5AHNA

Imp-bound form of the d199n mutant of impdh from pseudomonas aeruginosa
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
467
structure length
297
Chain Sequence
MLRISQEALTFDDVLLIPGYSEVLPKDVSLKTRLTRGIELNIPLVSAAMDTVTEARLAIAMAQEGGIGIIHKNMGIEQQAAEVRKVKKHTYPLASKDEQGRLRVGAAVGTGADTGERVAALVAAGVDVVVVDTAHGHSKGVIERVRWVKQTFPDVQVIGGNIATAEAAKALAEAGADAVKVGIGPGSICTTRIVAGVGVPQISAIANVAAALEGTGVPLIADGGIRFSGDLAKAMVAGAYCVMMGSMFAGTEEAPGGALSAIVHQLMGGLRAAMGYTGSADIQQMRTQPQFVRITGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
publication title Crystallographic Studies of Two Variants of Pseudomonas Aeruginosa Impdh with Impaired Allosteric Regulation
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Oxidoreductase
total genus 102
structure length 297
sequence length 467
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5ahnA00
4Y8FA 3W07A 5LNRA 1TPDA 3GIYA 2WSQA 1ME7A 5I3FA 4M19A 4HPJA 1THFD 3RMJA 2FLIA 5D2YA 4DO5A 3I7QA 2V2HA 3DZ1A 4O18A 3TSDA 3BLFA 3OG3A 2E6FA 4G1KA 1HO1A 1M7OA 1JCNA 4MJMA 1TQJA 5FEXA 4UTKA 1SO5A 3OHIA 3N19B 3KAOA 4EF9A 3F4WA 1GYNA 2NWSA 4KFPA 2J9ZA 3L66A 3NO5A 4JTEA 3HG2A 1SZFA 1LDCA 3CLMA 3JS3A 4JR5A 4PA8A 3R89A 3LHUA 4IMEA 4QITA 5J5RA 3G8RA 2NWRA 3G24A 4JTHA 2FJKA 5HNRA 1H60A 3O6CA 2P10A 1QPRA 5GVJA 2RDWA 3N9RA 4RXFA 4HNUA 4UCGA 2ZCGA 3G1YA 3Q94A 1Z48A 1ZHAA 1HO4A 3U2OA 2WKJA 4QM1A 1ME9A 3OA3A 1XCFA 3W9ZA 1EA0A 2BLEA 1OG0A 1B4EA 4AVFA 1I4NA 2R14A 2ZYFA 2ZZ4A 3TH6A 3GNDA 1OFEA 5D2VA 1M6JA 3IEBA 1XXXA 1DV7A 2VEMA 5DY2A 4NU7A 3MHUA 1JJKA 1SO3A 4CCDA 1T99A 3W7EA 5HINA 1O95A 1K02A 3TAOA 1EUNA 1H7RA 1JCLA 3KHJA 4NJJA 5I3GA 4IX0A 3CIXA 2F84A 1IGSA 3NQEA 4IMCA 5G4WA 4H6KA 3R5EA 3PY2A 5CPNA 2AAMA 3M41A 1NAL1 5HMSA 2NX9A 1ICPA 3C2EA 3JRKA 3BW2A 3W72A 3P81A 3UWYA 3I68A 3THQA 3B0UX 3TFXA 1SPQA 1UASA 3TCEA 3VE9A 4QQ3A 4JNMA 3BK0A 4MJZA 3E0IA 1PE1A 5AFDA 2F7FA 5KSWA 4UUIA 1L6YA 3NL6A 3T78A 4RR4A 3HPXA 4AHOA 4R33A 3O16A 2LLEA 3PR2A 4GUGA 3PSWA 4RZ4A 3DKLA 4E0CA 3A21A 5DBUA 2NUYA 5CSSA 4ADSA 1PIIA 1L6SA 3NR0A 3T7VA 4DELA 2VXNA 2V8ZA 4WY0B 3ELFA 3NQMA 3TE9A 4LVAA 1GVRA 1H63A 3YPIA 3FA5A 3DBPA 2TSYA 5KZMA 1G67A 2DZWA 2R91A 5F4SA 4MYXA 3L9CA 1WBHA 1B57A 2GQ9A 1AW1A 1KM5A 3OBKA 1B3OA 3ATZA 2ABAA 2QCMA 1BTMA 4XBSA 5HR7A 1W3NA 3LGEA 3G3MA 5G4EA 4IOTA 4Z08A 4MY1A 1A50A 1YDNA 5DCDA 1YDOA 3I7RA 1QFEA 4Y9AA 1EP3A 1KFBA 3EWUA 4AWSA 5KTLA 2VFDA 3IGUA 1DVJA 2A7RA 3GDLA 2OJPA 4S2BA 1Q6QA 2Y6ZA 5D09A 3BPWA 4TX9A 1JQXA 2GVJA 4M7SA 5T26A 3LCGA 5D02A 5E0KA 1GVQA 1XBZA 3OVQA 3E12A 4BFAA 4K7VA 3NPWA 1TIMA 5EY5A 4BK9A 4JX5A 4Z1DA 2V30A 2VEKA 3GDTA 3C6CA 1TV8A 2OMAA 2OZ0A 3W22A 4OU1A 3EWZA 4MUZA 3L65A 3FS2A 3C52A 3PBVA 4LUIA 1RVGA 4UFIA 1D9EA 1P4CA 4JD4A 4AF0B 3IGXA 5FF0A 1LOLA 3N2XA 5FI8A 3BO9A 4LU0A 4GUHA 3GXNA 4Q4KA 3W1PA 1OFOA 5K3VA 4FNUA 4W9TA 4LTSA 1VCFA 4K6AA 2B7QA 2DORA 3ABOA 1OX5A 5G2HA 5BRBA 1OHLA 3A9IA 4TU1A 5TQLA 3SZ8A 2NZLA 3EX1A 3DGRA 4NX0A 5C5YA 3NM1A 3ATYA 3OIXA 4MPQA 1XDLA 3T40A 2YYTA 1TTPA 3F4NA 1UUOA 2AGKA 2DZPA 1I2PA 7TIMA 3FFSA 1JCJA 4I7UA 2W0UA 5FEWA 3GAYA 2PC4A 2QAPA 2NXGA 3BW4A 2PRHA 3M5XA 3QPYA 5AYXA 5DLCA 4Z0SA 2QCLA 4A21A 2RHGA 1O4UA 4K37A 1G7VA 2CZFA 1ICQA 3B05A 4U28A 4NXSA 4Q32A 3RNDA 2CW6A 4XTDA 2D73A 3EB2A 4RXGA 3A5VA 3IIXA 3UWWA 2J9YA 3CHVA 3PAJA 1KTNA 1P1XA 4GFSA 6TIMA 3EXRA 4XZ9A 3Q37A 1WDWA 4X22A 3M0ZA 3L68A 3SIZA 4A29A 4IGHA 3LCFA 3NL3A 1KM2A 5CZSA 3LHTA 3EWYA 1TJPA 4CQ9A 4X9SA 2GPTA 4UFMA 2DJLA 2ZRYA 1GWJA 2Y89A 3EXTA 3W2LA 5D30A 1WA3A 1VYSX 3U8GA 3TV8A 1XUUA 2ZRXA 2R8WA 3UQNA 2E6YA 1VYPX 3EX2A 4HSOA 3MW7A 2JKPA 1F7BA 2DZUA 1XI3A 3CEPA 3G0SA 4XUGA 3N2MA 1T96A 3EX4A 4O17A 3IIVA 2A7NA 2E5CA 2H8ZA 1RR2A 3S9YA 1KLZA 3O05A 4EVZA 1HTIA 4QJ1A 5F2MA 3CC1A 2GVGA 3E96A 3HG3A 3EXSA 3I6RA 5BMXA 1W5NA 5HQEA 4JX6A 5LZLA 3F1QA 4ZVJA 3SR7A 2V82A 2C16A 1OFRA 4WJEA 3NPXA 5H91A 3W75A 5KITA 4GXMA 2X1TA 2ZA2A 3PVFA 1UB3A 4PEKA 3FLUA 2GJLA 4RZ5A 4NUWA 3LCWA 3W7OA 2O7SA 3W85A 3NXFA 3NQ8A 3RLUA 5HWNA 5AN7A 4JICA 3O07A 4TR9A 4LC6A 3JR2A 3PC0A 4LS1A 3QMRA 1I45A 1W0MA 3BARA 1G4EA 3MYOA 3M6YA 1F74A 3THAA 3OEXA 3TXVA 3PUOA 3G8EA 3G1SA 3MP3A 4JTSA 2ZRVA 2BWGA 3UWUA 4I9AA 2NUWA 4DXVA 2ATSA 1IIHA 3G0XA 3G1DA 2QCGA 1DHPA 3P7YA 4ML9A 1VQTA 1LRTA 3FIGA 3RFAA 3DFSA 1TPUA 2VFIA 3FJ6A 1PL9A 3SSJA 4FIRA 1F73A 4AHQA 5D2WA 4LV4A 2A6LA 2DP3A 4JTIA 2E5DA 3MP5A 1QMLA 3MI3A 1RPXA 4N02A 5AHMA 5IBXC 1RD5A 4ZQOA 1OVDA 3UWQA 1B9BA 3PG9A 2Q3RA 4FNPA 1JCYA 1G4PA 4TO8A 2AQWA 4YMZA 1JUEA 4QNWA 1FCVA 2Z6IA 3P62A 1F76A 3DHDA 3W73A 3W1LA 4LT9A 1OJXA 4JTJA 4ZL1A 1GG0A 3W7HA 1JCXA 2GJNA 3M5VA 5AYZA 1TPFA 2P1FA 2Y70A 4WY0F 5CZJA 3LB0A 1Q45A 3M44A 1CI1A 1HG3A 2ZA1A 4MVAA 5LNUA 4JDBA 1R2TA 1KM0A 3L2IA 3LBMA 1EB3A 1KFKA 3SW6A 2CLHA 3WJSA 1DJQA 3LHVA 4UTUA 3W2KA 3HOJA 3EWWA 1DQXA 2X2GA 5A8GA 1Z41A 1VHNA 2FDSA 1ZCOA 5BOOA 4FXSA 2X16A 1SFLA 1J5TA 3QSTA 3GAKA 5K4XA 1FQ0A 4K7YA 1OX4B 2B0MA 2X1SA 1JULA 1X1OA 3BGJA 4IXHA 4N4QA 5AYYA 1WAUA 2HS6A 5LHEA 1PV8A 2GUUA 3P5YA 1H7XA 5I3IA 2GQ8A 4LY8A 3C61A 2QAFA 5CPOA 1QO5A 1RV8A 2CZEA 4AWTA 3PUEA 2E6AA 3LTSA 4N9EA 1SZEA 3W7MA 1I2NA 3IIOA 4N9CA 2CLLA 3WK0A 1JUBA 4TMCA 1KA9F 3MO7A 1NF0A 3W7NA 1QNVA 1L2UA 2QCHA 5AC8A 3O6YX 3QFEA 3TUUA 4O10A 3W71A 2H8XA 2ZZ5A 4BF9A 4PH6A 4HNVA 4Q33A 1KTBA 2H90A 3TC7A 3CTLA 2YW4A 3Q58A 2ATMA 3TMQA 4Y96A 1MEIA 1H61A 1EPXA 3U6WA 4L4LA 2C0AA 3LV5A 3DI0A 4UTJA 5CG7A 5CGQA 4IWWA 2CLFA 4NZFA 1LOSA 1UJPA 3N14A 3PUDA 2Y88A 5J5DA 5LKYA 4K8HA 2WV8A 4NVTA 2PE4A 4O16A 4ZQCA 4I7VA 5CPMA 2A0NA 2EPHA 4FEZA 2NXHA 5KMYA 1SW7A 1J2WA 3W1UA 3I7SA 4P2VA 4AWUA 1HFBA 3MMTA 3S42A 2Y62A 1JUKA 1NF7A 3SJ3A 2ZTKA 3MP4A 1KM1A 1NEYA 2DZVA 1ADOA 4KKXA 3W7JA 1O94A 3DKJA 3W1AA 1X1ZA 3HF3A 4QNEA 3QYQA 2IQTA 2FTPA 3W7PA 5HJLA 3MJYA 3P67A 4LUJA 5BNKA 1GQNA 1K8ZA 4LVFA 4UR8A 3UZJA 2V0TA 2I1OA 4FNTA 4QSHA 2VEIA 4RKAA 4RK8A 2CLIA 1BWKA 5D2TA 1ONRA 3QC3A 4NNAA 2DZXA 3HGJA 4YCOA 2UV8G 3NVTA 1W3IA 2YX0A 5D03A 4WY0A 2ISWA 1RQBA 5EPDA 3UXDA 5CZ0A 4JTTA 2XN0A 1H7OA 4CLMA 1H1YA 3HO8A 1O60A 3TJXA 1K7XA 4GE8A 4FIQA 1OFAA 3W7KA 4XQ6A 1X8FA 3BVJA 4WXZA 2NX3A 2WSRA 2YW3A 5F2GA 3KX6A 4N4PA 3FYOA 4O52A 4A2SA 3V1PA 1W54A 4HNTA 4N9DA 3CEUA 3B06A 3TROA 3O1NA 3KXQA 1XFBA 3W1NA 1XL9A 4NQ1A 4MOZA 3NQCA 3DFPA 4MY9A 1D3HA 1K03A 1GVSA 1ZENA 1KFCA 3UWVA 5EBUA 2QEZA 2ABBA 4POCA 3AJXA 4WD0A 4O12A 1TTIA 3RLVA 2VEPA 3C2OA 1P0NA 3IVUA 3G0UA 2VFGA 3LI0A 2H3BA 2ZDRA 5D32A 1WOBA 3FJLA 3A22A 4LVBA 2C1HA 3P8IA 3RU6A 1FDZA 3CWOX 3NGJA 1YPIA 1SQ7A 1OFPA 2H3DA 3KRUA 5D37A 2VFFA 4GJ1A 1LROA 3UY8A 4BR1A 1LLZA 3PG8A 1A5SA 4JYFA 1DQWA 2J9XA 3NPVA 4I7WA 1QPNA 1A5BA 1YXYA 1VGAA 3TDFA 3LCXA 1H1ZA 5BW6A 3QMSA 5U7SA 5FESA 3USBA 4A3UA 3NQ6A 1GEQA 1G6CA 2G96A 4GRSA 5AC7A 1SR9A 1TPEA 3W3OA 4UTHA 5L9FA 5F1UA 1HUVA 2C18A 3BGGA 1WOAA 3PBUA 3QSRA 3GDKA 1EWDA 2NV2A 4JTLA 1WYIA 3TJLA 4LC8A 3W76A 1AW5A 2OX1A 3LRKA 1TTJA 1EIXA 3NNTA 5K9CA 2WNNA 3DH7A 4GNJA 3ZR4A 1LYXA 2WSYA 2BZNA 3CT7A 1FXQA 3A5FA 2FFCA 1DKWA 1VLWA 3KOFA 3P84A 3NDOA 1LM1A 2EAWA 2X1RA 1LZOA 2YSWA 3QQ0A 1F6PA 1C9DA 4DF2A 1GOXA 4R53A 4ZZ9A 2OCZA 3SY5A 4CNOA 3VCRA 3EKZA 3P8JA 2WQPA 2V2DA 4JTUA 4MFEA 1WXJA 2V81A 3STGA 5U4NA 4PODA 3NQVA 1TB3A 4TIMA 4DBEA 4A22A 2CLEA 2FQIA 4FNRA 1FWWA 1QAPA 1PVNA 3DI1A 4M6VA 1TPC1 4BWLA 1W56A 3FKKA 2TPSA 4WQ6A 3WK1A 3DXIA 1K8XA 3LOTA 3M5YA 2OT0A 2B7PA 1ML1A 2Y7DA 5EL1A 4N9BA 3MUXA 4NNBA 4LS0A 3STEA 1GVOA 3LERA 4JDYA 4FB7A 3B4UA 4OHQA 1TV5A 4LVDA 3PM6A 3L5LA 3C0JA 2B7OA 1LBMA 1OFDA 4O53A 5DCEA 3C4UA 4Y90A 4UMCA 2NUXA 1XBYA 3LHYA 3W1TA 3KRZA 4UNLA 5G1TA 2HMCA 2JKAA 1GPWA 1JRCA 2VELA 3BLIA 1XBVA 4MFDA 2C19A 1GYLA 2E09A 2ZRZA 3QW3A 3M5ZA 5LHFA 3DU0A 3QEZA 5DELA 4RCXA 3TXZA 1TPWA 4WZHA 3LDVA 2ZZ7A 3NQGA 4JX4A 3S5YA 2DZTA 3O63A 1Q6RA 4DO4A 1IXOA 4BI5A 1W5PA 1YTDA 3Q2DA 4WOZA 1YTEA 1QOQA 5DN1A 3W86A 1KM4A 5D33A 4UTLA 2YDAA 1OF6A 3DHFA 5LNSA 3IVTA 4IMDA 1FWSA 1AMKA 4IPIA 1X6UA 4M6PA 5AC6A 3LLDA 1G69A 3STFA 4O1DA 3O06A 2J6XA 1YLVA 5IM51 2Y7GA 3GK0A 3S6DA 3WJZA 1OABA 1ZAIA 5C6MA 1LP6A 5K4ZA 3KRSA 3L5MA 3G1XA 4GUFA 2ZZ3A 4LRTA 2ZA3A 2I14A 1C29A 2RKXA 5DXYA 1TJRA 3EWBX 3NOEA 3UPWA 2YZRA 4E2DA 5D2XA 5A5WA 1O5XA 3NL2A 3PF3A 4DF1A 4JTGA 4UTWA 3S1WA 3GR7A 3W23A 3C2FA 3LX9A 4ALDA 2NLIA 1KM6A 2QJGA 2GQAA 3QM3A 3ZWTA 4Z1CA 3HGRA 4XWUA 4NT0A 3LCIA 5D05A 2NV1A 1GT8A 4JN6A 4LNYA 3WFAA 3HGOA 4KFNA 2FPVA 1O5KA 3BG9A 1SU5A 1H7PA 2QF7A 1ZJIA 1I2RA 3SGUA 1I8JA 1OFBA 5G1YA 5G5IA 3VKJA 1RZMA 3P74A 1H7WA 4O11A 3A23A 3SFKA 3TC6A 2DJXA 2JK2A 3NL5A 5EMUA 1FX6A 1TPVA 1P5BA 4O0ZA 1YYAA 3NPUA 3D0CA 4AAJA 3O15A 5FF2A 3HMJG 1SSGA 3B03A 3DFOA 4PC8A 3BG5A 4UFLA 2GOUA 4JTFA 3M9YA 1KM3A 2VENA 4RZ6A 2ZQ0A 3NZ1A 3W1XA 1JQVA 4FF7A 1K7EA 1T0OA 1GJPA 4XKYB 2OT1A 3STCA 4JY8A 3C8FA 1N8FA 1SUXA 4DBDA 1H7NA 4O1BA 3VNDA 3KVMA 3R12A 1TYGA 5I3KA 2TYSA 1B4KA 4IUOA 2HSAA 3G3DA 3W1MA 2Y85A 3H54A 1ZAHA 2ISSA 3W2JA 4DQWA 4R34A 1KFEA 1OX4A 3QZEA 1U83A 2YPIA 5F4XA 1VRDA 4NXKA 4RJEA 5LGXA 4AHPA 4AH7A 4IMFA 3LXAA 2ISVA 1CX9A 2G5WA 5I3JA 2RDTA 2QCNA 4GC4A 3GLCA 2ZFAA 2WPBA 2HTMA 4PTNA 4O50A 4WOQA 1D3GA 4DO6A 4S1FA 3W7GA 4BWLC 2A4AA 3NQ2A 5AHEA 4CCEA 4OV4A 1X7FA 4FNSA 1SZNA 1ZNNA 1TQXA 4NJKA 4DF0A 3M7WA 5AHFA 2YFNA 2EKCA 3DFTA 4XTIA 1SO6A 3A24A 3HPZA 2KZHA 1PS9A 1W5MA 1SSDA 5AB3A 3GXTA 4WX2A 1QWGA 1MZHA 3NAVA 1FY6A 1ZAJA 1VHCA 2V5LA 3B0PA 1KW1A 2A5HA 3DFQA 3QF0A 1LRNA 4D2JA 1KLYA 4IXXA 1IIGA 4FHAA 1EP2A 1SZGA 3PS7A 4OGZA 4MZYA 1S5VA 4IX2A 4O1AA 1KFLA 2Y63A 3PSVA 3GZ3A 3N3MA 4O14A 1M5WA 1Q6OA 2I9EA 3N34A 4GUJA 3EEGA 3INPA 1TO3A 2QUVA 3G1HA 3IGSA 4DEFA 1W5QA 4KWVA 2C3ZA 2QCDB 3O8AA 1F05A 3IIZA 5FEPA 3W7LA 3CU2A 2YXGA 2TMDA 1LBFA 3N9SA 3NQAA 3CWNA 3HPSA 4N6FA 3QQ1A 2QDHA 3NM3A 3S5OA 2ZTJA 3M1ZA 3O6DA 5H2ZA 2H6RA 3EKLA 4JTKA 3HIJA 4M6QA 4OV9A 3MBFA 3S5ZA 3T55A 3B04A 1Z44A 1VJIA 3LI1A 3F03K 3EX3A 3BW3A 3LLFA 4ORIA 5DXXA 1N55A 5LGZA 1I2OA 1VYRA 4X3ZA 2WNQA 4ZQPA 3E49A 4ZQRA 4AEOA 5K2ZA 3M43A 4O15A 1E51A 5E93A 5C54A 1S5TA 5HWJA 1F6KA 2XFWA 4MLJA 4X2RA 2QKFA 3LXBA 3G1VA 5LNWA 3WJWA 3M16A 3PBYA 3NA8A 1TCDA 1WV2A 4HKPA 5E1QA 1AG1O 2W79A 5G2IA 1ZY9A 2A6NA 3P61A 5EYWA 1VS1A 4KWWA 4FXRA 2G97A 1Q3NA 1I2QA 4NJHA 4EF8A 1VCVA 5DBTA 2ZZ6A 5G2WA 2CZ5A 3PWAA 1C8VA 1GTEA 2CLMA 2QCCA 4YLWA 1FXPA 1PCWA 4QAIA 1HL2A 1DOSA 1W8SA 3TQ0A 1NFBA 3CIWA 2YFOA 1VPXA 3R2GA 3LRMA 3ZWSA 1V7YA 3EX6A 3TSBA 4AMAA 3LCHA 2CZDA 1MO0A 3CM4A 3W7CA 1YTKA 3T44A 2Z1BA 1FWNA 3NEVA 3MWAA 1LBLA 2DU2A 1KV8A 1ZFJA 3LHWA 1JR1A 4KFOA 3W1QA 2VOMA 5L6UA 3W7QA 4O54A 1W1ZA 3TW6A 4OQVA 5I3HA 1AL7A 2NXIA 4MYAA 3LRLA 3TNOA 4WXYA 4DPQA 1LLWA 3KVJA 4MIMA 2CU0A 2A2IA 5DY3A 3E02A 1T8XA 3TFCA 1QR7A 3W2MA 1JVNA 3ANYA 4K8EA 1XUZA 4BI7A 1AK5A 2VFEA 1VH7A 4QISA 1SFJA 2J88A 2FPYA 3SGZA 3UNDA 4PL2A 2C13A 3E9AA 3NQ7A 4L4MA 4H4IA 5CSRA 5EA9A 3FYPA 3EWXA 3I65A 1UUMA 1PHQA 2E5BA 1P0KA 5KINA 4DPPA 3W1RA 3IV3A 4UNKA 2YYUA 1F5ZA 3TQVA 4FX8A 2EGZA 2X1UA 4LV9A 4E38A 1TPH1 4AF0A 1L6WA 1IXNA 1G4TA 4HT3A 1AL8A 5D38A 4UTTA 1OFQA 5CZTA 1FCUA 1YXCA 2WO5A 3GNNA 1OK6A 1A53A 1TTQA 1EX5A 2ZRWA 1OYAA 1GZGA 5AOUA 5C2XA 1TRIA 1OK4A 1FCQA 3ABSA 5D04C 3BG3A 5FEZA 4JIPA 1IF2A 2PRLA 2A85A 2DZSA 3TU9A 2WNZA 3W74A 4H3DA 4OBTA 5HUOA 2QR6A 4YCPA 3S0CA 2J27A 3P60A 2WJZA 1ME8A 3VE7A 5MHBA 4HPXA 2XN1A 4YWIA 2JGYA 4QIUA 4OE7A 3OVPA 4ADUA 4UC5A 3SI9A 1NVMA 2FB3A 1LCOA 4UFJA 2G95A 4OWGA 3UZ5A 2PURA 3UXAA 4YL2A 1OYCA 1L9WA 4EWND 2ZRUA 1W31A 3R8RA 4LWWA 4PFMA 4GWEA 2B4GA 3S8HA 4EIVA 1XKYA 4O0KA 1RQEA 4ZQNA 4O4VA 1KBIA 5KZDA 3CPRA 4RLIA 4FNQA 1G4SA 3TKFA 4B5NA 1W3TA 2GVLA 4C1KA 3W70A 2EHHA 4JYEA 2CWNA 4ICNA 5HUPA 1VLIA 4UTIA 2QCFA 1TSIA 1DL3A 4JIQA 3TA6A 5IBXA 1BKSA 2BSLA 3LTPA 4NX5A 2CLKA 2QUUA 2XN2A 4M7TA 1XM3A 1MEWA 2QJIA 2C6QA 2Q8LA 3S1VA 3LM7A 5LNVA 3IIPA 3K30A 1DORA 4CQ8A 1U5JA 3PB0A 4HSNA 1VR6A 2VC6A 3QH2A 4IMGA 1VCGA 1Z42A 4IQLA 3UD6A 1JRBA 5F2IA 3N73A 5AHNA 2E6DA 4CCCA 1EUAA 4JEQA 5DCBA 3L0KA 1RQHA 1Q6LA 2B7NA 5K9XA 5SWUA 1TV7A 4K36A 5F2LA 3W7IA 3GDMA 2YCEA 4LOCA 3HB9A 3FOKA 4R7JA 1ICSA 4O1CA 3OVRA 4LW7A 4HN4A 2V5BA 2FIQA 1YPFA 1PCKA 4FX7A 3SECA 3GDRA 1QDSA 4E2BA 2E1DA 4MZ8A 4TMBA 3IRDA 4N6EA 4PCFA 4A2RA 1H62A 3NQFA 3QRHA 3QMTA 2Q3OA 4JGDA 3C56A 3CQ0A 3MI6A 3WJYA 2QCEA 5F1VA 1OX6A 2JGQA 4IPJA 4O4WA 1SO4A 2Y7FA 2EF9A 1KV5A 3LXCA 4UFHA 3FEMA 3GB6A 3GX9A 3G22A 3BLEA 3KVKA 1XC4A 2FB2A 4OT7A 1KBJA 1SW3A 1S3HA 1XDMA 4K38A 2RH9A 3R13A 5K7JA 4MZ1A 1FWTA 3G1FA 1OF8A 3P5ZA 3DENA 3QPZA 4XKYA 3NYZA 4BI6A 1NSJA 3HGSA 1DBTA 1IXQA 3DAQA 1AW2A 4NJIA 1MXSA 3HJZA 1IXPA 5EKYA 1F2JA 1A5CA 2RDUA 5FF3A 2ZBTA 3TMLA 2YGYA 1UCWA 3RK8A 4CNNA 2CFFA 4K39A 2BXVA 3C3NA 2ZZ1A 4NJGA 5F4WA 4U4MA 1KFJA 3L21A 2VKZG 1FDYA 1MEHA 3CB8A 2JKEA 2Q8ZA 4UTMA 4UTTC 2A7PA 2Y7EA 1WX0A 1GTHA 3KVLA 2QDGA 1JCMP 5CKSA 4JYDA 4C1LA 5KZEA 4GUIA 3MHGA 1LORA 4ORMA 3ZFHA 3TIMA 4MKNA 4N2YA 1LOQA 3WK2A 1TRDA 1BWLA 3M47A 2O7QA 3HBLA 2PRMA 4UFKA 3NZRA 1WQ5A 4FX6M 5CPLA 1K3UA 3UPBA 3L5AA 4ZQMA 4ONVA 4Z0JA 1LTDA 2A21A 4MY8A 1QOPA 3QJAA 4AXKA 4NNCA 4CNPA 2V9DA 4IJBA 4Z1AA 3GR8A 3UWZA 6ALDA 1KTCA 3AO0A 3W6YA 2PCQA 4ZMGA 1ALDA 2HS8A 1ZALA 3DFNA 5HULA 4LS2A 5TIMA 1M7PA 1FDJA 1VZWA 3TW7A 4J9JA 3WK3A 1QPQA 1BEUA 4CQAA 1R2RA 1OYBA 5C55A 3GVGA 2ALDA 5LSMA 3G1AA 4O57A 3TAKA 2C15A 1EWEA 4RX0A 4Y6GA 3B0VC 8TIMA 1FUYA 1SW0A 4LVGA 3W84A 3BV4A 2TRSA 3C2VA 3TR2A 1YDVA 2QJHA 5K9DA 3C2RA 4O28A 3W2NA 4EOUA 1G7UA 3W83A 3VFLA 3GKFA 3UYCA 3LBCA 4S2CA 3W2UA 4ADTA 3GKAA 3V75A 2WOQA 2A1YA 3VI2A 3KFTA 2QCDA 1H51A 1EP1A 3MHFA 4MLRA 1FBAA 1R30A 1TPB1 4Z1BA 4RV8A 1R46A 3H53A 4UMAA 5BMWA 4P61A 3UY7A 3S1UA 4JXCA 3S5NA 1QCWA 2Z2UA 3NG3A 5ABTA 4WUIA 1DJNA 4JS3A 1K8YA 3T4CA 3W7DA 1W37A 3LCLA 2X30A 1MSSA 1WBJA 5TBOA 1TREA 3TX9A 1H50A 2V2CA 4AB4A 5HR6A 1TMHA 2BTMA 4PL1A 1EEPA 3L0GA 2BX7A 1FWRA 1CW2A 1H5YA 5HWMA 1XBXA 2E68A 1YXDA 5FF4A 4UMBA 3PBWA 1K7FA 1FCBA 1V5XA 1UBSA 2FPTA 4GBUA 4UIOA 3FKRA 1J4EA 4HIBA 4LRSA 3B8DA 1W5OA 2YR1A 3RF9A 4O13A 3QW4B 3TK7A 4UXDA 2RFGA 3LV6A 3MYPA 1QO2A 2JBMA 5AHLA 3TQKA 3GYEA 4NZJA 1PHWA 4HHPA 3PULA 2Z6JA 2P0OA 4XBKA 4JY9A 3MBDA 4O8RA 1R47A 3ABRA 3L0NA 3W7RA 1QPOA 1Y0EA 3GXPA 1N7KA 2VFHA 3H55A 4O19A 3W87A 3ABQA 2ZZ2A 2E77A 3HG5A 3TSMA 3S1XA 1YADA 3L67A 3MI2A 2R94A 2Y61A 3ZS4A 1LRQA 3HG4A 2CLOA 5AHIA 4UR7A 2QUTA 1A5AA 1S5WA 3IVSA 3WJXA 1GG1A 4UTWC 1R2SA 4FO4A 3P82A 4HNNA 3W88A 5FF7A 3LHZA 2NX1A 2C14A 3G18A 1VC4A 1GVFA 4M5PA 3PB2A 3NQDA 3P80A 3LTYA 4YXGA 3HQ1A 2Z0IA 2W6RA 2J24A
chains in the Genus database with same CATH superfamily
3CPUA 3W07A 2Y0FA 2PU1A 1FWGC 1TPDA 3EB3A 4B3ZA 4M19A 1KXHA 3PZQA 3UESA 4DO5A 3RILA 4JFTA 1P48A 3WDHA 4MDOA 4IL0A 3VIPA 2E6FA 4G1KA 4PTXA 2PTYA 1JCNA 4XVEA 2FFIA 3KL0A 4A3RA 3OHIA 2QIIA 4MNLA 3E0LA 4EF9A 4QS5A 1GYNA 4V1YA 2J9ZA 1EH9A 1S38A 3NO3A 3CLMA 4L9YA 3CBWA 3VFCA 4XAGA 5J5RA 3AALA 2FJKA 2PI6A 4P8UA 4LB3A 2WMKA 4AZHA 5HK4A 1U5HA 3ID7A 3HU7A 4B5SA 1BXBA 1G1YA 1Q2RA 3T08A 4UCGA 2ZCGA 3G1YA 3Q94A 1ZHAA 3U2OA 3BDKA 2WKJA 5LIUX 3OA3A 3CZJA 2PDXA 3KBSA 4PYSA 2BLEA 5CLWA 2ZUNA 4IL2A 3OG2A 3JUGA 1TVLA 3RHGA 2XJ7A 3CHEA 3SURA 2BV9A 2ZYFA 3TH6A 3VZZA 3SCSA 5I7GA 4ZOCA 2VZSA 4UWMA 4NG3A 4L7ZA 4BY3A 1M6JA 3QR0A 4LUTB 3PK7A 1J5SA 3MUZ1 4GZIA 3MHUA 1JJKA 1SO3A 3PPHA 3VXGA 1JCLA 3KHJA 2AMXA 4IX0A 3CIXA 3NQEA 3RCNA 3IUIA 4H6KA 4JFUA 5CPNA 2AAMA 4FLSA 1NAL1 4DAIA 4HNOA 2EPNA 3THQA 3B0UX 3VNYA 8CGTA 3TFXA 1SPQA 1UASA 2WWDA 3H2OA 3VE9A 4JNMA 2XISA 1PE1A 3B8VA 4BF5A 4AZCA 1L6YA 3ZVHB 1R5YA 3NL6A 3UWEA 3CAWA 1FWEC 1Z9AA 3O16A 1Q7ZA 3BAYA 3PSWA 8RUCA 4PUWA 1Y7VA 5AZ0A 2VVSA 3CHFA 4NZ5A 3WEZA 1BTCA 2NUYA 5CSSA 4Q6JA 4QLJA 2VXNA 3WQGA 2J78A 4MB4A 4GG9A 3TE9A 4DZHA 2DSWA 2AGTA 4LVAA 4JPGA 2ADAA 3DBPA 2TSYA 2DZWA 2VRKA 2R91A 4MYXA 3L9CA 1WBHA 1AW1A 1Q8AA 3CH9A 1C90A 1XH0A 3N2CA 1NQKA 3W02A 2C79A 1MW3A 3CL6A 4FR1A 5AKQA 4IOTA 5E6YA 5DCDA 1Q6EA 1ONEA 4CQBA 1Y65A 3I7RA 5KTLA 3IGUA 1A5LC 3CZLA 3W37A 4DB7A 5KEZA 4TX9A 5T26A 3LCGA 4KEVA 2ZOXA 2J7HA 1PIFA 4K7VA 2QF8A 1V6VA 3NPWA 4BK9A 3CGTA 2E1WA 3C6CA 2OMAA 3EB4A 4OU1A 3EWZA 3FS2A 2WLZA 4UFIA 1I1XA 4KS0A 4JQ3A 4JD4A 5ECVA 3SADA 2WHJA 3N6JA 3SRKA 1LOLA 3N2XA 4LU0A 4Q4KA 5K3VA 3W1PA 1OFOA 1HVXA 4M6UA 1VCFA 2B7QA 3ABOA 4MNMA 5G2HA 2NZLA 3IK2A 4Q8VA 4JN7A 1VFHA 2OGYA 1AQHA 4YHGA 4NX0A 3WLJA 2EG6A 3ATYA 2YYTA 1GGOA 1IEVA 3FAXA 7TIMA 1L8NA 3U0HA 1EF3A 1HX0A 1RJQA 1BD0A 1VFOA 5HXMA 1PKLA 2QAPA 4I8DA 3VAVA 4Z0SA 4ZE4A 2HXTA 4K37A 1PTGA 3C86A 1TWSA 3PZOA 1S5MA 3VINA 4XO7A 5HNNA 4XTDA 3CHCA 4ZODA 4X22A 1AZ2A 3L68A 4IGHA 2GSHA 4JIHA 3LZ5A 3UETA 3UG3A 2GPTA 1OG6A 3EXTA 1JDCA 3CMFA 3KZSA 4CD7A 2ACUA 3TV8A 2WJEA 2E6YA 4XUYA 1Z32X 3TONA 4B2DA 4PRTA 4WSKA 1XI3A 2VRQA 1YMYA 3G0SA 3EX4A 4O17A 5B7YA 2A7NA 1RR2A 3UJEA 3GFXA 3S9YA 4QR6A 1HTIA 3F4CA 4QJ1A 2PCEA 3HG3A 4Y9PA 1CGWA 5BRPA 3N4AA 1MWOA 4GCAA 4RE0A 2C16A 3NYDA 3NPXA 5H91A 1K4GA 4GXMA 3MJMA 3GVWA 4PEKA 3FLUA 2X42A 1KXVA 2A3EA 2GJLA 1GK8A 3LCWA 3P0XA 2W61A 2DT0A 2QT3A 3DUGA 2G8ZA 3O07A 5LA1A 2C0HA 4IPNB 4PTVA 3JR2A 6REQA 2V5DA 2ZUWA 1I45A 2OQHA 4C5YA 3BARA 2WC3A 2QV4A 1E5NA 3DC0A 1G4EA 4DJFC 3PWGA 2NQ5A 3G8EA 2NQJA 4DY1A 1VEOA 4I9AA 2DT3A 4U31A 3RPDA 4DXVA 2OYMA 4KWUA 1IIHA 2WB5A 3G1DA 2QCGA 4JZ5A 1E0TA 3TTYA 1DHPA 1YHTA 1ZL1A 3QYSA 1V6YA 3V18A 3IRSA 3ZOAA 1TPUA 4OVXA 4A3YA 1J0KA 2CBVA 1PL9A 2W27A 4B9YA 1B0IA 1E15A 1S3TC 1UP2A 2G3NA 4DN1A 4F0MA 4F2BA 2HDJA 1PSCA 3R8HA 5D9PA 4KCTA 3GXMA 1RPXA 1FWBC 3A4XA 2E8YA 4TOQA 1IHIA 2SFPA 4A3HA 3URBA 1G4PA 2AQWA 1LF1A 4YMZA 3P62A 4V1XA 3UA3A 1XLEA 3DHDA 4ICCX 4IQEA 3W1LA 4LT9A 3A3HA 3Q65A 4ZL1A 2BVTA 3W7HA 5FACA 1JCXA 1BF2A 1UA7A 4W8LA 3M5VA 5I03A 3HA1A 4HOXA 4WY0F 4ZE5A 4GABA 1CI1A 1HG3A 3QPEA 3NZGA 4MVAA 2OQLA 1ONWA 3VNJA 5LNUA 4JDBA 1R2TA 4J1OA 5A69A 3MVTA 4MAVA 2V69A 3LBMA 1KFKA 4L61A 2IPGA 3W2KA 5A8GA 3TJ4A 1J8VA 1V02E 1V6WA 1Z41A 4QAWA 1VHNA 3WF4A 1F07A 2FDSA 2NSXA 1SFLA 1Z69A 4GX8A 1HKWA 4G7EB 4MAZA 4PMVA 1XJBA 4K7YA 1X1OA 3BGJA 4IXHA 4N4QA 1CGYA 3M07A 4L9XA 1PV8A 2F6XA 2GUUA 3P5YA 7REQA 4PMUA 3C61A 4QX4A 4FK9A 5CPOA 2NQLA 2CITA 3WQCA 3PUEA 4B92A 1XLDA 4HJFA 3S2CA 1NP2A 1I2NA 3IIOA 1RAKA 1GNXA 2CLLA 5T9CE 4JL2A 1RCXB 1NF0A 4WCJA 1QNVA 2QCHA 1MW0A 5BXPA 4L4OA 4MHBA 2XZ9A 3SRFA 2WVVB 3TUUA 5E9AA 3W71A 4BF9A 3KL3A 4LAUA 5JBDA 2H90A 3CTLA 3S3GA 1A5NC 4H04A 4I6KA 1H61A 1EPXA 4L4LA 1NDWA 1CECA 3WDPP 5CG7A 2FGLA 5CGQA 4NZFA 3WO8A 3JZUA 3N14A 2IS7A 2WV8A 2RJHA 3REQB 5D9NA 1Y5XA 4I6VA 5DMNA 4A6GA 5KMYA 1ITCA 3BJFA 2GQ3A 3H7VA 3WNLA 5E0CA 1ITXA 1KM1A 2DZVA 3OQ8A 1R87A 4KKXA 2IQDA 1GVIA 3B8WA 1O94A 3W1AA 3HF3A 3UFYA 3CQIA 2DEPA 3CUXA 5E70A 4DUXA 1Q4WA 3GVQA 4FOKA 1PYMA 2GK1A 2V0TA 2I1OA 4QSHA 1PDYA 5REQA 1VP5A 3PZGA 4RKAA 2CLIA 2DZXA 3HGJA 3VDCA 1XRVA 1BYCA 2YX0A 3UG4A 4WY0A 3KW3A 1XCXA 2CHOA 2BASA 5C7HA 4TUFA 2XN0A 4CLMA 5C9WA 4US5A 4AZIA 4FIQA 3W7KA 3ARXA 4CUCA 3BVJA 2C1IA 4J2PA 3GTHA 3FJ4A 4G7FA 3U4AA 3MCMA 1J01A 2ZVRA 5HAOA 4O52A 4PCPA 2PTZA 4HNTA 5IFPA 2Q01A 3O1NA 3OLIA 3SUUA 1MUCA 4NQ1A 4LGXA 3DG7A 1D3HA 2XUCA 3QC0A 3KP0A 3TW9A 4GFIA 3T0AA 4AIOA 4POCA 1GOKA 4WD0A 2VEPA 3K8KA 4U5IA 1I1WA 1KBKA 4IIFA 1JI1A 4J3VA 2ZDRA 2WC7A 4YTUA 2Z26A 2PLKA 1WUEA 4LYKA 1ZSXA 3FAWA 4AW7A 3KRUA 2VFFA 5CC3A 1DQWA 1R8LA 3E74A 3ARWA 1A5BA 5CGMA 1T41A 3LCXA 4UCFA 2PS2A 1H1ZA 3LY0A 1LQ2A 4OUIA 4FLRA 1G5AA 4HK6A 4QEEA 2G96A 5AC7A 2TODA 2C18A 2XVNA 3BGGA 3A47A 1WOAA 2QUNA 3PBUA 3VOJA 4XZHA 1AW5A 5C0QA 2BZNA 2ALRA 1FOBA 1VLWA 3P84A 1E1CB 1LM1A 2P88A 2EAWA 4HOZA 2YSWA 5AVHA 4WJXA 3KLLA 1GOXA 1Q7MA 1UROA 4QTGA 3EZ4A 3EKZA 2ICSA 3WDQA 3TN5A 4PODA 1TB3A 4DBEA 2FQIA 4FNRA 1JPDX 1QAPA 4AIUA 4M6VA 1TJ1A 1C3FA 4IICA 4GVFA 3M5YA 2OT0A 2Y7DA 1HJQA 2FTYA 4LS0A 3WQDA 1HKIA 3GE7A 4FB7A 3H12A 3F7JA 3C0JA 3K1DA 2B7OA 1LBMA 1Z8AA 4L1GA 2NUXA 1DIKA 1XBYA 3W1TA 2POZA 2VZOA 2RUSA 1R3YA 1GPWA 4AWEA 2C19A 1GYLA 3QW3A 5LHFA 3FVDA 1R3QA 3BXWA 3JW7A 3LDVA 4JX4A 1KQYA 1W5PA 4S23A 4WOZA 3WUFA 2PTWA 1ESWA 4AY7A 1P6BA 3EGJA 4J40A 1Z3NA 1KM4A 2BY1A 3MC5A 3DN5A 1J10A 4KGLA 3DHFA 4L56A 4KBXA 2ZX9A 4R5EA 1FWSA 4IPIA 2JE8A 5AC6A 2CCRA 4KF1A 4O1DA 3O06A 4I90A 4KT2A 2J6XA 5IM51 2X40A 3WJZA 4DJDA 1H49A 3W24A 3E2RA 1ZAIA 5C6MA 5K4ZA 2J75A 3LS9A 4GUFA 1QOXA 2ZA3A 1C29A 3WDJA 1TJRA 2PGRA 3MKVA 4UTWA 2EBNA 1UKOA 3C2FA 2X0HA 3CASA 4NAEA 3V0TA 3ZWTA 4LBUA 4XWUA 2WVUA 4D71A 3IJIA 1A5OC 3LCIA 1AUSL 1UR4A 4JN6A 1GT8A 4KFNA 1UWTA 1SU5A 1H7PA 1ZJIA 1I2RA 3SGUA 1J0JA 1OFBA 2CXEA 4GHRA 2ZC8A 3AFBA 3SFKA 2JK2A 4C7DA 4QS6A 3D0CA 4B5TA 3LYEA 3B03A 5JVLA 2GOUA 4JTFA 3UR5A 1DWAM 3M9YA 3ARTA 1FA2A 1QNRA 2VENA 1JF5A 3EDEA 1JQVA 3URNA 3W29A 1GORA 1E9IA 3UU0A 1M03A 3C8FA 1DWFM 1SUXA 4ICMA 3QOMA 4KW2A 2B81A 2TYSA 2PODA 4J4KA 4IUOA 3EPNA 1BGAA 3G3DA 4LCQA 3W1MA 2PZNA 5IXEA 1RBLA 3OLDA 4E5TA 4KWOA 1LWIA 3LUTA 1OX4A 3F5JA 3EAUA 3P3BA 4IMFA 1YIXA 2XIJA 3XINA 3WG6A 2GSJA 4PTNA 4A05A 2BS9A 4V15A 2PAJA 3WH8A 3WX7A 4PMQA 1D3GA 4DO6A 2A4AA 3UGRA 1GQLA 2Q71A 1OC5A 4LPCA 3M7WA 2W91A 1XGZA 4OZOA 3BAKA 3CXOA 3UZWA 3MV11 1XRFA 5AB3A 1QWGA 3NAVA 1FY6A 3CO4A 2PA6A 3B0PA 1FH9A 3R58A 1OC7A 1A4MA 4D2JA 2CETA 3U5UA 1K9DA 3CZKA 5C2GA 1RCQA 3KM8A 1PEZA 4O1AA 4TV5A 4O14A 4W84A 4GUJA 3LMZA 2ESCA 2BGQA 3W82A 4IISA 1UIPA 4AD2A 3PTDA 3WBAA 4W93A 3IIZA 5FEPA 3N2OA 3WSUA 4QHRA 1LBFA 2BOFX 1W1A1 3P14A 3W27A 1EHNA 3CWNA 4PRWA 4N6FA 1GKRA 2QDHA 3VABA 3S2LA 2ZTJA 3O6DA 5H2ZA 3EKLA 4M6QA 4OV9A 3MBFA 3S5ZA 3S6OA 5LYRA 1Z44A 2PMQA 4F79A 2AOSA 1TG7A 1N55A 1HL8A 2E8ZA 1U1UA 1AQ0A 5JBEA 3KP1A 1QK0A 2HK1A 2WNQA 4ZQPA 3RX2A 1E51A 5E93A 1IT0A 1S5TA 5HWJA 4JFVA 4CGTA 4CVUA 1ZUAX 3PBYA 3NA8A 1EIBA 1WV2A 3VK5A 1CZ1A 3BICA 1AG1O 1E0VA 4C65A 4ZENA 1VEPA 4D6EA 1ZY9A 4RE4A 1S2WA 4OOUA 1I2QA 4HGXA 3L7RA 3N1AA 5DBTA 4PFHA 1C8VA 2CLMA 2GGEA 4I8YA 3ZO9A 5MKGA 3GW0A 4ES4A 2NVDA 3CPGA 3SUTA 1JFXA 1X98A 1TZ7A 3R2GA 2E4TA 4PUJA 4INFA 1V7YA 2X41A 1UWSA 3GH4A 2BBFA 5I79A 3CM4A 1YX1A 3W7CA 4U10A 1YTKA 2BY2A 3T44A 1UZ4A 3RIKA 3R1ZA 4TTGA 1ZFJA 1KBLA 2PD5A 3GSMA 4PGLA 3WQVA 3W26A 3TW6A 5JQ9A 4KIRA 2NXIA 4MYAA 2WLYA 2X1IA 2WJFA 2A2IA 3WL1A 4HYRA 3E02A 2VC9A 1SMAA 1QW9A 3B8UA 4XX6A 3MUAA 3W2MA 3GU2A 4AQLA 5LA0A 4K8EA 1DP0A 1AK5A 1R7OA 2VFEA 2VR2A 2FPYA 3AIVA 2ASHA 4PL2A 4S3JA 3CT2A 4IT1A 5EA9A 4GYKA 3EWXA 4H9XA 1EZWA 1FWIC 1PZ2A 4UQEA 3W1RA 1D7FA 4UNKA 1RXOB 3TQVA 4FX8A 4AF0A 1L6WA 1UKSA 1A3XA 4HT3A 4C1NA 1AL8A 3FY1A 1ISYA 1KQZA 3LMYA 5CZTA 3MPGA 4GO9A 1OK6A 1TTQA 3GTFA 4Q8UA 4AU0A 1J6PA 1IWAA 1ZJHA 1Q5MA 2KAUC 1REQB 4XZNX 3MANA 5D04C 1JZ2A 3CUIA 3BG3A 2WMJA 4R85A 1R3VA 3GQYA 4PULA 1H2JA 2A85A 4OBTA 4URIA 1XFCA 2GJXA 3WQWA 2QR6A 4DVOA 4YCPA 2J27A 3VE7A 1JDEA 4YS1A 4YWIA 2JGYA 4OE7A 3D46A 3OA5A 4CN1A 1HP4A 1V6TA 2P8BA 2FB3A 4UFJA 2G95A 3UZ5A 3UXAA 5BWAA 1MDRA 3TYAA 3OIHA 1L9WA 3DDMA 3UJRA 2ZRUA 3RMEA 1BYBA 4GD0A 4GWEA 3S8HA 2I16A 2YLAA 1XKYA 4O0KA 4ZQNA 2PDFA 3AMKA 1KGWA 4AZCB 2Z2AA 4D6HA 3HFYA 3TKFA 4B5NA 3FJNA 2FZNA 4D9PA 3BSHA 3H7UA 2GVLA 3QR3A 5A6LA 2CWNA 5HUPA 2QCFA 4JEJA 1DL3A 5JU6A 5IBXA 3WDIA 4Z2IA 7TAAA 4W89A 4KCUA 2CLKA 2XN2A 4HYWA 1MEWA 1E3XA 2QJIA 2C6QA 1XLCA 1IQ8A 4FZIA 5LNVA 3H2AA 2XFYA 5A6AA 4CQ8A 3PB0A 4X0VA 2VC6A 3CZ8A 4B5VA 4F2UA 1Z42A 1J18A 1BFNA 5AHNA 2VQTA 4RDVA 1E6XM 1E0WA 4B4FA 1RQHA 2E0PA 3GG7A 1FP8A 1LJYA 1TV7A 3GDMA 4R7JA 3E0VA 3ARUA 4LW7A 2G37A 1YPFA 1GPFA 4JN8A 3SECA 1Q6DA 3GDRA 1QDSA 4E2BA 5I5RA 1JZ3A 2ZC1A 4TMBA 3IRDA 4PCFA 1DTNA 3NQFA 4EE9A 3M46A 3WJYA 1XYAA 2EJAA 3E38A 1WKDA 2YDRA 4M0XA 4YVPA 2EF9A 2ZUTA 3LXCA 1UD4A 3FEMA 4I9JA 1L2QA 3BLEA 1AA1B 1E9LA 1ZP3A 2Z1XA 3EOOA 4H9UA 4C6BA 1EGMA 1RP8A 1ADSA 1JZ8A 3V5OA 4XKYA 3QPZA 3HGSA 4JIEA 4H9YA 1KCXA 5CZKA 2BHUA 1KR0A 4EXAA 1ZB5A 2YOCA 5EKYA 1S39A 4W86A 2OPJA 3G6MA 3V5CA 3WLTA 3CV1A 4XSMA 1KC7A 1PX4A 3CB8A 4GOAA 4ZB0A 2JKEA 4WLCA 4B4HA 3KLKA 3KVLA 3R94A 2C1GA 3ES8A 2QDGA 4NSBA 3MHGA 1LORA 3ZFHA 2CEQA 2JEPA 3TYUA 3URAA 4N2YA 1C8YA 3CNYA 4P7OA 1BWLA 3MO4A 2O7QA 3BJTA 3HBLA 2PRMA 2YCJA 5TD4A 3NZRA 3TLQA 1K3UA 3UPBA 2XVKA 3RCMA 2GSEA 4ONVA 2I5IA 2WZEA 1RA0A 3F4VA 5AC4A 3GTIA 4IFRA 4NNCA 2QXWA 3ONBA 2DT1A 1ECEA 5I07A 2QLYA 3GR8A 4LH8A 6ALDA 3AO0A 4AVOA 5D9OA 4YHEA 3DFNA 4P7RA 2QIWA 1M7PA 1FDJA 1QI0A 3SAZA 4KESA 4PBGA 4YYFA 4PMXA 3ARYA 4H1ZA 3RX4A 2HNEA 4PCNA 1RY8A 2ZUMA 1WO2A 2C15A 1EWEA 1BPLB 3ZR6A 3B0VC 1SW0A 3W84A 2TRSA 1XLGA 3FXGA 3N4FA 4O28A 2QGYA 3W83A 3VFLA 3GKFA 3UYCA 3LBCA 4L65A 3W6MA 5C9ZA 2WOQA 2A1YA 4Y8EA 3GC4A 2E9MA 3WH9A 4MLRA 1FBAA 4Z1BA 4UMAA 3H53A 5DO8A 3IAPA 3T1GA 4WKFA 4P61A 3NZPA 2PLMA 3UY7A 4XAYA 2OXNA 3PJUA 2OWCA 1DTUA 2DW6A 3CV6A 3A4AA 4H9TA 3N29A 2WW5A 4QG8A 3R0KA 2F6UA 1W37A 1EYEA 1WBJA 5TBOA 1TREA 5G4HC 2OKOA 4AB4A 4HD5A 2WPGA 4MJ2A 3QKEA 4H9VA 1CW2A 5HWMA 1JZ7A 1VBJA 1XBXA 3WNPA 3RDKA 5H8PA 4GPNA 3SCQA 4GQQA 1IWBA 3M4HA 3PBWA 2W66A 1E4MM 4ZO7A 1K7FA 1V5XA 2FPTA 4GBUA 4UQAA 1J4EA 5I23A 4DI9A 5M2FX 1AH4A 5F7UA 4JHMA 2OGJA 1QO2A 2ZIDA 1VAHA 4J27A 3GYEA 4TVCA 4B5UA 3KDOA 4H9ZA 2AKZA 1BRLB 3ABRA 3MZNA 1BVZA 1QPOA 5EB8A 4HMEA 1MZRA 5HJXA 2VFHA 3SN4A 2NV9A 2DT2A 3WY1A 3DG3A 3TSMA 3S1XA 3L4TA 4F40A 2R94A 1S46A 1UYQA 4CD5A 1KGUA 2DZAA 1LRQA 4GXPA 4J3WA 5AHIA 2P50A 2QUTA 3NSNA 4DBWA 1A5AA 1OZQA 3WJXA 4K1WA 3CWHA 4HHHA 1FHLA 3VMOA 2A3AA 3MCNA 1B30A 4XVDA 3LNPA 4RUBA 2PSNA 4M5PA 3NQDA 4Z1YA 3TR9A 3P80A 2W67A 2WMGA 1NOWA 2DVTA 4YXGA 1DJZA 4EWJA 1NOFA 1SFTA 3HQ1A 3E3HA 4B3KA 3T0TA 3BMWA 2W6RA 4D8ZA 1EOKA 5LNRA 3GIYA 3TYDA 1ME7A 5I3FA 1TE1A 3ABXA 3RMJA 2FLIA 3WBXA 3OBAA 4JCMA 3DZ1A 4O18A 3I6EA 3OG3A 4GQ0A 5FEXA 1E9YB 2CHNA 2NWSA 4UOZA 1IR2A 4Q4SA 1ZQ5A 3RUBL 3ABZA 1XYFA 7REQB 4IIEA 3RLHA 2PBGA 3UNTA 4D6DA 3BJSA 1P6CA 2P10A 3OB8A 1QPRA 5GVJA 2ONEA 4RXFA 1QTWA 4K3ZA 2FVLA 3MSRA 2XU2A 1X39A 2D20A 5CPSA 3MMWA 2I17A 1XWYA 4LEQA 2FJUB 3V0UA 1OG0A 6ENLA 5CPQA 4FA3A 1V6UA 3CYVA 6XIAA 1GOIA 5ECUA 4ATDA 2ACSA 1ISZA 4X2PA 3SM0A 2XPKA 5A6BA 1T99A 1CTNA 1O95A 1EUNA 4LF2A 4NJJA 4F9DA 1QI5A 3IGHX 5HBFA 3BSMA 3E6EA 4LAKA 3NCOA 4S3DA 2NX9A 4C6FA 4C7FA 3N04A 1HGYA 3BW2A 3I68A 3EDKA 3QV7A 5I06A 3TCEA 4QQ3A 4LUYA 3CZEA 1KB3A 3HV9A 1QHZA 4Q8QA 5AFDA 2F7FA 4XG1A 4ZFMA 1U2YA 4RR4A 1POKA 3HPXA 5A2BA 2CXGA 2LLEA 3WENA 3PR2A 2GK1B 4RZ4A 5REQB 5I77A 2E28A 1NU5A 4UQBA 4UBPC 3NR0A 1S2CA 4DELA 2V8ZA 2GLKA 3N9KA 4WY0B 3NQMA 3UJFA 1GVRA 3YPIA 3E2SA 1G67A 1WDRA 2VX7A 1W1B1 1B57A 2XH7A 4PMNA 1VBUA 2ABAA 3ATZA 2QCMA 3VGEA 1BTMA 4XBSA 3LGEA 4S3AA 4XAPA 3G3MA 5G4EA 1UP3A 4G6CA 4MY1A 3WNNA 4Q4QA 1EC8A 4Y9AA 3RRXA 3PUGA 1TV4A 2OO0A 4AWSA 2UWFA 4J3XA 4PCTA 4M81A 2OJPA 4MWAE 3AXKA 2Y6ZA 3FW6A 2QPSA 4P8XA 3WD4A 1FHVA 2G50A 5D02A 1XBZA 2FHBA 4H6QA 3E12A 4XIAA 3ZR5A 4BFAA 3PTKA 4UQCA 3AZRA 4Z1DA 2V30A 3W22A 3GDTA 2OZ0A 3K2GA 1WZLA 3M7SA 4MUZA 3VPLA 3L65A 3C52A 3GRIA 1D9EA 3B9OA 2WSKA 2XZ7A 3SO7A 4GVHA 3SCWA 3UCCA 3VD5A 3IGXA 1UR0A 3GIPA 5A8MA 2W63A 3BO9A 4GUHA 3EA2A 4FNUA 4DWSA 4K6AA 2DORA 4ZXOA 4TU1A 5TQLA 3EX1A 3DGRA 5C5YA 1OB0A 3NM1A 3OIXA 4MPQA 3T40A 1KBBA 1TWZA 4RE3A 1UUOA 3WNOA 1I2PA 3FFSA 1Z6KA 3AXIA 1JCJA 4DAFA 2BGNE 2W0UA 4YIWA 5PTDA 5HPCA 3BW4A 3QPYA 3B0XA 2YJQA 4KMQA 1BSIA 2VUYA 3B05A 3AMDA 4E8CA 3RNDA 3KUMA 3EB2A 3UR2A 3RYSA 4L1XA 3IIXA 1EQCA 4MNKA 3UWWA 3PAJA 2J7GA 1XIJA 4GFSA 1V7AA 3EXRA 4OTKA 2TAAA 2WNWA 4A29A 2OOGA 4DXXA 4H9MA 3LHTA 3GFYA 3OU8A 1DXIA 1GCYA 2DJLA 1RSCA 2DIKA 2PGFA 1GWJA 3W2LA 5D30A 3WBEA 1WA3A 2I5GA 4C6CA 4MWAB 2R8WA 1MNSA 2OYKA 3WYZA 1VYPX 3EX2A 4AYSA 2JKPA 2DZUA 1FTXA 4QFUA 3CQHA 4PSPA 3CEPA 3PZNA 3N2MA 4G9PA 3NTYA 3IIVA 2BOGX 1BWVA 5M03A 3VOIA 4EVZA 1K6WA 2Z2BA 1IEXA 4R3UA 4RV3A 5BMXA 4QDWA 1OY0A 2ANUA 3F1QA 3SR7A 2BG5A 1X38A 4WJEA 3WQ6A 3W75A 4ZOAA 3SB0A 3SGGA 1Q6FA 1NDVA 2J7EA 1YDYA 3PVFA 2VZTA 2C91A 4RZ5A 4KRUA 1RVKA 2V5KA 3NXFA 3RLUA 1J0ZA 4EXBA 5HWNA 2DFAA 2NQZA 1XSIA 4IGSA 4ROQA 2PBOA 1KXTA 2Y5SA 3OODA 3VA8A 3PANA 3M6YA 3THAA 3PJTA 3OEXA 3TXVA 3PUOA 3MP3A 2P0IA 4PMZA 2ZRVA 2BWGA 2V5CA 4MSSA 4AC7C 2ATSA 3WDRA 3G0XA 1JNDA 2D0HA 4M51A 1CXHA 3AS2A 1OGGA 3WMLA 3VUSA 1NIUA 5CAKA 2J77A 1L6GA 1XYBA 4WEVX 4K8GA 4XKMA 1R3WA 3UZZA 4E3TA 2DP3A 2QMKA 5RUBA 3NFUA 3FGCA 4CU6A 1X96A 4MWAC 4GQBA 2WZHA 1RD5A 4XZBA 2VM8A 1JYVA 4QNWA 1FCVA 3UXKA 3RX3A 4JTRA 3VOCA 1M68A 2DH3A 4V27A 3S2MA 3B9NA 1BXCA 3CQKA 3AXMA 2GJPA 2VURA 1XIMA 5CZJA 3BZGA 3LB0A 1Q45A 3NGFA 5FCZA 1UQZA 4UOJA 5BRQA 3WBWA 1ZU8A 1KM0A 5HDRA 1PXGA 3KWSA 2DW7A 1EB3A 3SW6A 3RXZA 4XZWA 3EDFA 3WJSA 4GO8A 4M82A 5C9RA 3HOJA 2XM1A 3MU7A 5GPRA 5CC7A 1VF8A 4Q22A 5LIKX 3THCA 1WCGA 1A5MC 4CNSA 1EJRC 1OD8A 1IV8A 5K4XA 1FQ0A 4ZGYA 1F3TA 1OX4B 5AYBA 2X1SA 1E6RA 2G3IA 1JULA 3WCZA 3WEMA 4B9ZA 2PLCA 5AYYA 3EBVA 3WLIA 3LQLA 4OBSA 5LHEA 2W3ZA 3RITA 5I3IA 2NT0A 4LY8A 1S5NA 2QAFA 1NM9A 1QO5A 3POCA 4YJ5A 4HZ6A 1RV8A 1CGUA 1CXLA 2E6AA 2VGBA 4IIGA 3APYA 3H2CA 4CQDA 2EPOA 3H8AA 2EG7A 3P93A 5T8GA 3LTSA 4KRZA 4N9CA 4JTQA 4NASA 2ZE0A 3MO7A 4JHOA 3W7NA 3K4AA 2CBUA 2WKGA 1YE6A 4A8RA 3QTGA 3N18A 3QFEA 1YBQA 1JIBA 2XM2A 4GY0A 3PTQA 2H8XA 1NY1A 4HNVA 3C3UA 1KTBA 5BOFA 4HNLA 3GFZA 3Q58A 5I0DA 3S4TA 4H00A 4GY7A 3BMXA 4Y96A 3U6WA 3BAXA 4PB3A 3M0MA 4MF4A 4R27A 3DX5A 2CLFA 1LOSA 2I57A 4ZSTA 5LKYA 4NVTA 2PE4A 4ZQCA 4I7VA 4ZTYA 1UD6A 5CPMA 2A0NA 2EPHA 2DV0A 5H8MA 2DUAA 1Y8BA 4P2VA 4AWUA 3MMTA 3S42A 2JF6A 1HKMA 1NF7A 2ZTKA 1NEYA 1ADOA 3HPFA 4IM4A 4C6OA 3VNMA 5C70A 4E8GA 4QNEA 1YW1A 4WKAA 4JQ1A 4GY1A 2IQTA 5CC6A 3TA9A 3W7PA 1ZS2A 3P67A 4LUJA 1K8ZA 4E8DA 3UG5A 4UR8A 3UZJA 4FNTA 3BUVA 4RK8A 1BWKA 1EL3A 3SCOA 2WHMA 4YCOA 2UV8G 2PDIA 1V0LA 5AYIA 2ISWA 3U9IA 1BYAA 3BLDA 4JTTA 3VKDA 2Y8VA 2IPWA 3DFHA 3HO8A 1HGWA 3ZLFA 1C8QA 3G2GA 3VX0A 4NAFA 2PWUA 1BQGA 3KX6A 3CL8A 2VGGA 3FYOA 3UR8A 3VDGA 3B06A 4Y9NA 3VZYA 3KXQA 1XFBA 1CXKA 4IIDA 1XYZA 5A1AA 4IZGA 1GVSA 1KD0A 1LG2A 2BXYA 4K2SA 2QS8A 1B3VA 3AJXA 5DRCA 3L4ZA 3RLVA 1JXKA 1UWUA 5FSDC 3G0UA 2RAGA 3VIKA 4DX3A 3U7VA 1UR9A 3LI0A 3N6HA 2YIHA 4S38A 3DYOA 1ZZMA 4U3AA 3VD7A 1OIFA 2Z24A 3GU1A 3IPWA 4W7UA 1ADDA 1WKYA 3A22A 5M17A 3D5HA 1FDZA 3CWOX 2QDDA 3EWDA 5DRIA 4PTDA 1OFPA 1XGDA 2DIEA 5D37A 3GHRA 4GJ1A 1J9YA 3IUDA 3PG8A 1A5SA 2J9XA 2HRWA 2NQHA 1XSKA 3TDFA 4MPKA 1HNYA 1S2VA 4Q8PA 4OFCA 3ZT5A 4IQDA 5B80A 5CC5A 3LPGA 1E0UA 4MNJA 1QT1A 4A3UA 1LUCA 2VZVA 2D3LA 1G6CA 4GRSA 4GZ7A 1SR9A 3W0KA 3W3OA 4HU3A 4A8LA 2F2KA 3NJ3A 4KERA 1M7XA 5CSUA 2WJDA 3CUFA 2IPJA 4Q4OA 4HHMA 4YPJA 1E1FA 4A4AA 1JD7A 1TTJA 1EIXA 3NNTA 5K9CA 3DH7A 3ZR4A 5HMEA 4LALA 1DKWA 2DSUA 1Q65A 3NDOA 3MT1A 1ZTVA 4BZYA 5JMUA 3PZIA 1F6PA 2INZA 2VI0A 3PFRA 4R53A 1XC6A 3SY5A 4CNOA 3VCRA 2WQPA 2V2DA 1V79A 1WXJA 4MFEA 2HPIA 2V81A 5FAJA 4XD4A 5XIAA 1VRXA 5E6ZA 1P0EA 1JGMA 1DJGA 1ZJAA 4QJ5B 1A0CA 1GEHA 4ATLA 1OT2A 1TPC1 4R88A 4BWLA 3FKKA 5CPTA 1JZ5A 1K8XA 3HURA 3LOTA 5EL1A 4XIMA 5FA5A 2PGEA 3AS3A 3LERA 2GJXB 1DWHM 2YXOA 3FA4A 3AZTA 3L4UA 4JQ2A 3ZVIA 1IE7C 2IKIA 1OFDA 2CYGA 5DCEA 4Y90A 4UMCA 3ZJ8A 1ZGDA 4JOMA 3T09A 3VTRA 3DGBA 1JRCA 4NF7A 2VELA 1XBVA 1ZBCA 5A6KA 4MFDA 5E9XA 3T81A 4CD6A 3DG6A 5DELA 4RCXA 1TPWA 3S5YA 2DZTA 3O63A 4DO4A 1YTDA 3IK4A 3R43A 5DN1A 3ITVA 3VM5A 1GOQA 3DOPA 1V8EA 4HCHA 1VIWA 3OBEA 1OF6A 2ZWYA 5LNSA 3VILA 1RBOB 3LA4A 3B40A 4M6PA 3MQTA 1F9CA 4J3UA 3XISA 2V3DA 3THUA 2OR2A 2PDGA 3K4WA 2Y7GA 2PWVA 3H24A 3S6DA 4MG4A 2O9PA 5BOEA 2V68A 1LP6A 2C71A 3L5MA 4P8WA 3G1XA 3NXLA 4E4UA 3UBPC 4B91A 3AIEA 3ALGA 4AMCA 1WXZA 4GI4A 4UB9A 2YDSA 2ISFA 3L4YA 3PF3A 4H19A 2HE8A 2PZ0A 2GQAA 1XGEA 1PDZA 3LBOA 4P7NA 1MFUA 4NT0A 4E6MA 3VD9A 2IKJA 4C6KA 4DJEA 4LCSA 4LXFA 3ITGA 1O5KA 1UW9A 2WCGA 2QF7A 5G1YA 1RZMA 3P74A 3A23A 4PEEA 4GMEA 1M7JA 3I3EA 3NL5A 1FX6A 1TPVA 4YTQA 2ZXQA 5EMUA 1P5BA 1B9ZA 1TWDA 1XPGA 1YYAA 3NPUA 3VM7A 3O15A 5FF2A 4IG2B 3DFOA 4DYJA 4FS9A 2HROA 1V08A 1KM3A 5BU6A 3NIYA 3NZ1A 1LL7A 5FAGA 1T0OA 1GJPA 1BVNP 1FVPA 4XKYB 3STCA 4JY8A 1U5VA 4CEUC 3NSMA 4DBDA 1H7NA 1ZPTA 3VDAA 1T8QA 1TYGA 5I3KA 4GYJA 2HSAA 4HJWA 2D0FA 4NY2A 3H54A 1MFVA 2ISSA 2W62A 4DQWA 4GJJA 4FOUA 4IPPA 5LIXX 1KFEA 3QZEA 4Y2WA 2YPIA 4Q8TA 1E5JA 5LGXA 3RR4A 1CX9A 2QCNA 4TTUA 3QLLA 2ZFAA 3BCDA 4US5D 2QJMA 2WPBA 3U5YA 4M29A 3AUJA 2HQAA 1SGJA 4WOQA 4M80A 3WNMA 3MMUA 4S1FA 4BWLC 5C71A 3NQ2A 5AZ1A 4CCEA 2W4XA 4OV4A 3VIMA 5I78A 1X7FA 4PZVA 3MY9A 4J7RA 1CDGA 1TQXA 4DF0A 4W7VA 1KNWA 2YFNA 3DFTA 1HKJA 4WR3A 1PYFA 3A24A 1X8CA 1PS9A 1W5MA 2V63A 4L80A 2HVNA 4WX2A 1MZHA 2X0SA 3VNZA 2GUBA 3WIJA 3DESA 3DFQA 5DF0A 3I3DA 3TWAA 3KL5A 4IXXA 4FHAA 1EP2A 2P3ZA 4Q8MA 5BXSA 5FJTA 1JPHA 3VVGA 1SZGA 1S5VA 4IX2A 4WKHA 2BP1A 1Q6OA 4A8NA 3KOZA 3INPA 1TO3A 1JYNA 1ISVA 1TVPA 3GD6A 4LUSB 1XLJA 4C6NA 4EPEC 4YVXA 4G56A 1OSEA 1SJCA 3QVQA 3HPSA 3APGA 3BSGA 4H7CA 5DT7A 1PX3A 5IHSA 4DLFA 2XINA 3HIJA 3FA3A 1Q7QA 1NWTA 4F0KA 2NT1A 1XLLA 3BW3A 1QHPA 5DXXA 1KRMA 4IP4A 1H1NA 1I2OA 1T40A 3NDZA 4LUTA 3WZ0E 3TTQA 1J0HA 4X3ZA 1QWKA 3RN6A 5K2ZA 3Q45A 4LCRA 3D47A 2UBPC 4OIFA 1ECQA 9RUBA 3LXBA 1DIOA 2FYMA 3WJWA 4RNFA 1VIZA 3WD2A 1TCDA 4NZ1A 1ZBVA 2W79A 5G2IA 1YNPA 4D8LA 2A6NA 3P61A 4NI8A 3NUKA 3AC0A 1YQ2A 2PTXA 1RHCA 2XTKA 2G97A 4MWAD 3H2FA 1VCVA 3U3HA 2QJNA 2DY3A 4M24A 1NELA 4YLWA 2PUZA 9XIMA 4Z2HA 3U2EA 4FALA 2E40A 1FXPA 3V36A 2VX4A 3O0KA 1HL2A 4QAIA 1G94A 1XICA 7CGTA 2OVLA 4QSFA 4XAFA 1CLVA 1TZZA 3EX6A 1UR2A 3TSBA 3SCRA 3LCHA 4K1GA 2WWCA 1MO0A 4JTDA 4HCDA 2Z1BA 3NEVA 4AD3A 5H1WA 4ECLA 2DU2A 3CB3A 1NDYA 2ZX5A 3GTXA 4KFOA 1FH7A 1JFHA 2VOMA 4O54A 3E5PA 4FI4A 1OGSA 1AD1A 1E71M 5I3HA 1XG4A 4HK7A 3LRLA 4BQ3A 3O2LA 3KVJA 2HVOA 4MIMA 3ZQ9A 5DY3A 3VKBA 1T8XA 1I75A 3BURA 1S2AA 1EPVA 4H01A 4YVVA 1E9ZB 2XH2A 3NSXA 4BI7A 4QISA 4F4RA 2C13A 4Q7NA 4UR9A 1WDQA 1JEZA 4LAOA 2FHCA 2Y5JA 3FV9A 1QPKA 3AXXA 4DLMA 2E5BA 2HPMA 3SJNA 2XGZA 4LYPA 4DJDD 4DPPA 1GKQA 4MGGA 5FD0A 3IV3A 2GGIA 2YYUA 5A6SA 2FTWA 2O55A 1F5ZA 1TPH1 3TTEA 3ARPA 5D38A 4Z2KA 3ZXWA 1YXCA 1A53A 4KCWA 2Y4SA 3GNRA 4X61A 3AYTA 1V3IA 1FRBA 4C6LA 1F4AA 1FCQA 3ABSA 1UC5A 1VBGA 3GC2A 4JIPA 1IF2A 3TU9A 3W74A 4H3DA 1TELA 5HUOA 1KCLA 5JIPA 1H4PA 4GCXA 2D1ZA 1K8CA 2QW5A 4LB4A 4HNCA 2ZUUA 5MHBA 4HPXA 3ECQA 4QIUA 4ADUA 1HN1A 1HJXA 4DJFA 4ZB2A 1E6QM 3N6QA 1XH2A 3VO0A 3E2QA 3TTOA 2PURA 4YL2A 1OYCA 1W31A 5AECA 2ACRA 2PDJA 2B4GA 2J6VA 4EIVA 4I3GA 4NRSA 3FEQA 2MNRA 4LY4A 3VNKA 4EPBC 1ZJBA 4DWDA 1RQEA 4HMCA 4AIBA 1KBIA 5KZDA 2PP1A 1QI2A 3PJXA 1GQIA 2PDUA 1FKWA 4C1KA 3VU2A 1TMLA 3UT0A 5LIYX 2EHHA 4ICNA 1P43A 4IGNA 1XPYA 4W87A 1DEDA 4JIQA 3HZ3A 3CAVA 2XH0A 2AKMA 1VFMA 1XV8A 1HZYA 3AHVA 1EDQA 1JXJA 1XM3A 3DHUA 2QZRA 3S1VA 1QW8A 4P8VA 3KBMA 1DORA 4HSNA 3SN0A 1VR6A 1IWPA 1GHSA 2DUXA 3QR1A 3UXIA 3GUGA 3QBUA 2WZMA 4HA0A 3EYPA 1EUAA 4JEQA 3L0KA 2YL8A 1PKYA 5SWUA 4K36A 2YCEA 3FDKA 4F66A 4LOCA 4O1CA 3WKZA 2BVDA 2V5BA 3G6LA 1A47A 3H2EA 5A6JA 4X0NA 1RH9A 4FX7A 9CGTA 5DMYA 3VYLA 4AEFA 4MZ8A 4C6MA 4LAZA 4A2RA 2A3BA 1B3YA 3PJWA 4JGDA 3C56A 1BG4A 1C7TA 3RLGA 3BTNA 4IPJA 3IJ8A 4U5KA 2BFGA 2Y7FA 3F2DA 4AZGA 1HL9A 4UFHA 1KCKA 1XD0A 1UZDA 2XVGA 1XC4A 4OT7A 4S3BA 2YCKX 3AHTA 2HWGA 2PWGA 5CSYA 4DWSB 5K7JA 4MZ1A 3VIIA 3WFLA 4QROA 3P5ZA 2PB1A 1AW2A 2C8NA 4NJIA 3HJZA 1IXPA 1UD3A 1F2JA 3KRBA 3V5FA 4ML4A 2ZBTA 3RK8A 5I3DA 4K39A 1XHGA 4U4MA 3L21A 3KDNA 5CBIA 4IMAA 1UH3A 2Y2WA 2A7PA 2O92A 5CKSA 4C1LA 3R4IA 4GUIA 9XIAA 1RPKA 3NOYA 1SJBA 4UFKA 1EGVA 5HPOA 3BAJA 5CPLA 3F5LA 3GH5A 3L5AA 3AMGA 3GVVA 4YNGA 1NOUA 2O9TA 4MY8A 2GGJA 4IJBA 1JAEA 3BOXA 3R8GA 1ODUA 1W91A 3UWZA 1KTCA 5EMMA 4ZMGA 1CEOA 2HS8A 1ZALA 4S3KA 3MDUA 1GOOA 5TIMA 4J9JA 3TNBA 1BEUA 1R2RA 4CU8A 1X7IA 2ALDA 2CBJA 3ICJA 4W88A 5LSMA 2PC8A 3WF1A 2VNCA 3AHYA 4Y6GA 5CEWA 1UR8A 3GW3A 1XH1A 3C2VA 2QJHA 5K9DA 1W9BM 4Q4PA 4EOUA 1G7UA 2GDQA 4M1BA 3EEZA 4H8NA 4S2CA 3RM9A 1YKWA 3I3BA 4ADTA 4ZO6A 3V75A 4DYEA 3VI2A 2CBIA 3KFTA 2QCDA 1H51A 3C8NA 4AX7A 1LLOA 3VGGA 1R46A 1TA3A 3M0XA 1PWMA 1K70A 3S5NA 2Z2UA 5ABTA 1UC4A 1EO7A 4JS3A 1K8YA 1ISWA 3T4CA 4H7VA 2WVVA 3W81A 2VHLA 4PUKA 3TX9A 4Q8WA 1RUSA 1EEPA 2JIEA 3L0GA 3ZZ1A 2BX7A 4PRRA 4MMWA 3PPCA 4C7GA 3F5KA 2PGWA 4UMBA 2OYLA 2CKSA 4GH3A 2ZDSA 3WH7A 2X7VA 4HIBA 3KTXA 1W5OA 1X6NA 4W4QA 3GS6A 4UXDA 1E72M 2OZ3A 2RFGA 4PE8A 3LV6A 4L6OA 3S9IA 4YTTA 1R3SA 2PDCA 3PULA 2Z6JA 1BSLA 2P0OA 4XBKA 5KETA 3MBDA 1UPPA 3VMPA 3QV8A 3L0NA 3W25A 4XB3A 2WMIB 3FGCB 1N7KA 4MKVA 4O19A 1C8XA 2E77A 4LSBA 1W17A 3OP2A 4AYGA 1YADA 2DSZA 4TVDA 1EO5A 1EYWA 1V02A 3D6NA 3K8MA 3HG4A 2OOFA 4Q6XA 4UR7A 2XWEA 4DUWA 3VD4A 1VENA 1GG1A 4CNUA 3NO1A 1NTHA 3TYBA 2J62A 4FO4A 3AS0A 3BANA 3W88A 5FF7A 2NX1A 3CUZA 4C6JA 1VC4A 1GVFA 3EA3A 1V3LA 2F9RA 3PB2A 1JPIA 2Z7GA 3OGSA 3GBDA 1UHVA 3CLWA 3POHA 3QY6A 2V3EA 4Y8FA 1M04A 3QOKA 4HZ7A 2WMFA 3LLXA 2WSQA 1TMQA 1A4LA 1THFD 3PN8A 4NI3A 2Z00A 1UP0A 5D2YA 3I7QA 3UJSA 2V2HA 3BLFA 3GNOA 1WB0A 3S5SA 1DQUA 5I09A 1QRQA 1DE6A 1UOZA 4UTKA 1SO5A 4F9JA 3KAOA 1M9HA 1J79A 3I6TA 3L66A 3NO5A 4JTEA 4HQVA 3CK5A 1XKJA 1DWJM 2PDMA 4JR5A 4PA8A 4U2ZA 2BOEX 3R89A 3LHUA 4QITA 3OYXA 1DIDA 5CQ1A 3BAWA 3S1GA 5A8QA 3G8RA 3HJEA 2NWRA 3G24A 4WDTA 5HNRA 1H60A 4G5DA 4AISA 3O6CA 5C9UA 2YCIX 1VD6A 2RDWA 1KWGA 3N9RA 3B8TA 1Z48A 3H21A 3A12A 4B15A 1VJZA 2ZVIA 4QM1A 1ME9A 2XVLA 1SVDA 1XCFA 1EA0A 1XIHA 4D6GA 1B4EA 1LL6A 3VIOA 1O7AA 4P7LA 1UWAA 2HVMA 2WMHA 3GNDA 1OFEA 3ZLGA 3IEBA 2FZ8A 4H6RA 3UW6A 2VEMA 2R1PA 3F2CA 1R38A 3COTA 1FKXA 2OTDA 5HINA 3TAOA 1UJQA 2J79A 1H7RA 3N13A 1BKHA 2D0GA 3BCFA 1UH4A 2F84A 2V38A 4KCVA 2ODOA 1L0PA 3FHQA 4FR6A 5G4WA 2IKGA 2VL4A 3BC9A 1KCZA 3H26A 3W72A 1OCBA 4ZO8A 1FFQA 2GOKA 3BK0A 4MJZA 1E1CA 3E0IA 1XQLA 4YTSA 1C7SA 3T78A 1ZCCA 3RCYA 4GUGA 3H2MA 8A3HA 5CLTA 1UD2A 3DKLA 3LSCA 4E0CA 1K9EA 3BV7A 1H0IA 1PIIA 1L6SA 1S1RA 3T7VA 3AIBA 1MUMA 1W9VA 3O9NA 3C2YA 4ZBCA 4TX6A 2Z27A 1H63A 3A64A 1W2PA 2ISDA 5IDIA 5KZMA 4XD3A 3SUSA 2GQ9A 4P7QA 1B3OA 2R1LA 4GZJA 2ZE3A 5HR7A 1XINA 2ZUSA 2R24A 4Z08A 4GI6A 1CENA 1YDOA 1J11A 2FDMA 2V67A 1QFEA 1EP3A 3EWUA 4LFYA 1AZ1A 2H9AB 1W1VA 2VFDA 2G0WA 2FZBA 3VOFA 4S2BA 2J8GA 1Q6QA 3QGAC 3BPWA 1JQXA 2GVJA 4KEZA 3OVQA 3WQ4A 1TIMA 5EY5A 5C2CA 3ERPA 2RGLA 4XK2A 2VEKA 2WYSA 3USZA 3UPMA 3VGHA 1DJHA 1R3RA 1RVGA 3CO8A 3H4WA 1P4CA 3SRHA 1V3MA 1EDTA 5FF0A 4I9TA 5FI8A 3GHTA 2HJPA 2NSOA 4BQ2A 4W9TA 3ZIZA 4LTSA 3G1RA 2EPLX 4GYPC 1OX5A 4JL1A 5BRBA 4C60A 1WP6A 2ON3A 5BWFA 1AJZA 3TYCA 1XDLA 5BCAA 1TTPA 2DZPA 4K68A 3AI0A 3IJ6A 4PUUA 3EA1A 1W3LA 4CVWA 3RM4A 5FEWA 4BJHA 5IOBA 2PRHA 3M5XA 1E6PA 2I7GA 4A21A 1S1PA 4EKJA 1O4UA 2PP0A 4U28A 4NXSA 4Y7EA 4H8UA 4Q32A 1LT7A 4F0RA 2WBKA 1GW1A 2CW6A 3VUPA 2F2HA 2WAGA 3A5VA 1DXFA 1PZ0A 3CHVA 1XIIA 4O8AA 3Q37A 1UR3M 3M0ZA 3SIZA 2Z1VA 2Z25A 4LEFA 3AXHA 4D6IA 2WQDA 5CZSA 1JYWA 1FWAC 1EJTC 1RK5A 3BWWA 4QRNA 1BQCA 3UG8A 4GLEA 2VCBA 2Y89A 1PZ1A 4BHYA 1US3A 1VYSX 3U8GA 1JZ4A 2O9RA 1XUUA 3I10A 3UQNA 5ABFA 4HSOA 3MW7A 1OZMA 1F7BA 2F38A 3ITTA 4LNCA 3U48A 1ITUA 2O4MA 1ZP4A 5C8BB 1H5VA 2H8ZA 3EOUA 3N11A 5F2MA 3EXSA 5BXRA 1W32A 5HQEA 2XGIA 2BVYA 4HTBA 2W9MA 2YDQA 2V82A 1OFRA 1E43A 5KITA 2X1TA 3WD3A 5AY7A 1GZ1A 3WNKA 3NURA 3TZFA 2O7SA 3W85A 1NP0A 4JICA 1E6NA 4LS1A 4X60A 3QMRA 3DFYA 5JIWA 1W0MA 2GVEA 2UZ9A 1F74A 4GXWA 4HU4A 1W1TA 2QHAA 3LEPA 2IUZA 3ZJ7A 2NUWA 3SY1A 5BU9A 1VQTA 1LRTA 5FJRA 3RFAA 3DFSA 3KBNA 1EBGA 3QHMA 3SSJA 1PUDA 4RE2A 4FIRA 1F73A 1MW1A 3ZT7A 4AHQA 1J0IA 2X05A 3T6CA 4LV4A 1CGVA 4LBRA 1I9CB 1WAWA 2E5DA 4JTIA 1XLHA 4QLKA 3MP5A 4MDPA 1QMLA 5FJIA 1TUFA 3WD1A 4N02A 4IFKA 3DHPA 1VBHA 3UWQA 1V51A 1B9BA 3PG9A 1L6FA 5A6MA 2Q3RA 3PWIA 1JUEA 2Z6IA 3WH5A 3W73A 3F4DA 4BF7A 4F0SA 1GG0A 3U2CA 1QBAA 2VDGA 5AYZA 1U22A 4EPDC 1TPFA 4F8XA 5GJMA 3WH6A 3QY8A 4CKQA 4OUEA 5FSEC 3TP4A 3O7UA 3CTTA 2Y8KA 1MVYA 2CLHA 3SFWA 4DUVA 3LHVA 2AL2A 1A3WA 1DQXA 2X2GA 1EJUC 4AY1A 3WLMA 4J3SA 5XINA 5GNYA 1ISXA 1ZCOA 4IP7A 1VFSA 4FXSA 1J5TA 4H83A 1T7LA 3QSTA 4JQ4A 2WZIA 2WCSA 2HNHA 4GA8A 3W53A 6TAAA 4V28A 3GYCA 1F61A 4JBRA 2PDHA 4AFYA 1WAUA 3A6OA 4C6EA 2XIIA 4AC1X 1W9UA 1B31A 1H7XA 2GQ8A 1RK6A 5JXQA 3OLEA 3CUGA 3S47A 2XFFA 2XH4A 1UZHA 4GIYA 4LX4A 3T2OA 4PUDA 2IKHA 2CZEA 2J7DA 1EJWC 4W5ZA 4QJ4B 3S9ZA 4N9EA 1SZEA 4ACZA 1JUBA 4TMCA 4RNIA 2XGBA 1L2UA 5BZAA 5AC8A 3NQBA 4MUPA 2ZWZA 3O6YX 3QFWA 3T42A 1QNOA 2ZZ5A 4PH6A 3T2QA 1MMFA 1ITQA 3TMQA 1H0GA 1MEIA 2BDQA 2V3FA 1F8MA 3LV5A 3DI0A 4UTJA 4IWWA 3L23A 1UJPA 4WK9A 3PUDA 2Y88A 5J5DA 5ABGA 4GIAA 4K8HA 2J4GA 1EGZA 7ENLA 2NXHA 2QYGA 3W1UA 3I7SA 1KR1A 2DVUA 1JUKA 3MP4A 1LT8A 4DWSD 2YLLA 3W7JA 2VUNA 1X1ZA 1EXPA 2FTPA 5HJLA 5BNKA 1GQNA 3MV01 1CT5A 5EGRA 1EBHA 1JI2A 1REQA 3GG0A 1QUMA 5D2TA 1ONRA 1F3WA 2NW0A 4NNAA 3GG8A 3RU8X 4EXQA 1W3IA 5D03A 3H4XA 1JCTA 1EC9A 1H7OA 1F3EA 1H1YA 4Z2JA 4NZ4A 1O60A 4XD5A 4V2XA 3TJXA 3R7MA 5HANA 1B3WA 1OFAA 3OZYA 4XQ6A 4H2CA 2D2HA 2NX3A 2WSRA 2FVMA 2YW3A 4CD8A 5F2GA 4BEUA 3LGGA 4N4PA 3U57A 4A2SA 3V1PA 1NH6A 3UJ2A 3W1NA 4MB5A 2DPEA 4RZBA 3DFPA 2GDUA 1RLDA 3AHZA 4PR4A 4DUOA 1ZENA 1KFCA 1VPQA 5EBUA 2ABBA 1UG6A 5TAOA 3QTPA 1TTIA 3A4JA 4AD4A 1E0XA 1EZ2A 3C2OA 1SM9A 3H23A 1SR0A 3IVUA 4D1JA 1TV3A 2VFGA 2FMOA 1CWYA 5JBFA 2H3BA 2QUMA 1GW9A 1HP5A 1WOBA 2L5HA 1UIOA 1UMLA 1WZKA 4GKTA 2C1HA 4IJCA 4MADA 1JNEA 3TOYA 1SQ7A 3B8IA 1LROA 1SMDA 3I4EA 3IS4A 3UY8A 4BR1A 4ZSUA 1LLZA 1W1PA 1KRCC 4NRRA 2VRJA 1BHGA 4HK5A 4I7WA 1QPNA 5A3HA 1HIZA 2XDFA 1YXYA 3ENLA 3T07A 3ZT6A 1VGAA 3R11A 2PDLA 1JD9A 2PDBA 2VX6A 5BW6A 5A95A 2GFTA 5U7SA 1B54A 2WVSA 3EOSA 4XD6A 5I6SA 1XIEA 3NQ6A 1GEQA 1U1HA 1NWUA 1TPEA 4UTHA 3S46A 5L9FA 2MANA 3CAKA 4Z17A 1MI3A 4ERAA 3M0KA 1X1NA 4LJ3A 1P0BA 3VMNA 1CB7B 2QPXA 1EWDA 1NFPA 3VIGA 4WIWA 4DRSA 4LC8A 4FMVA 2G4JA 3WLOA 2WSYA 3B9DA 3CT7A 3KOFA 1A80A 4N0RA 1FWCC 1CXIA 1LZOA 3QQ0A 1C9DA 4DF2A 4ZZ9A 2OCZA 4JTUA 1RY0A 5U4NA 3CIVA 4A22A 2CLEA 4S39A 4RPPA 1PVNA 3DI1A 2Q02A 4GI9A 1W56A 3DXIA 1ML1A