 4H2CA 3UGVA 1GQKA 1Q7ZA 2ZX7A 1TQJA 3I10A 4UOQA 1ZL1A 1K6WA 3DFYA 1AW2A 3RAOA 1ZJBA 3G0SA 3WDJA 1ICPA 4OT7A 5CPMA 2X41A 1LOSA 3AOFA 1GCYA 3P0XA 3MDUA 3EOLA 4GXMA 5I3KA 3VIMA 4DHGA 3O6YX 3IEBA 1UZ1A 4L1WA 4LVAA 2IPWA 2J8FA 2YZ5A 4BQ4A 3QH2A 2Q71A 5IBXC 2BASA 3MZNA 4MYAA 2F7FA 4H6KA 1TPH1 2YA1A 4LEFA 1OY0A 3BOFA 3TX9A 4C6BA 3AMKA 5I77A 1U33A 3N19B 3A24A 4GX9A 1TX0A 1E9LA 1TZ7A 2ZWYA 4CU6A 5HJLA 1UKTA 3QZAA 1MDRA 4GISA 2DZAA 1DXEA 1E1EA 1GTEA 2RH9A 2QT3A 3WY1A 4HMNA 3IRSA 2E9MA 5CGMA 3MMWA 3G22A 1SFJA 4WSKA 4XVDA 4DRSA 3BGAA 4PMNA 3FXYA 1L9WA 4QJ3B 3M07A 3EOEA 3UJSA 2DT2A 1XYCA 4D6FA 1IV8A 3CHFA 5CG7A 2WWCA 3FY1A 3ABRA 3B9DA 1J5SA 1ME9A 2R1PA 4MB4A 2X1UA 2V2CA 3UCQA 4O19A 4TVCA 1FXQA 4M56A 2PF0A 5LNRA 2OLSA 2G3IA 3LDVA 4JPGA 3KRSA 1BKSA 4JS3A 4NAEB 1FCQA 1YADA 3AJXA 1J79A 4B16A 3JUGA 5BZAA 4E8DA 3N2TA 4DJFC 1FCUA 5A8MA 3BO9A 1KGXA 3ORWA 5CPLA 3PZIA 3DI0A 1A5LC 1J0KA 1KTNA 1SMDA 4U5IA 3NQ7A 3FFSA 2Z1VA 4UUIA 4IMEA 3OO2A 2G4JA 1WPCA 1DIKA 3EB4A 2HE8A 4YTQA 3UZZA 5BROA 1S39A 1PIGA 3FYYA 2VX7A 1JULA 3DDMA 2NZLA 1EJWC 1OQFA 4KCWA 3HPXA 2OGYA 3MP3A 3O6CA 1S5WA 3VOFA 4LVFA 1XXXA 1ML1A 3C8FA 1UQZA 4M0XA 3KL3A 1H0IA 4AD2A 4FR6A 4K7VA 1I6NA 2YCLB 3HPAA 2XYLA 3B8WA 2O7QA 1W3LA 4AEEA 4DAIA 2H3DA 4WOZA 3A3XA 3QYSA 4RNFA 2VNCA 3WLNA 3PZGA 4FXJA 4MJ2A 2Y8KA 4PSRA 4JTDA 3A4XA 1NARA 1GOQA 7CGTA 4DB7A 1CLXA 3GXIA 4MPQA 1TRDA 4GY0A 1DJYA 3A13A 4IISA 1XDLA 1J2WA 2NQHA 3D5HA 4IIEA 4OTKA 4JD4A 5I79A 3EXRA 4UNIA 4FNRA 5HJXA 3ARRA 3DKJA 4FXFA 2D22A 2KZHA 4HK5A 1B3ZA 2QCLA 3ZJ8A 1FWEC 4GGHA 3VVGA 1V0KA 4U31A 4E8GA 1OCBA 2P1FA 2X2YA 3T2QA 1MFUA 4X0NA 5H8UA 1YBQB 2DU2A 4PGLA 3CIVA 5A6KA 2I14A 3CZEA 2OZTA 2NXGA 1HW6A 4ICMA 4ENLA 4HZ7A 3W81A 1E5JA 4FSAA 3BWWA 4NZ3A 1FWNA 1E51A 1XLFA 2V38A 4A3QA 2CBVA 3N9RA 4XVEA 2PLJA 2QVHA 1J6OA 4PMYA 3BLFA 3AS0A 3S0CA 2VEMA 3N3MA 4KRTA 1SZFA 3N12A 4KCUA 3QFEA 3SRHA 2B31A 5A6JA 1XISA 1XCXA 3KVKA 4HYWA 4XZIA 3AWOA 4ACYA 3NWRA 3HOJA 3MI6A 3S83A 3WBAA 3DX5A 3VGEA 4LVBA 1P4CA 3SQLA 1TR1A 1E9YB 1XFBA 2EF9A 2JBMA 4Y9AA 2E6DA 2JKEA 4PMJA 4O18A 4ZEPA 2OQLA 4Q4KA 1S38A 3R94A 4GY7A 1ZQ5A 4J40A 3VNDA 1OC7A 5KETA 2NSXA 1XUZA 3S47A 1WZLA 2PZNA 4C7FA 4OKDA 1F3XA 3AUOA 4CNPA 3N13A 4O53A 2BODX 3W7HA 3P81A 1KM2A 1D7FA 4N9CA 4F0HA 4JYEA 3V5OA 1B9BA 2GVEA 1CGYA 3WMCA 4ORIA 4JKMA 1A3HA 1IT7A 4LUIA 2FJKA 4D1IA 3M0HA 4L1XA 1TPC1 1ZCCA 3PB2A 4GIAA 1B57A 3FN9A 4XD4A 3BAJA 4HNNA 3U3HA 1GONA 4D71A 2VI0A 5KEZA 4HCHA 4U3CA 2OKTA 3VD4A 3F2DA 1MRAA 1N7KA 4JFVA 3MHGA 1MW3A 1X6NA 4JDYA 3BURA 4XZMX 1RPKA 3G1XA 3QOKA 4JTGA 4GJIA 1ZBWA 4A8RA 1TJ0A 5LIWX 1GQNA 4IZGA 1L6SA 1H62A 4YVVA 2VGIA 1A5UA 3QC0A 1GVOA 1QK2A 3BAWA 2VEPA 4KESA 3RRXA 2PF8A 1CECA 2OO0A 4AWUA 2PC4A 3TTSA 1R3VA 3ID7A 4CCCA 1XLKA 2WSQA 3QOMA 3TK7A 3QHMA 1OSEA 4NUWA 1IZCA 3H4WA 1IEIA 2JGYA 3BJTA 3WD1A 5K4ZA 1TJRA 1GOMA 4ERGA 4QS6A 1WBHA 4GYJA 3MVIA 3NCOA 1EPVA 2PTDA 1QO5A 1IQ8A 3UERA 4GGBA 6A3HA 4UCGA 3I3DA 4CN6A 5FJJA 3GG7A 4MF4A 1J10A 2PGFA 5FF7A 5DELA 2A79A 4V28A 4XBSA 1OFAA 3VX1A 2X42A 1M6JA 4UTMA 1YXYA 5G5IA 3O06A 3MDWA 1F6YA 2G95A 3WLOA 1DJHA 1YDOA 2PLMA 4NX0A 4NJKA 1VFTA 4PRRA 4LUSA 1HF6A 5CCZA 3TMQA 3AI0A 4OUIA 1H4PA 4OJYA 3LUTA 3YPIA 4BEQA 2RDTA 1WO2A 1G1YA 2OOGA 4WOQA 5I3FA 1LT7A 2VGGA 3P67A 4AHQA 1W1ZA 1LF1A 2X1RA 3EA2A 4LQ1A 4OOUA 4IFOA 1V03A 2A5HA 4E2VA 1UWUA 1JGIA 4PUJA 3HQOA 1O6IA 3QGVA 1EDTA 4D6DA 4FNQA 4ZFMA 3G1YA 2Q8ZA 4RE3A 1XLCA 1J0HA 3PM6A 2V81A 1REQB 4Q7NA 2Z6JA 1JXKA 3KLKA 3BW2A 2FVMA 4LC6A 4MPKA 3FA3A 4NZ1A 3ZIZA 3CB3A 2WNQA 2WYSA 3EWDA 4BF9A 4GKTA 5AHIA 4BQ3A 3AIUA 2YFNA 3R25A 1H63A 4UTTC 2J6VA 1H7XA 3S1VA 3T08A 3M1ZA 3ZQ9A 4FX8A 1C9WA 2WJEA 4IG2B 4MIMA 4JX4A 1V3LA 1O4UA 3V0SA 2Y7GA 4Q8WA 3T42A 3HGJA 5A6BA 4FX7A 1DHPA 2ZXBA 1WAUA 1HQTA 4YNGA 4EXAA 3M0VA 2F8QA 2PAJA 1F3TA 3GXFA 3N9SA 3VE9A 3BVJA 1ONXA 2Q02A 3CM4A 4MNJA 2J75A 2XDFA 2C0HA 3W74A 3T44A 4HZMA 4M24A 1V02E 3GLCA 2G96A 4LBSA 3CO4A 1J12A 3RLGA 4Z1CA 4FLRA 4XSLA 1V7AA 1EPXA 3LY0A 4Z1YA 3NYZA 4AVNA 4U28A 3G1DA 1CI1A 1CGWA 2ZX6A 1Q5MA 2Q3OA 3DOPA 2CKRA 2CLOA 5CLWA 1VIZA 1ZAHA 2WVVA 3LCLA 5AHNA 5AN7A 7TAAA 3VUSA 3VX0A 2DQWA 4LW7A 4JOMA 1VJIA 4OUEA 3HFYA 3CZKA 4AYSA 1W5MA 5D2WA 4MZ8A 4FIRA 1V6UA 5HQLA 2W79A 3KBWA 1GVFA 2HBXA 4HNTA 2QZRA 1EIXA 2ZA3A 4EPKA 1UWAA 4H4IA 1H2JA 2VXNA 4ORMA 3LHTA 3AMLA 4HPHA 4UOZA 2XN0A 4C6JA 3SUUA 3I6RA 4UZSA 3LGGA 3H6OA 3MMTA 2R1NA 5HK4A 3U9IA 2ZZ7A 5ABEA 3W22A 4GQGA 4PRTA 4MB5A 3S5ZA 2OQHA 2VL4A 1VCGA 3MTWA 3WDQA 1X1OA 4PB5A 4JTQA 3WK3A 3B9AA 3LRMA 2XINA 1HJQA 4ZSUA 1VH7A 2GVJA 3N17A 4AD3A 4IGHA 3F4VA 4AIBA 3W76A 1KCZA 4XAFA 4M1RA 2VFGA 1OC6A 2G3JA 3M6DA 4ES4A 1CENA 1XIJA 3B8DA 3ZLHA 4PEKA 1UWTA 1ECQA 1WZMA 1NWSA 4MJMA 5JXQA 4XUYA 1KRCC 1A0DA 5C71A 1BVNP 2DH2A 1H51A 1E70M 4ACZB 2X05A 4X3ZA 5D2VA 3BLPX 3LTYA 3E74A 4H9UA 4X22A 4MMWA 3TTEA 3ZT7A 1EJ7L 4F2TA 1OM0A 4Y90A 2ZQ0A 3IK4A 4W5UA 9RUBA 3QZEA 2Y5SA 1XIMA 1PTGA 1EOMA 1EWDA 4GZ7A 2D3LA 1G7UA 2W6RA 1KO0A 5C70A 3I4KA 4LRSA 1LRQA 3CIWA 1EUAA 2PFHA 3Q4DA 1TPUA 5I09A 2XN1A 4GXWA 4A22A 1VBUA 4NHVA 5C5YA 2WHKA 4RDZA 3UXKA 3BH4A 4N4QA 2J66A 5F7UA 2UZ9A 5E9XA 4L65A 1OF6A 2QPUA 1OCNA 2YYUA 2DVXA 5I7GA 2WZEA 3M7WA 3W2LA 3NUKA 3G8RA 1IWBA 4MUPA 4GZIA 5IFTA 4HN4A 1QRQA 2WANA 3ZR6A 4YS1A 3WL1A 1PCKA 4AVOA 3EPOA 3KCJA 2FB2A 4AZ6A 1BWKA 4EPEC 1P1XA 3TLQA 3EPNA 4CCEA 5K9XA 4LT9A 3EKZA 4I90A 3P61A 1KRMA 3G1SA 3GIPA 3MUIA 1PZ3A 1ZNNA 3FKKA 3GHSA 4O28A 2WLYA 4HA3A 3W24A 1OX4B 4KF1A 3W29A 1AD1A 3M5YA 4AHPA 1QPNA 1NAL1 3S6OA 4M6UA 3WJWA 2A6LA 2TODA 2H9AA 2XSXA 3CUIA 3TQPA 4B92A 2CZDA 1VFSA 4JYFA 4QITA 1Q45A 1XSJA 1HX0A 4W87A 3PS7A 3SUSA 3UBPC 1GORA 4K2SA 1JZ2A 4DBUA 4DUXA 1TPB1 3SIMA 3VNLA 2J9XA 3K4AA 3CT2A 3SB0A 2DSUA 3EXTA 5C54A 4ZTYA 1NP0A 3N04A 1RSCA 4GG9A 1XHGA 7XIMA 2XWEA 4E2DA 1THFD 4PTWA 5EBUA 3TFXA 1FQ0A 2PDUA 4K8HA 1RA5A 4R7JA 3XISA 4A3UA 4CVUA 3GXMA 2FZ9A 4AY7A 3UFYA 5D37A 5HR7A 4L9XA 3ARQA 1M5WA 3FDKA 1EJSC 4DYJA 1T96A 4DWSD 1EXPA 1F2JA 2UWFA 1UOKA 4AY1A 1CEOA 3L12A 4QAIA 4L6OA 1J2BA 2XFWA 1W1B1 3M44A 2E3ZA 1RAKA 3WLSA 1W0MA 3GIYA 4GC4A 4KWSA 1DJIA 4M19A 1C9DA 1UR0A 1WZKA 2NWRA 1EJUC 5HR6A 4Y8FA 3ARSA 3SURA 3FJLA 2V5CA 3ALFA 1ICSA 3NZ1A 4WRHA 4XD5A 4B5UA 1G69A 1FWIC 2EEXA 2G3MA 4WD0A 3PJUA 1JZ4A 3ZJ7A 3M0KA 2QV4A 1QTWA 2PODA 3TLLA 5FI8A 1DPMA 1ITQA 1T0OA 3AIRA 4X2PA 3KHJA 3H2CA 2EG6A 3E2QA 4E0CA 4LUTA 3W53A 4GZEA 1Q6FA 3QM3A 1QI3A 4PRWA 5C9UA 5HNNA 3OLDA 3F4DA 3HFTA 4MKSA 2CZVA 5LNWA 3GFXA 5CC5A 1MW2A 3MWAA 2OYLA 2G3NA 1W31A 1GZJA 4HYVA 1N8WA 4RV8A 1IXNA 3IRDA 4H9YA 1X38A 4H9ZA 3W28A 3VGDA 3K8KA 3WJZA 1UD3A 2SFPA 2NUYA 3OVPA 1YNPA 3OBEA 4LCSA 1W3HA 1XLJA 2XJ7A 5AY7A 1ESWA 1EHNA 3AIWA 3WENA 2CCRA 3TR9A 4B5XA 4DX3A 3WQEA 2Z1KA 5U4NA 2ISDA 2V67A 4MLRA 3K4WA 3IJ6A 2PDCA 3VCCA 1IGSA 2GGHA 1RCOB 2Z29A 2ZX5A 1VPQA 1EC9A 1R9XA 4ZB2A 2IUZA 3HJZA 4FS9A 4JQ1A 5CPTA 1JUBA 5G2IA 4QLJA 3UR2A 1ENUA 5F1VA 1MMFA 3WQWA 4R33A 1JYNA 3AWNA 3IJ7A 3P62A 1W5OA 4S3GA 2HVNA 1UD2A 5L9FA 1FX6A 1QUMA 2WSYA 4E6MA 1SJBA 3O7UA 4GK8A 3GU1A 4QTGA 2XGZA 2NT0A 2AQOA 2NX3A 3DYMA 3NO1A 1CXFA 1XLEA 1OYAA 2J24A 3C6CA 4U3AA 4XAGA 2NX9A 3GIQA 4JIHA 1HKMA 4AD5A 1HKJA 4HHMA 3HURA 4LS2A 5IDZA 3CAQA 3K5XA 4N7QA 4WKAA 4DELA 1Z7AA 3LHYA 1PYFA 4E5TA 2Z1XA 2YDRA 3GKAA 3P2VA 4NG3A 3E12A 3CLMA 3EX2A 2YLAA 1WOAA 5CPOA 3VNJA 1JCMP 1PTDA 4WDXA 3FGCA 3SIZA 1WDSA 4JY8A 1UUQA 1P0DA 3EWUA 4JFWA 4YCPA 4P7NA 2Y7EA 4NXSA 4TO8A 3TN3A 3QTGA 1OINA 1QXLA 4E4PA 1EEXA 4H9MA 2MNRA 4ZXLA 3EDDA 2ZVRA 2PDPA 4QS5A 2PBOA 2DT0A 4LAOA 2FGZA 4ICCX 3FYOA 3T0BA 5AKQA 2R1MA 4W93A 3NXFA 1XW8A 2VR4A 2J7DA 1W9VA 3SY1A 5G1MA 1VD6A 2Z00A 4O8RA 1XRTA 2OFJA 2EPOA 1G4TA 1CDGA 2EBNA 2UY3A 5BRBA 4Z08A 2EKCA 3EMZA 4IPLA 2VEKA 3ZJKA 2QUMA 3W1LA 1XPYA 3CHEA 3SCVA 1KQZA 1KD0A 1DIEA 3AQUA 5EGRA 4DF0A 3N2OA 4FX6M 3DKLA 3SCOA 1JEZA 3IGXA 1X96A 4DEFA 4GFSA 5HATA 5EMLA 3STCA 2X09A 2J74A 1H7WA 3S2JA 3VNYA 5AYXA 1JL8A 1G6CA 2PDFA 3LRLA 1D8WA 4GH1A 4EF9A 2QJHA 2BVYA 1Q6QA 4IQDA 4HKPA 1ZP4A 1AMYA 2ZUTA 3W3OA 5CPNA 1IEVA 1V8EA 2G50A 1UR4A 1MVYA 5I23A 1Y0EA 3LTPA 2GGIA 5F4SA 1XGDA 2J4GA 3PBUA 4IL0A 3CEUA 4AZ5A 3PZ9A 3ENLA 4LBUA 3S5YA 2B4GA 1XRFA 3NSXA 4DF2A 1D7KA 2PRHA 3K8LA 4US5D 1NF7A 7TIMA 5CKSA 4UQBA 2ZX9A 3G0XA 4A2RA 1EJTC 4H7CA 4EP8C 2HCVA 3DEQA 1J0ZA 2ZUUA 1RVKA 4K3ZA 4RCXA 3ONCA 4C6MA 4P7OA 1SR9A 4RNJA 4Q6JA 3ZVHB 7PTDA 2QCDB 2R82A 4HD5A 4JTFA 3ARVA 5HMFA 2HVMA 3G77A 1DBTA 2J78A 2VR2A 3L67A 1VHCA 2A3BA 1H3GA 3GVGA 2BXZA 3CNYA 1G4SA 2O9RA 4GYPC 5PTDA 2R24A 1N8FA 3TOPA 4P8UA 3GXNA 5LHEA 3ES7A 3NDZA 5BMXA 3MP4A 1TE1A 3M4HA 3PWGA 3W7JA 2FLIA 2DDXA 4XV0A 4UFJA 1R2RA 4MOZA 3C3UA 2V5KA 1V3IA 1BSLA 4QSHA 4JTIA 4GX8A 1JDCA 4NJHA 1PHQA 2GDUA 3DAQA 3V0TA 4O8AA 1R3RA 1OADA 1FVPA 2X1TA 3M0LA 3WMLA 3H7UA 2WSRA 5C9RA 4FOKA 2ZIDA 3PFRA 1TZZA 3SR7A 1R3WA 3R12A 1T5AA 4LBRA 3U2EA 3P3BA 4YLWA 3DFSA 1EHAA 3SM0A 1M7PA 3S6TA 4QISA 1E55A 3DHFA 1KM1A 2R14A 2A3LA 5A8OA 3GHTA 5A6TC 4KRUA 1A5MC 3E38A 1SO4A 5HAOA 4CD4A 4D6EA 4HCLA 4QDPA 2G97A 5DQPA 3C56A 2FVKA 1O60A 3Q45A 2X0HA 1HGWA 2PWHA 1QWKA 1K77A 5HDRA 2PWUA 1V4YA 4YVXA 1UP0A 2BHYA 4ALDA 2HNHA 4AC1X 3TXZA 4XAPA 2WZTA 2HK1A 1S2UA 4IT1A 2QAFA 4JFTA 1BKHA 5L6UA 4M80A 2QLYA 4HU4A 3DG6A 5EMUA 4LAZA 5F2IA 3NL3A 4NAFB 1OK6A 5HOSA 1GG0A 1S2TA 4AIEA 5CZSA 3A47A 4REQA 3UA4A 3PZUA 4G1NA 5LGZA 3G0UA 1TG7A 1IR1A 1U2YA 2FGLA 3HA1A 5ECUA 1W3IA 5FEWA 3W82A 2C3ZA 2QR6A 4NL1A 5T26A 1NWRA 1L6WA 8XIAA 5LHFA 2HPIA 3RLUA 1A3WA 1A4MA 1JCTA 3M5ZA 3T0DA 1OBAA 3WQOA 2DH3A 3GXDA 5KMYA 1JQXA 2OWWA 4CQAA 1LBLA 2HWGA 3VDAA 2B0MA 3SGUA 4BR1A 3W2NA 4MZ1A 5FF2A 3INPA 4RPPA 2GWNA 3RK8A 4PL1A 1AH0A 2D2OA 4XAYA 1EP2A 2DW6A 1ZY9A 1XCWA 1KM4A 2ZC1A 3VGHA 4FLOA 1T6MA 4LFYA 4I5XA 4NP7A 4WSJA 4XZHA 3AIVA 4DPPA 4GIEA 4R34A 2BS9A 5CGTA 4UTWA 1AL7A 4WIWA 4C6IA 5JMUA 2YL6A 1ZCOA 3T6CA 1Q8AA 3LCFA 3SAZA 4LVGA 5JH2A 3PSWA 1OX6A 2YCIX 4OZOA 2BWGA 1JRCA 4CD5A 5CC3A 1JNDA 3BPWA 2ZTKA 3G18A 3BGGA 3CUZA 3DYPA 4WKFA 2DZWA 3ITCA 4Q4OA 2QCNA 2X16A 3BSGA 3APTA 4YYCA 4K7YA 4RV3A 3RRAA 4L9ZA 4JNMA 4QQUA 1VEOA 1E3ZA 4E3VA 2WNWA 3KS6A 3ECQA 1LOQA 4R7OA 5AB3A 2YXGA 4J3UA 1KV8A 1LL6A 1WUEA 2VZVA 2ZUNA 5KZEA 1FWDC 3T0TA 2VWTA 3ARYA 2C18A 3VDBA 2WAGA 1PZ1A 3VCNA 1TA3A 4HPNA 2OYMA 1F4HA 1UC5A 2XG9A 3W7RA 3NZQA 3HG2A 5BOFA 3B9EA 4ZB0A 3H55A 5FEPA 2AL1A 4GABA 5LA0A 2DUZA 1UH4A 2OEJA 3A4JA 4H9VA 3MSYA 1J9YA 1E0TA 5T8GA 3OQEA 4QCEA 2PDHA 3TSMA 1QJWA 1CLVA 1C92A 2VR5A 1XIEA 3RCMA 5ABTA 1A53A 2CBUA 3W6MA 1P0NA 4IOTA 3GK0A 4C6CA 2XSBA 1NM9A 1S2WA 3NYDA 2A7NA 3QQ1A 4PB4A 2O56A 4ZQMA 1WX0A 1VS1A 3THDA 1YX1A 3R8RA 3ABQA 2X8RA 3VGFA 2ALDA 3A9IA 3U2ZA 3GBDA 4UTTA 2ZUMA 2AAMA 4HPXA 3MCOA 2V3FA 2DZTA 1TCMA 6CGTA 2KAUC 4J2PA 4FALA 2JE8A 5G1YA 2P3EA 3II1A 4P8WA 1LWJA 5ABFA 3WNKA 3WLJA 3KRBA 7REQA 5JBFA 1LLWA 2F2HA 4S3CA 1B30A 3DFHA 1PV8A 2QMKA 1RY0A 4XB3A 2ODOA 3E2VA 3RCYA 1FWTA 1RV8A 3TE9A 2YDQA 3PB0A 5HNUA 3A3WA 3W7KA 2E6FA 5DT5A 1E6PA 3OLIA 5HJYA 4N42A 1SJAA 4JTHA 2QKFA 3N3TA 1JPHA 1VFHA 3NL2A 3L4UA 3LM7A 4HSOA 2EPLX 1F4AA 3QR0A 4B3ZA 3S5SA 2ASHA 4ADTA 4B9YA 5A8QA 1S5NA 3ZO9A 1BAGA 3A4AA 4R5EA 4FOUA 5C55A 1XH0A 2FZNA 5I78A 1PJ9A 1TE6A 2YB4A 2PDNA 4KEZA 2ZWZA 4W8AA 4NSBA 2PDWA 3FNDA 1LBMA 1S5TA 4FAMA 1VPYA 5DLCA 2EJAA 3QMSA 1MUMA 2GUBA 4KKXA 4FNUA 2TMDA 1A5OC 3P5YA 4GQRA 2O9OA 3VPLA 2C6QA 3RN6A 3LN3A 1S5VA 2Q09A 5T91A 3STPA 3WK1A 4Q8MA 2WCSA 1XYMA 3LNMA 3LHUA 2OEKA 3NPVA 1VFUA 4F4RA 2Z25A 3W7PA 2V5JA 1JYVA 4UTHA 1IIHA 1XS2A 4J3ZA 1WUFA 4UCFA 4O12A 1XC6A 1J8VA 2QDHA 2WMKA 1W1TA 3K13A 2VTFA 1KCXA 2X0SA 2GWGA 3B9OA 3GFZA 1C3FA 5A6BD 4OBSA 1F9CA 1XJBA 3MYOA 1YW1A 4V1YA 2JGQA 3T07A 4KEUA 1NVMA 4C6PA 3WQFA 6XIMA 1Q13A 5EU9A 3GX9A 4ZZ9A 1QPKA 3AHTA 3FOKA 4M3PA 4XG1A 2ZDSA 4UWMA 1PKYA 1SO6A 3BG5A 2VOMA 3T7VA 4ICNA 2PWGA 1OGSA 1GOKA 1JYXA 2GJXA 1XGZA 3LOTA 1R3QA 2Q3RA 1JZ7A 3PK7A 1P0BA 3ZS4A 2QUUA 2VRJA 3V16A 2ACSA 5A6SA 4PE8A 2Z1BA 1H1ZA 1TPWA 5E93A 4PTVA 4I9JA 3KBSA 1L0PA 3S5OA 1G01A 5KZ6A 2J7HA 4ASTA 3C0JA 1CXLA 3EXSA 3LS9A 5MHBA 5MKGB 6PTDA 1I75A 1ZTVA 3KVLA 2PC8A 3PAOA 2NVDA 1LG1A 3WDHA 1QBAA 5JBDA 5EMMA 1TWZA 3AXIA 1UUMA 4IIFA 1XYZA 1YTEA 3BSMA 1IGWA 1ZFJA 5C6MA 1W5NA 4NIRA 1K8XA 4CQ8A 1B3XA 5BXPA 5HPOA 1J18A 4MZYA 2OZ3A 4I7VA 4HCDA 1TREA 2OPJA 4AH7A 3W00A 4B91A 2J79A 1NWTA 1EDQA 1IT8A 3PZNA 1FHUA 4GA8A 1FRBA 1W1YA 4IJCA 1JG9A 4MGGA 4C1NB 1BRLA 5A2BA 1AW5A 2XIOA 5A8PA 5HULA 4JQ3A 2H90A 3GNNA 3QYQA 2ANUA 3W37A 4I3GA 2YA0A 4A3YA 1DKWA 5LIYX 2Z4GA 4JTEA 1W5QA 1OG6A 1BYCA 3EOSA 5EFDA 2FB3A 1AMKA 3F03K 2INFA 1PVNA 5CGQA 1SZGA 3KOZA 1XLMA 3HO8A 1RQHA 1UP2A 1NJJA 3WQ8A 1EC7A 1QOXA 1OGBA 2WZIA 2WVVB 1UH2A 3I7SA 5K3VA 2VP8A 1E71M 4LALA 4I6KA 3NQGA 1TWIA 4ZVJA 5KZDA 4ZE4A 5BNKA 3SY5A 3MSRA 3RX2A 3VIKA 1CT5A 3EGJA 4PMXA 5FESA 2GVGA 3BW4A 2UV8G 2ATMA 3WKZA 3FK4A 4BEUA 1UJPA 2BNJA 3WUBA 2E7FA 3FX4A 1YDVA 1GVEA 4IIDA 2NXIA 1XV8A 4EACA 1K3UA 1MQRA 1SUXA 3QSTA 3FV9A 1E0UA 1K9TA 4O50A 5EBAA 4DZIA 4UFIA 4C91A 3GTIA 4KGLA 4QG6A 4PCPA 3VNKA 3BMXA 3TC3A 2ZE0A 1LQ2A 1A49A 1KCKA 2ZA2A 3UXIA 1KGWA 5FJPA 5KZMA 1TWSA 1AQHA 4U2ZA 3FAWA 4YWIA 4MWAC 3D3AA 2V2HA 4NASA 5CZ0A 5FSEC 3LK6A 1NSJA 4Z42C 1F07A 1EL3A 1W3NA 3M6YA 1TIWA 4BS0A 4W8BA 4C7DA 3N6JA 1DWGM 3B0UX 1D3GA 1Z3NA 2BXYA 2YW4A 1V6XA 3GXPA 4XTIA 1EZ2A 4QR6A 1IEXA 3G1AA 3IGHX 4XO7A 1PS9A 2ZUVA 4RW3A 1HKKA 2GOKA 2C8NA 3NPUA 4RNIA 3G3MA 4ILSA 4GI9A 1K9EA 3WQPA 3N6QA 3RXZA 4G8TA 1BGGA 4XKYA 4YL2A 1O66A 4UTLA 1J0YA 3M7SA 1JD7A 3KBNA 2IS7A 1F61A 4HPGA 4N9BA 1QU4A 2GLKA 2CLMA 3TN6A 3JU2A 3MPGA 4H8VA 3THQA 4O13A 2KX9A 4Y9OA 1SMAA 1WKEA 1XYBA 3GM8A 5FSDC 1XIDA 1VYRA 4I9MA 3NFUA 4WHBA 1XIGA 4IMAA 4B15A 5D9NA 3PJXA 3S1GA 4GKLA 4MAVA 4LJ3A 3UWEA 1O5QA 2OX1A 3W85A 1VB9A 4GI4A 4GIRA 2YCLA 2XVPA 3TSBA 3GVWA 5J04A 1EFZA 5GQBA 4IXHA 3T1GA 3NZPA 5EPDA 1WDRA 4I8YA 4L7ZA 5I02A 2OSXA 3UZYA 4A3RA 4DF1A 3EKGA 4JICA 3UWYA 3CHDA 4A35A 4JIIX 2PRMA 4HA1A 3CL6A 3DGBA 4JTRA 4TMCA 3DH7A 2ABBA 1VYPX 1DTNA 3BAIA 1LROA 3FXGA 1UASA 1DOSA 1QMLA 3H2FA 5KINA 3GU2A 1JPMA 4IH3A 2QCMA 3ARWA 1XLAA 2OQYA 4H8HA 3FVMA 1GYLA 3RLHA 1E5NA 1UB3A 3ABXA 4F9DA 4HP5A 1M68A 2VVNA 1W1PA 3PPGA 1TMLA 4F0LA 2YZRA 2YDSA 4HU0A 1E4MM 2VFIA 1UWRA 2QNEA 2DVUA 3VAVA 3L21A 2BTMA 1VHNA 1TV7A 1K9FA 1MZRA 2NXHA 4Z2GA 4K8EA 4P7QA 3LSCA 3Q94A 3IJQA 1QNRA 3WF0A 3GD6A 5AYYA 1L2UA 5JIWA 2MANA 4DBDA 1ODZA 4GQBA 1F8IA 2CKSA 2XH0A 1UKSA 2B7NA 4QSFA 1HG3A 3GTHA 4F0SA 3IWPA 2CHRA 1XI3A 5TIMA 3ZFHA 1XBVA 4S2CA 4WY0B 4DI8A 1TV2A 1UMLA 4CNOA 3OBKA 2HSAA 3PP7A 1EQCA 5LZLA 1ISVA 1R38A 1X8FA 4DN1A 2TSYA 3P14A 3PUGA 3UXAA 1SW3A 3TOYA 3TAKA 4KWUA 4IP7A 1SFLA 2ZE3A 2CIPA 4DPQA 4M5PA 3IUHA 4F3HA 4J3XA 4RK8A 1E40A 4CEUC 1R87A 3S46A 3MC5A 2VC9A 3L9CA 4ZQNA 3WD4A 1RJQA 1EBHA 2DW7A 4JZ5A 4C5YA 1HN1A 1FKWA 3W4RA 1FWHC 1IWAA 4KFNA 1JPDX 3EMQA 1JPIA 4Z2JA 3WNOA 2BG5A 2VYOA 3LCWA 1OYBA 1A5CA 3ITXA 3VIPA 2WZMA 5LNSA 3H24A 5EMYA 3I6TA 3L5MA 5CJMA 3LGEA 3UU0A 4HVXA 4J3VA 1JDAA 3PY2A 2PEVA 5E5CA 3R0DA 4GRSA 1QW7A 3CLWA 5A8GA 2EPKX 1C8VA 1T99A 2QGHA 3GTNA 3WIJA 1UUOA 5A69A 4LV9A 1D9EA 2H6RA 3BAKA 2FFCA 1FDYA 3UCCA 4WGHA 2P3ZA 4NX5A 4M6VA 3LA4A 1GQIA 2DJXA 4GNVA 3NM1A 5F2LA 5A1AA 5K9CA 3FW6A 3C2OA 3TROA 2CPUA 2BXVA 5D30A 4LTSA 4MUZA 2I5QA 2OSYA 4LF2A 4Q4PA 4Q4SA 2FDMA 2J77A 3DIPA 1TVPA 3S9ZA 4HOWA 4AIOA 1LRTA 3UCDA 3ICJA 2R8WA 1SW7A 1WDPA 1GYMA 3KBVA 4ZGYA 1W9BM 3A3HA 5M03A 1T40A 1E73M 1VR6A 3H53A 1UR2A 3R6IA 2XIIA 1ZP3A 2XHYA 1PO9A 3O2LA 4H1ZA 1A80A 1JYWA 1CB7B 4URIA 4MNMA 4AHOA 3G2GA 1J01A 1HVXA 5CXPA 3WD2A 2NQ5A 1U1UA 3OVGA 3PZVA 5KITA 3GDMA 4DWDA 4LS1A 3W84A 2CLFA 3UR7A 2CITA 5K4XA 3TN5A 4S3FA 3WH5A 1YTKA 1EO7A 3JZUA 2XH7A 1OGGA 3IK2A 2ZC8A 3QLDA 2XH2A 2XM2A 3QV9A 3BW3A 2GVLA 2QJIA 1QHZA 1DEDA 3AZRA 3FEMA 3MBFA 4YN5A 4A8LA 3IJ8A 1V6VA 3CUHA 1UHVA 1XRVA 1EXBA 2GK1B 3WF4A 1Q7QA 3FIGA 3NAVA 4H8UA 2HISA 3DHPA 2VX6A 3P60A 3TYEA 2QHAA 5M1TA 1OCQA 3N4AA 4PCTA 3WBXA 2V5BA 3PSVA 1QK0A 5BWFA 4O1CA 3MO7A 4FK9A 1PWLA 5FCZA 5LA1A 2Y61A 3U6WA 5HWMA 2WJDA 1KQYA 5AYZA 3TZNA 4IIBA 1NWUA 1POKA 4EPDC 4UQAA 3IAQA 2YIHA 4HMEA 3LCGA 3VUPA 2DZPA 3MA8A 1KWKA 4MFDA 3KOFA 1FWJC 1UWIA 2V8ZA 1FWFC 1L2QA 3V5CA 4KGJA 2XPKA 3M41A 1YE4A 3AUJA 5BU9A 3TH6A 3VO0A 1V02A 4ZQCA 2PDMA 3QPYA 2PTXA 3FVDA 1CGVA 1OABA 2F61A 3AHVA 3W7DA 1AL8A 3BCJA 4KW2A 4RLIA 2J8GA 5IRPA 3E3HA 2WKJA 5D32A 3WLKX 1G9HA 1FWAC 2VFEA 1HUVA 3AYSA 5T9CE 3TZFA 4QBXA 1UD6A 3LG3A 3BDKA 3WK0A 3IJLA 2CXGA 3EKLA 2GQAA 1JI1A 3FSUA 4GNKB 5KSWA 4O11A 1JCXA 1YXDA 4XAZA 3UQNA 2DSVA 4NJIA 4GXPA 2RHGA 5E09A 4FHAA 2YBTA 1SJCA 2C15A 1OFPA 3G1VA 1R2SA 5GJNA 5M3WA 3UG4A 3LMZA 4N6EA 3OZMA 3QPZA 1B31A 3PNZA 3OPSA 2XH4A 1QDSA 4JCMA 3SQMA 1PCWA 3GZ3A 2QW5A 3LCHA 1HJSA 3W1AA 5EYWA 5I5RA 3JRKA 1ONWA 5BWAA 1VZWA 2PLKA 4B3LA 4AQLA 4S3AA 1TYGA 1KM3A 1Q6OA 1WCGA 1NTHA 1QR7A 3ME3A 2PCEA 3PTKA 3GNOA 4PUEA 4JGDA 5A8NA 4LVDA 3GS6A 5JU6A 3F7JA 3PUDA 4UOJA 4U2YA 5H8PA 1J6PA 1VLIA 4JIRA 3BC9A 5HWJA 3VOHA 4C6KA 3OVRA 3QV6A 2G0WA 4AD0A 4HU3A 1JDFA 3K8MA 1H7NA 5REQA 1B4EA 1F76A 1P1MA 3HG3A 4CUCA 1O5XA 2FKPA 5CPQA 2NW0A 3U48A 5HNRA 1P6WA 1GZ1A 2AGKA 1CXHA 4XZ9A 2PPGA 1BFNA 1DJWA 2B7QA 3DFOA 1Q63A 4WVXA 2NSOA 4HK6A 2QJGA 3SCSA 3EWXA 3UPBA 1X8CA 2QCDA 3HQ1A 4ZO8A 4DAFA 4A4AA 3WH8A 2XVGA 1BQCA 3A5VA 4Q22A 4PH6A 3MB9A 1UR8A 1W9DM 3GDLA 4DVOA 3L68A 5D2YA 1HTIA 2J27A 1FCVA 3V3WA 1M41A 4NKCA 1FXPA 3U7BA 2ZRYA 3C2FA 2AMGA 3AISA 4V15A 1C91A 3UWWA 3AROA 4CCZA 5LKYA 2OWXA 5B80A 3CJPA 4DXKA 3WLTA 1SQ7A 1XYLA 3OIXA 3W02A 2PDKA 2EPNA 1OB0A 1SO5A 1VBGA 3M0ZA 5CZKA 1UWQA 3EB3A 3WF2A 4A2SA 5CJNA 2IQ0A 5HMEA 3CUFA 3OVQA 4MJZA 5HNTA 3LZ5A 4GQQA 1RK6A 5DT7A 1I4NA 2YOCA 4MJ4A 5C2XA 2BGSA 1XFCA 4DUWA 4NJJA 4F2UA 3NJ3A 3LPOA 4FA3A 3CWHA 1ZALA 1E6XM 3DHUA 5I3DA 4IPIA 1TTIA 2OWCA 3UG3A 3IUIA 5F4WA 5GNZA 4QM1A 2XIJA 3EDJA 3A6OA 4QG9A 4Q8NA 5A5WA 4CN1A 3WNMA 2J6XA 2A85A 1AJZA