5AHNA

Imp-bound form of the d199n mutant of impdh from pseudomonas aeruginosa
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
467
structure length
297
Chain Sequence
b'MLRISQEALTFDDVLLIPGYSEVLPKDVSLKTRLTRGIELNIPLVSAAMDTVTEARLAIAMAQEGGIGIIHKNMGIEQQAAEVRKVKKHTYPLASKDEQGRLRVGAAVGTGADTGERVAALVAAGVDVVVVDTAHGHSKGVIERVRWVKQTFPDVQVIGGNIATAEAAKALAEAGADAVKVGIGPGSICTTRIVAGVGVPQISAIANVAAALEGTGVPLIADGGIRFSGDLAKAMVAGAYCVMMGSMFAGTEEAPGGALSAIVHQLMGGLRAAMGYTGSADIQQMRTQPQFVRITGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
publication title Crystallographic Studies of Two Variants of Pseudomonas Aeruginosa Impdh with Impaired Allosteric Regulation
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Oxidoreductase
total genus 102
structure length 297
sequence length 467
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5ahnA00
2HSAA 3NEVA 1JCNA 1UJPA 2QUUA 1AW1A 3TROA 3B0PA 2OJPA 1G6CA 4QM1A 4DF1A 4MJMA 3NQMA 5DLCA 2E6AA 4NT0A 3G1SA 1W37A 2BWGA 4UTWA 1LROA 3W7HA 5KZEA 2E6DA 2OCZA 1MZHA 2Q8ZA 4LS2A 5FI8A 3SGZA 5DBTA 3LI0A 5D05A 2YFNA 1VCVA 1JVNA 3LCIA 3ZWSA 2DORA 4N4QA 4RZ5A 1XUUA 3GXNA 3TQVA 2CLKA 3WK0A 2C15A 2KZHA 2ZFAA 4MY8A 4O15A 1GT8A 3CHVA 4PC8A 2OX1A 4AWTA 2TPSA 2CLHA 3W7EA 1WOAA 1C9DA 3VCRA 1RQBA 3UNDA 4ZQNA 2QUVA 1JCMP 3DENA 3HB9A 5HR7A 4Z1BA 1IXPA 1FWRA 4FNRA 4O14A 3BG9A 2V0TA 2O7QA 1GYNA 1H1YA 4Y6GA 4RX0A 4LV9A 3W23A 3C6CA 3S1UA 3UD6A 3LV5A 3CIWA 5F1UA 3P8IA 1GOXA 2NUYA 4RKAA 3WJWA 3W1LA 2PE4A 3OA3A 1TV8A 3W84A 3G0UA 2QJHA 5EKYA 3A5FA 1M5WA 3W7DA 5C55A 5KTLA 4O53A 3O16A 4WJEA 5D38A 2HS6A 1B57A 3GXPA 5LNWA 3PM6A 4AEOA 5EA9A 5D03A 2A5HA 3U6WA 2WOQA 2TRSA 1JUKA 2XN1A 3USBA 3NO5A 1Z41A 1ZENA 2VELA 3M5XA 3IIVA 4PCFA 3ATYA 1GJPA 3TSBA 5AYYA 5FF2A 4IGHA 5FF0A 1SO5A 3HPZA 2TSYA 1MO0A 5KZDA 4ZZ9A 2WSQA 3MHFA 5DELA 2ZZ5A 5CZJA 2H8XA 5F2IA 3BW3A 4K38A 3WJZA 2CZEA 4JX4A 4XTDA 3P74A 3A9IA 3RLVA 3P7YA 3L2IA 5K7JA 1J5TA 1VCFA 3N9SA 3MP4A 1IXQA 1LRNA 3QMSA 4J9JA 3IRDA 1J4EA 1L9WA 3UZ5A 2V5BA 1Q45A 1D9EA 3IIXA 1QPRA 1K7FA 4O4VA 5LNSA 1OK6A 4A21A 4JTKA 5TBOA 2E77A 2CLIA 3P67A 1VPXA 3HG5A 3O6CA 4O52A 5G2WA 1UB3A 3CIXA 4ZQPA 5D2TA 4JYFA 1F73A 3HGJA 3FA5A 3ABSA 1BTMA 2YZRA 3BO9A 2FPTA 2PC4A 3NZRA 4NZJA 2NX9A 4UMCA 5AYXA 2R14A 4O10A 1W0MA 1EP2A 4U28A 3BV4A 1GG1A 2ZA3A 3NM3A 4P2VA 4IUOA 2VFGA 4N6FA 3O05A 3NPWA 1RR2A 2Y89A 4NQ1A 5G2HA 2DJLA 1I2PA 2ZZ3A 1ZNNA 3M0ZA 1TTQA 1OK4A 2CZFA 1B9BA 3DFSA 5GVJA 3TJXA 4BI5A 4RK8A 2VEPA 5CZSA 4EOUA 5U4NA 2QCDA 4PEKA 1H1ZA 1KV8A 1Z48A 2TYSA 5D37A 2B7PA 4DF2A 3QPZA 4M6VA 4PTNA 1RV8A 4Y96A 4DO4A 2PRHA 3STCA 1R2SA 3CT7A 3QQ0A 3G3DA 1VHNA 4LV4A 2QEZA 4QNEA 3C56A 1EX5A 4MOZA 4N6EA 2CLOA 1OFEA 1EP1A 1OYCA 4UXDA 3NQEA 1PL9A 1W31A 1KV5A 3QJAA 4HKPA 4NJIA 4X9SA 1MEWA 5AHIA 1DJNA 4LRTA 3FIGA 5LHFA 4LC8A 1IIHA 1VHCA 2AQWA 2WPBA 1VJIA 1GPWA 1V5XA 3P62A 4JTFA 3NA8A 1ZJIA 3C0JA 3ZR4A 1XBYA 3L65A 2DJXA 3DFQA 1TPVA 3LHTA 4JS3A 5HMSA 4TIMA 3V75A 3PBWA 4KFPA 5E1QA 3WJSA 5AB3A 2EKCA 3LCGA 2Y7FA 2GVGA 3G1VA 3B05A 4JGDA 2CZDA 1W3NA 2CLEA 2QCDB 5D04C 2YYUA 4ICNA 2X1TA 4H3DA 4Y8FA 3T40A 4CCEA 3E96A 3L21A 1TPC1 1XKYA 5F4SA 1QWGA 2WO5A 2PCQA 4MFDA 4AAJA 3W7MA 4NJGA 3OVQA 1YTKA 3W75A 4GUJA 1G69A 4OV9A 2Q3OA 2J88A 1O5KA 5C6MA 3ZS4A 2ATSA 4N2YA 1HL2A 4QJ1A 3AJXA 4M6PA 1DVJA 4N9DA 5K9XA 1XM3A 4IMEA 1A50A 3KRUA 3STGA 3C2VA 1DKWA 2ZZ7A 3TUUA 1FXPA 1W54A 4LRSA 4DO6A 3G0XA 1TQXA 1XCFA 1YDOA 4ADUA 4O19A 1GVOA 4O4WA 1KTBA 2DZTA 1Y0EA 4PODA 4MYAA 4FIRA 3G0SA 3L0GA 2V30A 4FNTA 4JTTA 1W3TA 5AYZA 2P10A 3CM4A 1H50A 2E1DA 1I2OA 1TIMA 4KWWA 3GB6A 1YDVA 1ALDA 3QMTA 3BLFA 3UQNA 1G4TA 4NU7A 2OT0A 4GBUA 3ZFHA 1JUEA 3H54A 3O06A 3CPRA 1XI3A 2R91A 1X1ZA 2H6RA 2F7FA 1I2RA 3NQDA 3BG5A 5CKSA 2C16A 3SI9A 4UCGA 3WK3A 3H55A 1F76A 4GXMA 2HMCA 2X2GA 3LTYA 1GVQA 1Z44A 2OT1A 3KOFA 3N19B 4PFMA 1H7PA 4OWGA 1U5JA 5CPOA 5CSRA 1OX4B 3SY5A 3QZEA 3RU6A 3TC7A 2AGKA 3GIYA 2ZYFA 3TJLA 1K7EA 3I7QA 3GDMA 1L6YA 3F1QA 4LVAA 1H60A 2Y62A 2E5BA 2GQ8A 3TMQA 3LTSA 3L0NA 4UIOA 4FNPA 1N8FA 4LUIA 1QPQA 4RCXA 1IGSA 1PV8A 5D2XA 4NX5A 3FKRA 1H62A 4RJEA 4X3ZA 3S5OA 3MO7A 2E6YA 7TIMA 2QDHA 1VYPX 4K37A 3MP5A 3FKKA 4XUGA 1FDYA 2ZRUA 1YXDA 3MI2A 4UTLA 3PG9A 1NFBA 3P60A 3G18A 1I45A 4K36A 3S42A 1FWSA 3UXDA 4JX6A 5EBUA 4Z0JA 4HNVA 3W7LA 2FJKA 4Z1DA 1DBTA 4O12A 1T96A 4DQWA 3W6YA 3LHZA 3NG3A 4LW7A 1O60A 5AHNA 2P1FA 1N7KA 3TFXA 5AC8A 1GG0A 5HINA 3IIZA 4NZFA 2I9EA 2ISSA 1TTJA 3CU2A 1RPXA 3GK0A 3SJ3A 5EYWA 1FX6A 4NUWA 1FWTA 1BEUA 3QSTA 3O1NA 2X1RA 5ABTA 2EHHA 4NJKA 1WBHA 4GUFA 2JKPA 2V8ZA 4RV8A 1SZEA 2ZDRA 1VYRA 5HR6A 3W7IA 1OX6A 2ZQ0A 4BWLC 3NQ2A 4UTKA 2QDGA 3JS3A 3LOTA 1F6PA 1TRIA 3W9ZA 4OQVA 4R33A 2QCCA 3MBFA 1UUOA 2NWSA 2FDSA 4WOQA 3U2OA 3JRKA 1DQWA 2WQPA 2ABAA 1JUBA 1R2RA 1ICSA 4QQ3A 1XFBA 4K8EA 2C18A 4NVTA 2XFWA 1NVMA 1F2JA 4ONVA 2I1OA 2QKFA 3LV6A 2FPVA 1QMLA 3G1YA 4MYXA 4IPJA 4TU1A 1OX5A 3C4UA 3A24A 1H5YA 3TK7A 1KLZA 2YFOA 4FF7A 1UASA 3INPA 4AHQA 3UWZA 3GDTA 4EF8A 1VZWA 1LZOA 1SU5A 3TSDA 1KFLA 4O1CA 4WXYA 4KFOA 4GRSA 5E93A 2ZCGA 1YXCA 1P4CA 3FEMA 1S5WA 3DHFA 4C1LA 1NSJA 1XBZA 3LERA 2Z1BA 3W2MA 3TE9A 2ZZ2A 1OFRA 1SQ7A 3P5YA 2WNQA 4BF9A 1JQXA 1GVFA 4YXGA 1K7XA 4JN6A 4EIVA 4JIPA 3FJLA 4H6KA 3W1XA 4YMZA 2A7PA 1K02A 3UWUA 5EL1A 2CLFA 2GJLA 2B4GA 1TV5A 5LGZA 3W7OA 1IXNA 3QF0A 3SR7A 1W1ZA 2J9XA 2QF7A 1AL8A 2YXGA 3LCWA 5AC7A 5FF4A 2GUUA 3GKFA 3PBVA 2V2DA 1GZGA 4FXSA 1JULA 3GNDA 1DORA 3OBKA 5DCEA 2J27A 3UY7A 3W1RA 4ADSA 2FQIA 2A1YA 3MUXA 4RZ4A 3W7NA 4IXXA 2TMDA 4EF9A 4OHQA 4WY0B 3PUEA 4I7VA 2Y88A 3PUOA 2C19A 2NV1A 4MY1A 2FLIA 4MVAA 1TJRA 3N2XA 1HO1A 5CZTA 3QH2A 3MI3A 1HUVA 3FS2A 1JQVA 3LCLA 4M7TA 1AW2A 3I65A 3LB0A 5G1YA 2VFFA 3W86A 3IGXA 3MHGA 4JX5A 3L67A 3TSMA 8TIMA 4WD0A 4B5NA 1TPH1 2WV8A 2CU0A 3S1WA 2V81A 4O1BA 4M7SA 1TTIA 3W1AA 1TSIA 4O1AA 2ZA2A 4XKYA 4D2JA 4YCPA 3M41A 2Y7GA 1G7VA 2DZVA 1EWDA 2EAWA 2A21A 5A8GA 1SZGA 1AMKA 3B0VC 3C3NA 3GX9A 2EPHA 1SPQA 1WYIA 2JBMA 1FBAA 1QOQA 2NUWA 3NPUA 3LXBA 5AHEA 1FDZA 5DXXA 4CLMA 1YADA 2JGYA 3H53A 3G8RA 1QR7A 5L6UA 3TXVA 2QAFA 4ZL1A 1H7OA 4UMBA 3LHUA 3NQCA 3M47A 4FNUA 3HIJA 1SFJA 3W3OA 2NX3A 3NQGA 4MLRA 3NL5A 5LZLA 1I2NA 3EWUA 2Y6ZA 5K4XA 1FDJA 1TPWA 4R7JA 3CWOX 3LLDA 3LCHA 3EEGA 4HNNA 3CC1A 5D33A 3N9RA 2J6XA 3IIOA 2Q3RA 2ZRZA 4XKYB 1H7RA 4AXKA 3GZ3A 1XDLA 2Q8LA 4HSOA 1CI1A 3DFTA 1KFJA 2WSRA 3W7RA 1P0KA 1W5QA 5AFDA 4XBSA 5I3IA 1KFKA 3G1AA 2RDTA 5LNUA 4BWLA 2QJIA 4JTIA 5H2ZA 2BXVA 5I3JA 4AH7A 1OYBA 3CLMA 3UWYA 3W73A 4LVDA 1F6KA 4FHAA 2EF9A 5AC6A 4K7YA 5H91A 4X22A 2ZRYA 3PVFA 3DFPA 1KM5A 4FO4A 4LS1A 3Q94A 3KHJA 4JTUA 3CQ0A 4O18A 1VGAA 3NQFA 6ALDA 2NXHA 1EUAA 1LOQA 2ZZ6A 3UWQA 3EXRA 4WQ6A 4O1DA 1SW0A 4Q33A 3T7VA 4MUZA 4POCA 1Q6RA 1KLYA 3GR7A 4LVGA 2RDUA 4H4IA 4FIQA 4LY8A 3TNOA 3SZ8A 3PY2A 3PS7A 3G3MA 1XDMA 1GYLA 4WXZA 1BKSA 3FYOA 4K39A 4KFNA 1FQ0A 4JTHA 4RXFA 4AHPA 3QSRA 4WOZA 1PCKA 3T44A 2DZPA 2V2CA 1H61A 4BI6A 5I3KA 2FFCA 1AG1O 4N9BA 1F74A 2ZBTA 1T99A 3NVTA 4MZYA 4AB4A 1RQEA 3L5MA 3UWVA 4E2BA 4Q4KA 1LOSA 3W7QA 4AWSA 4AVFA 1PVNA 1EB3A 4O57A 5C54A 1FWWA 5LHEA 1NF0A 2WJZA 3BLIA 3EX2A 3GAYA 3HPXA 4GNJA 4OBTA 5G1TA 4TR9A 2C3ZA 4Z0SA 5F4WA 1WX0A 1R46A 3LLFA 3YPIA 1TB3A 2A4AA 2B0MA 2Y85A 3QPYA 3KVMA 4FXRA 4UFJA 4UMAA 1GVSA 4GUGA 1WV2A 4DBEA 4O11A 4PH6A 3HGSA 4XTIA 4E38A 3A21A 1O95A 1LRQA 4UFIA 2QCLA 2E09A 3CB8A 2A85A 3BGGA 1RQHA 5EMUA 3W7PA 1KA9F 5DCBA 5A5WA 2VEKA 3ABOA 1ONRA 3W1MA 3AO0A 4GWEA 2YDAA 2W6RA 2VFIA 3W83A 1XBXA 1M7PA 4HPJA 4N02A 5SWUA 2OMAA 4O50A 4HPXA 3NL6A 5K3VA 3CTLA 3DU0A 4UR7A 2V9DA 1AW5A 1VRDA 1SZFA 3GNNA 3E49A 2NZLA 4JIQA 4MIMA 2H3BA 3C52A 3O63A 4UFLA 5FESA 2C0AA 2JGQA 3I7RA 3UY8A 2ZRXA 1OF6A 2RKXA 2RFGA 4JTSA 4UFKA 4K6AA 1QAPA 3PG8A 3TKFA 4TO8A 3W76A 3IVTA 2ALDA 3TA6A 4JDBA 1OX4A 3TAKA 3GR8A 3N73A 4DF0A 4I7WA 5F4XA 4ALDA 4JYDA 3BW2A 1LP6A 3PF3A 1XBVA 1VR6A 5LNVA 2A0NA 2EGZA 2I14A 1EEPA 1OHLA 1W5PA 2LLEA 4O8RA 4JEQA 2XN2A 1QPOA 3N14A 1YYAA 4LS0A 3DGRA 3E12A 4QSHA 2X16A 3M44A 1ZAJA 5K4ZA 2A6NA 3TH6A 5F2GA 1VQTA 3S6DA 3DBPA 4S1FA 3I6RA 4ADTA 1GQNA 3C2FA 3M9YA 3BVJA 2Y7DA 4HIBA 3F4WA 3UPBA 1T0OA 3P81A 1F7BA 3W2UA 5TQLA 1KFBA 1YDNA 1W5MA 4N9EA 2PURA 4UFHA 1LLZA 1ZY9A 1WAUA 4GFSA 4CQ9A 4MY9A 2OZ0A 4IMCA 2V2HA 3F03K 3PSVA 1O5XA 4ZMGA 1CX9A 3B04A 1LBMA 4EWND 4UTUA 2CW6A 5KITA 1SO6A 3KFTA 4IX2A 1ME7A 1ML1A 1VYSX 1X6UA 1TCDA 3LBMA 4BK9A 1FCBA 3IGUA 3W1UA 4FX7A 1MEHA 3EX6A 1X8FA 3WK1A 5BNKA 3EB2A 1ADOA 3VE9A 1TPDA 1WBJA 2J9ZA 3C2EA 5C5YA 1BWLA 3SFKA 1UCWA 1OABA 5HULA 2DP3A 4CQ8A 4JNMA 3HGOA 3K30A 3P61A 3NL3A 2VEIA 4O28A 5FEWA 1XXXA 1KM1A 4O0ZA 1I8JA 4JDYA 2CFFA 1HO4A 5AHFA 3FLUA 1ZALA 3GDKA 3HGRA 1FCVA 3TR2A 5DY2A 3QC3A 2E68A 4NX0A 3L0KA 1YPIA 4O16A 1XC4A 3VE7A 1EUNA 5FF7A 3HO8A 1BWKA 1PHWA 1D3HA 2C14A 2Y7EA 1B4EA 3JR2A 2RH9A 3ABRA 3W2NA 2J24A 2R94A 3EWWA 1TRDA 3OHIA 4XQ6A 4Z08A 3T78A 5U7SA 2A7NA 3NQAA 5LNRA 2ATMA 3UPWA 3W2LA 2QCHA 3R5EA 1SO3A 1NEYA 2F84A 1G67A 3THQA 3GLCA 5LSMA 3OVPA 3P5ZA 5HQEA 3Q2DA 2GVJA 3QYQA 1T8XA 4ZVJA 4WZHA 5G2IA 2JK2A 3W87A 2ZTKA 2BZNA 4UUIA 2YSWA 1VCGA 4ZQCA 2GVLA 4YCOA 5G5IA 4FNQA 3W2KA 2FB2A 1VS1A 3O6DA 5DBUA 3M5YA 2V82A 1A53A 1R30A 1U83A 3W72A 3C2OA 4R34A 5EY5A 3BPWA 5KINA 1WDWA 2NUXA 1ME9A 2WNZA 1VLWA 2JKAA 4CQAA 4WY0F 4EVZA 3RFAA 3TFCA 3D0CA 4LOCA 4PA8A 2YX0A 3SIZA 3BW4A 4TMBA 1TQJA 2VFHA 3TAOA 1IF2A 3ZWTA 2YW4A 3EXTA 1QFEA 3M5ZA 4DPQA 1YXYA 5CZ0A 3PAJA 4PL1A 2B7OA 3B06A 3C61A 4GE8A 2ISVA 1YPFA 4RLIA 1SR9A 5F2LA 1SW7A 4WY0A 2HS8A 2BTMA 1A5SA 4UTHA 4XBKA 1N55A 3MI6A 1B3OA 1QPNA 1ZAHA 4DXVA 1HFBA 2DZWA 2B7NA 3T55A 2ZTJA 3SSJA 3W70A 3VNDA 1NAL1 5KSWA 2FTPA 4MFEA 1KM4A 3UXAA 1RD5A 3PUDA 4N9CA 4CCDA 4AWUA 3G1FA 3S5NA 2PRMA 1EWEA 3LHVA 3OG3A 3HQ1A 3WJXA 2DZSA 3TW7A 1GTEA 3HG3A 3W1PA 3MYOA 1PIIA 5CG7A 3TCEA 1S3HA 1EIXA 3DKJA 4JTJA 3HG2A 1EP3A 1IXOA 1HTIA 1H7XA 1TV7A 4HHPA 4AMAA 1SW3A 1ZFJA 1LYXA 2E5CA 3PWAA 3RK8A 2X1UA 1Q6QA 3EKLA 4ORMA 1TO3A 1L2UA 1G4EA 3EXSA 3NQ8A 4R53A 3TDFA 2QUTA 3MBDA 3NNTA 2GOUA 1TREA 4JYEA 1L6WA 3M43A 1R2TA 5HUPA 1JCLA 3V1PA 3STEA 5K2ZA 3G22A 3ELFA 5AHMA 5E0KA 5IM51 1W5NA 1SFLA 4KWVA 4LTSA 4QIUA 5BOOA 3M7WA 1EA0A 4O0KA 1C8VA 3LXCA 4X2RA 3S5YA 3S8HA 4HSNA 3KRZA 3TV8A 1ZCOA 4P61A 1DOSA 4A29A 1WXJA 2NXGA 2H90A 2WNNA 4UTTC 3S0CA 3EX3A 2P0OA 3PSWA 5FEPA 4LWWA 4M19A 5EPDA 3NZ1A 4NNCA 3LDVA 3W1TA 4ML9A 1KFCA 4Y9AA 1DHPA 3W7CA 5CPLA 4OT7A 4IWWA 5CSSA 1I4NA 3CEPA 5DCDA 2Y63A 2B7QA 1LRTA 4MZ8A 3R12A 3TW6A 3T4CA 2RDWA 4LVBA 3LBCA 3W7KA 3IV3A 2X30A 2CLLA 1OFQA 4MLJA 4Z1CA 2BX7A 1QO2A 5J5RA 2C13A 1K03A 4RZ6A 4FX6M 1H7WA 1YTDA 3NQ6A 1SSGA 3E0IA 3QW4B 3G8EA 3PBUA 1LOLA 4CNPA 4UR8A 1S5TA 1E51A 1XUZA 2CLMA 1MEIA 1KTNA 3TU9A 5L9FA 2GQ9A 4JY9A 1SUXA 4ZQRA 1F5ZA 3TQ0A 2ZRVA 3NPXA 1KBJA 4A22A 2X1SA 4HN4A 3EWYA 3TMLA 4YWIA 3HBLA 3P84A 1LLWA 3W71A 5I3GA 5LKYA 1NF7A 4IMDA 1KM3A 3FJ6A 5MHBA 3KRSA 5FF3A 5HWJA 5HWMA 5HNRA 3N34A 3GDRA 2ZRWA 4LNYA 2CZ5A 3GDLA 4IQLA 4ORIA 3GYEA 4QAIA 1M7OA 1DQXA 3LXAA 3NQVA 3PC0A 1QO5A 3M6YA 3RNDA 4M5PA 3I7SA 1H51A 3TQKA 3MWAA 3W1NA 1K8YA 3MYPA 4ZQOA 3L66A 4W9TA 1LM1A 3G24A 1SSDA 4IMFA 3PBYA 4JD4A 3DAQA 5F1VA 4TX9A 1WA3A 5D2VA 3UZJA 1S5VA 2W0UA 4NNBA 4IXHA 3ABQA 2Z6IA 2R8WA 3B0UX 1DL3A 3NDOA 5DN1A 3Q37A 1OFAA 3OVRA 2QAPA 1FY6A 1PS9A 2NXIA 4PL2A 4AF0A 3FOKA 5KMYA 4YL2A 4A3UA 2G97A 3W22A 3VI2A 4NXSA 5HUOA 3LCXA 3L5LA 3N3MA 3PULA 4IX0A 3SECA 3STFA 3R8RA 3BK0A 3DXIA 4OU1A 1X1OA 1DJQA 1UBSA 3GVGA 3I68A 1JJKA 5FEZA 3N2MA 1K8XA 1YLVA 2AAMA 3NOEA 1O94A 1GTHA 3PR2A 3DFNA 1GWJA 4JICA 1G4PA 2NX1A 3LRMA 3MHUA 5D30A 1LBFA 4A2RA 1A5CA 5HWNA 4OV4A 4CNOA 3DI1A 3NYZA 1LCOA 4QITA 5D2WA 2BSLA 3P82A 4L4MA 2QCEA 2VXNA 3SW6A 2YW3A 3R89A 2VOMA 5C2XA 1I2QA 2Z6JA 1FUYA 1L6SA 4AF0B 4NXKA 2G95A 5HJLA 2ISWA 3O6YX 3HOJA 3W2JA 4JTEA 4BR1A 4UTTA 3F4NA 3NGJA 4NNAA 1FWNA 4E2DA 3DHDA 5DY3A 5CGQA 3NR0A 2A7RA 1RZMA 3MP3A 1YTEA 1OF8A 3OIXA 3PB2A 4UTMA 1PE1A 3HMJG 1ME8A 3W74A 3LTPA 3CEUA 3RF9A 1JCXA 3M16A 1OFOA 3RMJA 3SGUA 1GVRA 3G1XA 5AN7A 1JRBA 1KTCA 1W5OA 4LVFA 3W7GA 3EWXA 4U4MA 4L4LA 3QW3A 3W07A 3S1VA 4DPPA 3M1ZA 4HT3A 3KXQA 4YLWA 5IBXC 3W88A 2ZZ1A 1LTDA 3A22A 1OJXA 1Q3NA 4IPIA 4LC6A 2YPIA 1LBLA 3NQ7A 1KM2A 1TPFA 3E02A 1QCWA 3TIMA 5T26A 3EX4A 3QQ1A 3IGSA 4UFMA 4MKNA 2QCMA 2VENA 1X7FA 3S5ZA 2V5LA 3A5VA 2C6QA 3LRKA 4FX8A 1LDCA 4QISA 1AL7A 6TIMA 3G1DA 3WJYA 2DU2A 2QCGA 4A2SA 4LUJA 1RVGA 5AOUA 2JKEA 3L68A 2O7SA 2YYTA 4I9AA 3WK2A 4FNSA 4E0CA 3GKAA 3IEBA 1R47A 3HPSA 4MPQA 3HJZA 2UV8G 3RLUA 4RR4A 4C1KA 1ICPA 4UNKA 3MMTA 1JCYA 4MZ1A 2QCNA 3MW7A 3BARA 2FIQA 3MJYA 4S2BA 1TYGA 1B4KA 1KM6A 2ZA1A 4DELA 1QOPA 1FCQA 3C8FA 3GXTA 3U8GA 4LU0A 1VH7A 3VKJA 3IVSA 1FXQA 1V7YA 4WX2A 3TX9A 2G5WA 3IIPA 4HNUA 1IIGA 3S9YA 3W7JA 4WUIA 4UTWC 5G4WA 2H8ZA 5G4EA 1WOBA 3WFAA 2J9YA 3EKZA 1FCUA 2E5DA 3P8JA 2CWNA 3W85A 1SO4A 3LX9A 5BRBA 1XL9A 2IQTA 1EPXA 5D02A 1P0NA 3LHWA 1HG3A 3KX6A 1MSSA 3UYCA 4FB7A 1J2WA 2Z2UA 1Z42A 3HG4A 3THAA 2VEMA 4GC4A 5BMXA 1VLIA 3LCFA 3O8AA 3G1HA 1AK5A 1TPB1 4JR5A 2D73A 4DBDA 4I7UA 3B8DA 3B4UA 3DI0A 5J5DA 4MJZA 3UWWA 4JTGA 1K3UA 3LHYA 2WSYA 2VFDA 3GAKA 3R13A 4GJ1A 1SZNA 3HF3A 1W3IA 4N4PA 1JCJA 2A2IA 1LORA 3KVLA 3LRLA 4BFAA 1Q6OA 5AHLA 2VKZG 2PRLA 3C2RA 3BGJA 4IMGA 3TC6A 2GPTA 1TPUA 2H3DA 1KW1A 4IOTA 4M6QA 4GUHA 4CNNA 1C29A 2QCFA 1P5BA 2FPYA 4G1KA 1JR1A 2VFEA 2RHGA 1TMHA 2A6LA 4QNWA 5LGXA 4KKXA 1ZAIA 3QRHA 3VFLA 4O13A 1G7UA 2QJGA 1W8SA 1JRCA 3KAOA 1OFPA 3KVJA 5I3HA 3EX1A 4DO5A 2Y70A 5TIMA 2GJNA 3NL2A 4JY8A 5CPMA 1P1XA 5CPNA 4FEZA 3BG3A 4NJJA 4XWUA 2Y61A 2DZUA 2NWRA 3E9AA 1KFEA 3EWBX 2GQAA 2YGYA 2Z0IA 1Q6LA 1CW2A 1F05A 3LGEA 3IVUA 5D2YA 4K8HA 3FYPA 3Q58A 3R2GA 4GUIA 1KBIA 2DZXA 1UUMA 2FB3A 3QFEA 4HNTA 3S1XA 4Z1AA 1M6JA 4UC5A 5DXYA 3TXZA 1MXSA 2ZZ4A 1OFBA 4TMCA 1DV7A 3DH7A 2G96A 4UTIA 5F2MA 4JTLA 1H63A 3DZ1A 5K9CA 3W1QA 1OFDA 3NAVA 5I3FA 1WQ5A 1TTPA 4UNLA 2HTMA 2C1HA 1VC4A 2QR6A 3OEXA 5FEXA 1TJPA 1PCWA 5D09A 1OG0A 4DEFA 3BLEA 3QM3A 4LT9A 4Y90A 1O4UA 1K8ZA 2BLEA 3O15A 4UTJA 4Q32A 3ATZA 3B03A 2XN0A 3DKLA 2YR1A 4BI7A 4NJHA 4O54A 3QMRA 3NPVA 2E6FA 1A5AA 3M5VA 5K9DA 5IBXA 2VC6A 1OVDA 1THFD 3PB0A 2W79A 2ABBA 4O17A 4RXGA 5KZMA 1W56A 5BMWA 1ICQA 3KVKA 1PHQA 2YCEA 4AHOA 1OYAA 1GEQA 3EWZA 4S2CA 3DFOA 1H7NA 3L5AA 3ANYA 2WKJA 1KM0A 2NV2A 4K7VA 3QEZA 3A23A 3NXFA 3CWNA 4IJBA 1ZHAA 3FFSA 3LI1A 5D32A 1A5BA 1G4SA 4ZQMA 3P80A 2NLIA 1D3GA 5BW6A 3NM1A 4JXCA 1QNVA 3L9CA 1TPEA 3O07A 4OGZA 4XZ9A 4CCCA 3LM7A 4OE7A 1QDSA
chains in the Genus database with same CATH superfamily
4PMYA 3VC5A 3NEVA 2ZX9A 4AD3A 1UJPA 1XLGA 3UXLA 3B0PA 3LY0A 2PMQA 4QM1A 3NQMA 5DLCA 2DSWA 2BP1A 1W37A 2BWGA 2E6DA 1JFHA 2OCZA 5A94A 5FI8A 2JF7A 3ZSTA 4JN7A 1JVNA 1YKWA 3GXNA 4BQ3A 1W9PA 4LBUA 1UR1A 4GY7A 3MANA 5FL1A 2F9RA 1XSKA 2TPSA 4DYJA 3BAYA 1RQBA 2E25A 2F38A 3QGKC 1DJXA 3GBDA 1XH2A 4AYSA 4FOJA 5HR7A 3IARA 4H00A 1IXPA 1RK5A 4NI3A 4J3WA 1FWRA 3XINA 2IPFA 4DLFA 1PX8A 4O14A 1J79A 4TQTA 3N2CA 3LM3A 2OEKA 2V0TA 2Z1SA 1GYNA 4Y6GA 1E9ZB 1LF1A 4QDPA 4G7EB 4UQDA 1GOQA 3C6CA 3S1UA 1ZCCA 3CIWA 1GCYA 4I9JA 4M8UA 2XHYA 2DQWA 3GTHA 3EMCA 3AAMA 3H26A 3G0UA 4LAZA 2QJHA 3PZQA 4PMZA 3A5FA 1M5WA 4DBWA 3FAWA 2PFHA 4PMNA 3W38A 1GKQA 4F2UA 1OB0A 3WLJA 3WDQA 3M0KA 3BQ5A 5LNWA 3XIMA 3PM6A 3AWOA 1U2YA 4LAKA 3NO5A 5LYRA 1ZENA 4MM1A 3VPLA 3T1GA 1MNZA 1C9WA 3IIVA 1UR9A 2YOCA 4H7ZA 4J3XA 4IGHA 1Z89A 3GTIA 1M3UA 2TSYA 1BSLA 2WMHA 2ZC1A 1TCMA 3VD7A 2H8XA 5F2IA 4JHOA 1IEQA 3CUFA 4K38A 2OSWA 3KBMA 4PCTA 3ZR5A 3QHOA 1UD6A 2WVUA 5E9AA 2DDXA 4QRNA 2VUNA 3R4IA 4HOZA 3P7YA 4DJFA 3EDKA 2YXXA 5K7JA 2JQXA 3L4TA 4GGHA 3N9SA 4M82A 1JGIA 1IXQA 3QMSA 2BGSA 1L9WA 4LFYA 1UKPA 2NT0A 3IIXA 4O4VA 1OK6A 2CLIA 4GZJA 4H8UA 4DZAA 3RLHA 1XKJA 3O6CA 2DEPA 2GSJA 1J0ZA 2FTWA 1PSCA 4FPSA 4IIGA 1BTMA 3NZRA 1ODUA 3DCPA 2R14A 4O10A 1W0MA 1EP2A 3BV4A 2ZA3A 4NRRA 5HXMA 2HK1A 3HQNA 3NPWA 2WMJA 3URBA 1BHGA 3KWXA 1RY0A 3WH9A 4NQ1A 1VFTA 2YLLA 3RCMA 4E2VA 3CTTA 1TTQA 2CZFA 1QASA 4HMNA 5GVJA 3N1AA 5I00A 3A6OA 3HQOA 1DWJM 4U10A 1CZ1A 2QQ6A 1HKJA 4EOUA 2MNRA 4ATWA 5U4NA 1ZBKA 1KV8A 1Z48A 3KTXA 1E1EA 4PB3A 3GH7A 4PTNA 4L1XA 4Y96A 4DO4A 1XLCA 1R2SA 4Z2KA 3G3DA 1XLAA 1TA3A 2QEZA 4QNEA 1EGMA 3C56A 1R38A 3NDZA 3RR4A 2CLOA 4XAGA 1AJZA 1S2TA 4QBXA 1W31A 4QG6A 4WR3A 4PZVA 1V0MA 5AHIA 1DJNA 4NAFB 3AS0A 1XIHA 1VJIA 3T2OA 2FZNA 4ZBCA 3CT2A 3UGVA 8RUCA 3P62A 1ZJIA 3UR8A 4HNCA 3OLEA 4UQ9A 2PDFA 4P7NA 2Y7FA 2GVGA 3B8IA 2QGHA 3B05A 1EX1A 4JGDA 2CZDA 1KR1A 3IANA 3HFTA 2VP8A 1IR1A 4S3GA 2H9AB 4D8AA 1TPC1 2D69A 1WZAA 2ACRA 2WO5A 3GDBA 4AAJA 3LU2A 1OCJA 1UA7A 2ZE3A 3ECQA 2Q3OA 3R43A 3KL5A 5A95A 4QXIA 4AXNA 3ZS4A 3SEPA 4H9YA 4PMQA 2W27A 1DWAM 2Z24A 1UH4A 1V02A 4IMEA 1HJVA 4B3KA 3C2VA 1X6LA 2ZZ7A 1WKEA 3LZ3A 1TV3A 4Q4MA 3KW3A 1IEXA 3AI0A 5JMUA 4EKJA 3L0GA 2V30A 1JNDA 4JTTA 3UGRA 3QY7A 4INFA 2Y8UA 3U2ZA 1F07A 2HJPA 4KWWA 4PUUA 3CZGA 2BVYA 3H4WA 4GBUA 3CASA 3AXKA 3O06A 2PDJA 5GNYA 3NQDA 2C16A 1V51A 4C91A 1E6PA 4W88A 4GXMA 2HVOA 3E0VA 1HQTA 3KOFA 4MJ2A 1KCLA 4PFMA 2POZA 4OWGA 2J8TA 2BHZA 3ARSA 2YCLA 1IHIA 2FVMA 3RU6A 3ZVIA 3GIYA 1IZKA 2AL2A 2XZ7A 2ZYFA 1XPGA 1OC7A 3BZJA 2R82A 4LF2A 1OM0A 2YJQA 1Z32X 3LTSA 3RPMA 3ZT5A 7REQB 1Z7AA 1XYBA 3CH9A 2W92A 2DZBA 2EEXA 1IGSA 4HJWA 1UH3A 4RJEA 1HGWA 4I9TA 3QXBA 1YX1A 1CTNA 4BHYA 2BMBA 1I0DA 3MI2A 3LMZA 5EMKA 3PG9A 1JNEA 1NFBA 3P60A 3G18A 2PDHA 1FWSA 3VZZA 1QTWA 4JX6A 5HOSA 4Z0JA 3G6LA 5CPTA 4AC7C 4O12A 4HPHA 3WLNA 1BG9A 2X0YA 3W25A 3TFXA 4DBSA 6TAAA 1GG0A 2OG9A 2I9EA 2OSYA 2O4QA 5XIMA 2WZTA 5T9CE 1TTJA 3SJ3A 1FWTA 3G2GA 3LENA 4IG2B 3QSTA 3N17A 4Q22A 3ZVHB 1WBHA 3KP0A 1XD1A 4E8CA 1TJ1A 1S38A 1VYRA 1WKYA 6CGTA 1IZCA 3ICJA 3AIQA 2DW7A 4UTKA 2QDGA 3OYZA 1DP0A 1CEOA 4OQVA 2QCCA 2Z28A 1B90A 2NWSA 3U2OA 4WOQA 4ACZB 2IUZA 2WQPA 3LPFA 3QV8A 4GQRA 1JUBA 5M2FX 1J11A 3L4UA 3ZM8A 2XFWA 3HFYA 4S3AA 4DJFD 1F2JA 1WZKA 2I1OA 2QKFA 3W00A 1QMLA 1NWRA 2YBVA 4TU1A 4HHMA 1H5YA 4Q6XA 4IPPA 1EA9C 4AD1A 4H9VA 3STPA 4AZCA 1VD6A 1E6NA 2QJMA 4KFOA 1EYWA 2ZCGA 2V5DA 4JFSA 3FEMA 3B9AA 1ECQA 3H4XA 1NSJA 1GQKA 1XBZA 2Z1BA 1PTGA 2PWGA 3TE9A 2ZZ2A 3P5YA 4G7EA 1GVFA 4JN6A 5A6AA 1XLIA 2PP3A 3FJLA 1JZ3A 1JZ8A 3W1XA 4F2TA 2CLFA 2GJLA 4KEZA 4XIAA 2O92A 5CH9A 3CZKA 1SJAA 1W17A 3LCWA 4W89A 5AC7A 5FF4A 3NO1A 3BURA 1LWJA 3AU2A 4JQ3A 3MDWA 2PP1A 3UY7A 3H7UA 3W1RA 4ADSA 2J27A 4FF5A 1IT0A 4CU7A 2A1YA 3GM8A 4JAWA 3IV8A 4IXXA 4KH2A 3N29A 4OHQA 5T9BG 3TTQA 3PUOA 2P88A 4V33A 2ZWZA 3QH2A 3MI3A 4S3EA 1KBLA 4QDWA 3FS2A 3I4EA 3LCLA 1AW2A 1O12A 5G1YA 3IGXA 4EPEC 4B5NA 3WY1A 2WV8A 1NP2A 2CU0A 4O1BA 2OLHA 3B0YA 1EFZA 4WRHA 1UQZA 1TTIA 3W1AA 4M81A 2XSBA 3SUSA 4EPKA 2Y7GA 4AY8A 2DZVA 1A0EA 4I9MA 2RUSA 2EAWA 1Z8AA 4AZBA 3MPGA 1S5NA 1NELA 2D20A 1WDQA 4AIUA 1XINA 1AJ2A 1FBAA 1N8IA 2PGEA 1DJIA 3IJQA 3GYCA 3I6TA 1FDZA 1ZGDA 5TNVA 4DY1A 3E2RA 3QKZA 1SJDA 3T05A 4AISA 1XIBA 4DRSA 3PWGA 4GYFA 2WVSA 1H7OA 1MXDA 1TVPA 4YTUA 2OKTA 5A6BD 1PTDA 3MV01 1AD1A 3BWWA 3Q4DA 3EWUA 4OOUA 4R85A 1FA2A 5K4XA 1U5VA 1TPWA 3CWOX 2R6OA 3L23A 3LLDA 1Q5MA 3UYIA 4YIWA 3N9RA 3FNDA 3LD5A 1LQ2A 2XIIA 3IACA 1Y5VA 3GZ3A 1SMDA 1XIEA 2Q8LA 1IV8A 3DFTA 2WSRA 5A6KA 1PZ0A 1H09A 5I3IA 3AYSA 3G1AA 4GH1A 4AQLA 3CLMA 3W73A 3AMLA 4QTGA 1RP9A 3PZNA 4K7YA 2GJRA 5H91A 4AZ7A 1BSIA 2PAJA 3DFPA 3R0DA 4GXWA 1M68A 3UJFA 4JTUA 1ZZMA 1EC9A 2VD8A 3JW7A 4XBJA 5AC4A 6ALDA 2NXHA 4NAFA 1ONWA 2PDBA 1I6NA 5G1MA 2WLYA 4WQ6A 2VL4A 4Q33A 1BGGA 1Q6RA 3GW0A 3VFCA 4F8XA 1KLYA 4GCXA 5CCZA 3S83A 4H4IA 4CKQA 5DMLA 5I07A 3PS7A 1E70M 4WXZA 3GXFA 5CGMA 1BKSA 3UW6A 3VXGA 4K39A 1CGTA 3RCNA 2GGGA 4DUWA 4KFNA 1FQ0A 2HWGA 2XDFA 3GG1A 4C6FA 3WD3A 2EG8A 3OJGA 4WOZA 1ZU8A 4MF4A 1JXKA 2FFCA 5I3KA 1AG1O 4C5YA 1M7XA 4JOMA 1J0JA 1XYZA 4P8XA 1AODA 2CETA 2EO7A 1VJZA 3LSCA 3F2CA 3AXHA 4Q4KA 1LOSA 2BB0A 3WD0A 5C54A 1FWWA 1PX3A 5LHEA 1NF0A 1F3WA 3EX2A 3HPXA 1RA0A 4OBTA 4TR9A 4Z0SA 5FD0A 4DNHA 2B0MA 3TOPA 2Y85A 4GQBA 1HL9A 1YNQA 4FXRA 4UMAA 4DAIA 4O11A 1H5VA 4XTIA 3PPHA 3DHPA 4QG8A 3A21A 1U30A 2QCLA 2E09A 3CB8A 2A85A 3ZO9A 4F2BA 3JZEA 3BAWA 5A5WA 1GYMA 4BJHA 2VEKA 4E2OA 4R5EA 3U48A 4JCLA 3AO0A 3MKVA 4GWEA 2VGBA 2QMJA 2YDAA 3RX3A 3W27A 2W6RA 2YB4A 1M01A 3W83A 1MW1A 1M7PA 2OODA 3PZMA 5J8LA 1CXLA 2OMAA 3NL6A 3CTLA 3DU0A 5BXTA 1DJZA 3AHZA 3A4AA 5D9MA 4JIQA 3O63A 2PSNA 2JGQA 2WZMA 4LYPA 4WJ8A 2GK1A 3I7RA 1KB3A 4IFKB 2OGYA 1N8WA 3E2VA 2RFGA 1DJHA 3PG8A 3TKFA 3VD9A 3IVTA 2X1IA 4JDBA 4WDTA 4ZOCA 4WVXA 1K4GA 3H2MA 3WYZA 3B3DA 3TTSA 4UQBA 1R9ZA 1HJXA 3SFWA 3SCNA 3PPFA 1QPOA 3N14A 4JTDA 3AC0A 1MUCA 1E0TA 1FWGC 1EC8A 2A6NA 4HQVA 1PZ1A 5F2GA 1VQTA 2GDVA 4HCHA 4ADTA 3H22A 1Q6EA 3BVJA 3EAUA 1RBLA 4HIBA 3GZAA 3HV8A 3WZ0E 3W2UA 5TQLA 1VBHA 1KFBA 1YDNA 4U2YA 1AJ0A 5CJNA 4N9EA 4UB9A 1XGDA 1ZY9A 1WAUA 4GFSA 2PB1A 3MTWA 4IMCA 4XVDA 2V2HA 1BRLB 4ZMGA 1W1IE 2O9PA 4KESA 4XIMA 3B04A 2PF8A 2XWDA 4LEFA 1A0DA 1NARA 4LUYA 3GRIA 1J0KA 1UD4A 2O56A 3WEZA 4KCTA 4IG2A 3ZVHA 2INEA 3GHSA 1ADOA 1EBHA 4X0NA 2WC7A 1RPKA 1TPDA 2OEMA 1ECEA 3GD6A 5C5YA 3PTKA 3VCCA 3E0WA 5A2BA 6PTDA 1C92A 3TN4A 1O68A 1TV2A 5CC3A 4C6NA 3K30A 3U2EA 3P61A 4NILA 5DMNA 5FEWA 4O0ZA 2CFFA 5AHFA 3GDKA 4ACZA 1ZSXA 4ACYA 4OIFA 3CMGA 4NX0A 3L0KA 1QJWA 2GUYA 1E9LA 4O16A 4L1GA 3ALGA 6ENLA 1BWKA 4BCEA 4F9DA 3W2NA 5A69A 1KFWA 4I90A 4HNLA 5HPCA 4Z08A 3T78A 3V3WA 4M24A 1UZDA 5U7SA 1F9CA 3OQ8A 1R3VA 2ATMA 3W2LA 1SO3A 4H9UA 1XW8A 3WEOA 1G67A 4D9PA 5A6MA 3GLCA 5LSMA 3AHXA 3HM7A 2X7VA 2PWVA 1B9ZA 4ZVJA 3W87A 2ZTKA 4LYQA 3KS5A 4UUIA 1T5AA 4B5WA 1XV8A 4G5DA 3W2KA 3O6DA 4J3VA 2PTYA 4X0VA 1U83A 4ICCX 3TTEA 5EY5A 4G7FA 1FHVA 1UD2A 5FOOA 4LOCA 1QUMA 4R88A 3BW4A 1V7AA 1OEPA 1YXYA 2BFGA 1XDJA 1UP0A 1YPFA 1SJBA 1JPHA 2VDGA 2GJPA 3ITLA 3M0VA 3MI6A 5HBFA 4YN5A 1QPNA 5EFFA 2B7NA 4KGJA 3T0BA 4YPJA 3WNOA 3VNDA 1NAL1 4I3GA 5CLWA 1J8VA 4B91A 1KM4A 5HNUA 3PUDA 2JIWA 4GO9A 3S5NA 4Q4PA 1EWEA 3LHVA 3FGCB 4GVIA 4KCWA 3HQ1A 1Q2RA 4M3PA 1K70A 4PN2A 1QHZA 5REQB 3MYOA 4TVUA 3TCEA 1EIXA 4ASTA 3AXXA 1R7OA 3HG2A 4JFVA 1WNOA 1ZBCA 3F5JA 1LYXA 3PWAA 3CAVA 2OPJA 4ORMA 1W3LA 4P8UA 4AEEA 3EPMA 3CL6A 1G4EA 4GYPC 4ZXOA 2Z7GA 1XWYA 4PBGA 1TREA 5HUPA 4PR4A 5AHMA 5E0KA 4KWVA 1RY8A 3RXZA 3M7WA 4O0KA 4RNFA 1C8VA 3LXCA 4X2RA 3AU6A 3TV8A 1W1VA 4A29A 4E4PA 4K1GA 2HDJA 1HJSA 3CAKA 4YWSA 4GK8A 3UVIA 1E3XA 2XVGA 3TQPA 1QPKA 3LDVA 3W1TA 1NTHA 4YHEA 3AS1A 5FJPA 4S3BA 4JNYA 1V3IA 4L56A 4JKKA 4S3FA 3VU2A 3AQUA 3OA5A 1J18A 2E8ZA 4MKVA 4HBKA 2J7GA 4Z1CA 4GZ7A 4W93A 4NSBA 1PZ3A 1QO2A 5J5RA 2C13A 3UP8A 3RX4A 1NU5A 3QOKA 3F4DA 2GGJA 4M1BA 4PTVA 3QW4B 2QDDA 2G4FA 2EBNA 3K4WA 3GQYA 4C7FA 3F2DA 1PB0A 2CLMA 1KTNA 3A3XA 3TU9A 1NOFA 3LNMA 2GQ9A 4ZB2A 3OG2A 4JY9A 2VWSA 3BL3A 4ZQRA 1F5ZA 3RIKA 3RPDA 3TQ0A 3ONBA 4KMQA 4DNMA 1P6WA 1CGYA 1ZLPA 4W86A 1P6CA 3OIHA 2NQLA 3CUGA 4MNKA 5I3GA 3SCUA 2C0HA 4F48A 4LEQA 2OX4A 3HURA 5MF5A 1EZ2A 3DOPA 2E9BA 2ACUA 2RGLA 2WVVA 5HWMA 5HWJA 3N34A 4LNYA 1W3JA 4IQLA 1XLJA 3PC0A 2BG5A 4AZ5A 4M5PA 3I7SA 3MWAA 4ERAA 5I3DA 1GNXA 4CUCA 3L66A 3G24A 4IMFA 1GZ1A 3PBYA 4JD4A 4IGMA 4GXPA 1A3XA 1US3A 5F1VA 5D2VA 2VYOA 1S5VA 2V38A 4IXHA 1K77A 3DFYA 2FFIA 3WNPA 4B9ZA 1OIFA 3QZAA 1DL3A 1TX2A 1OFAA 3TYBA 2QAPA 1FY6A 3VIFA 3OU8A 3FAXA 4J3TA 2YL8A 1Q8JA 3FOKA 5KMYA 4A3UA 2JEPA 4CN4A 1VFOA 3N3MA 2BNJA 4V2XA 4IX0A 1WKFA 3SECA 3AOFA 3RAOA 3R8RA 3BK0A 3W81A 5LXXA 1KBKA 4MWAC 3N2MA 1VF8A 2XIJA 2ZOXA 1YLVA 3BUVA 1O94A 1M1BA 3DFNA 2ZX6A 1UD8A 3V5CA 2WSKA 3LRMA 2XFRA 4A2RA 1TWSA 1L6FA 3DI1A 2ZX5A 3QOMA 2CBIA 3T09A 1A5UA 2E3ZA 2VOMA 4AF0B 1MRAA 1V3LA 1R86A 2UWFA 4ZE4A 1TVLA 2O55A 4UTTA 5BRPA 3I10A 3M0JA 4E2DA 1XGZA 3E5PA 4UQAA 1G5AA 2A7RA 1FWFC 1GQJA 1NDWA 4JFTA 2FGZA 3VOIA 1ME8A 1TV4A 1BLIA 3LTPA 5EU9A 5CG0A 1JZ5A 4D6JA 3NQBA 4MNLA 4LVFA 3TJIA 5EMYA 3WLTA 5BRQA 4D6EA 1E6RA 4HT3A 3KXQA 5IBXC 3W88A 1ZL1A 3E2SA 3VGBA 1OJXA 7A3HA 3VM5A 2DUAA 3WO8A 4LC6A 1CXEA 3CZEA 3NQ7A 2Q6ZA 2VC9A 2GGEA 5T8GA 4UFMA 3EOLA 4L64A 4MKNA 1KRBC 2V5LA 2C6QA 3FSUA 2J7CA 2BODX 2OU4A 4LUJA 1RVGA 1BRLA 2O0TA 5AOUA 3L68A 3AALA 3WK2A 4GO8A 1UPPA 2UV8G 2WMIA 4RR4A 4IP7A 1ICPA 4GC3A 1JCYA 3MU7A 1B3ZA 3Q67A 1W1PA 1NDYA 1PTAA 5LIWX 2FIQA 3MJYA 3VOHA 2ZA1A 3HU7A 3ZOAA 1UR3M 4WX2A 2G5WA 5FJJA 1UP2A 3W7JA 4E8GA 1WUEA 3M46A 4Z1YA 1AA1B 2YA2A 4C6KA 5G4EA 1UWSA 3S6OA 4XISA 1AQFA 5MKGB 1OGGA 1DWHM 3P8JA 1YBQA 1SO4A 3LX9A 1Q85A 5BRBA 4DO7A 1EPXA 5HATA 2J66A 1REQA 4OVXA 4PMOA 2G41A 3MMWA 1KNWA 4GC4A 3LCFA 3O8AA 4A3QA 1HKMA 4LUSA 3CH0A 4JFUA 5J5DA 3UWWA 2ZUVA 1K3UA 3LHYA 2WSYA 3GAKA 2ZVIA 4GIYA 3HF3A 3MUZ1 1LL6A 1CDGA 1YIXA 2A2IA 3L12A 4BFAA 3PZUA 3C2RA 4IMGA 5M03A 1KW1A 2YZ5A 4GUHA 2XFYA 2JIEA 1E0XA 1FVPA 4HZ6A 3WLPA 1W32A 4US5A 5CBJA 4KKXA 4IPLA 2ZADA 3QRHA 3VFLA 3IJIA 3VAVA 2XUCA 1LWIA 3GXDA 1LG2A 1LLOA 2Y70A 3OPSA 3ARPA 5CPMA 4QSFA 2G3IA 1FKWA 3QKEA 4NJJA 4HK7A 3H2FA 4LB4A 2EPKX 2GQAA 3MVIA 1OWQA 1F05A 3LGEA 4JIRA 3WN6A 3Q45A 1MRQA 4ZTXA 3FYPA 3Q58A 3R2GA 3QFEA 4J3SA 1OGSA 1M6JA 3XISA 1M41A 3FGCA 3R8HA 3DZ1A 2PZNA 3KLLA 4LF1A 1WQ5A 4UNLA 2HTMA 1RBOB 1TJPA 1PCWA 2D3LA 4XAYA 4DEFA 3VZYA 1BQGA 2YR1A 5JXQA 1H4PA 4NJHA 4PRWA 3K8MA 4LBRA 1W56A 2Y8KA 3PBMA 2Q02A 2VOTA 2HXUA 4AHOA 1OYAA 4J27A 1I60A 3EOUA 2AOSA 2J8FA 3SO7A 1G94A 2WKJA 1KQYA 1VB9A 4GNVA 3ANUA 2P8BA 4X61A 4NIRA 4FLQA 2PTWA 2WZIA 4ZENA 5D32A 1A5BA 2AGTA 1S2UA 1FWHC 3OW1A 3NWRA 4OGZA 4XZ9A 1A5NC 1MFUA 4CCCA 1XLHA 5EGRA 1FFQA 4U5KA 2VMFA 4L6OA 1CNVA 3RPTA 2YBUA 3VKDA 1G6CA 3VZXA 4DF1A 4NT0A 4UCFA 3G1SA 4WJXA 4UTWA 1LROA 4NZ5A 2WCAA 1MZHA 3G5EA 3SGZA 4JIIX 5A8OA 4XKMA 5D05A 1VCVA 3ZWSA 3EEZA 1J0YA 2CLKA 3TQVA 1BXBA 2KZHA 2JF6A 4MY8A 3MZ2A 4QLJA 2CLHA 3B40A 3LN3A 3COTA 2HPMA 3WCZA 3ZZ1A 3W24A 4ZQNA 3MO4A 3HB9A 3TYDA 3KEHA 1AQ0A 5HAOA 2WSPA 4NZ3A 2YL9A 3BG9A 3R1ZA 4MADA 2QNEA 5IDZA 1H1YA 4XZMX 1IR2A 1M53A 3U3HA 3UD6A 3P8IA 3FDKA 2NUYA 4RKAA 3WJWA 3EDFA 4WK9A 3WX7A 3P3BA 1JDCA 3FJ4A 3W7DA 3V18A 4FXFA 2VDIA 3KL0A 2YL5A 3O16A 4CD5A 5D38A 1B57A 1DYSA 2WAGA 5D03A 3U6WA 2TRSA 3ZJ7A 3QLLA 2AL1A 4NAEA 4LB3A 1Z41A 2CERA 4XD5A 4A8RA 3ATYA 3WQ4A 1XCWA 3SAZA 5FF2A 4ILSA 1A5LC 4PYSA 7ODCA 3HPZA 3V4BA 3ZSSA 1CGVA 1MO0A 3RITA 5DELA 5C9UA 2QLYA 2CZEA 3F5KA 4JX4A 3KDNA 3P74A 2Z4GA 3L4WA 3GVRA 1JAKA 4MJ4A 1UD3A 3NIYA 2PGFA 3BMWA 1UKOA 5I09A 1VCFA 2FGLA 2PWEA 3MQTA 5DT7A 4J9JA 1XH1A 2FZBA 3CAWA 3VIPA 2V5BA 1Q45A 3S9ZA 1K7FA 3ORWA 5LNSA 2WM1A 2ODOA 3TYUA 4A21A 4ZA0A 2E77A 1F4HA 1JYVA 1JDEA 5J04A 1VPXA 3CIXA 4IJCA 4ZQPA 1EJSC 4CEUC 3T4WA 3VOCA 3TWAA 3SBFA 2NX9A 5AYXA 4Y9MA 5M5DA 5HA7A 4U28A 4W7UA 2CKSA 3LPPA 1UZHA 1GVEA 4N6FA 1RR2A 2VWTA 3VDCA 4AD2A 2W9MA 5G2HA 2DJLA 1I2PA 3HA1A 2ZZ3A 4L9YA 3M0ZA 1FH7A 1OK4A 3HPAA 4MPKA 1EZWA 5CZSA 1T6MA 3GG0A 2WJFA 4PEKA 5DQPA 1H1ZA 2B7PA 4M6VA 3H4GA 4PRRA 2OYKA 2PRHA 3AHVA 4FLSA 3STCA 3PPGA 1VHNA 1BGAA 3CUJA 3R25A 4MOZA 4Y9NA 3KUMA 1V6VA 4HVXA 3M0YA 5I2UA 1TE1A 1RVKA 5A1AA 2GLKA 1KV5A 4HKPA 4DZ5A 3B97A 1M65A 3L2LA 4M29A 3UCCA 5C9WA 1XR2A 4LRTA 4LC8A 3L7RA 2FMNA 2PWUA 4H6QA 3VCNA 4GISA 3C8NA 1VHCA 1BVNP 2TODA 1GPWA 4JTFA 3NA8A 2QW5A 3H7VA 2D0HA 3V75A 3DFQA 3LHTA 5HMSA 4S38A 2NVCA 3PBWA 5E1QA 3QLDA 4NHVA 4RE0A 1O5RA 3G1VA 4JPGA 1XLEA 2IXUA 2QCDB 2YYUA 4ICNA 3H24A 2X1TA 2YCIX 4C5ZA 1DWFM 4Y8FA 1BVZA 3E96A 1XG3A 3KHDA 2CCRA 2R1NA 3KM8A 4P7RA 4MFDA 3ARVA 4Z17A 3M0HA 3ARUA 3ZQ9A 4S23A 2REQA 1YTKA 3W75A 4GUJA 1G69A 1RALA 3QY8A 2J88A 4IHCA 2QXWA 3MKKA 5C6MA 5CSUA 2F2KA 1EH9A 3N6QA 1K9DA 1Q4WA 2DSZA 4DZHA 1XYMA 2EQDA 1XM3A 4JL2A 1A50A 3KRUA 5A6LA 3TUUA 1W54A 3EBVA 1KRCC 5H1WA 1ZRQA 2R1LA 1YDOA 3AUJA 1FOBA 1R8LA 3S2CA 1R3SA 4O4WA 3H21A 2XVNA 4G6CA 3PJWA 4OECA 4GZEA 4PODA 5BZAA 4BQ2A 2PD9A 1AH4A 2VRKA 2FH6A 3CM4A 4ZCWA 2J62A 1I2OA 5BXRA 2W4XA 3GB6A 4ERGA 4AX7A 1I75A 2J7BA 2OT0A 3KBWA 2XH7A 4HHHA 4PGLA 2QMKA 1JUEA 2VX4A 3MT1A 4GZIA 3CPRA 1XI3A 2R91A 2GVEA 2H6RA 1UMYA 4RE4A 4PUNA 3NSNA 5E0CA 5CKSA 3H55A 1F76A 3GIQA 4ZOBA 1XYAA 4GLEA 2HMCA 3LTYA 1Z44A 2ZKMX 1Z6KA 2BASA 2HBVA 1H7PA 4QLKA 3RMEA 1U5JA 5CPOA 3WMBA 3ZT6A 5CSRA 1OX4B 3N15A 2RJGA 4JQ2A 3WNMA 3GVVA 3I7QA 2KX9A 3AIBA 4LVAA 3CUIA 2GQ8A 2VT0A 1O1ZA 3L0NA 4UIOA 4TUFA 1XPYA 4RCXA 1GK8A 5D2XA 4M51A 4X3ZA 4AVOA 3MO7A 2C1IA 1NQ6A 1OSEA 2BVDA 4RNJA 2QDHA 3GH5A 3SSZA 2FZDA 3FKKA 1VBUA 5A2CA 2ZRUA 3R8GA 1BWVA 1J93A 2ZWYA 3A4JA 3AUOA 2PEVA 3FXGA 3UPMA 2E28A 3CMFA 4Z2IA 2VCBA 4UR9A 3VIJA 1QNSA 3AIEA 3W7LA 1QI0A 1HZYA 4H9XA 1UBPC 1MNSA 3W6YA 3NG3A 3CV2A 1O60A 1N7KA 1GPFA 2RJHA 1N2VA 5HINA 1V3MA 3IIZA 4JTCA 2YB1A 3FJNA 2Z1VA 2ISSA 1XRTA 1RPXA 1GOWA 3GSMA 1E15A 4NUWA 2F61A 1BEUA 3BJSA 3UG3A 3S9IA 3FXYA 3O1NA 4PCPA 4NJKA 4CD6A 4N7QA 4Q4SA 4JQ1A 1GONA 2ZUMA 4L80A 3NVDA 4ROPA 1TIWA 3WMCA 1DHKA 1SZEA 2QVNA 4QCFA 3VO0A 5HR6A 2D2HA 4DIAA 4BF5A 2ZQ0A 3WF3A 3U9IA 4AZGA 3JS3A 1F6PA 2PLJA 3W9ZA 3DBNA 2PODA 1UUOA 2V3GA 1WDPA 3JRKA 4KWUA 3PZIA 4QQ3A 2C18A 1V3HA 4MB3A 4HN8A 2OFJA 4UOQA 3LV6A 4MYXA 3A24A 3QFWA 1KLZA 4DAFA 2YFOA 1ITCA 4AHQA 3M0IA 7TAAA 2PTXA 3GDTA 1VZWA 1SU5A 3LA4A 1VP5A 4WXYA 3CUXA 4GRSA 5E93A 1X97A 1P4CA 1S5WA 2F6XA 3DHFA 4C1LA 3LERA 1OZMA 4DXXA 3W2MA 2ASHA 4UQCA 1OFRA 1BYBA 4JIEA 3I6EA 4HPGA 2PI6A 1K7XA 1DTNA 5DEZA 1K02A 4R27A 3UWUA 5EL1A 2B4GA 5LGZA 1EO7A 3W7OA 5B7ZA 1W1ZA 4PTXA 2QPUA 4EWJA 1AL8A 1OIMA 4AIOA 3CB3A 4IH3A 4CQCA 4RPPA 2GUUA 3GKFA 3SQMA 3PBVA 4FXSA 4AZIA 3GNDA 1DORA 1FWJC 3FV9A 3OOQA 4LUTA 2FQIA 3ITTA 3MUXA 1FHLA 3SCVA 3EB4A 5C9XA 2FHBA 1B3XA 4YYFA 4TX6A 1TJRA 3AISA 3W28A 3OZOA 3SN4A 5CZTA 3BTNA 3R0KA 3D3FA 4O8AA 3WLLA 4JX5A 1VBRA 2PLKA 3TSMA 8TIMA 4WD0A 1TPH1 4HU8A 4TV5A 2V81A 2V3DA 4O1AA 4NY2A 3G6MA 2XISA 3H2OA 4YCPA 3M41A 1W3KA 3VNIA 5LA1A 1HJWA 1W9XA 1SZGA 2QJNA 3B0VC 3GX9A 3GXIA 1EEXA 3OHMB 2NUWA 2HPIA 3LXBA 1YADA 2JGYA 3H53A 1QR7A 4AUBA 3TXVA 5AKQA 4PMXA 2QAFA 1EDTA 4LAMA 4AY7A 3H70A 1Q6CA 3FY1A 4JFWA 2BGQA 3HIJA 4V1YA 1SFJA 2ZXQA 3LZ5A 1I2NA 1XX1A 2R1PA 3VOFA 4F0HA 2Y6ZA 1FDJA 1K1DA 1XJBA 3LCHA 4RW3A 1WXYA 1ISYA 4HNNA 3CC1A 2J6XA 2VC7A 2Q3RA 4AFYA 4XKYB 4DWSB 4AXKA 1E9YB 1XDLA 2CHRA 4FR1A 3EDEA 3P93A 1XHGA 3W7RA 3S1GA 1P0KA 1W5QA 5AFDA 4XBSA 1T7LA 1LQAA 4FR6A 2RDTA 3N04A 4H1ZA 4JTIA 2PDYA 2BXVA 5I3JA 4W8LA 3UWYA 1RP8A 3DG7A 4HYVA 2EF9A 3RLGA 3MY9A 2ZRYA 1KM5A 4FO4A 1CWYA 4LS1A 4DJDA 2C79A 4B5SA 1ISZA 2G3JA 2GUBA 1P43A 5HJYA 1UR0A 1BF2A 3NQFA 1LL4A 1EUAA 1UH2A 1E6XM 2ZZ6A 3M07A 3T7VA 4HJFA 2RDUA 3EGJA 4MG4A 4MMWA 2QPSA 2OB3A 3FYOA 5FAJA 3UVAA 3MUY1 3DEQA 4C6MA 4JTHA 4RXFA 4GI6A 3TLLA 3MB9A 3R0UA 3B8UA 1PCKA 2HROA 3SB0A 4WSHA 3N3TA 4Q4OA 3OO2A 2Z27A 1T99A 4MZYA 2GSEA 4GG9A 3L5MA 5C9ZA 4E2BA 4XSMA 4DI9A 4XZWA 2O9RA 3WF1A 3UESA 1KXTA 3N4FA 2BXZA 2UY2A 2J7EA 4WKAA 5G1TA 4GNJA 1AQHA 2EPOA 3QGAC 3WLHA 2ZUSA 1BKHA 5C2GA 4K68A 3WLQA 5H8MA 3VX1A 1WV2A 1DJGA 1P48A 4XG1A 4V27A 1PYFA 4DJED 1V0NA 4KGLA 4HOWA 4QAWA 3UCDA 2CHNA 4V1XA 1ONRA 3NSXA 1QHOA 4D6GA 2C71A 1TG7A 1XBXA 1UIOA 1E0VA 1C3FA 4X9YA 2D2OA 4O50A 3VIKA 2WWDA 5K3VA 5DMYA 2V9DA 1AW5A 1SZFA 3MSGA 5KEZA 3WD4A 1BD0A 3E49A 2XGBA 1Q7QA 3CJPA 3T6CA 3O7UA 3OQEA 4NF7A 3GFYA 4NKCA 1R5YA 4MKSA 4DVOA 4JTSA 4ROQA 3QHNA 4K6AA 3B9OA 1K9EA 1CXHA 4LPCA 4RZBA 3EA3A 3BMXA 5I7GA 3ZXWA 3TA6A 1OX4A 3TAKA 4R7OA 2VZSA 3GR8A 4I7WA 4ALDA 3BW2A 3EMQA 1LP6A 1K9TA 3PF3A 3W26A 1VR6A 5LNVA 2A0NA 4AEFA 1EEPA 2HNEA 1NJJA 1G1YA 1WKDA 3M64A 2XN2A 1YYAA 4GIAA 4LS0A 2XSXA 4QSHA 1ZAJA 2QV4A 3C0SA 2DIEA 3SUTA 3S6DA 2PU0A 3DBPA 4S1FA 1PKLA 2W67A 1JFXA 3UPBA 5GNZA 2OVLA 1F7BA 2VURA 4FOKA 4YTTA 5IHRA 1W5MA 1RLCL 3VC6A 3AFBA 4QQUA 5DANA 4YJ5A 3WBYA 3F03K 1HKWA 1AUSL 3GS6A 3ABXA 2P3ZA 3GHUA 4O1EA 4UTUA 4ZO8A 1TCDA 3LBMA 3W1UA 1E0UA 1MFVA 1VFFA 2WWCA 1Q6FA 1MEHA 1X8FA 1ADDA 1TZ7A 3GC4A 1WBJA 5AECA 4YNGA 1BF6A 1UCWA 1OABA 4MWAA 3HGOA 3IUDA 3WEMA 4O28A 2CBVA 4P5UA 3APTA 1I8JA 4JDYA 4QE4A 3BOFA 1KGUA 4IQEA 3C0QA 3PNZA 1HJUA 5DY2A 5AC5A 3QC3A 1GVYA 1YPIA 4GA8A 2VVNA 1EUNA 1SMAA 3IUIA 4HU3A 4A8NA 1D3HA 3JR2A 1IT8A 4ICMA 1H0IA 1S5MA 4U5IA 4XQ6A 1PIFA 3W6LA 4URIA 3E2QA 2A7NA 3MUAA 3DHUA 2CBUA 1NEYA 4OZOA 2GWNA 1JPKA 2P50A 2I57A 3VD3A 4WLCA 1T8XA 3QV7A 2HXTA 2DVUA 4WZHA 1GOOA 4FS9A 3EOOA 2ZE0A 1VCGA 4ZQCA 1EQCA 2GVLA 4YCOA 1A5MC 1VS1A 4HOXA 3TCSA 1ESWA 1HF6A 2V82A 3W72A 1RD6A 3C2OA 3SM0A 4J2PA 4LYRA 3WF0A 3R79A 3S2LA 4B2DA 2NUXA 4ZO6A 2W5FA 3CPUA 1K4HA 3RFAA 3TFCA 4PA8A 2YX0A 5JIWA 1HKIA 2VFHA 5BROA 3TAOA 3SQSA 1IF2A 3L4VA 2YW4A 3EXTA 4DPQA 5CZ0A 2PF0A 2B7OA 3GC5A 1RCOB 4GE8A 2ISVA 2VX5A 4RLIA 2ZUTA 3SUVA 1SW7A 1XYCA 3CGTA 2HS8A 4KEVA 1PIGA 3DESA 4XBKA 1N55A 2R1MA 3BSHA 4TVDA 2NQHA 3ZJKA 4AZHA 1ZAHA 3TW9A 4E4FA 1VKFA 2DZWA 2ZTJA 2ACQA 4J4KA 2QV5A 5KSWA 4H9MA 3FVMA 3WNLA 4LCQA 3WQDA 2PRMA 2DT1A 1JIBA 3OG3A 3UFYA 3HQPA 3WJXA 1DWIM 1GTEA 3AICA 1S3HA 3DKJA 3VX0A 1EP3A 1H7XA 2J8GA 1SW3A 3RK8A 2VX7A 2X1UA 3UERA 1TO3A 3U7VA 2QIWA 3G1RA 3EXSA 4R53A 3QQWA 4OUEA 4RV3A 3GTNA 3TDFA 3NNTA 3UZXA 3BV7A 1R2TA 2YCJA 1JCLA 3V1PA 3EOSA 1HNYA 5IM51 4LTSA 5BOEA 3POHA 3S5YA 4FAMA 1ZCOA 3QY6A 1UWIA 1PYMA 4H6EA 3C2YA 4UTTC 1NDZA 3S0CA 4J5NA 3EX3A 2P0OA 2UZ9A 3RO8A 1NDVA 3ZJ8A 5EPDA 5D8ZA 1OCNA 3NZ1A 4NNCA 4ZOEA 2VTFA 3W7CA 1ZP3A 4F66A 5CPLA 3A13A 4ZFMA 4JL1A 5CSSA 2ZUUA 1I4NA 2PWDA 3BXWA 4D1JA 3JUGA 5DCDA 2HK0A 4FLRA 4BY3A 1LRTA 4DWSA 3R12A 2J75A 3TW6A 4HA1A 2FZ8A 4LVBA 4B5TA 1ZPTA 1ZBWA 2ZXDA 3NURA 3IV3A 3F4CA 4C1NA 2TAAA 2X30A 4E5TA 5A6SA 2GSHA 2CXGA 3AROA 2X05A 4CD7A 1PKMA 5BCAA 1XF0A 4RZ6A 3EA2A 1H7WA 2ON3A 1YTDA 3PBUA 2PZ0A 1LOLA 4D8ZA 4MUPA 3N6JA 4IFRA 1KWKA 1C7TA 4TV6A 2EJ1A 2IQDA 1MDLA 3B0XA 2QZRA 3NCOA 3WNNA 2Z7KA 1KGWA 3ZIZA 2FGBA 2X1SA 1B2YA 4HN4A 3K13A 3HBLA 5EMJA 4IMDA 3VIOA 1CT5A 3FJ6A 1VFUA 5MHBA 5FF3A 4HA3A 1IWAA 4F0SA 2ZRWA 5I03A 4ORIA 3VKBA 1US0A 5AVNA 1YEYA 3LXAA 3RM4A 3BLPX 3RNDA 1TR9A 4YU1A 2NW0A 3GTXA 4NYUA 5CZKA 3MYPA 3GVWA 3BSMA 1SSDA 3OGSA 4FK9A 1B3YA 5M1TA 1TUXA 5E70A 2J47A 3DAQA 4IJRA 5M17A 1QBAA 2W0UA 1S2CA 5BOFA 1L0PA 3ABQA 2EPNA 4ATLA 3ES7A 3CUZA 3VIHA 2R8WA 4OOZA 3NDOA 3OVRA 1TZ9A 1Z9AA 2NXIA 3H2EA 2VVSA 3PK7A 1E0WA 3L5LA 2GGHA 4Z2JA 2BGNE 2C1GA 4E3VA 4NI8A 3TYCA 2V5JA 3STFA 2VCAA 3KCLA 1NM9A 5CXPA 4OU1A 4C6QA 4ECLA 7ENLA 1DJQA 4MAVA 2AAMA 4ZTYA 3AXMA 1R3QA 3VINA 1G4PA 3MHUA 2J13A 2G4JA 4Q8QA 2PCEA 5DRIA 4CNOA 3WMSA 4WDUA 1QT1A 3P82A 3CHFA 3AHYA 4L4MA 3OLGA 2NVAA 2DVXA 1IQ8A 1SR0A 2PU1A 3CZLA 4AIBA 1ELSA 3WNKA 3N4EA 1FRBA 1XSJA 1L8NA 5C2XA 1I2QA 1UKQA 2Z6JA 4GY1A 1L6SA 4J3UA 4B4HA 3DX5A 5HJLA 2BXYA 5DF0A 8XIMA 3BE7A 4IIDA 1A47A 5B80A 2QHAA 1FWNA 2IQ0A 3DHDA 5CAKA 5CGQA 3NR0A 3NOYA 3BSGA 1X8CA 4YYCA 5BWFA 5G4HC 3PB2A 1JPIA 3URNA 1M9HA 5LA0A 1AVAA 2A3EA 3HMJG 1BQCA 4OFCA 3AMKA 2ONEA 4FMVA 3M16A 3RMJA 4S3KA 2G3NA 1Y5WA 1KKOA 1VAHA 5AN7A 2Z2AA 1JRBA 2O4MA 1W5OA 4UZUA 1WZLA 1D8CA 4U4MA 3QW3A 3CQJA 3ZYZA 2IMRA 3CAQA 3E0LA 3M1ZA 2GZXA 3UWEA 3MVTA 2J4GA 1DIDA 1EJ7L 1C91A 2YPIA 1L2QA 1OT2A 1HX0A 3WBAA 5FJIA 4XUYA 4XZBA 2VENA 3LNPA 1UWAA 1VBJA 4FX8A 1JXJA 2CXEA 2WJDA 3A4WA 2PDWA 1GEHA 2YYTA 3WL0A 3GKAA 3IEBA 4H01A 3P6LA 2QCNA 2D24A 3BARA 4S2BA 4DELA 1QOPA 4Q4QA 3U8GA 3VKJA 2I5GA 3IVSA 3FA4A 4EP8C 2JFEX 2X42A 5IRPA 4HNUA 3S9YA 1IIGA 2QPXA 3NO3A 3SCSA 3MCOA 4IGSA 4WUIA 2CEQA 4UTWC 1QNQA 2H8ZA 3K1DA 4OTKA 1WOBA 4W85A 3S2NA 2VM8A 1R9XA 2J9YA 3EKZA 3ZJ6A 3LUTA 1MVYA 4XD3A 3CPGA 2VGFA 4FALA 3UYCA 1HG3A 3ZT7A 1H0GA 3KCJA 4FB7A 4YVXA 3WF2A 3N4AA 3THAA 2VEMA 5DO8A 3QR1A 3USZA 1VLIA 2FTYA 3G1HA 3WH8A 1ZTVA 3VDAA 4YTSA 4REQB 3B8DA 3RU8X 4JTGA 2VFDA 2XH0A 3R13A 4B4FA 2OO6A 1W3IA 2WHKA 1HKKA 4I5UA 5DFAA 1JCJA 3M0MA 1E40A 3LRLA 5AHLA 1DIOA 2VEGA 4EPBC 3R7MA 3CZ8A 2H3DA 4NRSA 4P8WA 1C29A 4OUIA 2QCFA 1P5BA 2FPYA 4G1KA 1JR1A 2RDXA 4O1FA 5LGXA 3LQGA 1ZAIA 3D6NA 2GDUA 1G7UA 1GQLA 1W8SA 3KVJA 4PUMA 3EX1A 5I3HA 4BF7A 1E4LA 2INFA 4L61A 3BG3A 1WO2A 4XWUA 3H12A 4N42A 1JDAA 1ZJAA 1R7AA 3KBNA 3PZ9A 4LAOA 1E6ZA 4U2ZA 2ISFA 2DZXA 1UUMA 4HNTA 4KIRA 3O2LA 1NP0A 1E5JA 1Y8BA 4GIRA 3WFZA 1MXSA 5HMFA 1SJCA 1A0CA 1V79A 1OFBA 2XIBA 4UTIA 4JTLA 1QATA 5I3FA 2Y0FA 4H7VA 5LIXX 2C1HA 2QR6A 5CQ1A 1UC5A 2YBTA 3QM3A 4Y90A 4R9OA 4Q32A 3B03A 4BI7A 4IZGA 1S46A 3QMRA 3NPVA 3M5VA 3LLXA 1OVDA 3GNRA 1GOMA 3ENLA 3T0AA 3WQPA 3EYPA 1AMYA 1KQZA 1XYFA 1PHQA 3WQGA 3SGGA 1W9VA 4HSHA 3EWZA 3K4DA 4S2CA 3SCQA 3KE0A 4MSSA 3ANYA 6XIMA 4OBRA 4QR6A 2NV2A 3A23A 3FFSA 1PKYA 1QNOA 1X7IA 2D0GA 4U33A 1XIMA 2ZXBA 4ZQMA 1S1RA 1D3GA 3S6TA 3IJ9A 5A8QA 3GY1A 3O07A 3A9BA 4H19A 2E40A 5K2ZA 1RA5A 2HSAA 1JCNA 1AW1A 3TROA 2P0IA 2OJPA 3UR2A 4Y9PA 2E6AA 3H6OA 4DI8A 2Z00A 4PTDA 2IXVA 3GNPA 3W7HA 4ZEPA 1E3ZA 2Q8ZA 3ALFA 4LS2A 5DBTA 2DORA 3K46A 3VKCA 1XUUA 3KCOA 3CQHA 1ZBVA 1IZJA 3PTQA 3WK0A 3FSTA 2XM1A 4QHRA 1B3VA 1O5QA 2OX1A 2V6AA 3BGAA 1C9DA 1J9YA 2WHMA 3UNDA 4S39A 1JCMP 2FYMA 4MB4A 1W1B1 1EF3A 3VNMA 2RAGA 2PLCA 1E72M 1V6TA 4ZSUA 2O7QA 1EJVC 1F3EA 5A3HA 1A5OC 4RX0A 4LALA 4C6JA 3LV5A 1TMLA 1X1NA 4PRTA 4AX6A 1QI3A 3W1LA 3OA3A 1RSCA 4HMCA 5C55A 4D71A 3TVAA 3HV9A 3WLOA 4O53A 4K2SA 2CNCA 4WJEA 1YE6A 3T0CA 5BYWA 2HS6A 2V5CA 4AEOA 2A5HA 4J35A 2VDHA 2G3FA 4L9XA 1BYDA 3M5XA 4BS0A 2WXDM 3UA4A 2POTA 8A3HA 5HQMA 1YNYA 3E0FA 1PJ9A 3M7SA 5I23A 3BJFA 1SO5A 1J0HA 1IEVA 1PZ2A 2CZVA 5KZDA 2WSQA 3MHFA 1FTXA 2AKZA 5CZJA 1CIUA 3WQCA 3WJZA 2NQ9A 2ZICA 2ESCA 4XTDA 3A9IA 3RLVA 3BLKA 1TJ2A 4MB1A 2V3FA 2MUCA 4TVCA 4KEMA 2AKMA 2XZ9A 4HK5A 1J5TA 1F8IA 1AZ2A 1LRNA 3URQA 3IRDA 1YHTA 4LAUA 3UZ5A 4LNCA 4IT1A 1D9EA 3SN1A 2DVTA 5TBOA 4LQ1A 1BPLB 3TONA 3U2CA 3HG5A 4O52A 5G2WA 5H8UA 5D2TA 1NFPA 1XCXA 2X7WA 1XRSA 3HGJA 4LX4A 3FA5A 2YZRA 2PC4A 4K8GA 5GJNA 1UWUA 2Y4SA 3IJLA 4AY1A 4IUOA 2VFGA 4AD5A 2OR2A 3O05A 4GVFA 2Y89A 1B54A 2OELA 7PTDA 3SRDA 1JPDX 3FHAA 3HN3A 1ITXA 1A3WA 1UZ1A 1ZNNA 4BA0A 4GMEA 1JPMA 1R0MA 5B7YA 4FA3A 3DFSA 3NYDA 4DN1A 4RK8A 3UETA 3VMNA 3K1GA 1JYNA 1MWOA 4W4QA 1V08A 2DZAA 4DF2A 3QPZA 5E6YA 4IIFA 2H9AA 1RV8A 2I7GA 2DH2A 1KWGA 2AMGA 3PBGA 1V6WA 3CT7A 3QQ0A 4FLOA 4LV4A 4Q8UA 5FIPA 1G0CA 1EX5A 4BZYA 3MUCA 3UG8A 4LBSA 1OFEA 1EP1A 1OYCA 4UXDA 4KERA 3QJAA 4H04A 3GU1A 2GOKA 3FCPA 3OP2A 4CQDA 1XQKA 2GGIA 1IIHA 4HCDA 5I02A 4DZIA 2WPBA 1QWKA 1W9UA 2PDGA 1V5XA 1EDQA 3ZR4A 1JZ7A 1XBYA 2DJXA 1TPVA 4JS3A 4KFPA 3WJSA 5AB3A 3LCGA 2FKPA 3QZ6A 4B5XA 4CNSA 1FWBC 2CLEA 5CAHA 1LT7A 1OG6A 2XH2A 3T40A 4H83A 3L21A 1S2AA 1XKYA 5F4SA 1MW0A 1TE6A 3W7MA 4F40A 5E5CA 1XQLA 4TTGA 3LBOA 1XIGA 3Q65A 4A3YA 3VNJA 1O5KA 1QK0A 1WP6A 4RE3A 2ATSA 5ENLA 1J0IA 1MQRA 3A4XA 1CXFA 1HL2A 4QJ1A 2WKGA 3AJXA 1DVJA 5CJ5A 3KBJA 5ECVA 1TR1A 2A79A 5K9XA 1E9IA 2PTZA 3V7PA 2P76A 4REQA 4F0MA 1WPCA 2HEJA 3G0XA 1TQXA 1I1WA 1R87A 2J79A 4O19A 1QVBA 1GVOA 2PDMA 1KTBA 1Y0EA 4MYAA 4FIRA 3SY8A 3G0SA 5AZ1A 2WZEA 5H8PA 3H7RA 1UR2A 1XICA 3B9NA 5AYZA 2XWEA 7REQA 1IWPA 4UZSA 3A3HA 1TIMA 3BICA 2WJEA 1ALDA 4ZR8A 3BLFA 4ZSTA 4KQNA 3MZNA 4PTWA 2V63A 2OGJA 2VR4A 3ARZA 3A47A 3ZLGA 1WB0A 1CECA 3OODA 2DT2A 3WK3A 4A6GA 3TN3A 2X2GA 2OT1A 4GACA 1TUFA 3N19B 4LGXA 5FAGA 4GNKB 3WBXA 1JF6A 2WK2A 3T8LA 3SY5A 4QROA 4B5VA 4GCAA 4GH3A 3TJLA 3TJ4A 1I9CB 3F1QA 1H60A 2E5BA 3UEQA 1FH8A 5ABFB 4WIWA 3B9EA 4FNPA 4QX4A 5BU9A 2CESA 1QPQA 4R3UA 1MW3A 1KGXA 4JZ5A 1IT7A 1PV8A 4NX5A 1GKRA 3FKRA 1H62A 1VJSA 3J7HA 3S5OA 3VGGA 2PDQA 7TIMA 3IJ6A 1S2VA 5BXPA 1HXJA 4XO7A 1VYPX 1JDFA 1OADA 1FDYA 1YXDA 4UTLA 4Q6JA 5ECUA 4QE5A 4K36A 1LUCB 3RRAA 2B81A 3UXDA 1DJWA 5LIKX 1B3WA 2WM0A 2UY4A 5CC5A 2VQTA 4IPNB 3WLRA 2FJKA 4KBXA 3VNYA 3WQ6A 2NV9A 4DQWA 4LW7A 1CENA 2YCLB 3WFLA 3L4XA 5C70A 2AL2B 3GXMA 3C3UA 3OBAA 1JEZA 3IK2A 2AAAA 1DE6A 1XH0A 5LXEA 4GI4A 3M0XA 2X1RA 5ABTA 2EHHA 4E8DA 2VGIA 3DYMA 4QS5A 4CD4A 4Y8EA 2ZDRA 3W7IA 3GG7A 1I0BA 1D7KA 4GKLA 4IUGA 4KCUA 4J3ZA 1VEPA 2VNCA 4Q8MA 1EKOA 3MBFA 2FDSA 4NZ1A 1DQWA 3V35A 3VGFA 3F7JA 1XFBA 3L4ZA 4DJDC 5CEWA 1JD9A 4NVTA 4F3HA 3K8KA 1NVMA 4ONVA 3O0FA 3PZVA 3S4TA 4ZOAA 2FPVA 3MSDA 4JKLA 4IPJA 1OX5A 2GFTA 3TK7A 4FF7A 3KWSA 1UASA 3INPA 1JI2A 1BTCA 3WD1A 1JDDA 3N2TA 1LZOA 3D47A 3TSDA 1KFLA 1Q13A 4O1CA 4D6FA 2EKGA 1KKRA 1EJRC 1A80A 1HGYA 3B8SA 2OXNA 3EMZA 3H2NA 1SQ7A 4U3CA 3II1A 2WNQA 1M7JA 1R85A 1QRQA 4YXGA 2IS7A 4JEJA 4EIVA 2DSVA 3DUGA 4C7GA 3VUSA 4H6KA 1UWTA 1HKVA 3TYAA 4YMZA 2G37A 2A7PA 5PTDA 1TV5A 4Q3MA 1WCGA 3AJ7A 4IMAA 1IXNA 3QF0A 4PUKA 3SR7A 2J9XA 1W8GA 2Z29A 3I3BA 1O6IA 4C7DA 4GQQA 3QBUA 3N13A 1E4MM 4KPLA 3VIIA 1JULA 3OBKA 2C7FA 1JZ4A 4RZ4A 3W7NA 3IJ7A 4WY0B 1GOIA 3PUEA 2Y88A 4MWAE 2C19A 2NV1A 3R10A 4MY1A 2FLIA 4AZCB 2VHLA 3BQ6A 4M7TA 3LB0A 2VFFA 3W86A 1J6PA 3MHGA 3L67A 2PP0A 1B1YA 4IQDA 1SM9A 1XLBA 3S1WA 2ZUNA 4M7SA 2ZC8A 5CLTA 5A8PA 5TAOA 3TYEA 3SY1A 2ZA2A 1UP3A 3MSYA 3NGFA 2A3HA 1P1MA 1CGXA 1RJRA 1G7VA 2Z1XA 2ZX7A 1MUMA 1SFSA 2A21A 1AMKA 2VX6A 3C3NA 2EPHA 2JBMA 3BC9A 2DIJA 5TF0A 4KETA 5DXXA 1RLDA 3SIMA 1Q7MA 1WUFA 5L6UA 5LA2A 3URAA 2BS9A 1G01A 2FVKA 1W91A 1MYRA 1R3RA 3UBPC 3NQCA 3ITYA 4S3DA 3M47A 3IAQA 4FNUA 4EXAA 3SCTA 4WKFA 3W3OA 2UY5A 2PWHA 3NQGA 3REQB 1JI1A 3WENA 2QT3A 1E4NA 1FWEC 2X09A 4CVUA 3IIOA 3EOEA 3HMCA 1R9YA 2GQ3A 2ZRZA 3OGVA 3KBVA 5KZ6A 5AYBA 4QFUA 2NQ5A 1KFKA 4GPNA 4BWLA 2VR2A 1E43A 1IEWA 2CC0A 1C7SA 4AH7A 5JH2A 1F6KA 4FHAA 5HPOA 2G8ZA 5AC6A 4ZE5A 4X22A 3PP7A 1P0DA 3PVFA 2SFPA 2HV5A 5E0FA 5A6JA 3GHRA 4PULA 4O18A 3KOWA 3NFUA 1N82A 4S3CA 4H2HA 1BXNA 1XD0A 3UWQA 3EXRA 4IP4A 1SW0A 4YVPA 4DYEA 3WH7A 4D6IA 1PPIA 3UU0A 3GR7A 4FIQA 3VD4A 3TNOA 3SZ8A 3PY2A 1UOKA 3G3MA 4JBRA 5FJOA 1XDMA 1GYLA 3WDJA 3LK6A 2YA1A 4GABA 1UYQA 4RNIA 4RPQA 4AHPA 3TOYA 4QS6A 3VTRA 2DZPA 1H61A 4BI6A 2BV9A 1F74A 4D6HA 2ZBTA 2FZ9A 1CGUA 3NVTA 3R94A 2XU2A 4W8BA 3UWVA 5A8MA 3SN0A 4A8LA 3NDYA 3W7QA 4AWSA 4AVFA 1PVNA 2BY3A 1QNPA 4O57A 1G9HA 3FA3A 4PBEA 4JQAA 2WJZA 1R3YA 4IFKA 4CVWA 3S3GA 2EG6A 5F4WA 1WX0A 4H6RA